A database of hormones and their receptors

Peptide Hormone

Search Result - 1

HMRbase accession number	10142
Swiss-prot Accession number	Q91221 (Sequence in FASTA format)
Description	Somatotropin-2 precursor (Somatotropin II) (Growth hormone II).
Source organism	Oncorhynchus nerka (Sockeye salmon)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei;Protacanthopterygii; Salmoniformes; Salmonidae; Oncorhynchus.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the somatotropin/prolactin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Growth hormone plays an important role in growth control and is involved in the regulation of several anabolic processes. Implicated as an osmoregulatory substance important for seawater adaptation
Protein Length	210 Amino acids
Molecular weight	23938
References	1 Devlin R.H.; "Sequence of sockeye salmon type 1 and 2 growth hormone genes and therelationship of rainbow trout with Atlantic and Pacific salmon."; Can. J. Fish. Aquat. Sci. 50:1738-1748(1993).
Domain Name	Hormone_1
Hormone Name	Somatotropin-2 (Somatotropin II) (Growth hormone II)
Mature Hormone Sequence	MENQRLFNIAVNRVQHLHLLAQKMFNDFEGTLLSDERRQLNKIFLLDFCNSDSIVSPIDKQETQKSSVLKLLRISFRLIESWEYPSQTLTISNSLMVRNSNQISEKLSDLKVGINLLIEGSQEGILSLDDNDSQHLPPYGNYYQNLGGDGNVRRNYELLACFKKDMHKVETYLTVAKCRKSLEANCTL
Position of mature hormone in Pre-Hormone protein	188 Residues from position (23-210)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 2

HMRbase accession number	10715
Swiss-prot Accession number	P26774 (Sequence in FASTA format)
Description	Somatotropin-2 (Somatotropin II) (Growth hormone II).
Source organism	Acipenser guldenstadti (Caspian sturgeon) (Russian sturgeon)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Chondrostei; Acipenseriformes; Acipenseridae;Acipenser.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the somatotropin/prolactin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Growth hormone plays an important role in growth control and is involved in the regulation of several anabolic processes. Implicated as an osmoregulatory substance important for seawater adaptation
Protein Length	190 Amino acids
Molecular weight	21821
References	1 PubMed abstract 1576156
Domain Name	Hormone_1
Hormone Name	Somatotropin-2 (Somatotropin II) (Growth hormone II)
Mature Hormone Sequence	YPMIPLSSLFTNAVLRAQYLHQLAADIYKDFERTYMPNEQRHSSKNSPSAFCYSETIPAPTGKDEAQQRSDVELLQFSLALIQSWISPLQSLSRVFTNSLVFLTSDRVFEKLKDLEEGIVALMRDLGEGGFGSSTLLKLTYDMFDVNLRNNDVLFKNYGLLSCFKKDMHKVETYLKVMKCRRFVESNCTL
Position of mature hormone in Pre-Hormone protein	190 Residues from position (1-190)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 3

HMRbase accession number	10716
Swiss-prot Accession number	O93360 (Sequence in FASTA format)
Description	Somatotropin-2 precursor (Somatotropin II) (Growth hormone II).
Source organism	Carassius auratus (Goldfish)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;Cyprinidae; Carassius.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the somatotropin/prolactin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Growth hormone plays an important role in growth control and is involved in the regulation of several anabolic processes. Implicated as an osmoregulatory substance important for seawater adaptation
Protein Length	210 Amino acids
Molecular weight	23767
References	1 PubMed abstract 8651695
Domain Name	Hormone_1
Hormone Name	Somatotropin-2 (Somatotropin II) (Growth hormone II)
Mature Hormone Sequence	SDNQRLFNNAVIRVQHLHQLAAKMINDFEDSLLPEERRQLSKIFPLSFCNSDYIEAPTGKDETQKSSMLKLLRISFRLIESWEYPSQTLSGTVSNSLTAGNPNQITEKLADLKMGINVLIKGSLDGQPNIDDNDSLPLPFEDFYLTMGENNLRESFRLLACFKKDMHKVETYLRVANCRRSLDSNCTL
Position of mature hormone in Pre-Hormone protein	188 Residues from position (23-210)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 4

HMRbase accession number	10717
Swiss-prot Accession number	P20332 (Sequence in FASTA format)
Description	Somatotropin 2 precursor (Growth hormone 2).
Source organism	Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei;Protacanthopterygii; Salmoniformes; Salmonidae; Oncorhynchus.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the somatotropin/prolactin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Growth hormone plays an important role in growth control and is involved in the regulation of several anabolic processes. Implicated as an osmoregulatory substance important for seawater adaptation
Protein Length	210 Amino acids
Molecular weight	23946
References	1 PubMed abstract 2908440 2 PubMed abstract 3393535 3 PubMed abstract 2647438
Domain Name	Hormone_1
Hormone Name	Somatotropin-2 (Somatotropin II) (Growth hormone II)
Mature Hormone Sequence	MENQRLFNIAVNRVQHLHLLAQKMFNDFEGTLLPDERRQLNKIFLLDFCNSDSIVSPIDKQETQKSSVLKLLHISFRLIESWEYPSQTLTISNSLMVRNSNQISEKLSDLKVGINLLIKGSQDGVLSLDDNDSQHLPPYGNYYQNLGGDGNVRRNYELLACFKKDMHKVETYLTVAKCRKYLEANCTL
Position of mature hormone in Pre-Hormone protein	188 Residues from position (23-210)
Receptor	N/A
Gene ID	100136734
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated