CancerPPD

This page gives details of Query peptides and provides facility to browse the same in CancerPPD database. Please wait while data is being retrieved. For more information see HELP page.

ID	PMID	SEQUENCE	NAME	LENGTH	ACTIVITY
1103	18617323	RAGLQFPVGRLLRRLLRRLLR	Buforin IIb	21	IC₅₀=11.2 µg/ml
3362	None	NHFTLKCPKTALTEPPTLAY	TG20	20	<5% cytotoxicity at 1 µM
3363	None	NHFTLKCPKTALTEPPTLAY	TG20	20	<20% cytotoxicity at 10 µM
3364	None	NHFTLKCPKTALTEPPTLAY	TG20	20	~15% cytotoxicity at 1 µM
3365	None	NHFTLKCPKTALTEPPTLAY	TG20	20	>20% cytotoxicity at 10 µM
3366	None	NHFTLKCPKTALTEPPTLAY	TG20	20	<5% cytotoxicity at 1 µM
3367	None	NHFTLKCPKTALTEPPTLAY	TG20	20	<5% cytotoxicity at 10 µM
3368	None	TAGIKLTVPIEKFPVTTQTFWG	TG23	22	<5% cytotoxicity at 1 µM
3369	None	TAGIKLTVPIEKFPVTTQTFWG	TG23	22	~10% cytotoxicity at 10 µM
3370	None	TAGIKLTVPIEKFPVTTQTFWG	TG23	22	10% cytotoxicity at 1 µM
3371	None	TAGIKLTVPIEKFPVTTQTFWG	TG23	22	>10% cytotoxicity at 10 µM
3372	None	TAGIKLTVPIEKFPVTTQTFWG	TG23	22	>10% cytotoxicity at 1 µM
3373	None	TAGIKLTVPIEKFPVTTQTFWG	TG23	22	<5% cytotoxicity at 10 µM
3374	None	GQVWEATATVNAIRGSVTPAVSQFNARTAD	MB30	30	<5% cytotoxicity at 1 µM
3375	None	GQVWEATATVNAIRGSVTPAVSQFNARTAD	MB30	30	<5% cytotoxicity at 10 µM
3376	None	GQVWEATATVNAIRGSVTPAVSQFNARTAD	MB30	30	>20% cytotoxicity at 1 µM
3377	None	GQVWEATATVNAIRGSVTPAVSQFNARTAD	MB30	30	~35% cytotoxicity at 10 µM
3378	None	GQVWEATATVNAIRGSVTPAVSQFNARTAD	MB30	30	<5% cytotoxicity at 1 µM
3379	None	GQVWEATATVNAIRGSVTPAVSQFNARTAD	MB30	30	~20% cytotoxicity at 10 µM

CancerPPD :Database of Anticancer peptides and Proteins

Browse Result page of CancerPPD