Browse result page of CPPsite 2.0
The total number entries retrieved from this search are 1753| ID | PEPTIDE SEQUENCE | PEPTIDE NAME | LENGTH | CHIRALITY | LINEAR/CYCLIC | SOURCE | CATEGORY | N TERMINAL MODIFICATION | C TERMINAL MODIFICATION | CHEMICAL MODIFICATION | CARGO | PUBMED ID |
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| 2205 | WLKLWKKWLKLW | PF28 | 12 | L | Linear | Synthetic | Amphipathic | Stearylation | Amidation | NA | Nucleic acid (Plasmid DNA) | 24463071 |
| 2206 | KALKLKLALALLAKLKLA | NAP | 18 | L | Linear | Synthetic | Non-Amphipathic | Free | Amidation | NA | Nucleic acid (Plasmid DNA) | 24463071 |
| 2207 | KALKLKLALALLAKLKLA | Stearyl-NAP | 18 | L | Linear | Synthetic | Non-Amphipathic | Stearylation | Amidation | NA | Nucleic acid (Plasmid DNA) | 24463071 |
| 2208 | RRRRRRRRR | R9 | 9 | L | Linear | Synthetic | Cationic | Free | Free | NA | Nanoparticle (PMS labelled with the fluorescent probe di-4-ANEPPDHQ) | 24583633 |
| 2209 | RWRRWWRRW | RW9 | 9 | L | Linear | Synthetic | Amphipathic | Free | Free | NA | Nanoparticle (PMS labelled with the fluorescent probe di-4-ANEPPDHQ) | 24583633 |
| 2210 | RRWRRWWRRWWRRWRR | RW16 | 16 | L | Linear | Synthetic | Amphipathic | Free | Free | NA | Nanoparticle (PMS labelled with the fluorescent probe di-4-ANEPPDHQ) | 24583633 |
| 2211 | BRRXRRXRRX | FAM-1 | 10 | Modified | Linear | Synthetic | Amphipathic | FAM linked with beta-alanine | Amidation | B, Beta-Alanine; X, α-amino isobutyric acid | Fluorophore (FAM) | 24661993 |
| 2212 | BrrXrrXrrX | ent FAM-1 | 10 | Modified | Linear | Synthetic | Amphipathic | FAM linked with beta-alanine | Amidation | B, Beta-Alanine; X, α-amino isobutyric acid | Fluorophore (FAM) | 24661993 |
| 2213 | BRrXRrXRrX | FAM-2 | 10 | Modified | Linear | Synthetic | Amphipathic | FAM linked with beta-alanine | Amidation | B, Beta-Alanine; X, α-amino isobutyric acid | Fluorophore (FAM) | 24661993 |
| 2214 | BXRXRXXRXRXXRXRX | FAM-3 | 16 | Modified | Linear | Synthetic | Amphipathic | FAM linked with beta-alanine | Amidation | B, Beta-Alanine; X, α-amino isobutyric acid | Fluorophore (FAM) | 24661993 |
| 2215 | IPLVVPLRRRRRRRRC | RIPL | 16 | L | Linear | Chimeric | Cationic | Free | Free | RIPL peptides is conjugated to maleimide-derivatized liposomal vesicles via the thiol-maleimide reaction | Fluorophore (FITC) | 24704199 |
| 2216 | RRRRRRRRC | R8 | 9 | L | Linear | Synthetic | Cationic | Free | Free | NA | Fluorophore (FITC) | 24704199 |
| 2217 | IPLVVPLC | IPL | 8 | L | Linear | Synthetic | NA | Free | Free | NA | Fluorophore (FITC) | 24704199 |
| 2218 | KFLNRFWHWLQLKPGQPMY | IP-1 | 19 | L | Linear | Synthetic | Cationic | Free | Free | NA | Fluorophore (Hilytefluor 488 and TAMARA) | 24706763 |
| 2219 | KFLNRFWHWLQLKPGQPMY | TAMRA-IP-1 | 19 | L | Linear | Synthetic | Cationic | Free | Free | NA | Fluorophore (TAMRA) | 24706763 |
| 2220 | KFLNRFWHWLQLKPGQPMY | Hilytefluor 488-IP-1 | 19 | L | Linear | Synthetic | Cationic | Free | Free | NA | Fluorophore (Hilyteflour) | 24706763 |
| 2221 | YGRKKRRQRRR | EGFP-TAT | 11 | L | Linear | Protein derived | Cationic | Conjugated with EGFP | Free | NA | Protein (eGFP) | 24746937 |
| 2222 | RQIKIWFQNRRMKWKK | EGFP-Antp | 16 | L | Linear | Protein derived | Cationic and amphipathic | Conjugated with EGFP | Free | NA | Protein (eGFP) | 24746937 |
| 2223 | DAATARGRGRSAASRPTERPRAPARSASRPRRPVD | EGFP-VP_22 | 35 | L | Linear | Protein derived | Amphipathic | Conjugated with EGFP | Free | NA | Protein (eGFP) | 24746937 |
| 2224 | LLIILRRRIRKQAHAHSK | EGFP-pVEC | 18 | L | Linear | Protein derived | Amphipathic | Conjugated with EGFP | Free | NA | Protein (eGFP) | 24746937 |
| 2225 | GSVSRRRRRRGGRRRR | EGFP-LMWP | 16 | L | Linear | Protein derived | Cationic | Conjugated with EGFP | Free | NA | Protein (eGFP) | 24746937 |
| 2226 | LGTYTQDFNKFHTFPQTAIGVGAP | EGFP-hcT(9-32) | 24 | L | Linear | Protein derived | Amphipathic | Conjugated with EGFP | Free | NA | Protein (eGFP) | 24746937 |
| 2227 | KETWWETWWTEWSQPKKKRKV | EGFP-Pep-1 | 21 | L | Linear | Synthetic | Amphipathic | Conjugated with EGFP | Free | NA | Protein (eGFP) | 24746937 |
| 2228 | GALFLGWLGAAGSTMGAPKKKRKV | EGFP-MPG | 24 | L | Linear | Synthetic | Amphipathic | Conjugated with EGFP | Free | NA | Protein (eGFP) | 24746937 |
| 2229 | GLFRALLRLLRSLWRLLLRA | EGFP-ppTG20 | 20 | L | Linear | Synthetic | Amphipathic | Conjugated with EGFP | Free | NA | Protein (eGFP) | 24746937 |
| 2230 | RRRRRRRRRRRR | EGFP-R12 | 12 | L | Linear | Synthetic | Cationic | Conjugated with EGFP | Free | NA | Protein (eGFP) | 24746937 |
| 2231 | KKALLALALHHLAHLALHLALALKKA | EGFP-LAH4 | 26 | L | Linear | Synthetic | Amphipathic | Conjugated with EGFP | Free | NA | Protein (eGFP) | 24746937 |
| 2232 | YARVRRRGPRR | Hph-1 | 11 | L | Linear | Synthetic | Cationic | Conjugation with 6-histidine tag | Free | NA | Nucleic acid (Hph1Hph1dsRBD/FAM-labeled siRNA complex) | 24768403 |
| 2233 | CRQIKIWFQNRRMKWKK | Penetratin | 17 | L | Linear | Protein derived | Cationic and amphipathic | Acetylation | Amidation | NA | Peptide (KLA) and Nanoparticle (DSPC and DSPG liposomes) | 24796502 |
| 2234 | CRQIKIWFQNRRMKWKKKLAKLAKKLAKLAK | KLA-Pen | 31 | L | Linear | Chimeric | Amphipathic | Acetylation | Amidation | NA | Peptide (KLA) and Nanoparticle (DSPC and DSPG liposomes) | 24796502 |
| 2235 | CRRLRHLRHHYRRRWHRFRC | Mgpe-9 | 20 | L | Linear | Synthetic | Secondary Amphipathic | Free | Free | Addition of cysteine in Mgpe3 sequence makes Mgpe9 | Nucleic acid (Plasmid DNA) | 24816284 |
| 2236 | CLLYWFRRRHRHHRRRHRRC | Mgpe-10 | 20 | L | Linear | Synthetic | Primary Amphipathic | Free | Free | Addition of cysteine in Mgpe4 sequence makes Mgpe10 | Nucleic acid (Plasmid DNA) | 24816284 |
| 2237 | RRLRHLRHHYRRRWHRFR | Mgpe-3 | 18 | L | Linear | Synthetic | Secondary Amphipathic | Free | Free | NA | Nucleic acid (Plasmid DNA) | 24816284 |
| 2238 | LLYWFRRRHRHHRRRHRR | Mgpe-4 | 18 | L | Linear | Synthetic | Primary Amphipathic | Free | Free | NA | Nucleic acid (Plasmid DNA) | 24816284 |
| 2239 | RKKNPNCRRH | hBCPP | 10 | L | Linear | Protein derived | Cationic | Free | Free | NA | Peptide (Smurf1-binding peptide) | 24831974 |
| 2248 | RRRRRRRRR | R9-PCP | 9 | L | Linear | Synthetic | Cationic | Acetylation | Amidation | Φ, L-2-naphthylalanine,miniPEG, 8-amino-3,6-dioxaoctanoic acid | Peptide [PCP, miniPEG-DE(pCAP)LI-NH2] | 24896852 |
| 2249 | RKKRRQRRR | Tat-PCP | 9 | L | Linear | Protein derived | Cationic | Acetylation | Amidation | Φ, L-2-naphthylalanine,miniPEG, 8-amino-3,6-dioxaoctanoic acid | Peptide [PCP, miniPEG-DE(pCAP)LI-NH2] | 24896852 |
| 2250 | RQIKIWFQNRRMKWKK | Antp-PCP | 16 | L | Linear | Protein derived | Cationic and amphipathic | Acetylation | Amidation | Φ, L-2-naphthylalanine,miniPEG, 8-amino-3,6-dioxaoctanoic acid | Peptide [PCP, miniPEG-DE(pCAP)LI-NH2] | 24896852 |
| 2257 | RRIRPRPPRLPRPRPRPLPFPRPG | Bac-ELP43 | 24 | L | Linear | Synthetic | Cationic | Free | Free | NA | Peptide [ELP (Elastin like peptide sequence), Fluorophore (Alexa-Fluor)] | 24866938 |
| 2258 | RRIRPRPPRLPRPRPRPLPFPRPG | Bac-ELP63 | 24 | L | Linear | Synthetic | Cationic | Free | Free | NA | Peptide [ELP (Elastin like peptide sequence), Fluorophore (Alexa-Fluor)] | 24866938 |
| 2259 | RRIRPRPPRLPRPRPRPLPFPRPG | Bac-ELP122 | 24 | L | Linear | Synthetic | Cationic | Free | Free | NA | Peptide [ELP (Elastin like peptide sequence), Fluorophore (Alexa-Fluor)] | 24866938 |
| 2260 | ISFDELLDYYGESGS | NYAD-41 | 15 | L | Linear | Synthetic | NA | Acetylation | Free | S5 [(S)-2-(4′-pentenyl)alanine] and R8 [(R)-2-(7′-octenyl)alanine] indicate stapling sites in the peptide sequence. | Fluorophore (FAM) | 24237936 |
| 2261 | ISF-R8-ELLDYY-S5-ESGS | NYAD-36 | 15 | L | Linear | Synthetic | NA | Acetylation | Amidation | S5 [(S)-2-(4′-pentenyl)alanine] and R8 [(R)-2-(7′-octenyl)alanine] indicate stapling sites in the peptide sequence. | Fluorophore (FAM) | 24237936 |
| 2262 | ISF-R8-ELLDYY-S5-ED | NYAD-66 | 13 | L | Linear | Synthetic | NA | Acetylation | Amidation | S5 [(S)-2-(4′-pentenyl)alanine] and R8 [(R)-2-(7′-octenyl)alanine] indicate stapling sites in the peptide sequence. | Fluorophore (FAM) | 24237936 |
| 2263 | ISF-R8-EWLQAY-S5-EDE | NYAD-67 | 14 | L | Linear | Synthetic | NA | Acetylation | Amidation | S5 [(S)-2-(4′-pentenyl)alanine] and R8 [(R)-2-(7′-octenyl)alanine] indicate stapling sites in the peptide sequence. | Fluorophore (FAM) | 24237936 |
| 2264 | PKKKRKV-AGYLLGKINLKALAALAKKIL-PQMQQNVFQYPGAGMVPQGEANF | TP10-SRC1LXXLL | 51 | L | Linear | Chimeric | Cationic | Conjugated with NLS | Free | NA | Fluorophore (FITC ) | 24705462 |
| 2265 | PKKKRKV-RRRRRRR-YSQTSHKLVQLLTTAEQQ | R7-SRC1LXXLL | 32 | L | Linear | Synthetic | Cationic | Conjugated with NLS | Free | NA | Fluorophore (FITC ) | 24705462 |
| 2266 | PKKKRKV-AGYLLGKINLKALAALAKKIL-PQMQQNVFQYPGAGMVPQGEANF | TP10-SRC1(1222-1245) | 51 | L | Linear | Chimeric | Cationic | Conjugated with NLS | Free | NA | Fluorophore (FITC ) | 24705462 |
| 2267 | PKKKRKV-RRRRRRR-PQMQQNVFQYPGAGMVPQGEANF | R7-SRC1(1222-1245) | 37 | L | Linear | Synthetic | Cationic | Conjugated with NLS | Free | NA | Fluorophore (FITC ) | 24705462 |
| 2268 | LCLRPVG | Xentry peptides | 7 | L | Linear | Protein derived | NA | Free | Free | NA | Fluorophore (FITC- and TAMRA) | 24811205 |