A database of hormones and their receptors

Peptide Hormone

HMRbase accession number	11464
Swiss-prot Accession number	P48757 (Sequence in FASTA format)
Description	Gastrin precursor [Contains: Gastrin-71 (G71); Big gastrin (Gastrin-34) (G34); Gastrin].
Source organism	Mus musculus (Mouse)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Mus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the gastrin/cholecystokinin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Gastrin stimulates the stomach mucosa to produce and secrete hydrochloric acid and the pancreas to secrete its digestive enzymes. It also stimulates smooth muscle contraction and increases blood circulation and water secretion in the stomach and intestine
Protein Length	101 Amino acids
Molecular weight	11607
References	1 PubMed abstract 7488110 2 PubMed abstract 7492958 3 PubMed abstract 8647266
Domain Name	Gastrin
Hormone Name	Big gastrin
Mature Hormone Sequence	GSASHHRRQLGLQGPQHFIADLSKKERPRMEEEEEAYGWMDF
Position of mature hormone in Pre-Hormone protein	34 Residues from position (59-92)
Receptor	P56481 Detail in HMRbase Q8BKF6 Detail in HMRbase
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments