A database of hormones and their receptors |
|
|
|
|
|
|
|
| HMRbase accession number | 10142 |
| Swiss-prot Accession number | Q91221 (Sequence in FASTA format) |
| Description | Somatotropin-2 precursor (Somatotropin II) (Growth hormone II). |
| Source organism | Oncorhynchus nerka (Sockeye salmon) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei;Protacanthopterygii; Salmoniformes; Salmonidae; Oncorhynchus. |
| Subcellular location | Secreted protein |
| Developmental Stage | N/A |
| Similarity | Belongs to the somatotropin/prolactin family. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | Growth hormone plays an important role in growth control and is involved in the regulation of several anabolic processes. Implicated as an osmoregulatory substance important for seawater adaptation |
| Protein Length | 210 Amino acids |
| Molecular weight | 23938 |
| References | 1 Devlin R.H.; "Sequence of sockeye salmon type 1 and 2 growth hormone genes and therelationship of rainbow trout with Atlantic and Pacific salmon."; Can. J. Fish. Aquat. Sci. 50:1738-1748(1993).
|
| Domain Name | Hormone_1 |
| Hormone Name | Somatotropin-2 (Somatotropin II) (Growth hormone II) |
| Mature Hormone Sequence | MENQRLFNIAVNRVQHLHLLAQKMFNDFEGTLLSDERRQLNKIFLLDFCNSDSIVSPIDKQETQKSSVLKLLRISFRLIESWEYPSQTLTISNSLMVRNSNQISEKLSDLKVGINLLIEGSQEGILSLDDNDSQHLPPYGNYYQNLGGDGNVRRNYELLACFKKDMHKVETYLTVAKCRKSLEANCTL |
| Position of mature hormone in Pre-Hormone protein | 188 Residues from position (23-210) |
| Receptor | N/A |
| Gene ID | N/A |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
| HMRbase accession number | 10715 |
| Swiss-prot Accession number | P26774 (Sequence in FASTA format) |
| Description | Somatotropin-2 (Somatotropin II) (Growth hormone II). |
| Source organism | Acipenser guldenstadti (Caspian sturgeon) (Russian sturgeon) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Chondrostei; Acipenseriformes; Acipenseridae;Acipenser. |
| Subcellular location | Secreted protein |
| Developmental Stage | N/A |
| Similarity | Belongs to the somatotropin/prolactin family. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | Growth hormone plays an important role in growth control and is involved in the regulation of several anabolic processes. Implicated as an osmoregulatory substance important for seawater adaptation |
| Protein Length | 190 Amino acids |
| Molecular weight | 21821 |
| References | 1 PubMed abstract 1576156 |
| Domain Name | Hormone_1 |
| Hormone Name | Somatotropin-2 (Somatotropin II) (Growth hormone II) |
| Mature Hormone Sequence | YPMIPLSSLFTNAVLRAQYLHQLAADIYKDFERTYMPNEQRHSSKNSPSAFCYSETIPAPTGKDEAQQRSDVELLQFSLALIQSWISPLQSLSRVFTNSLVFLTSDRVFEKLKDLEEGIVALMRDLGEGGFGSSTLLKLTYDMFDVNLRNNDVLFKNYGLLSCFKKDMHKVETYLKVMKCRRFVESNCTL |
| Position of mature hormone in Pre-Hormone protein | 190 Residues from position (1-190) |
| Receptor | N/A |
| Gene ID | N/A |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
| HMRbase accession number | 10716 |
| Swiss-prot Accession number | O93360 (Sequence in FASTA format) |
| Description | Somatotropin-2 precursor (Somatotropin II) (Growth hormone II). |
| Source organism | Carassius auratus (Goldfish) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes;Cyprinidae; Carassius. |
| Subcellular location | Secreted protein |
| Developmental Stage | N/A |
| Similarity | Belongs to the somatotropin/prolactin family. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | Growth hormone plays an important role in growth control and is involved in the regulation of several anabolic processes. Implicated as an osmoregulatory substance important for seawater adaptation |
| Protein Length | 210 Amino acids |
| Molecular weight | 23767 |
| References | 1 PubMed abstract 8651695 |
| Domain Name | Hormone_1 |
| Hormone Name | Somatotropin-2 (Somatotropin II) (Growth hormone II) |
| Mature Hormone Sequence | SDNQRLFNNAVIRVQHLHQLAAKMINDFEDSLLPEERRQLSKIFPLSFCNSDYIEAPTGKDETQKSSMLKLLRISFRLIESWEYPSQTLSGTVSNSLTAGNPNQITEKLADLKMGINVLIKGSLDGQPNIDDNDSLPLPFEDFYLTMGENNLRESFRLLACFKKDMHKVETYLRVANCRRSLDSNCTL |
| Position of mature hormone in Pre-Hormone protein | 188 Residues from position (23-210) |
| Receptor | N/A |
| Gene ID | N/A |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
| HMRbase accession number | 10717 |
| Swiss-prot Accession number | P20332 (Sequence in FASTA format) |
| Description | Somatotropin 2 precursor (Growth hormone 2). |
| Source organism | Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri) |
| Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei;Protacanthopterygii; Salmoniformes; Salmonidae; Oncorhynchus. |
| Subcellular location | Secreted protein |
| Developmental Stage | N/A |
| Similarity | Belongs to the somatotropin/prolactin family. |
| Tissue Specificity | N/A |
| Post translational modification | N/A |
| Function | Growth hormone plays an important role in growth control and is involved in the regulation of several anabolic processes. Implicated as an osmoregulatory substance important for seawater adaptation |
| Protein Length | 210 Amino acids |
| Molecular weight | 23946 |
| References | 1 PubMed abstract 2908440 2 PubMed abstract 3393535 3 PubMed abstract 2647438 |
| Domain Name | Hormone_1 |
| Hormone Name | Somatotropin-2 (Somatotropin II) (Growth hormone II) |
| Mature Hormone Sequence | MENQRLFNIAVNRVQHLHLLAQKMFNDFEGTLLPDERRQLNKIFLLDFCNSDSIVSPIDKQETQKSSVLKLLHISFRLIESWEYPSQTLTISNSLMVRNSNQISEKLSDLKVGINLLIKGSQDGVLSLDDNDSQHLPPYGNYYQNLGGDGNVRRNYELLACFKKDMHKVETYLTVAKCRKYLEANCTL |
| Position of mature hormone in Pre-Hormone protein | 188 Residues from position (23-210) |
| Receptor | N/A |
| Gene ID | 100136734 |
| PDB ID | N/A |
| Drugpedia | wiki |
| Comments | !Receptor for this Hormone are either unknown or have not yet been curated |