CancerPPD

This page gives details of Query peptides and provides facility to browse the same in CancerPPD database. Please wait while data is being retrieved. For more information see HELP page.

ID	PMID	SEQUENCE	NAME	LENGTH	ACTIVITY
1106	18617323	RAGLQFPVGRLLRRLLRRLLR	Buforin IIb	21	IC₅₀=17.6 µg/ml
1249	7849420	KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL	Cecropin B	35	IC₅₀=>100 µM
1543	22073006	GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE	Pardaxin	33	IC₅₀=15.74 µg/ml
1544	22073006	GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE	Pardaxin	33	IC₅₀=15.40 µg/ml
1545	22073006	GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE	Pardaxin	33	IC₅₀=14.51 µg/ml
1546	22073006	GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE	Pardaxin	33	IC₅₀=14.52 µg/ml
1634	12366526	PEWFKCRRWQWRMKKLGA	L1	18	IC₅₀=>404 µM
1635	12366526	PAWFKARRWAWRMKKLAA	L2	18	IC₅₀=>440 µM
1636	12366526	PAWRKAFRWAWRMKKLAA	L3	18	IC₅₀=141 µM
1637	12366526	PAWFKARRWAWRMLKKAA	L4	18	IC₅₀=57 µM
1638	12366526	PAWRKAFRWAWRMLKKAA	L5	18	IC₅₀=14 µM
1639	12366526	PAWRKAFRWAARMLKKAA	L6	18	IC₅₀=15 µM
1640	12366526	PAWRKAFRAAWRMLKKAA	L7	18	IC₅₀=16 µM
1641	12366526	PAWAKAFRAAARMKLKAA	L8	18	IC₅₀=180 µM
1642	12366526	PAWRKAARWAWRMLKKAA	L9	18	IC₅₀=52 µM
1643	12366526	PAARKAFRWAWRMLKKAA	L10	18	IC₅₀=35 µM
1644	12366526	PAARKAARWAWRMLKKGA	L11	18	IC₅₀=248 µM
1645	12366526	PAWRKAFRWAKRMLKKAA	L12	18	IC₅₀=25 µM
1646	12366526	PAWRKAFRKAWRMLKKAA	L13	18	IC₅₀=29 µM
1647	12366526	PAWRKARRWAWRMKKLAA	L14	18	IC₅₀=423 µM
1648	12366526	PAWRKARRWARRMKKLAA	L15	18	IC₅₀=178 µM
2933	23598079	GFIFHIIKGLFHAGKMIHGLV	Epinecidin-1	21	82 % Cytotoxicity at 50 mg/L
2934	23598079	GFIFHIIKGLFHAGKMIHGLV	Epinecidin-1	21	85 % Cytotoxicity at 25 mg/L
2935	23598079	GFIFHIIKGLFHAGKMIHGLV	Epinecidin-1	21	42 % Cytotoxicity at 12.5 mg/L
2936	23598079	GFIFHIIKGLFHAGKMIHGLV	Epinecidin-1	21	41 % Cytotoxicity at 6.25 mg/L
2937	23598079	GFIFHIIKGLFHAGKMIHGLV	Epinecidin-1	21	39 % Cytotoxicity at 3.125 mg/L
2938	23598079	GFIFHIIKGLFHAGKMIHGLV	Epinecidin-1	21	41 % Cytotoxicity at 6.25 mg/L
2939	23598079	GFIFHIIKGLFHAGKMIHGLV	Epinecidin-1	21	41 % Cytotoxicity at 6.25 mg/L
2940	23598079	GFIFHIIKGLFHAGKMIHGLV	Epinecidin-1	21	41 % Cytotoxicity at 6.25 mg/L
2941	23598079	GFIFHIIKGLFHAGKMIHGLV	Epinecidin-1	21	90 % Cytotoxicity at 50 mg/L
2942	23598079	GFIFHIIKGLFHAGKMIHGLV	Epinecidin-1	21	95 % Cytotoxicity at 25 mg/L
2943	23598079	GFIFHIIKGLFHAGKMIHGLV	Epinecidin-1	21	45 % Cytotoxicity at 12.5 mg/L
2944	23598079	GFIFHIIKGLFHAGKMIHGLV	Epinecidin-1	21	25 % Cytotoxicity at 6.25 mg/L
2945	23598079	GFIFHIIKGLFHAGKMIHGLV	Epinecidin-1	21	25 % Cytotoxicity at 3.125 mg/L
2946	23598079	GFIFHIIKGLFHAGKMIHGLV	Epinecidin-1	21	95 % Cytotoxicity at 50 mg/L
2947	23598079	GFIFHIIKGLFHAGKMIHGLV	Epinecidin-1	21	96 % Cytotoxicity at 25 mg/L
2948	23598079	GFIFHIIKGLFHAGKMIHGLV	Epinecidin-1	21	46 % Cytotoxicity at 12.5 mg/L
2949	23598079	GFIFHIIKGLFHAGKMIHGLV	Epinecidin-1	21	30 % Cytotoxicity at 6.25 mg/L
2950	23598079	GFIFHIIKGLFHAGKMIHGLV	Epinecidin-1	21	28 % Cytotoxicity at 3.125 mg/L
2951	23598079	GFIFHIIKGLFHAGKMIHGLV	Epinecidin-1	21	84 % Cytotoxicity at 50 mg/L
2952	23598079	GFIFHIIKGLFHAGKMIHGLV	Epinecidin-1	21	85 % Cytotoxicity at 25 mg/L
2953	23598079	GFIFHIIKGLFHAGKMIHGLV	Epinecidin-1	21	38 % Cytotoxicity at 12.5 mg/L
2954	23598079	GFIFHIIKGLFHAGKMIHGLV	Epinecidin-1	21	30 % Cytotoxicity at 6.25 mg/L
2955	23598079	GFIFHIIKGLFHAGKMIHGLV	Epinecidin-1	21	28 % Cytotoxicity at 3.125 mg/L
2976	23598079	FIFHIIKGLFHAGKMI	Epinecidin-8	16	60 % Cytotoxicity at 50 mg/L
2977	23598079	FIFHIIKGLFHAGKMI	Epinecidin-8	16	50 % Cytotoxicity at 25 mg/L
2978	23598079	FIFHIIKGLFHAGKMI	Epinecidin-8	16	8 % Cytotoxicity at 12.5 mg/L
2979	23598079	FIFHIIKGLFHAGKMI	Epinecidin-8	16	10 % Cytotoxicity at 6.25 mg/L
2980	23598079	FIFHIIKGLFHAGKMI	Epinecidin-8	16	5 % Cytotoxicity at 3.125 mg/L
2981	23598079	FIFHIIKGLFHAGKMI	Epinecidin-8	16	75 % Cytotoxicity at 50 mg/L
2982	23598079	FIFHIIKGLFHAGKMI	Epinecidin-8	16	70 % Cytotoxicity at 25 mg/L
2983	23598079	FIFHIIKGLFHAGKMI	Epinecidin-8	16	5 %Cytotoxicity at 12.5 mg/L
2984	23598079	FIFHIIKGLFHAGKMI	Epinecidin-8	16	7 % Cytotoxicity at 6.25 mg/L
2985	23598079	FIFHIIKGLFHAGKMI	Epinecidin-8	16	10 % Cytotoxicity at 3.125 mg/L
2986	23598079	FIFHIIKGLFHAGKMI	Epinecidin-8	16	76 % Cytotoxicity at 50 mg/L
2987	23598079	FIFHIIKGLFHAGKMI	Epinecidin-8	16	70 % Cytotoxicity at 25 mg/L
2988	23598079	FIFHIIKGLFHAGKMI	Epinecidin-8	16	12 % Cytotoxicity at 12.5 mg/L
2989	23598079	FIFHIIKGLFHAGKMI	Epinecidin-8	16	4 % Cytotoxicity at 6.25 mg/L
2990	23598079	FIFHIIKGLFHAGKMI	Epinecidin-8	16	4 % Cytotoxicity at 3.125 mg/L
2991	23598079	FIFHIIKGLFHAGKMI	Epinecidin-8	16	90 % Cytotoxicity at 50 mg/L
2992	23598079	FIFHIIKGLFHAGKMI	Epinecidin-8	16	75 % Cytotoxicity at 25 mg/L
2993	23598079	FIFHIIKGLFHAGKMI	Epinecidin-8	16	8 % Cytotoxicity at 12.5 mg/L
2994	23598079	FIFHIIKGLFHAGKMI	Epinecidin-8	16	3 % Cytotoxicity at 6.25 mg/L
2995	23598079	FIFHIIKGLFHAGKMI	Epinecidin-8	16	3 % Cytotoxicity at 3.125 mg/L
3012	23598079	GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE	Pardaxin-1	33	88 % Cytotoxicity at 50 mg/L
3013	23598079	GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE	Pardaxin-1	33	82 % Cytotoxicity at 25 mg/L
3014	23598079	GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE	Pardaxin-1	33	40 % Cytotoxicity at 12.5 mg/L
3015	23598079	GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE	Pardaxin-1	33	35 % Cytotoxicity at 6.25 mg/L
3016	23598079	GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE	Pardaxin-1	33	35 % Cytotoxicity at 3.125 mg/L
3017	23598079	GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE	Pardaxin-1	33	90 % Cytotoxicity at 50 mg/L
3018	23598079	GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE	Pardaxin-1	33	90 % Cytotoxicity at 25 mg/L
3019	23598079	GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE	Pardaxin-1	33	30 % Cytotoxicity at 12.5 mg/L
3020	23598079	GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE	Pardaxin-1	33	30 % Cytotoxicity at 6.25 mg/L
3021	23598079	GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE	Pardaxin-1	33	30 % Cytotoxicity at 3.125 mg/L
3022	23598079	GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE	Pardaxin-1	33	97 % Cytotoxicity at 50 mg/L
3023	23598079	GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE	Pardaxin-1	33	95 % Cytotoxicity at 25 mg/L
3024	23598079	GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE	Pardaxin-1	33	39 % Cytotoxicity at 12.5 mg/L
3025	23598079	GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE	Pardaxin-1	33	28 % Cytotoxicity at 6.25 mg/L
3026	23598079	GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE	Pardaxin-1	33	38 % Cytotoxicity at 3.125 mg/L
3027	23598079	GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE	Pardaxin-1	33	90 % Cytotoxicity at 50 mg/L
3028	23598079	GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE	Pardaxin-1	33	90 % Cytotoxicity at 25 mg/L
3029	23598079	GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE	Pardaxin-1	33	15 % Cytotoxicity at 12.5 mg/L
3030	23598079	GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE	Pardaxin-1	33	5 % Cytotoxicity at 6.25 mg/L
3031	23598079	GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE	Pardaxin-1	33	10 % Cytotoxicity at 3.125 mg/L
3052	23598079	GFFALIPKIISSPLFKTLLSAVGSALS	Pardaxin-6	27	80 % Cytotoxicity at 50 mg/L
3053	23598079	GFFALIPKIISSPLFKTLLSAVGSALS	Pardaxin-6	27	85 % Cytotoxicity at 25 mg/L
3054	23598079	GFFALIPKIISSPLFKTLLSAVGSALS	Pardaxin-6	27	45 % Cytotoxicity at 12.5 mg/L
3055	23598079	GFFALIPKIISSPLFKTLLSAVGSALS	Pardaxin-6	27	30 % Cytotoxicity at 6.25 mg/L
3056	23598079	GFFALIPKIISSPLFKTLLSAVGSALS	Pardaxin-6	27	25 % Cytotoxicity at 3.125 mg/L
3057	23598079	GFFALIPKIISSPLFKTLLSAVGSALS	Pardaxin-6	27	84 % Cytotoxicity at 50 mg/L
3058	23598079	GFFALIPKIISSPLFKTLLSAVGSALS	Pardaxin-6	27	84% Cytotoxicity at 25 mg/L
3059	23598079	GFFALIPKIISSPLFKTLLSAVGSALS	Pardaxin-6	27	48 % Cytotoxicity at 12.5 mg/L
3060	23598079	GFFALIPKIISSPLFKTLLSAVGSALS	Pardaxin-6	27	30 % Cytotoxicity at 6.25 mg/L
3061	23598079	GFFALIPKIISSPLFKTLLSAVGSALS	Pardaxin-6	27	35 % Cytotoxicity at 3.125 mg/L
3062	23598079	GFFALIPKIISSPLFKTLLSAVGSALS	Pardaxin-6	27	90 % Cytotoxicity at 50 mg/L
3063	23598079	GFFALIPKIISSPLFKTLLSAVGSALS	Pardaxin-6	27	85 % Cytotoxicity at 25 mg/L
3064	23598079	GFFALIPKIISSPLFKTLLSAVGSALS	Pardaxin-6	27	30 % Cytotoxicity at 12.5 mg/L
3065	23598079	GFFALIPKIISSPLFKTLLSAVGSALS	Pardaxin-6	27	35 % Cytotoxicity at 6.25 mg/L
3066	23598079	GFFALIPKIISSPLFKTLLSAVGSALS	Pardaxin-6	27	15 % Cytotoxicity at 3.125 mg/L
3067	23598079	GFFALIPKIISSPLFKTLLSAVGSALS	Pardaxin-6	27	90 % Cytotoxicity at 50 mg/L
3068	23598079	GFFALIPKIISSPLFKTLLSAVGSALS	Pardaxin-6	27	90 % Cytotoxicity at 25 mg/L
3069	23598079	GFFALIPKIISSPLFKTLLSAVGSALS	Pardaxin-6	27	20 % Cytotoxicity at 12.5 mg/L
3070	23598079	GFFALIPKIISSPLFKTLLSAVGSALS	Pardaxin-6	27	1 % Cytotoxicity at 6.25 mg/L
3071	23598079	GFFALIPKIISSPLFKTLLSAVGSALS	Pardaxin-6	27	10 % Cytotoxicity at 3.125 mg/L
3281	19527490, 23533710	FKCRRWQWRMKK	LfcinB	12	IC₅₀ =148±8 µM
3289	19527490	KAAKKAAKAAKKAAKAAKKAA	KW5	21	IC₅₀ =55±14 µM
3305	21453492	WKKW-Dip-KKWK	LTX-302	9	IC₅₀ =75 ± 5 µM
3308	21453492	KKWWKKW-Dip-K	LTX-315	9	IC₅₀ =38 ± 3 µM
3311	21453492	OOW-Dip-OOWWO	LTX-318	9	IC₅₀ =248 ± 5 µM
3314	21453492, 23533710	FKCRRWQWRMKK	LfcinB	12	IC₅₀ > 160 µM
3452	None	NHFTLKCPKTALTEPPTLAY	TG20	20	20% cytotoxicity at 1 µM
3453	None	NHFTLKCPKTALTEPPTLAY	TG20	20	~10% cytotoxicity at 10 µM
3454	None	NHFTLKCPKTALTEPPTLAY	TG20	20	<5% cytotoxicity at 1 µM
3455	None	NHFTLKCPKTALTEPPTLAY	TG20	20	<3% cytotoxicity at 10 µM
3456	None	NHFTLKCPKTALTEPPTLAY	TG20	20	<20% cytotoxicity at 1 µM
3457	None	NHFTLKCPKTALTEPPTLAY	TG20	20	~15% cytotoxicity at 10 µM
3458	None	TAGIKLTVPIEKFPVTTQTFWG	TG23	22	<15% cytotoxicity at 1 µM
3459	None	TAGIKLTVPIEKFPVTTQTFWG	TG23	22	~15% cytotoxicity at 10 µM
3460	None	TAGIKLTVPIEKFPVTTQTFWG	TG23	22	<5% cytotoxicity at 1 µM
3461	None	TAGIKLTVPIEKFPVTTQTFWG	TG23	22	<3% cytotoxicity at 10 µM
3462	None	TAGIKLTVPIEKFPVTTQTFWG	TG23	22	<5% cytotoxicity at 1 µM
3463	None	TAGIKLTVPIEKFPVTTQTFWG	TG23	22	<5% cytotoxicity at 10 µM
3464	None	GQVWEATATVNAIRGSVTPAVSQFNARTAD	MB30	30	40% cytotoxicity at 1 µM
3465	None	GQVWEATATVNAIRGSVTPAVSQFNARTAD	MB30	30	~50% cytotoxicity at 10 µM
3466	None	GQVWEATATVNAIRGSVTPAVSQFNARTAD	MB30	30	<20% cytotoxicity at 1 µM
3467	None	GQVWEATATVNAIRGSVTPAVSQFNARTAD	MB30	30	20% cytotoxicity at 10 µM
3468	None	GQVWEATATVNAIRGSVTPAVSQFNARTAD	MB30	30	~30% cytotoxicity at 1 µM
3469	None	GQVWEATATVNAIRGSVTPAVSQFNARTAD	MB30	30	>40% cytotoxicity at 10 µM
3858	16722632	YA*	8	2	9.8% inhibition at 10^-6
3859	16722632	YA*	8	2	1.6% inhibition at 10^-5
3860	16722632	YA*	8	2	5.4% inhibition at 10^-4
3861	16722632	YA*	8	2	26.5% inhibition at 10^-3
3882	16722632	YSA*	9	3	4.9% inhibition at 10^-6
3883	16722632	YSA*	9	3	8.9% inhibition at 10^-5
3884	16722632	YSA*	9	3	3.4% inhibition at 10^-4
3885	16722632	YSA*	9	3	20.8% inhibition at 10^-3
3909	16722632	YSA*	10	3	0.7% inhibition at 10^-6
3910	16722632	YSA*	10	3	8.3% inhibition at 10^-5
3911	16722632	YSA*	10	3	10.5% inhibition at 10^-4
3912	16722632	YSA*	10	3	21.8% inhibition at 10^-3
3929	16722632	YSA*G	15	4	5.4% inhibition at 10^-6M
3930	16722632	YSA*G	15	4	7.4% inhibition at 10^-5M
3931	16722632	YSA*G	15	4	9.5% inhibition at 10^-4M
3932	16722632	YSA*G	15	4	15.7% inhibition at 10^-3M
3953	16722632	YRA*G	16	4	7.6% inhibition at 10^-6M
3954	16722632	YRA*G	16	4	3.8% inhibition at 10^-5M
3955	16722632	YRA*G	16	4	12.4% inhibition at 10^-4M
3956	16722632	YRA*G	16	4	22.4% inhibition at 10^-3M
3978	16722632	YA*GFM	17	5	3.3% inhibition at 10^-6M
3979	16722632	YA*GFM	17	5	11.0% inhibition at 10^-5M
3980	16722632	YA*GFM	17	5	7.9% inhibition at 10^-4M
3981	16722632	YA*GFM	17	5	23.7% inhibition at 10^-3M
4003	16722632	YA*GFM	18	5	16.2% inhibition at 10^-6M
4004	16722632	YA*GFM	18	5	6.6% inhibition at 10^-5M
4005	16722632	YA*GFM	18	5	5.1% inhibition at 10^-4M
4006	16722632	YA*GFM	18	5	14.5% inhibition at 10^-3M
4023	16722632	YGGFMA*	23	6	9.2% inhibition at 10^-3M
4495	22057278	KAAKKWAKAAKKWAKAWKKAA	Z1	21	EC₅₀ >211 µM
4496	22057278	KAAKKWAKAWKKAAKAWKKAA	Z2	21	EC₅₀ >211 µM
4497	22057278	KAAKKAWKAWKKAAKAAWKKAA	Z3	21	EC₅₀ >211 µM
4498	22057278	KAAKKAWKAAKKAAKWWKKAA	Z4	21	EC₅₀ =173 µM
4499	22057278	KAAKKAWKWAKKAAKWAKKAA	Z5	21	EC₅₀ =67 µM
4500	22057278	KWWKKAAKAAKKAAKAAKKWA	Z6	21	EC₅₀ =31 µM
4501	22057278	KAAKKAWKAAKKAWKAAKKAA	Z7	21	EC₅₀ =21 µM
4502	22057278	AWKKWAKAWKWAKAKWWAKAA	Z8	21	EC₅₀ =23 µM
4503	22057278	AAWKWAWAKKWAKAKKWAKAA	Z9	21	EC₅₀ =13 µM
4504	22057278	AAKKWAKAKWAKAKKWAKAA	Z10	21	EC₅₀ >211 µM
4641	8445676	VV-Nme-VPP-2-hydroxyisovaleryl-2- oxo-4-methoxy-5-benzyl-3-pyrroline	Dolastatin 15	Not Available	IC₅₀=.00013-.0013 nM
4645	8445676	2-[[2-(dimethylamino)-3-methylbutanoyl]amino]-N- [3-methoxy-1-[2-[1-methoxy-2-methyl-3-oxo-3-[[2-phenyl-1- (1,3-thiazol-2-yl)ethyl]amino]propyl]pyrrolidin- 1-yl]-5-methyl-1-oxoheptan-4-yl]-N,3- dimethylbutanamide	Dolastatin 10	Not Available	IC₅₀=.0013-.013 nM
5056	24714081	TKPRKTKPRKTKPRKTKPR	T Peptide	19	70% maximum inhibitory rate at 8 mg/kg

CancerPPD :Database of Anticancer peptides and Proteins

Browse Result page of CancerPPD