Antigen browsing page


The page has been created to visualized all the protein sequence their gene ID and protein ID from NCBI from selected strain. The strain can be selected from the option given in the form and then click submit to display all the proteins and their corresponding information available in our database. The output will be presented in a tabular format where Gene ID is linked to display an antigen card. If you click on gene ID of a proteins, the number of epitopes mapped and/or predicted will be displayed in result page.

Please select a strain:

Selected strain is M_abscessus
Gene IDProtein IDProtein DetailsSequence
169632028YP_001705677.1 50S ribosomal protein L34 [Mycobacterium abscessus ATCC 19977]MAKGKRTFQPNNRRRARTHGFRLRMRTRAGRAIIAGRRRKGRRELTA
169632027YP_001705676.1 ribonuclease P protein component [Mycobacterium abscessus ATCC 1997MLPTRHRMTKSSEFRQTVKRGVRTTHADLVIHLRRGCPDSACEQVEGPKV
GLIVGKSVGGAVVRHRVSRRLRHAAAELLPKLEPVDRMVIRALPSSSTAL
SASLRQQLRDGIDRSARRQEPAAERQR
169632026YP_001705675.1 putative inner membrane protein translocase component YidC [MycobacMFDWFNLGFIYYPVSGIMWVWYKLFAYLLGPKNFFAWALSVMFLVFTLRA
ILYKPFVRQIRTTRQMQELQPQIKALQKKYKNDRQRMALEMQKLQREHGF
NPILGCLPMLAQIPVFLGLFHVLRSFNRTTGGFGQVHMTVEANRATGNYF
FSANDVANFLDANLFGAPLGATMIQTTGLDAFTEFNRLAVAGVSIPLMII
AGVATYFNSRASIARQSPEAQANPQTQIMNRLALYVFPLGVVVGGPFLPI
AIILYWVSNNIWTFGQQHYVFNRIAKEEEEKKQADLERRAANAPKPGAKP
TRGKSQPAEQADDSDASPEVVESTGTDEDSGGPASPNSTNGSGTTSRTPK
PGARPDRRRKR
169632025YP_001705674.1 hypothetical protein MAB_4952c [Mycobacterium abscessus ATCC 19977]MTDLDTQAEETTAEETAAPEAEPRTADLEERLVAEGEIAGDYLEELLDLL
DFDGDIDLDVEGDRAIVSIDGGSDLSKLVGRKGEVLDALQELTRLAVQQK
SGERSRLMLDIANWRGRRRDELAALGTKIAKQVLESGEREELAPMTPFER
KIVHDAVAAVDGVHSESEGVEPSRRVVVLHD
169632024YP_001705673.1 methyltransferase GidB [Mycobacterium abscessus ATCC 19977]MKHGETLPVPEAAAEVFGERLARAVEYVAALATIGVERGLIGPRETGRLW
GRHILNSAVLGELLEAGERVIDVGSGAGLPGIPLGIARPDVGIVLVEPML
RRTEFLREMIEQLGLTNVSVVRGRAEEPAVIAEVGGADAVTSRAVAALDK
IARWSLPLTRIGGRMLAIKGDRAEDEVEQYGSALGQLGADDVRVVQCGTR
YLDSPTTVVVARRKECDGNRQRGSSRGGSRKRSR
169632023YP_001705672.1 putative chromosome partitioning protein/ cobyrinic acid a-c-diamidMSSDDVSRETGAASDGHRAPTEFVESETPIGAAAQRATQLKQGSVRLPKP
AHRRMLTIANQKGGVGKTTTAVNLAAAMALQGLNVLVIDLDPQGNASTAL
GADHRAGTPSSYEVLLGEIPIQDAIQSSPQSEHLFCVPATIDLAGAEIEL
VSMVAREGRLRSAIAGLPADAFDFVFIDCPPSLGLLTVNALVAANEVLIP
IQCEYYALEGVGQLLRNIELVQAHLNPALHVSTILLTMYDGRTKLADQVA
DEVRGHFGPKVLGSVIPRSVKVSEAPGYGTSVLEYDPGSRGALSYLDAAR
ELAQRPSSSASDPQ
169632022YP_001705671.1 chromosome partitioning protein ParB [Mycobacterium abscessus ATCC MSQSASSRRKGGLGRGLASLIPTAPVDGSSAPAGPSLGAAAADVVIGGGP
APAAPAATPAADIGAVYREIPVTAIKPNPKQPRQVFDEEALAELVHSIRE
FGVMQPIVVRVVDDGDYQLVMGERRWRATQEAGLDTIPAIVRETADDNLL
RDALLENIHRAQLNPLEEAAAYQQLLDEFEVTHEELAARIGRSRPVISNM
IRLLRLPIAVQRRVAAGVLSAGHARALLALEGGAGAQEELAARIVAEGMS
VRAAEEAVTLANRSDAPKPAPRRKPMQMPGLQDVAERLSGTFDTRVTVSL
GKRKGKIVVEFGSVDDLQRIVDLMSGEGTS
169632021YP_001705670.1 hypothetical protein MAB_4948c [Mycobacterium abscessus ATCC 19977]MSARIVPLRLDGFEQLPKHARRCVFWEVDPATVGDGQHLSDPEFEKEAWL
SMVMLEWGSCGQVAVTGPQSRPTTAGYALYAPPGVVPRARLFPTAPVSAD
AILLTSLGVEPGHESDGLPHSIIANVVAELVRRGVRALEAFGRTAEALDL
CEGSLARHSEAPDVLGECTIEQCMIDVDFLKDVGFTVVAPHQHFPRLRLE
LDRGLGWKAEVEAALERLLESVQIPQHAGAGPVVGAGF
169632020YP_001705669.1 beta-lactamase-like protein [Mycobacterium abscessus ATCC 19977]MFSAAVRTFTVGDATVTQLTELDVWPIKPHHWYPALSEEQLVFARANYAP
SAVSDDGSELIFAIHNYVIELADTIIVVDTCSGNHKNRPLFADLHMLNTD
YLTRLEQSGYSPEAVDIVVNTHLHLDHCGWNTRLVEGTWRPTFPAATYLF
HHTELKYIRAQWESAPIDQWQDNGGWVYEDSILPVLEHAPYGFVKSGQVL
HSYGSTHIRALDAGGHTPGHVAIEVRAADTGLLIAGDALHHPMQAQFPDL
PFYADADPAQAVATRRALLGRCADENLKLLTAHFPAHSPLGVRRSGAAFT
WDGSRAID
169632019YP_001705668.1 putative transcriptional regulator TetR [Mycobacterium abscessus ATMEDPAEPPIRMADRQRARRSELVKEEVVEAALAEFSERGYHQTSIAHIAE
RLGTGHSMFYRYFTNKRDILEHVVQHATQRTIETLSHTLPGRITSLNEFH
DFSVNLGLAYIDLVVADPRLSRLLLQQGAAVDAEMTAQFCGVFDAGAAVL
GGLLRDGIESGYVREDIDVEAVADSVVGIPLGILARYGHEPNQDILAARV
RATADLVCRGIAP
169632018YP_001705667.1 hypothetical protein MAB_4945c [Mycobacterium abscessus ATCC 19977]MTRLSAGAEWGPPPVIHGEPWWAWTVVAVLVVCLMISAAWVGWMTIRKHE
DALMYWLIMLSGVTILPYFVEPWLDVIGATTYMTNTLPYVIIADRPLPIF
VPLVWVGTAPTALVVYEMIKKGWAAWTLIVFALVFGIAECIGEMVNSHFG
LMRYYSNNALVFGVPLPSLVQNGGFLVIIAWVLVAIRPRMRGYRWAVIPF
VAPAAYLAYTIVCTLPNYFAIHLGLAPLPSWGLAGLSTTLNLLAVAIAAY
SPTCQRYRDEVGTKVLGPVRTAARQSVPAA
169632017YP_001705666.1 putative cytochrome P450 [Mycobacterium abscessus ATCC 19977]MTELVGKEVTRGCPAEPHQDGPTGFGDFPRELAGQWGPLPLNPSVHEVNE
IARARQRFEYSRKDPWWLTRASFPLASSIVRGVGSPALTPPGPVGHPVVG
SVPEMRREPFEFFRRCAREFGDVYRVPFPLGGSIVVVNHPDYASQVMDDP
VGRYSMIGPGQAAMGVIGAAIPMLEGDKFRQRRRMLMPMFGRRHLARVAE
VIADEFVRRVDRWACWADTGQVVDLQHAIAQVTLPAFLRAMFSSTITEQE
ISETDVDLRTFMSLMASVTMMSPLPSVLPLPGRESAPRSMWRLWRLTRRL
IQQRRKNPIETPDLLSLLLEASYDDGSQLSERDLSMELMILMAGGYETVV
ASLSWTLALLLGHPEHLRRLYAEVDGLAGALPTPDDLPKLAWAKACFDEG
QRLQGHPLNPRFAMDDDVIGGYFIPKHTIVGPSLYSIHRDPRWWADPDTY
DPNRFMDEVAARSRPRLAFMPFGSGRHHCLGTGMAYMNAQFLLAIIFQRY
RLALPEGWKPKHHFNFSVTLEGGLPVTLTTV
169632016YP_001705665.1 hypothetical protein MAB_4943c [Mycobacterium abscessus ATCC 19977]MGSGYCVAQHPDLFGADVDGTAVPLHKGVLSGEQAREAADAAHVCPAAAI
EIHPASQ
169632015YP_001705664.1 N-acetylmuramoyl-L-alanine amidase CwlM [Mycobacterium abscessus ATMTTGASNIRHGDRGPAVTEVREVLTALGFLEDPDEVLATGRHVMVDRFDA
TLDDAVRAFQQCRGLLVDGIVGPATYRTLKEASYRLGARTLFHQFSAPMY
GDDVATLQKRLQDLGFYTGLVDGNFGLQTYNSLMSYQREYGLTADGICGP
ETLRSFQLLGRHVTGGSAHAIRETEHVRNAGPQLSGKRIVIDPGLGGGDR
GRIVPGREGPTSEADILWDLASRLEGRMTAIGMDTYISRAIQNNPTDVER
ATYANNVGADLMISLRFDAQPTVAASGVASYHFGNLHGSVSTIGHMLADF
IQREVAARTGLRDCRAHGRTWDLLRLTRMPTVQVDIGYITSPHDVSILSS
AHYRDVVAESILAAVKRVYLLGKNDRPTGTFTFDELLAHELSAGS
169632014YP_001705663.1 thioredoxin [Mycobacterium abscessus ATCC 19977]MSDHATVTVTDDSFQEDVVSSNKPVLVDFWATWCGPCKMVAPVLEEIAKD
HGEALTIAKLDVDANPETARAFQVTSIPTLILFQNGEATKRIVGAKSKSA
LLRELDGVV
169632013YP_001705662.1 thioredoxin reductase TrxB [Mycobacterium abscessus ATCC 19977]MSQAPSTGTESDVHELIIIGSGPAGYTAAVYAARAQLKPIVFEGTQFGGA
LMTTTEVENYPGFREGIMGPDLMDQMREQAIRFGADLRTEDVDEVSLRGP
VKTVTVGDEVYRARAVILAMGAAPRYLGVPGEDTLLGRGVSSCATCDGFF
FKDQDIAVIGGGDSAMEEATFLTRFARSVTLIHRRDEFRASKIMLERAYA
DPKITVLTNTKIVGVEGTDSVTGLKLENTVTGQASELPVTGMFVAVGHDP
RSELVKDVVDVDPDGYVLVRDRSTYTSVEGVFAAGDLVDRTYRQAVTAAG
SGCAAAIDAERWLAETAHSQTLIEA
169632012YP_001705661.1 hypothetical protein MAB_4939 [Mycobacterium abscessus ATCC 19977]MVSNPPGGADDEGNLDKVNLAEVPLSLEVLADLHAGVYDTGDSNVLRQRA
DQDPDARQTLAALDQVRAELVAWMDSPAPEVPESVVDDIVAALRAESAKS
TLPAIAADAVRPADVSLNLVTGPVPLDHRRRPAAKRRWLAYSGAGLAAAA
CVAVAITVVAQDNQRASQTTTAVAGPSLSQQIAPKTAAPVAPELPARGAV
GQTAFPLSGNEITALVGRAPAFGELDDAARRASCLTGLGLSASTPVLGAQ
TLDIDGPAVLMVLPAERPGELLAVAVRPGCSQTDPQRVAQTRIGATPSR
169632011YP_001705660.1 alternative RNA polymerase sigma factor SigM [Mycobacterium abscessMVQGVLTTPQHSDAELLAAHVAGDPSAFEQLFRRHHRRLYRLARATSRTP
EDAADALQEAMLSAHRGAANFRNDAAVTSWLYRIVVNACLDRMRRNKAHI
PIELEEDVYTLEDPSTNVDTSIVIQKALLRLPAEQRAAVIAVDMQGYSVA
DAAELLGVPEGTVKSRCARARARLAVALHYLDKAGSVEPETIDY
169632010YP_001705659.1 hypothetical protein MAB_4937 [Mycobacterium abscessus ATCC 19977]MREPLDPLPDPEADDTIEELSDAAVVSHSGSMAVATLVSRITGFIKLLLI
TAALGAASASAFSTANTLPNIIAALVLEATFTAIFIPVLTRAEREDADGG
EAFIRKLLTIVTTLLLVTTLLSVLAAPLLAGIMLGGDPKVNTPLTTALAY
LLLPQVFFYGLSSLFMAILNTRNVFGPPAWAPVWNNLVAIATLVLYWLMP
GELTLDPIRMSDPKLLVLGIGTTLGVAAQAMVLLPAIRRQQIPLRPLWGL
DDRLKQFGGMAAAMFAYVAISQFGYVIANRIAAGAAESGPIIYSQTWMIL
QLPYGVVGVTILTAIMPRLSRNAAAQDTPAVLGDMSLATRLTMTVLIPVV
AVMTVAGPAMGPALFAYGNFHLGSAHYLGLSISLSAFTLIPYALVLLQLR
VFYARHEAWTPTLMIIVITAVKVIGSVAAPHLTDDPDLVAGYLGAANGLG
FVAGALCGYLLLRRSLGRAAGPLIGPDVARTALVALAASVTAAAVGLGID
RGFGLDLLTQRGGGLGSILRLAILGIVMLAVTFALMVAVKLPEALSVVAM
LQRRLGGRLGARLRAETQDHASVMGNSPGPSLPYPDSGDPVGGSDAIGST
TANKPAHGGGADTRKGRAVTDTPGSSTRPVPTQSPSTGPVPTSVMPGASI
AGGRYRLLTSHGGPDGLQFWQATDTELNRPVALTIIDGAAFTADQVQDIL
SNTLRLSKIESSGLARVLDAVHEGNGGIVVAQWVRGGSLREVADTEPSAV
GASRAVRSLAEAADAAFEAGSALSIDHPDRVRISIDGDAVLAFPATLSSA
SADEDVRGLGAALYALTTRRWPLAETGQPSGLPAANRAPDGRPVEARVLI
PTVPAEISDVAARALSDDPGSAAELLDGLESAIASVDHTTMLEPAAAAPT
QALDVGRRPSFEDPADSDDEDYEDYEEEDPEEAARHRKIFLIGLGVVGVL
VISLCIALGVWVTRIFGDVGPLDKINIGIGLPTQSSGGDAAKPGSPAKIV
QATVFPPGPDADQPGKAGLAVDGNPSTSWITDTYTDADPFPVLFKPGVGL
LLDLQSSSALSSVTIESHSVGTQVQIRSADSATPGSINDTKEISATATLQ
SGKTTIPITSSSQVSHVLVWINKLGSTNGDHHAEISEITVSTAS
169632009YP_001705658.1 hypothetical protein MAB_4936 [Mycobacterium abscessus ATCC 19977]MTRPTHRSATRVAAVLAVLALVLLGAPWSVPRAQAYRDGQFLKVVIDEVN
PQTVTTVDSMVTVRGTVANVGDRPVTDVVVRLERADAVATSSDLRASLHG
HHDQFRPVGEFVTVAGTLEQGQQRPFSLAFPLRGGTGANWNIEAPGVYPA
LVNVNGTPDYGAPARLDDARFLLPVLGVPPPNNAASEPEVAPDTSRPVGL
TLLWPLADRPRLAPGQPGGPTPVRLLDDQLERSLSPGGRLDALLGALEFA
TEPAVDPKGELARTVCVAVDPDLLVTVNEMTQNYQVLDNSADPAGPVHPG
TGQGLAVAWLDRLRAMAKHTCVTPLPYAQASLDAVAEMADDGLSHQATTG
AADVLDQILGVVSLRGATLLGDSHLSAASIDLLTAQGPTVAVSPLPSGQE
TPPDFNPRRVSDTLVAAPFDPSVGAALSAVGRTPMTPDYVPQSLRFALQH
DSRVARIQDALGAMAWQALSPQQTPRQTVLLPDATWDLSDGEARSILSAT
STLLHSGLAIPRPLPTLIGEARAGAQPNPVDTTFGVDAQEAVDDWVSQGL
GDEVRRVWGLTAALTVDARTGLTGVQYTDPLRQDALRAVSQSVPADARDD
AARERLAAIRRTVGDLFNAVTVVNPGGSYTLATEHSPLPLVLRNELPVPI
RVSLRVETPAGMSATDVGVQEVPPGFLPVKVPVEVNVSQRMAVDVTLHTP
DGLPLGDPVRLSVHSNAYGKPLFFITISAATVLFALTGRRLWHRFRGQPD
RADLDREDEPAAPEKGAQWQQ
169632008YP_001705657.1 MutT/NUDIX family protein [Mycobacterium abscessus ATCC 19977]MSDSSGGSRTGGSSDEPGSNPASARGRGSRRGRRNRSQGRAQGRAQGANT
PAASPAAGAPAAPNGANTAAGKGRGRVKGRAAGTSLRTVRETSAGGLVIA
GIDGPKDGQVAALIGRTDRRGRMLWSLPKGHIEQGETAEQTAIREVAEET
GIRGTVLAALGSIDYWFVTEGRRVHKTVHHYLMRSLGGELSDDDVEVTEV
AWVPLGELPTRLAYADERRLAEVAGDLIDKLHTEGPAALPPLPPSAPRRR
PQTHSSTHRTPGRRSGRGQQQ
169632007YP_001705656.1 Poly(A) polymerase PcnA [Mycobacterium abscessus ATCC 19977]MPESIPTAELLATAAVTLNRHKKLLSELGALFDSAGFDLYLVGGSVRDAA
LGKPGIDLDFTTDARPEQVQNLVTGWAEAIWDTGIAFGTIGVARRGQRVE
ITTFRSDSYDQQSRNPEVVFGDSLEGDLVRRDFTVNAMAVKIGPDGPGEF
CDPLNGLEALRAGVLDTPSAPEISFGDDPLRMLRAARFVSQLGFTVAPRV
LEALHAMADQLGRITAERVQTELDKLIVGAHPVAGIDLLVDSGLGAVVLP
EVGQMQLTIDEHHQHKDVYRHSLTVLEQAVDLEDEGPDLVLRWAALLHDI
GKPATRRHEEGGGVSFHHHEVVGAKMVRKRMRALKYSKQMVDDVSQLVYL
HLRFHGYGDGKWTDSAVRRYVTDAGPLLPRLHKLVRADCTTRNKRRAARL
QANYDGLEERIAELAAKEDLARVRPDLDGNQIMELLGVPAGPIVGQAWQF
LKELRLERGPLDHDEAVEALRQWWAGRS
169632006YP_001705655.1 hypothetical protein MAB_4933 [Mycobacterium abscessus ATCC 19977]MDAPTLAVLLAAASAAGWVDAVVGGGGLILIPVLMLVFPGMAPATALGTN
KLTALSGTASAAIRLFPRTPLNWRVLVGAFFVAAAFASAGAYTASRLPVS
VFKPVVLVLLVAVGVFVATRPQFGTTTEGTARTKTATLTALTIAAVAIAF
YDGIMGPGTGTFLIITLTVAAGMTFLESSATAKVLNSGTNVGALVVFASQ
GHVLWLLGLALGLANIVGAQLGAHMALGRGAGFVRVVLLAVVVVMVGKLG
YDMLR
169632005YP_001705654.1 hypothetical protein MAB_4932c [Mycobacterium abscessus ATCC 19977]MDYCFGAGDGVVTAWDAPPNVDLDGDGVMDAVRLDFDGDGLFDDMMWDAD
GDGSADHSVLDIDNDGRPETYFTDDGLGTWRFHVERSGSISWFGLDGMEH
PGGTADIDGDGKPDQLFDVDGDGDAERAFSTTDSGNSVYADTTGDGRWDV
VLTDGDGDGIAEAARPVASPQVSAENPVEGLP
169632004YP_001705653.1 acyltransferase PapA5 [Mycobacterium abscessus ATCC 19977]MNPGAAVRTLDPSEAMFAGNRSTVAYSAFGTGVLDIDALTLAFRALLRSY
PVLATQIVSAGHEYLLHHVPRPPALQVGTCTALPPAGFTIVDPDAVCAID
VAQQGNDFRLTLLTHHSIADAGASLKYLEVLCSLYTRVVETGSAGATRRH
PLAMSLEQFLAERGYVIPAPCAPPATPVEPTVETAVVLRHGRTRLSRAQT
TRLFDSARAAGLTVHGIVCAAILSAAQTLSRSQDPVTFGLTSSVDLRTRT
GAPITAAQGTVIQGADTATLAVTSDDDPLRLARAVLDSLASGLVDRRVHQ
AFLRHQPLQQQSVENPLMVRTGAAYLRCACRRGCAYTTSVPPHVGGASGC
GPRHFPRASSSPPARDNSASITQSG
169632003YP_001705652.1 hypothetical protein MAB_4930 [Mycobacterium abscessus ATCC 19977]MTSTADAVIDDLRAESDELDALVAALPEQGWARDTPAAGWTIAHQIAHLH
WTDAQSLLAVTDPAVFAEELPKAMADPLGFVDKAAEETAQIPPADLLIQW
RSTRNQLHAALRAVPDGVKIPWYGPPMSAASMGTARLMETWAHGLDVADA
LGVPLAPTPRIKSIAHLGVRTRDFAFSVHGLPAPSEPFRVELTGPDADTW
TWGPEEAAQRVTGSALDFCYLVTQRRPRADLDLRATGQDAEQWLSIAQAF
AGPPGAGRG
169632002YP_001705651.1 hypothetical protein MAB_4929 [Mycobacterium abscessus ATCC 19977]MTARHSPLSLWRAIHDLPDFGRLVWVRLLTQFSDGLFQAGLAGALLFNPE
REAEPWAIAGAFAVLFLPYSAIGPFAGALLDRWDRRAVLICANLIRVLLV
ALVGFELAFSADDVVLLLGALIVNGVTRFVTSGLSAALPHVVPRDQVATM
NSVATAVGATATFIGANFMLMLRAAFGAGDLGSATVIFLVIVPTTAAAWV
ASGFPGDRLGPDDSVRAVHGSAFYAVATGWLHGARTIVGTPSVFDALIGL
AAHRMVFGVNTLLVLVLVRSNESVFAGIGAAALFLACTGIGSFLGTVSTP
ALLRRFGRGRTLGMALGGAVVLQLIASGLYIPILLASAFGLGMAGQVIKL
CADVGMQTDVDDALRGHVFAVQDSLFWVTFTGAMAVGAAFITHAHWLAFS
GAMIYLAGLIVHMTRTLWPSTLDTGSLPTQPNAGSLPTQPNPEGQARDLD
R
169632001YP_001705650.1 hypothetical protein MAB_4928c [Mycobacterium abscessus ATCC 19977]MAHGDEPEEGEAYGEGYMAPPAHRLRAGTLLIANTNLFEPTFRRSVIFIV
EHNDGGTLGVVLNRPSETAVYNVLPQWAKLAGKPKTMFVGGPVKRDAALC
LATLRAGVSIDGVKGLRHVAGRMAMVDLDAEPEDIAPLVEGIRVFAGYSG
WTIGQLEGEVERDDWIVLSALPSDVLTDASEDLWAKVLRRQPLPLSLLAT
HPIDVSRN
169632000YP_001705649.1 hypothetical protein MAB_4927 [Mycobacterium abscessus ATCC 19977]MTDNTPVPAHNNRELRPDRVVQGVAMLAAKTWWRGVKWSADVATTTGTKI
IDDVRAGRSATDIALSATEHVLGAVRDALQLPSDSSGLTLAKPQKPAPSR
VTIDITESGALDGDELRRRGAELLRRSADVTDVEDTHPAYARIINQLAPD
EARILRFLAAHGAQPVVDVRTSRPFDVGSEMIAEGLSMVAERSGCRYTNR
NNAYTNNLVRLGLVRASPEAVAAERYQVLEVQPDVVAACRRAGRAHKTVR
RSIHLTPFGEDFCRAVIPTDPSVGDDL
169631999YP_001705648.1 hypothetical protein MAB_4926 [Mycobacterium abscessus ATCC 19977]MKDTKQMVKFILVGVLAVASGIAAYIYRDDQLIVDLLTIPLFTGIIGYIT
NWTGVLMLFAPLRFYGWRIPGLRTLYAFLPRRVQVIPAITSDGRFGWQGI
VPSRAEKMASIAVDKSLAKLGSISDFYEQLEPDLIANHLALIAKSEIRGV
ITKIMEREDPQLWHNLPPALREMMFKRIENQLPQIIKNMTDQIGENIEQL
VDAKLMIIRYLTAHPKLLNDIFRTMGHKELQFMQNFGFYFGYPMGFVLVA
ILQSVPHHWWTPWIVLPLGGVIIGYIVNYLGITMIFEPVHPNKWVPWRQG
LFIKRKAEISEEYARTISENVITLENIGDEMLNGPRSDRTRQMLADGIRP
ALEQALGPARRAIRVAVGRRQYDQITESVTLEATGFAPLAFSDPEFNKQR
QGKIGAFVSTQMHKLSLDDFNELLRSAVKQDEWLLFVHGAVLGAAGGLAH
LLIFPPAG
169631998YP_001705647.1 hypothetical protein MAB_4925 [Mycobacterium abscessus ATCC 19977]MLIAAIVTIALAGLLAALSAAAFLRAPHGSPQRMLAPAQAAAAVILAAGG
LAALFGSTTIGLVGLTVCGAAALVTVGAAAWQVAQYTTAAQQMSAAGGCG
SACGGCPGAGRNDSPGRDGLRASGSSVCARP
169631997YP_001705646.1 hypothetical protein MAB_4924 [Mycobacterium abscessus ATCC 19977]MTTTRYSVRFAAATASVAALLAGTAAVAMADPQPAPVPPVPAATANAAVA
PAPNAAPAPAVAPTTSANPLQPAAPIAGVAPAADGTLSEFFASKNVKVEP
LTKSSHGVPRISIPIPNNWANVPDPNVPNAYQVIVSKANGTGIYQSNAQL
TMSKLIGEFDTNEAVSHGPVEVKALQGWQPTDASLVTYQGFPSSIVEGTF
RQDGETLNTSRRAVIITQGKDRFLVQLAVTTTVGNAIAEAPATDLIVNGL
RFGDAAPVTAPVADPNALADPDAVPGAPATPAAGAPAAADPNAPASPAPG
VPGLPPLPTLPALVPPAPPAA
169631996YP_001705645.1 leucyl-tRNA synthetase [Mycobacterium abscessus ATCC 19977]MTETQHDATDTAELPRHRYTAQLAGQIERRWQQTWADRGTFHVPNPVGSL
APTDGTPIPADKMFVQDMFPYPSGDGLHVGHPLGYIATDVYARFHRMRGA
NVLHALGFDAFGLPAEQYAVQTGTHPRVRTEANIVNYKRQLGRLGLGHDS
RRSFATTDVDFYKWTQWIFLQIYNAWYDEQARRARPIQELIAEFDSGTRA
PSDGTVWAELSVGARADVIDSYRLVYQSDSVVNWCPGLGTVLANEEVTAD
GRSERGNFPVFRKRLRQWMMRITAYSDRLIDDLDVLDWPDKVKTMQRNWI
GRSQGASVLFGAPGAGDIEVFTTRPDTLFGATYMVLAPEHPLVDQLAADV
WPQDTDPRWTGGQDSPRAAIEQYRRSIAAKSDLERQENKEKTGVFTGAYA
TNPVSGKPVPVFIADYVLLGYGTGAIMAVPGHDQRDWDFANTFGLPVQEV
ISGGDVTKAAYTGDGVLVNSDYLDGLDIEAAKVEVTRRLVKDGRGESRIE
YKLRDWLFARQRYWGEPFPIVYDEDGRPRALGENVLPVELPEVEDYAPVS
FDPDDASSEPSPPLSKAADWVNVELDLGDGLKHYTRDTNVMPQWAGSSWY
ELRYADPDNAEAFCDKENEAYWLGPRPAEHGPNDPGGVDLYVGGMEHAVL
HLLYSRFWHKVLYDLGHVSSREPYRRLLNQGYIQAHAYTDARGMYVPAAE
VTEENGKFFYQGAEVQQEFGKIGKSLKNSISPDDICDNYGADTLRVYEMS
MGPLELSRPWATKDVVGAHRFLQRAWRVVVDEETGKIRVTTDDLTSEDTL
RALHKTIAGVTEDYAALRNNTAAAKLIEYTNHLTKDYPEGAPRAAVEPLV
LMLAPLAPHLAEELWSLLGRDDSLAHGPFPESDDRWLVADTVEYPIQVNG
KVRGRITVAADAPKGDIEAAALTEEKVLEFLAGATPKKVIVVPGRMVNLV
V
169631995YP_001705644.1 putative short-chain dehydrogenase/reductase [Mycobacterium abscessMPHALITGAAGGLGAAIARALAATHSLLLGGRPSLRLDTLADELDATPWP
VDLSDQDAILAAVAGIDALDVLVHNAGVSYPATIADSTLADWRKTLDVNV
LAPVALTQALLPALRAAQGDVVFINSGAGINAHPGIGSYSVSKFALRGFA
DVLRAEEPALRVTSVHPGRISTPMQQELTEHEGREYNPDDYMRPESVAQL
VADAVNLPRDARVHQIVVRQN
169631994YP_001705643.1 hypothetical protein MAB_4921c [Mycobacterium abscessus ATCC 19977]MTAVEPVTPGIRYVSLDVMRGIAILGTLGTNIWIFTNPEGFIGYVSGVGR
AEGVWRWVEAVLQQLCQGKFLGLLTVMFGIGLAIQQHSAQRRGDSWPGAY
PVRAGLLFVDGVVNFLLFTEFDVLTGYAVTGLIVAFVLATSARSQRIWLS
AAVLVHVAILMVIVGAIVASPPPEDNPPVQQQPNPYAEGSFWDLVVFRVD
HLLVFRAETILILPVAIAMFIAGAMVFRAGVLAPEGAELRRRLMIVGFIV
ALPIDLIVGLFWGSAGMLVGRYLTAAIIAFGVLAAVAQFYVAGRVPGIVG
RALGTVGRMALSCYVLQNALAGALCYGWGLGLAQRMGPGTVVPGTIGVYA
LVVAVLMLFSKLWLSRWERGPLEMLWQASYQRLTTRR
169631993YP_001705642.1 hypothetical protein MAB_4920c [Mycobacterium abscessus ATCC 19977]MPSHPMFTPTQLAARAAYLLRGNDRGTMTSAAPKLYPHMWSWDAAFVAVG
LAPLSVERAVTELDTLLSAQWANGMIPHIVFANGVDGYFPGPARWQTSEL
AANAPSGYQTSGITQPPVHAIAVQRILDHARRRGRSARGIAEAFLDRRWT
DLMRWHRWLAETRDQNQHGRITLYHGWESGMDNSPRWDGAYANVVPGELP
PYTRADTAIVTDPSQRPKDAEYDVYLWLLEEMKSVRYDDARLPDAMSFAM
EDVFVSAIFSVACEVLATIGEEHARPRADVRELHGWAERFRQGVLDTTEE
RSGAARDFDVKTGKWVATDTVAVFAPLLSGGMPRPQELALLRLLEGPRFC
GHPDLRYALVPSTSPVSRDFRPREYWRGPVWPVLTWLFCWAFERRGWSER
AFLLRQEGLRQAGDGSFAEYYEPFTGEPLGSMQQSWTAAAVLDWLG
169631992YP_001705641.1 AsnC family transcriptional regulator [Mycobacterium abscessus ATCCMTTLDATDAKLLLALTQTPRASGVELAQRLGLSRNTVQARLTRWDQHEAL
AGIDHQIVPRAMGYPMTAYVTARIDQHQLEAIGAALADVPEVVQVHGLAG
ADDLMIKVVAVDSDDLYRIAGNILDIPGITRTSIAIAMHELVAFRMTPLL
RRLSGQE
169631991YP_001705640.1 pyruvate dehydrogenase E1 component subunit alpha [Mycobacterium abMETIQLLDSDGNRIENPEYMPLVSDILDEDGLTQLRALYRDMVVVRRIDN
ESTALQRQGELALWAPLLGQEAAQVGSARALRHDDFAFTSFREHGVAYCR
GIEPTAMLQFWRGSTQSGWNPRDHNVTAPAIIVGAQALHATGYAMGVKFD
GSDTAVIAYFGDGATSQGDVSEAFAFASSFGAPVVFFCQNNQWAISEPVR
VQSHLPLAARGIGFGVPGIQVDGNDVLAVTAATRMALRRAREGSGPTLIE
AVTYRMGPHTTSDDPTKYRNAAELDEWRAKDPLARVEKYLESRGALSESE
KHRIAALADEVAAQLRAGCLGTVEPTAADMFNHVYAEPHPLVSAERRDYL
EYLATFEDEGTYAS
169631990YP_001705639.1 pyruvate dehydrogenase E1 component subunit beta [Mycobacterium absMTRMTMSGALDAGLRSALEDDDKVIVMGEDVGKLGGVFRVTDGLQKDFGD
HRVIDTPLAESGIIGTAVGLAMRGYRPVCEIQFDGFVYPAFDQIVSQVAK
LHYRTKGAVGMPLTIRIPFGGGIGAVEHHSESPEAYFAHTAGLRVVSCSS
PQDAYDMIRQAVACDDPVVFFEPKRRYWEKGEVDTALVPVPLGAARVVRS
GTAATIAAYGPMVAVANAAAELAATEGISVEVVDLRSLSPVDFDTLEASV
RKTGRLIVVHEAPVFMGLGAEIAARITERCFYHLEAPVLRVGGFALPYPA
NKVEHHYLPDAERVMDAVDRAIAA
169631989YP_001705638.1 putative dihydrolipoamide acyltransferase component [Mycobacterium MAVKQFLLPDLGEGLTEADLISWKVRVGDEVKLNQVLADVETAKAMVELP
SPFEGTVVALQAAENSTVAVGAPLISIEVAGAEPDAPANLVGYGPSDSAG
QTRRRRRSGAGAAALALVEQTTEPEPAVAAPAAQAESVPSRAAAKPSVRK
LAAELGVALELINGTGIGGSITRQDVEAYTRSLTARAPQGAPAEEEPVAG
VAVQPGGETRIPIAGVRKHTAAAMVRSAFTAPHVTEFLTVDMTSTMGLLA
ELKAKSPDLKLTPMTLVARMVLLALRSHPSLNSAWDEQAGEIIVKHYVNL
GIAAATERGLVVPNVKGADAMSLGELATAIAQLVSTARAGKTAPTDMSGG
TFTLTNIGVFGVDAGTPIINPGEAAILALGSVAKRPWVVNGELAVRDVTT
LALSFDHRLVDGEQGSKFLADLGAMLTDPRMALVV
169631988YP_001705637.1 hypothetical protein MAB_4915c [Mycobacterium abscessus ATCC 19977]MRRGMAAVCIVLSLAGCSRISGGEPTAPVGIEGVYREIRPVDGKLGGRLL
PAEEVRAVTGLPRLLKVWDPVDSMFGSTDPSLECGLGYSLAEVVQYSGYS
AARIEGYSQETEEVREYSVSDALVVFADADAAQREFRSFAGRMSKCDGVT
TQKRPHEDADFWKLSITSADTADEVAWTRSVIGSTWACYMAARQRANFVA
SSMFCSHGSDNKAGDVLDRLMQKLSGSR
169631987YP_001705636.1 hypothetical protein MAB_4914c [Mycobacterium abscessus ATCC 19977]MRGAPVILLSVTVLLSSCTQAIAGDATAPVKAEKLYPVLPPRQAELADRL
LSASDVRAAAGLPEVKTIPPVETVLSTANTVSDCAYGYSLATRQQYLSFG
AARIQAYAHTVDKMRKHTVGTALIVFETASSASQQFEQFAQRMSRCDGAH
GTTSVGGASENWTLKILHSGQDEVNWTRTTDHSPWSCRLVARQRANYVAS
VMFCRIDPEDDKTEAMFTLLLDKLAR
169631986YP_001705635.1 putative short chain dehydrogenase/reductase [Mycobacterium abscessMLQDKVVVVTGGSRGLGRAMVRAFAAHGADVVIASRKIDSCQELAAQVEA
EHGRRALPVACNVSSWEQCDHLVDTVYREFGRVDVLVNNAGLSPLYPSLD
QVSEALFDKVIGVNLKGPFRLSASIATKMAAGAGGSIINISSIEAVRPDA
TALPYAAAKAGLNALTLGLSHTFGPTVRTNTIQCGLFNTDIAAAWPEGFA
EALIPSIPLRRVGEPEDIVGAALYLASEASAYCTGTTIRLDGGIL
169631985YP_001705634.1 TetR family transcriptional regulator [Mycobacterium abscessus ATCCMTEAGAKPRRGRPPASDGDAAATRQRIMEVATDLFAEKGFHATGVAEIGA
AAGVRGGALYYHIGSKEELLWEILRSYIDEMLTEAVHIANMNTEPARRLR
TLIGSYVILIVKYRKQVAIQVRDGSALTGERAAQLQGLRDELQRCWQRVF
DEGHEVGTFHTADHVLTNAILGMLNMVAVWYRTDGKSPAQIAKRIADMVL
DGIHVDRPEEHAEQAPTDRK
169631984YP_001705633.1 acyl-CoA dehydrogenase FadE [Mycobacterium abscessus ATCC 19977]MTAMAWDFETDPEYQELLDWADEFVRTEVEPLDYVFPNPYDKSDTVAMDY
VRPLKEEVKRRGLWACHLGPELGGPGYGQLKLALLNEILGRSVWAPSIFG
CQAPDTGNAEILAHYGTEAQKAKYLQPLMDGDIGSCYVMTEPQGGSDPTL
FKTTAVRDGDEWILNGEKWFNSEARHAAFWIVMAVTNTEVSPYQGMSMFI
VDPNAPGVEIVRNITVHGFSEDEAYTRFTNARIPAENMLGAEGGAFAIAQ
TRLGGGRVHHAMRTVAQVRKAFDMMCERVVSREARGGTIAKLQMTQERIA
DSWIEMESFRLLVLRTAWLIDKHQDYLKVRKDISAIKAAMPKVMHDVAQR
ALHLHGSLGVSEEMPLAKMFLYSEVMGLVDGPTEVHKVTIAKEVLKDYTP
YEGLFPPSHIPALTEKARAHVAARLEHRVGNL
169631983YP_001705632.1 putative aminoglycoside phosphotransferase [Mycobacterium abscessusMAAPHHIDPKSVDFDVVSHWMDEQGLPGGQLTDISAITGGTQNIMVRFSR
GGREYVLRRPPKHLREASNNVIRREARLLGALRGQGVPAPELIAACTDET
VLGGAVFYLMEPVDGFNASVGLPELHAGNAEIRHQMGLEAVSGIAALGAL
DYQELGLDGYGNPDGFLERQVPRWLKELDSYAKHDGYPGPDIPGLQSVAN
WLERHRPSQWKPGIMHGDFHLANMMFRNDGPQLAAIVDWEMSTIGDPLLD
LGWMLATWPSETDDASLGGALVQAGGLPTPQELVAHYAERTDRDLGAMDW
YTVLACFKLGIILEGTHARACAGKAPVAVGDYLHGLTLQLFKRAVAITG
169631982YP_001705631.1 GABA permease GabP [Mycobacterium abscessus ATCC 19977]MATTAAPSEGGLQHSLQKRHLTMIAIGGVIGAGLFVGSGATIQAAGPAAF
LTYAITGVLIVLVMRMLGEMAVANPSTGSFADYSRRALGDWAGFSVGWLY
WYFWVIVVGFEAVAGGKLIQDWLPHAPLWLIALLLMLAMTATNLFSVRSY
GEFEYWFASVKVAAIVAFLVAGTCYVLGLWPGKKLDFSNLTVHEGFMPHG
PGAIFSSIVIVIFSMVGAEIATIAAAESKDPAKAISQATNSVIYRVAIFF
VGSIFLIAVIVPWNSPELGTSPYVTAFKTMGIPAADHIMRVVVLTAVLSC
LNSAMYTASRMLFVLAGRGEAPRSWLKVNARGVPVQAILASSFIGFVCVI
LAYFFEHTVFLFLLNSSGAVILFVYLMIAISQYVLRRRTPEEKLLVKMWG
YPALTILTAIGIVAILVAMGFQDATRTQLWTSLLSWGVILLLFAILRLTR
RRTPEPGERTTR
169631981YP_001705630.1 putative luciferase-like oxidoreductase [Mycobacterium abscessus ATMTGFGISTTSADGYVSPDVLARAVEERGFEWLLFDDHSYFPVDTPDSIDA
EFRARLPLIRDLPVVLAYAASATERLIVGSGVALLPQRDVLHTAKAWATV
ATLSGGRTVLGVGVGWNLGEVRNHGIDPAKRGAVLDEQLAALHALWTQEQ
AEFHGEHVDFGPVVARPRPARPLPVHVGGPSRAAQARALRVGDGWLPYAG
TSTPDDVRRACGWFAEQGRADLPVTVSGVPGDHQLAGEYLGAGAERVLFD
VHPLNEADTLRALDRLTEVVARLT
169631980YP_001705629.1 myo-inositol-1-phosphate synthase [Mycobacterium abscessus ATCC 199MSNTSSEVRVAIVGVGNCASSLVQGVQYYQDADENSTVPGLMHVKFGPYH
VRDVKFVAAFDVDAKKVGFDLSEAISASENNTIKIADVPPTDVIVQRGPT
LDGIGKYYADTIEVSDSEPVDVVKVLKDNNVDVLVSYLPVGSEEADKFYA
QCAIDAKVAFVNALPVFIASDPVWAKKFEDAGVPIVGDDIKSQVGATITH
RVMAKLFEDRGVTLDRTYQLNVGGNMDFKNMLERERLESKKVSKTQAVTS
NLNGSLADKVYDKNVHIGPSDYVAWLDDRKWAYVRLEGRAFGDVPLNLEY
KLEVWDSPNSAGIIIDAVRAAKIALDRGLGGPILPASAYLMKSPPKQLAD
DVARAELEQFIAG
169631979YP_001705628.1 PadR family transcriptional regulator [Mycobacterium abscessus ATCCMLELAILGLLLESPMHGYELRKRLTGLLGAFRAFSYGSLYPALRRMQADG
LIEEDAAPGINSAATMLRRGKRVYQLTTAGRSRFSELVADTGPQNYTDDG
FGVHLAFFNRTPAEARMRILEGRRRQVEERREGLREAITRASSSFDRYTK
QLHQLGLESSEREVKWLNDLIAAERTAQARVEER
169631978YP_001705627.1 hypothetical protein MAB_4905 [Mycobacterium abscessus ATCC 19977]MATRPPSQTRAKDSDRDATCQALDIALGDGQLSMEEHRERVTAATSAKTL
GDLSALVTDLQLDAPPVALPREHKPSAWRQRTPFLVIAAFSAAVIALGVG
LLVRESGTAERPGSAGAPGAVGRGAGPIDDGVAPTVIPRPAPAKKNIFTA
PGLSTLIDRIHQKFGDSTGYELDLYPEYAIIERADPDEPKGLISYLYREG
TFDDPDRRPRSFDNLGDVGAFDQAAILGIIRGAAQTLGIDRGEPSHVIIR
PNAEGGLQINIYASRGNYESGYISVDAQGLNPKLYPPS
169631977YP_001705626.1 hypothetical protein MAB_4904 [Mycobacterium abscessus ATCC 19977]MATRAKDSDREATCKALDTAFGDGQISTEEHRQRIALATRAQTLGELKGV
VADLQITAHAAETPTAPPPRRRWPALAATAVVAAAIGAGAGIYATRPSAP
DPGAVSDGIAPVVIAPAKLFSVPGLTGLLAQMRAKFGDTVGIELTIRATN
ASLVRIEASDPDLPITYPYQGGFRDGGAMPGTWRNVKIGDLSRFDPTKIV
GVLRGAPETLNVPTAGDGGTVMVIKPSDDGVDITITVSDKDRTGRMLVAG
NGEPKEVTPAS
169631976YP_001705625.1 hypothetical protein MAB_4903 [Mycobacterium abscessus ATCC 19977]MTSRRLSTALAGFAIITGAAAGCGTTADTPAIDSATSTTTSTTRSGPTDG
PAITASAPAGVRGKGKVVGSAVLKVLGSGTATVTWKANGGPAHVERDVPL
PWEHSIDVVEEAPSEVRADGAASGCTITMGDMLVSFKNEPNPVCEFAYWG
169631975YP_001705624.1 hypothetical protein MAB_4902c [Mycobacterium abscessus ATCC 19977]MRLQRQVVDYALKRRSLLAEVYSGRTGVAEVCDANPYLLRAAKFHGKPSA
VVCPICRKEQLTLVSWVFGEHLGAVSGSARTAEELVLLATRYSEFAVHVV
EVCRTCSWNHLVKSYVMGALPAPKGTTPRQRTTRARTASE
169631974YP_001705623.1 penicillin-binding protein [Mycobacterium abscessus ATCC 19977]MVGEENSVAPNSGPDSPRTPSTDDRPTSILDPIEDLPLYRRDDDAVAAAR
AALERDEDGGRGHEPPPPPGTPGRPGGSSRPPQRRRKRKSNGWKIFRNVM
IALVLLAIVIPLATFALAYSVVDIPKPGDIRTSQVSTILASDGTTELAKV
VPPEGNRVDIKIDQVPQHVRAAVMAAEDRDFYGNPGFSFSGLLRAVKNNM
FGGDTQGGSTITQQYVKNAMVGSQRAGLGGLTRKAKEIVISTKMSQSWSK
DQVMEAYLNIIYFGRGAYGISAASKAYFDKPVEQLTVSEGALLAALIQRP
SRLDPAVDLPESTNRWNWVLDGMVTIGALSAQDRAGQVYPATVPPEQAAA
QNATTGPNGLIKRQVMAELTDLFNIDEQTLNTEGLQITTTIDTKAQQAAE
NAVNTTLQSENPDLRTAVVSIDPRTGAVKAYYGGSNAQGLDYAQQGLQTG
SSFKVFALVAALQQGIGLGYQLDSSELTYQGITIKNSEDASCGTCSVAEA
LKRSLNTSFYRLMLKLKNGPEDVAAAAHNAGIAENFPGVSHTLSEDGQGG
PPNNGVVLGQYQTRVLDMASAYATLAASGTYRKPHFIQKVVNADGQVLFD
AGSSDNTGEKRISDDVANNAISAMKPIAAYSRGHALAGGRESASKTGTAQ
LGDTKDNKDAWMVGFTPSLSTAVWVGTDDGKPIKTSWGGPIYGSGLPSDI
WKKTMDGALDGTAKETFPKPGPIGGYAGVPTYVPPPPVPNGPPAPAPTGG
GEVTVIQPTIEIAPGITIPVGPPTTVPVGPAAPPAGDVPPPGP
169631973YP_001705622.1 hypothetical protein MAB_4900c [Mycobacterium abscessus ATCC 19977]MPTESTVSPEPLADDLRSADDRDFPSRTDALGAELSEVVGGPLGRHALVG
RQPFWTPLRVVFVIALGFLILGWTSKAPCLQQSGTGNGAQRVANWDNNRA
YYQLCYSDTVPLYGAELLNQGRFPYKSSWLETDSGGHQKIQYDGTPAVRY
MEYPVVTGVYQYTAMALAKTYTQASDVLGLPIVAEVVMFFNIVAFGLALA
WLVTIWASAGLSPHTRPWDVVMIAASPIVIFQIFTNFDALATAFSMTALW
AWARKKPWLAGVLIGLGVAAKLYPVLLLLPLLLVSLRSGKVHEFSKTAAG
AAASWVLVNMPVATLFPRGWGEFFRLNTRRGDDMDSLYNVFKSFTGWQGF
DGPLGFWEPPVILNAVSAVLFGLCCLGIGYVALTAPRRPRVAQLAFLVVA
VFLLTNKVWSPQFSLWLVPLAVVALPHRRILLAWMTVDALVWVPRMYYLL
GIENKGLPEQWFTGTVLVRDLAVIGLCALVLRQIYHPGEDLVRAGDDDPA
GGPCDGVADAPPGWLPAWLRPRKPAPHIARAHSVGSSASLTRK
169631972YP_001705621.1 30S ribosomal protein S6 [Mycobacterium abscessus ATCC 19977]MRQYEIMVILDPTLDERTVAPSLDTFLNVVRGDGGTVSKVEVWGKRRLAY
EIAKHTEGIYAVIDVVAAPATVSELDRQLGLNESVLRTKVLRTGAR
169631971YP_001705620.1 single-stranded DNA-binding protein [Mycobacterium abscessus ATCC 1MAGDTTITVVGNLTADPELRFTPSGAAVANFTVASTPRIFDRQSSEWKDG
EALFLRCNIWREAAENVAESLTRGSRVIVTGRLKQRSFETREGEKRTVVE
VEVDEIGPSLRYATAKVNKASRGGGGGGGFGGGGGGGSRSSEPADDPWGS
APASGSTAADDEPPF
169631970YP_001705619.1 30S ribosomal protein S18 [Mycobacterium abscessus ATCC 19977]MAKTTKRRPAPEKPVKTRKCAFCTKKALNIDYKDTNLLRTYISERGKIRA
RRVTGNCVQHQRDIAIAVKNAREVALLPFSSATR
169631969YP_001705618.1 50S ribosomal protein L9 [Mycobacterium abscessus ATCC 19977]MKLILTTEVEHLGTAGDAVEVKDGYGRNYLLPRGLAIVATRGAERQANDI
RRAREAKEIRGVEHANEIKQAIEGLGAVKLTVKTAGEGKLFGSVTAADVV
GAIKAAGGPNLDKRTVTLPKAHIKQIGSYVLDVHLHAGVATKVTVDVVAE
G
169631968YP_001705617.1 replicative DNA helicase [Mycobacterium abscessus ATCC 19977]MAIVDDLGQSGPAAPPEEDFGRQPPQDVAAEQSVLGGMMLSKDAIADVLE
KLRPHDFYRPNHQSVYEAILDLYGRGEPADAVTVAAELDRRGQLRRVGGA
PYLHTLISTVPTAANAGYYAGIVAEKALLRRLVEAGTRVVQYGYAGAEGA
DVAEVVDRAQAEVYDVTDRRMSEDYVPLEELLQPTMDEIDAIASAGGISK
GVPTGFTDLDEITNGLHPGQMIIVAARPGVGKSTLGLDFMRSCSIKHQLP
SVIFSLEMSKTEIVMRLLSAEAKIKLGDMRSGRMSDDDWTRLARRMSEIS
EAPLYIDDSPNLTMMEIRAKARRLNQKAGLKLVVVDYLQLMTSGKKHESR
QQEVSEFSRNLKLLAKELEVPVIAISQLNRGPEQRTDKRPQVSDLRESGS
LEQDADMVILLHRPDAFERDDPRGGEADLILGKHRNGPTATITVAHQLHL
SRFTNMAR
169631967YP_001705616.1 hypothetical protein MAB_4894c [Mycobacterium abscessus ATCC 19977]MVYESRLELAHLVRADFDPSVRRIVAQPFLVQIALDSKCRRHVPDYLLFT
GDGLVIVDVKPRELLEKPKIAYTLAWMRDVGARMGCSFEVQSEPPAMERL
NLRFVAGFRRSESVSAQVLEELRGCNLDGLTIGQAVSCVQHPPPRVRAAL
LHMVWRHELLIDLGRPMTSQTLITRVAP
169631966YP_001705615.1 integrase/transposase [Mycobacterium abscessus ATCC 19977]MTAGAERFGIGTRFVYEGQIIDVVQLRSTPKGPEVIASNGLEVMHVALKE
LLQSSRARLIPTEDGPSADDEQETAAMMLAQLSKAELKTVRERAAHVREV
LTGFRRGSEHIKEPDEPRPGFDPCGALADRYKAKAEQLNTSVRTVQRWVS
NYRRFGEAGLVDHRKPRQLGVDQRWVDEALAVMVERTNESRCTRKLVMWE
ATKRIEQRYGTGSVQIPSKTTAYKVLKILETRYPAFRLSAARNRDIAGRP
QEPYGKLKPTRPGEFMLMDTTPLDVFAYDPATSRSIRVELTVAMDWYTRC
ITALRLTPVSTKAVDVAAVLYQLYRPLPAGPNWPDHACWPEHGVPRSVLI
DPDAIDYTGAKYPQKHEQQAGPPTRSGGPAIVPETIVIDHGKIYVSEHIN
SVCARMGISIQPVRLGEGRDKGPVERFFRSVRQGVLEFLPGYAGPDIASR
GLDPQAQAELYIDELEELLRQWVAVYYHHRPHSGLVDPHLPSARMSPAQM
YEHGLAGAGFIEIPRDPDLAYEFLRPELRTIQPYGVQVDNRIYRGLPQDE
THILGELANLPSPYGRHRWPVYSDPDDIRYVYVRHPDNRRWHTLTWELAD
ALNMPMSDERLSYLRRQAAQQHEEFDDRLILDELLSGWNLSMGTSTTEKR
IALRMSRPHATLSYQIQQIGPRPSRPETGQLAPDTAPEPLLAQGTSAIAA
DIQIEGTAARCRAAAQASDDDDDDELDDFYAGALEEA
169631965YP_001705614.1 hypothetical protein MAB_4892c [Mycobacterium abscessus ATCC 19977]MSPQPRRNLQNITLIRKEGWRDFVVAAPRRQPEQLTTAELAVLSPRAAAQ
YNTRRADWHANMGVLKTHQLKAVQEMLDLILESNQQDGDKAKDAIALSAS
AGLGKTTAVEDFGKKYHLSQIQTHGPRTTGGHERWPVCRITLTGSTTIRD
FNRALLEFFAHPGADRGTAAQYLRRALDCFLSCQVRLLIVDDVHFLQPRS
RNGVEVSNHFKFITSEFPVTLLLVGIGLENIGLFPRGVDHTLAQTGRRTT
ILTMDPYTDTGEQWRALLLAIEQRLVLANKHQGMLADTLSDYVYRRTGGH
IGSLMTLINRGSLHAIRTGTEALTEELLDAVPIDFAAEGQRGAREAAHRN
STRRLRRQ
169631964YP_001705613.1 hypothetical protein MAB_4891c [Mycobacterium abscessus ATCC 19977]MTRTLPIRVEPIAGESLQSWLTALAHRNDVTWTQILRAVGLHHHSRDTGR
CGWTVRLHPHELQGMAEATEIEPAVLQQMTLARFEYVGITLGRKPHLIDM
GGIRDYASRSRYCPHCLNDTQGRWQLHWRLGWSFACLTHRCLLAHTCPHC
QRPPRRLTPYAAAIPQPCCCEHRLQQQPHVQICGKDLRRSPAVILDGDDA
ILHAQQCINTIIATGTADLGVYRNAPVAARIALADLKALATRLARQYSGS
GDEPGLQGEELCEIDPADDTLGARKVSAMQPALALTDALRVLSAPDVHTA
GRHLQTLIETIRRHGRAASATSTATWGISTSKTLTAVQLAAVSPWLSPSD
QIRYRVASSKPQRPQRPQLVLARIARAVPALLWPNWAIPMQPNNIEYESV
RAALSVATLLVGTRATLGQATQLLGSAITPAAVSRTLVQLRSSGHWTGIQ
NAVTDLAEHLADQHPVIDYQRRRALDYTNLLPDRQWARICRTTDADTRST
AAPLLRCLLFTELSGGPASAAPWFNRQPAFRRRLAELPSALTPDLHRQLH
CTAQEFLEEQHISEPVSAPPPNTVLDSGTLPGPNLDRIRPGAIHRRIQAG
STIRQTAQQLCLRTETVRYILETNPATPRPTNGPRALHQLIRLHDLKNGT
AALIRAHPATPPNITELARHAGASRQTLARMANALDTPLNPPGRPRSHRI
CQREWLQHHYIRDHRTIAEIAALAAVSPTTVRRWARYHHITLRSRGTASH
RAHGQLRRAARSYPARIRAALDSPGGHDRLTRFTQAMSYPTLHAAATALS
TTQPVLTQQINRLERELGVRLYQRARRGHPMTPTASGIELIKDWTR
169631963YP_001705612.1 hypothetical protein MAB_4890 [Mycobacterium abscessus ATCC 19977]MLYVRYESPVSNSRGENVGVFSIANDLAWSGRLSEIDWSWWRSNNDWLNA
AYADPATVDATLFDKAKNPAVSCWFKSTANHLLDRVPGYLALLERHGIAW
TVRRTSEPGRILYRDDVQVVVAPFR
169631962YP_001705611.1 GCN5-like N-acetyltransferase [Mycobacterium abscessus ATCC 19977]MALSITPADFQDIGLLRFLQAHLDDIAPTTPTESRHALDASGLQHPGVRV
WVARDGSDLVGIVALARISAQHEELKSMRTAPQRRGQGIASQLLLHALDD
AKRRDVTRISLETGSMEFFAPARALYRKHGFTECGPFGSYRQDPNSTFMT
TPIH
169631961YP_001705610.1 hypothetical protein MAB_4888 [Mycobacterium abscessus ATCC 19977]MPTRNQRLRTLTGSHIWPQHDRPSFIVRSWPRLVDHHFKWPSGMPEPQFI
RTHHMPTRLVTRREQEIDGSTAWTLMPTARNLEDHVAAPGLPIPAALRMW
GQPKDSCSIRNLFIYHRSLHNPGHKRPSALSQRLSLPQASSRHISNLSFG
RW
169631960YP_001705609.1 hypothetical protein MAB_4887 [Mycobacterium abscessus ATCC 19977]MTEREYGLAVPELIEIFCLTFLWLVVLVRIPTIRGRNERTMWSALLLGAT
SMSLQITFTYELAVHLVGRDLLGINRDIVADVIGLFAAAAIFSFVLKVVG
KDQYARLTYGAALVVTATLLLINHYFDQRTPTGSSQDSAAGTVYWLVLLL
YHFVANSWCSYICWRCFARTRSSPLRVALLFFSVGTAMAALYMLVSLIHF
FIPINSIARFFPLVRATEALLYGAAAAVPIVTSMSRWVRASAWLSQLYPL
WRDITKSVDGLTLHKPRGYLLYLFLACTDQRQGLYRKIIEIQDGILELKR
YVPAETLLAATHYVQAQNLGDNDVRAAATACWITSALHNRSQDHQTLADH
EDQPQQSASLSTEAAHLSKVAFFYSSPLPTQFGAFLRQAQNVPHTNQNPS
ITQA
169631959YP_001705608.1 hypothetical protein MAB_4886 [Mycobacterium abscessus ATCC 19977]METSLKQQCKSLARALDLCSAWTVSDLASRLSELRGRPLHIEALPHGQTG
PVPCGLWVATETTDYIFARQGASSLHHKHFVLHEVGHMICGHQGLDIPAG
LPALLPHLKPELIRRALARTTPYSTPQEREAEFFADLLYRSSAQNRTGRE
ADELARRAGGAMGIL
169631958YP_001705607.1 hypothetical protein MAB_4885 [Mycobacterium abscessus ATCC 19977]MSKPQEDGPLARKIDRLFDVIRRENGEQHSHEEVARACRESSGESFSATY
LWQLRTGRRDNPTKRHLEALAEFFQVPVAYFFDEQIGAEVDSELKFLGAL
RNAGVQHLALRALELSPAGLTTITDMLEVIAKRETDKAQ
169631957YP_001705606.1 hypothetical protein MAB_4884c [Mycobacterium abscessus ATCC 19977]MDNYMLRTVISGSYGKHFGQMIAIKKFLQGREIIVQAPVSEGIVDGTQDT
FILLDEDPVTDPRTLQDSVFAKIRSSTFLVVANVGGYLGRAAVLEMGYAV
ACGVQILTLEPVEDPNLGVYCRLLTDVFPDWATRHEVPALAANSAPTRSV
HEAELISAGNPSAQGR
169631956YP_001705605.1 exopolyphosphatase [Mycobacterium abscessus ATCC 19977]MDFILDVGSHSLKLYKLGATVELSETLTWDPWGGDVEGHAPNTLLKDLLF
RTQQRHPEHQITAFGTEAMRRDGELAGQVSASCGALGVPFRVISQDEEAA
LISAAFQAEGEYSHDIVNVGGGSIQMVLGASGIPQTWLLEFGIVDLNRGF
NLLSEPEARDVAGCREFVAASLPQDIRQFVYTGGELTYLRHFGVPLVDGY
CDRYAFADLADRLEQLSVGELVHDSPFDPNWMKGAIASNCIVLALLDHAG
LQRFVPSDLNIGHGLAAQIAETARTPDVSLPGAVSS
169631955YP_001705604.1 putative phosphatase [Mycobacterium abscessus ATCC 19977]MSRDAAPRHIVWDWNGTLLDDNPAMLDSVNAVCEHFGRPAIDMLTWQMAL
CRPLWRCYGKILECDLRAPQDWAVVENIYHQAYRRNVATCQAAADAHDAL
SRAKSIGMTQSVLSMGLHDDVTGQVHHFGLHEYFDRIDGVKDAVAGGTKS
SYLSTHLRDLDIDPEACVLIGDVVDDALAAQSVGAQCVLVTTGMTRRQEL
QETGHPVADNLTDAIATLLGDDQRLTAPRPFEEPVPR
169631954YP_001705603.1 major facilitator transporter [Mycobacterium abscessus ATCC 19977]MSAGVSLQDYRALLATPQHRWTLVWSAMARLPYAMISLVVLFYTQARSGS
FGWAGALAGAMLIGTALGAVLQGKIIDAAGPGKPLLTASAAFVLCVLLLA
LAVEHQWPGPCRLLCAFGVGMCQPNVAAASRALWGRVVTDPGYIKTGAAY
EALSLEAFFIIGPGLAGVFAIAGCTLTGLALCAALMAVGTIGFCRSALVR
RWPAPRQRSEQSSSHPAGLRQLFGHKGLRALMTAATGLGICLGGVEVAIP
AALRTQSSPGLGGLVLSGWTITSVLFALFYGTRPWPAEVSNRVPALLAAF
AALIAASAIPRAPLGACALILIAGTLIAVQPTTYSLALQHVVPNTQVAEG
FSWILTSMTVGAAVGQLVSGQIVEIFNARTALACVGLIGLGAAIAVALQR
AGLTEQHRQVRTGTFETTQDSTSSQ
169631953YP_001705602.1 amidophosphoribosyltransferase PurF [Mycobacterium abscessus ATCC 1MCWTNRTRSSHRRRAPTCGPNRAAPPGPHRDVRDHARFHQFTVTRKSGFE
MAGILALATAAGSGIEPAEQTGLIGQIIAQLAHRGQRGFSLIAQQVSGTE
SGYFSELPAANLDQGAIAEGLGGQRMRALLGHVHQTRADMNNQPFSSDQP
VTGAQPRRPFALHVAMDGGIVNTSELAQELSAAGVKISAGSDVEILTRVV
EQICVSKYVNRGLRPDYAEVFREIDLKVDGAVSAVLVDDAGVVVAYRNWQ
GLRPLSVWQRPEVIAVASEIDSAAAETGSILELQASQIAVIESAGGGQIQ
VQFVGRAAHRPKKCVFETLYLGHPRTRFHGETHWETRRKIGFELGALLGQ
TLAGTEDLIVASMPKTGIPYADGLFEYLQTHAPKNAVVREELVKIGLAQR
TLIGIPGERKALIERKYSLRDVDVTGRNVIVVDEALIRGDTSRAVAQLLF
DAGARSVHWVVGSPPFISPSYYGLGVNSLEELIFWQIWSSLALKPERPWL
ELNSRDPQLLSFFESLVATDIGVTRVTYLPFHRLTRVLPGGEYDYDCSPF
TFRMPTPIGQVRADEEYLQILEQRCAPEEMVG
169631952YP_001705601.1 putative phosphatase [Mycobacterium abscessus ATCC 19977]MPLTVVYDWNGTLLDDADAFTTSINTILTHFRRPEIDAETLREICEFPFS
RLYEKLGLPAAAQDNDNELFFGSYQPLAATSGLRIGAERALEAFKESADV
LILSNHIEHLIREHIALLGVESKIAHILAYASRESQYQGFTKGQMLQRYM
REQDISPQHTVIVGDTPEEIRIAQSLGLTSVAMTGGMASESRLRNAGADH
VVHDHDELLAVLTRENLL
169631951YP_001705600.1 3-hydroxyisobutyrate dehydrogenase/ 6-phosphogluconate dehydrogenasMTAATTLRIENKPHLSGQAVGLVGAGRMGTGIGLCLLRQGAKLRVIANKD
RSGTNELIDHGATESRSLAELADGCAVVVLSLPSSAQVENVCGQDGGLFG
ALSQGAVVLDTTTAWPQSTIALAQQAGALGIRFVDAPVTRSPEHARQGAL
NSMLGCTGDFRGLIDVVSAYSATITRVGPVGSAHQMKIVYNAMTMGISAV
VAEACQLAASMDVDLHTLRSIVSMGSTNSGIFQKITEYLLEEDTTVLSIS
LENAAKDIRLAVDAAAENKLSLRSLAAASETYQEACRAGLADKTLPNLAT
HSQKATRPELG
169631950YP_001705599.1 hypothetical protein MAB_4877c [Mycobacterium abscessus ATCC 19977]MECDTLVRQHHVALSQVRKDVAEAVLRTAALWESVFSDPSDMHGQLHCTS
VRGLLIKVRTDREAGVGLPDGERAPKSSLTTRCGQGMSAILDDGRGGEGI
RIRKAPSKVVAEHDRLVVYPSKQQREAALKLAQAEAQRAAERAAAKAGCD
RESEPEVINGQYTFGGEFDQLERKPTGYDWFVLWTLSPDSLHVLEVYLAA
VIGIDDSTNTVIVASTPLPKSVAQQGDTSDTDFEDFGKGGEEGTGPAPA
169631949YP_001705598.1 hypothetical protein MAB_4876c [Mycobacterium abscessus ATCC 19977]MTKTVEIFGLRVRQARLMRRLTAKHVMEAVGWSGARLSRLERSETAQVSE
GELAALMDVLRVPALFFTSVPVCRVEPDQLLFRAPKSTTETEKNRMAQFI
ALSGDFLLEMNGRHKLPPVQISAAPDPDPVSAALHARQCLGVDRDVPIGD
LTHLFERGGIPVVMRYERFGGSAPEDNSRGRLEKHLGCSTWVGEFRERPL
IVLRELDSWERTRWTLAHELGHLILHTNVAELTDDHEDQASRFASEFLAP
FAAVSQSVKAAPSLLNLLPVKQKWGISVGALLRHFHDSGALDTERYDMLR
TQLYTRINADTGFTWGRTEPGWDDRKPERPRLMSKWIEFAFGVSSPEALM
AHRVMWPLDMLQEFLVGQRMAVPATGAPRPPSPRGSGGVADFAAYRRRRA
169631948YP_001705597.1 putative transposase/phage integrase [Mycobacterium abscessus ATCC MARVQRVLDAADGSRWYTVVGADHLPVAPVAEYIAFLRDDQASPHTVRAY
AAGLAAWWTLLEHTGTGWTQISTSLFGGFLTYLRTGDLPGTARVGPEGSG
LAAATVQQRAAAVLAFYRYHAHAHNLDVPYQKLYGSLGKRGRSRYVPMLA
GVGRRPRRDRPIYRVRGENARRTPILLPVQVQLILDACAIQDTDGQWSGS
QAGLRDRLLFATLAETGMRLGEALSLRHQDFCIGAGGTPWIDVAARQDHP
HGVRVKGQPRRIYVGDDLEALYSAYVWQLVDAGADMTVPDLNNHFVFVNR
AGGTLFAPLRPETVYAKVRSVNRSAKDLLPAGWSPHWLRHTHASALLASG
VPTHVVMRRLGHLDIQTTLSIYGWVTEDIAMRTAAQWKNYAAGWKGLHDA
PN
169631947YP_001705596.1 putative transposase/phage integrase [Mycobacterium abscessus ATCC MPPTDPPPTGQLDPRYAENPAWEQQWAKVPAAWRAPVYQIDTAPFNEVFV
QNRYYTTATPGYDGYDFTPPGPPRFAHELAWWVYTCWREGLRRIDPAKIV
WFTQALPEAAAEYRRRRGRSPASLLDITVPDIVRHATVLFEQRRHRLPTP
SYRRNLEWTVEHLHTLLAVRCTPAPWWSYDTWDLRIDPRIPQREHEPHHE
RVLKLAGIQPVWLREGLRFWMRTAITHQLFTWTTAVSRCQTLGRHLGLFC
QHNNYRDDPLITADPEQLRAVFMDFLTYLRSPEATTKSGTLSDYLVAEIQ
YQVQAFYTFMHDHGAEAAAATGEKRWKKLGISHTRLWAPAYLPRKTHRSR
ELTWYSTADLQRMLAYLEVLGADTEERVVLTHPDGQISVMAGLGDPQAAR
AWLLQAMTGRRASEILMLDHDPLQAIPGAAAPAGADTGIFVARLRYQQTK
VAGVDPTILVEQQIVDVIREQQRWLSRHYPGMKPKYLFVGMVHQHQGQRA
RPYTSYLNALKKLDGVHRLVDTQGNPLRFSQTHRLRHTRATELLNDGVPF
HVVQRYLGHKSPEMTARYAATLAATSEAEFLKHKKIGAMGADIAISPSDI
YEMTQLGKRTDRVLPNGVCLLPPLKSCDKGNACLSCGHFATDATHLADLR
DQLTATETLLAGRRQQFADRTGRELTDDNVWVSERLREIASLQAIITRLS
DQANTLAHNRSGDIAVAGPATAGRRPQLPILTRGAHETTINHASGHRHCD
D
169631946YP_001705595.1 hypothetical protein MAB_4873c [Mycobacterium abscessus ATCC 19977]MTDRSPGTDGLRRHAQQRSDDARRRIDKAIRDLRKRGEPINVNAVARTAR
VTRKTIYAHSDLLERIRAHTPLHLAAPTPPAPDSQNSIVAALRRQLTTQQ
TQLANLKAELKAREDALAAAHGEIARLSNGQR
169631945YP_001705594.1 hypothetical protein MAB_4872 [Mycobacterium abscessus ATCC 19977]MATVWVSSTSADVDVDEDRPGDHWQRVGVIDTSAQRDFYTYIQQYIGVRK
TTKGKPEFYLSGDPESAWVQQVKENVGAQLPFWILINPYGSGQIHYSSGS
IKYLLGADKATLVHSLVPRAPEPHPGLLVTPVALAVKLKRRAGDLFTPCR
TR
169631944YP_001705593.1 hypothetical protein MAB_4871 [Mycobacterium abscessus ATCC 19977]MTQEELALRSGVTRNVLIDVEHGRRGLLYERLFDIADALQVRVGALVEGT
ED
169631943YP_001705592.1 hypothetical protein MAB_4870c [Mycobacterium abscessus ATCC 19977]MFETDSDFDPDFGPEETVSSLALDVIDELRMKMLECLLVLHTLPDEADLN
FADLANDILAAHRGTQEAYQAASILHQGAELDERWGNNLSRPKAIFARHN
AAVRQGATKVVPVPALCDRLERHLYQLPRPDRTQTAAAARPKCSGMVKTT
GEDCTNSAIYLGAGMFGAHCYSHATPTERERYRVHHEENDARQARSHTDL
RNLQRAVGEKIAAHWISTREQRAQWVNDIVPN
169631942YP_001705591.1 hypothetical protein MAB_4869 [Mycobacterium abscessus ATCC 19977]MMSTRKDRALRVVHNTQDVQSTVHLGQVLRGHRERAKLTQEQAAVRAGIT
RGALAALEKKQFPDPHLSTLLALMLTYRLGSLEALLGPSHSEVLAATWHA
QGWQGGKPSAPEARGPWGQGS
169631941YP_001705590.1 hypothetical protein MAB_4868c [Mycobacterium abscessus ATCC 19977]MMGSSTVDDTLDNQMRAASAGLVASDAVIALGRALRGSDLQPRETAVLTG
LAKGFGQEADLLTGSRPRPRTADGGYMRSAHALAGATILDGPHLRSLEDI
KDLDQKTQVIEIFRSLSQVLDKVASGNRSDADHISWARDVLRDLSDTMNA
RLTSSGESAEFFE
169631940YP_001705589.1 dCTP deaminase/DeoxyUTP pyrophosphatase [Mycobacterium abscessus ATMDDSVRVQVLAEIFISRIAWFSEKIERAQIDTPRRSTGHRRVFELFNEYV
DQVRARVNEDLAADDIEPTDLARQLRLLMTQFVGLHRTFDDLFSRDRSRV
PQSLPFFVQEACRQWELPAADTVITVGKPGNFTTRNRSSWNTMFLYGSPS
NILSIAVPEHEGTQARWLPITLGHELAHHYLLAGNIPELEEIEAQIAEQF
AAALKGEDGQGAESTFADQWRAEEVLHEWVEELVCDAYAVDLFGPAAVAA
SLEFLHSLGDPSAPTKTHPPTLFRAELMLAWLADVTAGAPDHGTLSLQYL
GDEKITHPQSALLCDAIRTQSQAIWDAVRSWSKERSYCATEREPHVDALA
RLLSQGIPGAFTPDTPHDVIDIVNAYWRARSAGTQFPIDRLALKAIDDLY
FIKLWTSADGAIHEDHVSCDWVGGPGVLTNADFRTRINNGDDNQISITPM
LPGALGPASVDLRLSNQFIVFEQTSNASFNALEMLQDPRSMQSRLEKDWG
DEFYLHPGQMVLASTLEYIVLPSDLCAQVITRSSYGRLGLLSATAVQVHP
GFRGCLTLELVNLGKMPLAITPGERVAQLMFFGVSSPHAPAAETARKYEC
PTGPEFSKIKTDPELNTLRNIRNYSTRTTTAVNVEATRGRPEKSQGETGG
NTRG
169631939YP_001705588.1 hypothetical protein MAB_4866c [Mycobacterium abscessus ATCC 19977]MGTPEVDQLLAAPDSELYAAVGRAVDKSAADDGSAENAGEQYFRSNLPKF
AQKICADPHVTALRRSYADGTTLVAAIADALGTLAGLPAVLSISVLVLRY
GLDKLCGIPPAQT
169631938YP_001705587.1 putative pyridine nucleotide-disulfide oxidoreductase [MycobacteriuMSPRHVIAIGGSDAGISAALRIRELDPTTDVTVVVADDYPNFSICGIPYY
VSGEVTHWSNLAHRTAADLAATGMRVLTSTRATAINAAAHTLDVLDPHGN
PQQLSYDALIVGTGAVSARPPITGLTGPDALGPADGVHLLHSMGDTFEVM
DSLTTRDPKTAVIIGAGYIGLEMAEGLTARGIKVTQIEALPEVLPTVDPE
LGALVHTELQRHGVEVLTNTAVTAISRTDSDALTVTAVHDGQTLTRTVDF
VLVVVGVKPDVELAADAGAELGIKGSIVVDEAMRTNLPDVYAAGDCVHTH
HRLLGITWLPLGTTAHKQGRVAGENAIGGNARYAGSLGTQVVKIFDLVAA
RTGLREHEAVAADRGWVPVSTTSTPDDHKAYYPGATPISIRITGDATTGA
LLGAQLVGHRSAEISKRVDTYATALFHAMAVDALSELDLSYTPPLGSPWD
AVQVAAQNWVREHRSAQVIATA
169631937YP_001705586.1 putative arsenate reductase [Mycobacterium abscessus ATCC 19977]MTNDLTSGRIPAVLFVCVKNGGKSQMAAALMRQIAGDSVEVHSAGTAPGS
AVNALSAESLHEVGASTEGEYPKTIDPDLLARIDQVITLGREAKVEVPEG
VTLDNWDTDEPSERGIEGIERMRLVRDDIAGRVQQLHRQLTATAN
169631936YP_001705585.1 arsenic-transport integral membrane protein ArsC [Mycobacterium absMNATADTAEHPAVAGKLSTLDRFLPVWIGVAMAAGLLLGRNVPGLNTALE
KVQVDGISLPIALGLLIMMYPVLAKVRYDRLDTVTGDRKLLLGSLVLNWV
LGPALMFALAWLLLPDLPEYRTGLIIVGLARCIAMVIIWNDLACGDREAA
AVLVALNSVFQVVMFAVLGWFYLSVLPGWLHLPQTEISTSPWQIAKSVLI
FLGIPLLAGYLSRSIGERTRGRDWYESKFLPVIGPWALYGLLFTIVILFA
LQGDQITSKPWDVARIALPLLAYFAIMWGGGYLLGAAMGLGYARTTTLAF
TAAGNNFELAIAVAIATYGATSGQALAGVVGPLIEVPVLVALVYVSLALR
GRFTPAPQHNSPAASTAASTTNVTE
169631935YP_001705584.1 ArsR family transcriptional regulator [Mycobacterium abscessus ATCCMSNQLVIEPVNIRCSPLVREPISAGQAVDLAKVFKALGDPVRLRLFSLIA
SHAGGEACVCDISPGIEVSQPTISHHLKVLRNAGLLASERRASWVYYQVV
PEVLDALAGIVRIPDTTISATPTEGPS
169631934YP_001705583.1 ArsR family transcriptional regulator [Mycobacterium abscessus ATCCMPKALPVIDVSAPICCPPLSAAPMGEDVAVELALRLKALADPTRLRLLSI
LLTASDGEVCGCDLASAVGLTEATVSHHLSQLKKAGLAASEKRGLNVFHR
ANPQAIEALRGVLMTCC
169631933YP_001705582.1 hypothetical protein MAB_4860c [Mycobacterium abscessus ATCC 19977]MRSRVDSARPSVWTPADFPDESAWSFPLSGADRNILIAYGRGQIEDLSAH
LGGAAAQWIELLHQGPGFVRLRGFPIHELTDTQIEHAYLGLGQLLGRPVG
QDRHANLLTHIRDEQIGAEPGVRKYRTNLRQDFHSDGSDLVGLLCLRPAK
TGGESKIVSAHAVYNEMLDRAPHLVEVMYRPMPWDRNNEQPVGEPPFFEL
PPIIEIDGIPRVFFIAWYIRDSQRHPGAPRLTGGQRQALALAEIIANDPA
FHIQMQFAPGDVQLLNNTTVLHSREEYTDHDDLALRRHLLRLWLTTDSAA
THEILRGGIPMQKAN
169631932YP_001705581.1 hypothetical protein MAB_4859 [Mycobacterium abscessus ATCC 19977]MSIAVCLLLYSVAVLIFGPRLLRRLTRTGYAPRLAITAWLAAIVSVLGTW
ISAAALIVIDVVRHWNSPAVVLAACAARLHAMLIGQAGAAAQVGLLALSA
AGSIAAPALGVRLARTLIRLRDTAHEHAYAVHMVGRRTAEGDVMVLEAPE
AAAYCVAGRPSAIVLTTGALAVLDDAQVAAILAHERAHLAGHHPQLVSVL
RALADVFPRVRLMTDGSAQISRLLEMCADDSAARHHGRGVLLSGLMDLAG
TVPAAAVGAANVAVLDRAERLLTPPEPPARAWARIALTMCVAAISAGPLV
TIALATSGALLCSP
169631931YP_001705580.1 penicillinase repressor [Mycobacterium abscessus ATCC 19977]MVMDRVWSRGDETATTVREVFDELAAERDIAYTTVMSTMDNLHTKGWLER
EREGKAYRYWAALTREQHSARLMREALSGGGSPELVLTHFLEQISAEESE
RLRAVLRRPAKRARTK
169631930YP_001705579.1 hypothetical protein MAB_4857 [Mycobacterium abscessus ATCC 19977]MRVLRMIMMAAAAVLAMLAVSVPLANAAKNDCPHKMGSHQRLSDADGAVV
QEWTISGLRKSTDGVPGYPVAGQLWEATASVHAVTGSVTPLIPNLGAVSG
SQERYPALWQVASPYGIPAATIAQGHTATGKVYFDVTGEAPAMVTYQGGG
GSMAALMWCDEAAMKTMMAAMKSAPDADCPCCADMPAAKGGDDCCADKP
169631929YP_001705578.1 hypothetical protein MAB_4856c [Mycobacterium abscessus ATCC 19977]MTTQWQGGQMRHRMRRLAALLAAGLAAMAVLHCSGSVQVPLLTAGAVQLG
APIAAAVSGDADYPGMGSEHSSMHCLPAASVAIVGDGSGIWSVSDLTLAS
SASYRPLETPGLRAPPRPAQGGGALMYRLCVIRR
169631928YP_001705577.1 hypothetical protein MAB_4855c [Mycobacterium abscessus ATCC 19977]MLNTTFIRRTRFTAAALIGAAALAITASPTALAGPTGTPNALEVIAMLER
QGDTVIVSRTGNKPLQMCTVTSVREIQAQYWWTRPRVQNPKPTRRPNAVG
TQLIIRTMRVEIRC
169631927YP_001705576.1 ArsR family transcriptional regulator [Mycobacterium abscessus ATCCMTIKGSVVQSFAPVSLQAASALFHSLSDETRLAILRRLACGEARVVDLTG
ELGLAQSTVSAHLGCLRECGLVDYRPQGRSSVYRLARPEVLAVFTAAEDL
LAATGNAVALCPNYGHPDGHPETKRKVVR
169631926YP_001705575.1 cation-transporting ATPase G [Mycobacterium abscessus ATCC 19977]MSDACGCGHDEPATGDEVDGEREPERLWEVSELRFAAVAGVVLLAGYVVG
WTGGSHPVEIGLYAAALAIGAYTFVPSTLRRLARGKIGVGTLMTIAAIGA
VILGEVGEAAMLAFLFSISEGLEEYALARTRRGLRALLSLAPEEATVLRD
GTETTITATELQVGDTMLVRPGERVATDGTITAGRTALNTSAITGESVPV
EAGPGDEVFAGSINGNGVLQVRVSATAADNSLARIVAIVEAEQSRKGASQ
RLADRIAKPLVPAIMITAAAIAVLGSVFGDPLVWIERALVVLVAASPCAL
AISVPVTVVAAIGAASKLGVLVKGGAALEALGVVRTIALDKTGTLTANRP
TVIEVAATAGATGERVLSAAAALESRSEHPLAAAILAAAGSVDPADDVEA
VTSAGLTGRRGGHTLRLGRPGWIDPGSLAPDVARMQQGGATAVLVEEDGQ
LLGAIAVRDELRPEAAHVIAALHRSGYRVAMLTGDNAATATTLARQVGID
TVHADLRPEDKARIITELRQQHPTAMVGDGVNDAPALATADLGIAMGAMG
TDVAIETADVALMGEDLRHLTQALAHARRARTIMLQNVGLSLALIAVLIP
LALLGILGLAAVVAVHELAEIVVIANGVRAGRTQPLTAPEHANTPAAQLA
QQE
169631925YP_001705574.1 phosphate ABC transporter periplasmic-binding protein [MycobacteriuMKLNRFGAVLTLVASGALVLSACGSDNNASGSSGSGSGDPAGVSCGGKKS
LKASGSTAQANAMTRFVNAYEQACSGYTLNYTSNGSGAGVSEFLGKQTDI
GGSDSPLSKDKGEYDKAVQRCGSPAWNLPVVFGPLAVTYNLAGVDALVLD
GPTAAKIFNGAITTWNDPALAALNPGASLPAEPIHVVFRSDESGTTDNFQ
KYLNGASEGAWAKGAGKAFNGGVGEGAKGNEGTSAAIKNTPGAITYNEWS
FAKAQNLSVAKIVTSAGPDPVEISVDTVGKTIAGATIKGEGHDLVLDTTS
FYKPTQAGAYPIVLATYEIVCSKYPDADTATAVKAFLKSTIGPGQKGLSD
NGYIPLPDAFGSKLSDAVGAIA
169631924YP_001705573.1 phosphate ABC transporter permease [Mycobacterium abscessus ATCC 19MMVPEPNLSTSVRVPPTAAPARGQKPAMADQPTFSPPPSAIRPGSGRWGE
QLFKGLATAAGATIVSAIALIAIFLLIRAVPSLLADNANFLTSAEFSTTD
ENNLRFGIRDLFMVTVLSAVFALVIAVPVAIGIALFLTHYVPTRLARPFA
ALVDLLAAVPSIIFGLWGILVLANWLEPVAAFLNSTLGWLFLFDQGNVSL
AGGGTIFTAGVVLAVMILPIITSVSREVFRQTPTAQIEAAQALGATKWEV
VRMTVLPYGRSGVIAASMLGLGRALGETVAVLIILRSAAQPGTWSLFDGG
YTFASKIASAAAEFSAPLPTGAYIAAGFVLFALTFVVNAAARAIAGGKVN
G
169631923YP_001705572.1 phosphate ABC transporter permease [Mycobacterium abscessus ATCC 19MTSTLDEPIKTSTFHSVSTVRRIKNRVATTLFATAFGVALVPLAWVLFIV
LERGWQAVTTSGWWTRSLQGVLPEEFAGGIYHALYGTLVQAGIAAVLAIP
LGVMAAIYLVEYGRGTLAKLTTFMVDVLAGVPSIVAALFIFALWIATLGF
PQSALAVSLALVLLMLPVVVRSTEEMLKLVPDELREASYALGIAKWKTIV
KVVVPTALPGIISGILLSVARVIGETAPVLVLVGYARSINFDVFEGNMAS
LPLLIYTELINPQPAGQMRVWGAALTLIIVVAILMALAAVATRLLTRKR
169631922YP_001705571.1 phosphate ABC transporter ATP-binding protein [Mycobacterium abscesMAKRFDLKDVNIFYGDFHAVADVGLSVPPRSVTAFIGPSGCGKSTVLRSL
NRMHEVTAGARVQGSVLLDGEDIYGDGVDAVGVRRTIGMVFQRPNPFPTM
SIRDNVVAGLRLQGVRNSGALDEVAERSLQGANLWNEVKDRLDKPGGSLS
GGQQQRLCIARAIAVQPDVLLMDEPCSALDPISTLAIEDLIAELKQEFTI
VIVTHNMQQAARVSDQTAFFNLEATGKPGRLIEIDDTEKMFSNPGQKATE
DYISGRFG
169631921YP_001705570.1 putative response regulator [Mycobacterium abscessus ATCC 19977]MSIEARHTEGAAKLSEHRAGAAPSRGAIMLVDTDPQIAAGLSEQAAQIGI
STLWCRDGADALLHIGAEPPDVLVLAAHTDIINAAQITAAVRGRWQLPIL
IGAAPATDLIARKALAAGASAVITRPYDINAISPFVLGSEEQPGSGPAVY
IAGPIQVDRRGHETRVRDRDVQLTVRELELLVFLIEQHGRVASSEEISRA
VWGRPSDTNTVAVHVRRLREKLGDDPEHGEYIRTIRGAGYRLAPSISS
169631920YP_001705569.1 putative helicase [Mycobacterium abscessus ATCC 19977]MNTAMKSVGAESVAWRKAMAALRIFQSARGSAEVPRRFRVQGVDLGAWVY
TCRDRYWDGLLSAAHVAELQSVPGWSWGPVRPGTWRHAFDALARYATIHG
STLAPAEESVRQWSAAQRKSHTSGELCAARSALLETLPHWEWDLDQLRWH
DGMQAARQYAHKHGTISSAAPGTCVGGFGLGWWLQRCRQDHRAGTLPAPR
ATELEELPGWSWGRGEDSWERGMAALTRYVAQAGDACPSQHVVIDGVALG
VWVCDKRRRYRLGILPPHQAAALQGVAGWQWYPQEASWQRGLAALSEYVD
RHGGACPSSGCRVGAYPVGEWVRAQREAYRHGRLAARRAAQLQAVPGWCW
HHQDCPAGHCCATSPS
169631919YP_001705568.1 hypothetical protein MAB_4846 [Mycobacterium abscessus ATCC 19977]MNLHIDWMALGRVVALSAVVGVAIVAAFSVGVLGISRADTAVSDGIIDQP
RRMSGYLQAAVMHGLCIAAVAYGLYLLIPQFH
169631918YP_001705567.1 inorganic phosphate transporter [Mycobacterium abscessus ATCC 19977MDIPLLVLIVIVTALAFDFTNGFHDTANAMATSIATGALKPKVAVAVAAV
LNLVGAFLSTEVAKTISGGLVDDTKITTAVIFGGLTGAIVWNMLTWLLGI
PSSSSMALFGGLIGAVWIGSGANAVHFGAVISKVLIPAFASPVVAALVAA
AATYLAYRIVRSANGASVSRGFRVGQTVSASMVSLAHGTSDGQKTMGVIT
LTLIAAGQLHQGSGPPLWVVFSAGTAIAIGTYLGGWRIIQTMGHKLVRIE
APQGFSAETTSTVVLLVSSHAGFPLSTTQVCAGSILGAGLGKDRQSVRWS
VAWRMLLAWCFTLPASGIVGGIAARIANTGNTGVLVVAAVLIGTVTAIYL
INRRNAVTAATVNEVPAESAVPTTVA
169631917YP_001705566.1 ArsR family regulatory protein [Mycobacterium abscessus ATCC 19977]MATEGVEEGTPPDQGLLARVAVHAALADPTRLAIVEALSIGDASPTELQA
RLSIPSSNLLAHHLGVLQSAGVVHKRRSEGDRRRWYLRLIPQVLDSMCTT
SPTSVSRVVFVCTQNSARSQLAAAAWRAQSPIPAESAGTRPARRIHPEAI
ETARRHGLELAAAAPRRLDDVLQASDYLIVVCDNAHEELPAIITRSHWAI
QDPVPDGGTAVFDEVMTDIDSRIGRLAPRLIPAQAS
169631916YP_001705565.1 hypothetical protein MAB_4843 [Mycobacterium abscessus ATCC 19977]MIAWARAAHAAGHLLSSSPHSTGPEHRHWLRRAVAAAAAWVRGGYDQDAP
RWGFSPLIALNGPVSLTGGQLDQVVRNFRTCGNTHPDPVDVRVAICTVTG
TLPSPSQVAAVLHALGGQP
169631915YP_001705564.1 putative arsenate reductase ArsC [Mycobacterium abscessus ATCC 1997MTGQASTEPRQELTLDQVHALKTAATRLQQEFEGTFGTETIERFLQSSYG
QFAGRASVSRFLPLLAERFARQRLRALARVEGKSADGRPTVLFLCIHNAG
RSQMALGFFQAVAGDSAVAWSGGSEPGTEVNAIAIAAMAERGIDISGEYP
KPWTDEVVQAADVVVTMGCGDACPVFPGRRYLDWTLDDPTGLDVEGLRPI
RDEIERRVRHLVDELLGARQ
169631914YP_001705563.1 ArsR family transcriptional regulator [Mycobacterium abscessus ATCCMSSPAIPLAPAGAQACCSPLSGGILDSASAERIAQIFKALADPARVKLIS
LIAAAEGGQACLCDLTAPVGLSQPTVSHHMKMLVDTGLVHREQRGKWAYY
RLDAAAFGQLAQLITPPS
169631913YP_001705562.1 hypothetical protein MAB_4840c [Mycobacterium abscessus ATCC 19977]MSSDLPVVVIGAGPQGLAAAAHLLERGVEPLVLEAGAGPAAAVAEWGHVR
TFSPWPELVDGAAARLLTAQDWSAPEDGYPTGQDWVQLYLGPLAVALGDR
VRYSTAVTGVSRRGRDRLVSSGRAEQPFVIHTVDGQGRQQRLLARAVIDA
SGTWRSPNPVGADGLAAAGEQAAAAAGVLTYIPPAPELLRQWAGRHIVVV
GSGHSAMTAVIELAQVVRRDPATTLTWVLRRGISSDTFGGGTADELPQRG
ALGIRAKQAVDDGLASLVTGFRTEQIEATADQVVLVAEDGRTLAPADHVV
ALTGFRPDLSFLSEIRLELDPILQAPVRLAPEIDPNQHSCGSISPHGVTE
LAHPEPDFFVVGMKSYGRAPTFLAMTGYEQVRSVAAELAGDHEGARRVEL
VLPDTGVCGGAGLFDDPDSQGAGGCCGVASSPEPLTIGARPPQQ
169631912YP_001705561.1 MFS family transporter [Mycobacterium abscessus ATCC 19977]MSTAAVHAQPHSITGLRGVLITLCLTEITSWGVLYYAFPVLAPRITADTG
WSAPAVTAAFSAALVVAAAAGIGVGRWLDRHGPRWLMTAGSLWGPAALIG
VAMAPNYGWFLAAWLMAGIAMAAVFYPPAFAALTRWYGPGAVRALMVLTL
VAGLASTVFVPLTAVLASHMDWRTTYLALAVLLTIITVPAHIIGLRRPWP
SLPATHLAESPTRIARSRPFISLIIAFALASCASYAVIVNLVPLMNQRGL
DGTVAATALALGGVGQVIGRFGYPALAQCISVVPRTLLIMGVVAATTALL
GVFASAVSLIAVAVAAGMARGIMTLLQATAITERWGSTHYGHLSGLLTAP
IMLTTALAPFTGAALAQLLHGYPAMFVALGVAGIIGAAAATATNPSQ
169631911YP_001705560.1 putative acetyltransferase [Mycobacterium abscessus ATCC 19977]MHEAVTSSYGHLHPWMRWLAEPMTIEGAQAFIDSAARGWPTSSGDCNYGI
FDAREAVLGGLGLHDCVGPGALEIGYWCHVAHTGQGLITRCVAALTEAAL
ALPGVDRVEIRCDIANVRSVAVPKRLGYRLVERYERPVCTPAESGIGMVW
VKASHQ
169631910YP_001705559.1 phosphotransferase [Mycobacterium abscessus ATCC 19977]MLRAVDMHAGQVRITSSVVRGLIDAQFPQWRVQPIRPVQSVGTVNAIFRI
GSQFAARFPLQGEDPGAVLQQLQAESDAAAKLVGRTRFPTPEPVAIGSPG
PGYGLPWSVQTWLPGVVATGRDPGDSAGFARDLAEFVAGVRMISTGGKNF
EGPGRGGVIALHDEWMQMCFERSAGLLDVPRLRQVWAQMRELPRGSDVDV
TSHRDLIPGNMLVSGEGRLAGVLDAGGLGPADPALDLVGAWHLLDAAARK
VFRESLRPDELQWQRGRAWAFQQAMGLVWYYANSNPAMSRVGRRTLDRLL
ADSS
169631909YP_001705558.1 glycosyl transferase [Mycobacterium abscessus ATCC 19977]MAVVSVAAFVIWATPWRPASQLAPATDFAAGLASQAYGEFGWPELTATVT
SIYQELPAEQRRSAVIITERYIQASALDYYQSAAGLPAIFSPKRGFGYFG
APPDNAETVLWVGSTKADLQARFTTVVAAAKFGVRLGMPQVTRDITIWKC
TGPIQPWSTMWPIMQTL
169631908YP_001705557.1 hypothetical protein MAB_4835 [Mycobacterium abscessus ATCC 19977]MRVASENLVDKQLFACGVGLAIVTVMLGQLDFQIRVGANKVRVDTQRVPE
SELLVPSGTVVRQQV
169631907YP_001705556.1 hypothetical protein MAB_4834 [Mycobacterium abscessus ATCC 19977]MDIDVPTAQRQLTIAAAHQRLCRRELERAIYRAARHAGLTQRQISDIVGS
YSQATIQRIIRRMALDPSLLEESPTDTVDRRAAGLITDEEMMNKLLHRNY
GFGAAVRIDGVVTDAYARGTWDDIEMAYYQRLLTDDESHTLADYPLRT
169631906YP_001705555.1 hypothetical protein MAB_4833c [Mycobacterium abscessus ATCC 19977]MGIEDLIKNANAGQLALHMDDEAFSELIKACDVYRDQLERLYNDAKSLGH
HPLGFSEDHLSSGAALARKFQEKAAAPDNSAAATFKSHMERVDEFKSLFL
ASRAAYRQMEEDNARKFKPGDGH
169631905YP_001705554.1 hypothetical protein MAB_4832c [Mycobacterium abscessus ATCC 19977]MATNSWVLPVLALTAALTVSCSHSRIQPQDASTSTSTSTSAVATNTAGRA
KITFDPCSQIPASVIAQQKLDRLPPKPDRSADGDIENNRCGYLAQARYGV
SAVASNYTLEMDKKVDFHGDFKEFDINGRRALSFLIYKNDPTACAIDVEA
TTGTYGVNASSAMGTFGDFPDCLTAARAHLDAFLPYFPA
169631904YP_001705553.1 hypothetical protein MAB_4831c [Mycobacterium abscessus ATCC 19977]MHLSVDAVIPNVDRLGTVARDLEESLRQLVSNVEGVVGVSWTGDSAKLYE
ESWQEFREAASRIVGDAKEIESRVRGNVTQFLQQEAINASRLGGQ
169631903YP_001705552.1 hypothetical protein MAB_4830c [Mycobacterium abscessus ATCC 19977]MPRSQDPSGRYTFDADELDQLEADVKRWVTLAAESLATVEKVISELSDST
VWSGEANDAYQARHRDWLEKLKELRENASDMASWANTASQTYRKVIATNI
AMLGQGS
169631902YP_001705551.1 hypothetical protein MAB_4829c [Mycobacterium abscessus ATCC 19977]MPKVTVEPDWFFYTAACLGQAASSLAGAVSTATGDGGLLYSQKMAGNDAK
GSGWGTPYDASAKTVLHGAASLVSAWSSMAQKVHQAGVNHQFAEWEAGRR
GYPGPNSAPPKPPISSSVANTPPSAVGDNGPGLDDFIPGLVDAVGEPCPN
GDYEKLGRMAPAWTALGNAINRSGSEWIAKIHRPDPSMTDAMPFYDAIMK
LNEPANAIAGDAMQMASFTSTFGTAIHAFREASAKAIDDLVLIIGLIGVA
TVVGTRIAGKKAVQVGGRLTAREVGETGKEINGLIRALEPVVASMRTFVT
ALNPTMQGLLDQTTQFPAESYELQPDGTFKKTIRYFKLEKWMAWQRYLLR
GGDMDIDTWSDYYDRIRQNQADGDAFDKLAADVMGYDKGEGWTPQFGSKK
EDYDKVPLPGRHWDWGNPDLQQVAEHKKGKLDSDQMVTDREVLERTRWTV
TYNINANHQYTKAEEDWLAQMQKAFPGRFIVNRIEF
169631901YP_001705550.1 hypothetical protein MAB_4828c [Mycobacterium abscessus ATCC 19977]MAIEFPVEDCPEVAGIMYTEESLAVVENKLLSLYDNFRDALDEQHVHTTM
RYVYYIGETYRIAFEGTWAALPKAGAGADDNTPVVDLPFWETLLKPMESV
QAALNRRNGSELAGQYPYAQRDYLAWVEAGRPERTYRGTLREND
169631900YP_001705549.1 hypothetical protein MAB_4827c [Mycobacterium abscessus ATCC 19977]MGEIGKEQLPFARRSDKIGIVELADSPFEHAVAVVLDTSYFDSGHFHVEK
VTQFAKGLAHRGVQLWIPQQVVLEWAVHTMGLLSDLRRAQTRLRNAGLLR
WFGDDNLGRDAAEVAAGLQQRCERIPNVVVLPMNGAAAVAAVRDQILGTG
PGRVEKGIRTGAVDSSWVRDALVHLDGDHRKIIFLTKNGADVRAAGRALG
LEIRCWTGRLNSLFGNVFPITPIADGDQVTVLKTICTVLQLTLIGSSLGN
SRNHAAPPVWFETDNIDPGDDIHPRIQEHIEQLVDPYVQIDPPIKIIDVR
DIEVDNNGENTRTVRFAVRLLTDLRVDGRVIDDDGSLITLYDTDIMEDRL
LRVPLAAELTDDGLTILTQTESASSQAAEQRFDDGYDAYVWLYTEEICRW
EHITVHPLSEQTEGFSAPSSFQLRGPTGRTVIASLDEQFSLIQEWTLRFE
GLNVSISGRFDPGGRMWLGPDVYLYRDDPVYHRRPYGLKSEGQSADLNTD
EPYTALAVVWSFLLDTSAGLGR
169631899YP_001705548.1 hypothetical protein MAB_4826 [Mycobacterium abscessus ATCC 19977]MPLDLGRINPGKRAHLLEPRDIFAALPDKRWPRLRAEQGEVLKAWFARRT
ERDLVIKQNTGGGKTLVGLLIGQSSLNEGIGPVIYLVPDRYLITQVVDTA
EAVGIAVTTDVDEELFRAGRAICVATFDKLVNGRTVFGVRGRREITPLGT
VIVDDAHAALSAARQQFRPTLSANSEGYAKLLGLFAADLQRQSQRGYADL
AAGDRGTPLRVPPKAVVERTAEVMAILRPLGEDHAVKSMFFGWPLISEDL
ALATITFTSRSVEIKTPCPRIDLIAAFADATRRVYLTATLADEGVLVTEL
GADARSVRKPITPDRASDLGDRLILAPQSINPDVDEKLVRQLVRDFADGD
RNGDGTLEADPVNVVVLVPGTERAKLWDQFANHTLNVNTMGPVIEQMTNG
EHVGVVVLINKYDGVDLPDGACRLLIIDGVPTPLSGSEQREAAALTGSLT
FESRKVQRLEQGMGRGIRDLQDYCAVLVLTREASLTLRDPKRLQFYSPVT
RAQIELSQQVADQIAAEGLEEIRNVLDIFLEREESWVSVSRAAVADVEYK
HDGAVDAHTEARRQAFDKAVAGDLSTAVQLLRSGIDTLTDELETGWAMEE
LAGYQQHVDPAGSQKTLVGARLRNPGALKAEVPPEPRRTKGPAQQAEAAA
TYLGAQYDDPVALRLSVGSLFDNIVWAVPETHDLAEDQFRLLGLHLGFAS
SRPDREENDGGPDVLWGLSPEANAVIELKTEITRKDPVIHKLDEAGQLLT
SLEWDARRNPGATSRIPVIVHPSAVLSPNASLPPHTRVITKQDLADLRVD
VENFVKDLVAVGRWSHPATVREALVRNRLTAATVISAHSTAISTS
169631898YP_001705547.1 hypothetical protein MAB_4825c [Mycobacterium abscessus ATCC 19977]MQPDGRWERLRQIAANQFGLFTAHQARALRVRRYELSRMADAGQLWRARH
GVYAFTDESADKYPYEDWAAQWLALRPAADVGERRGDPDVVISHQSAAEI
LDLGTIVSHDILHLSGPRRINVRSARVLAHRQPVGECDADWQLVEGLPVA
TAPRVIEDLAAAHIDGSHLGIAIEDALHRGLADVDDIHARLDRHANTWNA
RNGTELALRLLTSAGRH
169631897YP_001705546.1 hypothetical protein MAB_4824c [Mycobacterium abscessus ATCC 19977]MVAAGWLTPDRGGGDVLYEPWTSTQDPLLTYGLAAVTDTLRNDGRAAFQG
GQALYEPVHWLRFYRLQAAYMLACSILERIAFRLAPNAGPTTKVNILGRQ
PQFMSAVQSAGVPIPRRAVYRADNPRERVNLNKADQFANWAYQIRSNLVH
RGKSASLEAELVRTALIDLHDVLRIYLQAAIPSISDTWMHADPTDSIRDW
RIKTEFNAPPDN
169631896YP_001705545.1 hypothetical protein MAB_4823c [Mycobacterium abscessus ATCC 19977]MLEEYCNVFTSMVGSAFKGPIWLIDGYAGPGWYQSDDNTARVPGSPIVAA
RLAQRWRTTGKRDLRCIFIEANPAYFCSLREGLTEFAQDSAILVPLNGEV
QERLDEAWKCVNGAPTITFLDPFGIAMPNHLVTDVLLSRTRQQAPSEVLL
NINLEAVWRLGGCLQERDGQIVAKTRQEKGVERVDRFFGDIWWRREFYEA
RNANGASAAAAATAVVEQYRRRITDATGCLSISIPVRRRHGNPPLFHLTL
FYRHPVAGYKFADAARRATRKWRDTFRAKELADATLPVEGTLFDLTEQIQ
ESREKEAAAQERAFADSWIAVISANIKELVAEHRVLPVAENVVPILGATL
SLAGEPELRRAWDQLSETGIVLPRNKSKALYQQSLCATP
169631895YP_001705544.1 hypothetical protein MAB_4822 [Mycobacterium abscessus ATCC 19977]MRRSTGIEWTEVTWNPTTGCDRVSTGCDNCYALAMAKRLKAMGSARYQVD
GDPRTSGPGFALQIHPDALDQPYKWSGNRTVFVNSMSDLFHAKVPLDFVR
SVFEVIEDTPRHTYQVLTKRSARLPKIANKLRWPENLWLGVSVEDRRHLD
RIDHLRQVPAAVRFLSCEPLLGPLNGLNLSGIGWVITGGESGPKARPLDE
QWVRDIRDACIENGVPFFHKQWGGRTPKERGRVLDGMVWDEMPQKSTA
169631894YP_001705543.1 hypothetical protein MAB_4821c [Mycobacterium abscessus ATCC 19977]MTDELTALRRMSREAFRQDYRLEVMLAVGRSTDGLVCLSDLAAAVGTSTS
NVQGPLRSLIALGLLTPLPRSDSKRRHMLRNPSAAWQWAEELAVLADSQT
DSPGTNQLR
169631893YP_001705542.1 hypothetical protein MAB_4820 [Mycobacterium abscessus ATCC 19977]MNDIALQHICEVCGIQATLTPSQAFKAGWDYPPHMGTFAVIGPRVCPACP
CTGTVWWAIAVDGLTLDMLSQAQCATVERILGEPGSIAVASPG
169631892YP_001705541.1 hypothetical protein MAB_4819c [Mycobacterium abscessus ATCC 19977]MQLEIDVIHRPTTAYHAPVLIPFDHPHTELRAGGTTLYRVVGEVPSSQKA
ETANL
169631891YP_001705540.1 hypothetical protein MAB_4818 [Mycobacterium abscessus ATCC 19977]MANETLDDADDQWLHDLKCARAEKSYFALTLGANRRGKPFWARQTHFVGW
SERNPRWEIREASLVDAGWMTQLWNEIGQTWIVVHDDRALAVFLRWGGMR
WLRRNSPRIAYPM
169631890YP_001705539.1 hypothetical protein MAB_4817 [Mycobacterium abscessus ATCC 19977]MSRPLISVVSDETQAARMSISGLLVGSPIYDPAMPRLGGFPQRRSLDSDA
LFESAMGSEAGVMQRSLPPGPERDALLAKIFEAAQASAGDLPALIEELRG
LMVGRDLTQLINSVVVPATTVAYTDGESLADGDATSSWAAKIEYLVGVAL
SVDPEGDTDTPPQVSQRVRQLISDIFEADQLNMLTDGLAHADRGDGHREL
LLQQLRLEYQVDRMPGYAVHLEEVDTEVFGRHRDYYVNGLGFDPADVIRV
TRRRACWLNQTFKSALDALEDVLNGGVPNPMAEETMRKGLDAPTLWDPDD
VAACTDIPVEQIIAMLEFFSVEFGCQPEFRAPRDANRVRTHPVIKLDDGT
YLVPDSWSMSAVLHHRLAVEPKRSGYDPQKYFKHRQDAHERLIASTLTNV
FGTSNVHPSQHYTLASGDNGEIDALVCAEWPLVVEAKAIALTERGRRGYT
DRVDKKLQEILGKALEQTDRALTYILDENGRSFASKQGGPQISLLPADIA
GGTAIIITFERIDPFAFGGLAVAGDVNRPTWVISLTDLLMVAEILSDPAA
FHHYAHTRARMYSAEASVFSEADALGAYLLNRLRIVDQSTSEGSPRIFIG
YSCAEINDFYTRQEIGLEADRPTTGIPDEVTDALTNALRQPGWAECLDAV
MVVDSSRWKKWKRFWGKHRRGGDFALNDQVSLVSLPDGQSSLERIDGTIR
LNIPSRR
169631889YP_001705538.1 hypothetical protein MAB_4816c [Mycobacterium abscessus ATCC 19977]MSDLVLHREALAMNTPELVTALADQLGFKLVAYLGKVKETRAAKQWAEGT
RELANAEDIERLRLAFHAASLIMSRGPSSVAQAWFQGLNPALGDASPARL
LREGDIEAVGPRILSAARQFATAG
169631888YP_001705537.1 hypothetical protein MAB_4815 [Mycobacterium abscessus ATCC 19977]MSNNDLVVVIPGIGGSTLERGTIPLWSTKPGKLITALTVLTTHLQTLQLP
DGIGDEAPDDGVRAGTAISSLHVIPGLWSPAHGYQRLVRHLQPLFMPTKR
HARGYAITNPLVFPYDWRLSNRYTARQLKVFVERALGQWREYAPENRDAQ
VVFVCHSMGGLVARWYISCEGGAELTRKLITLGTPHRGALKALAVLTEGP
LPQLGRFGEWLHQTAISFPSIAQLLPSYACVNGEHGPEYLVDQLCSPLPT
RCIKDSARFYQELEVAEDADSGSRSRTHVIIGGSQNTAVSATLSGGRYRY
SLLLDGIEPGGDGTVSAASVPKGIALDSNSIRRIADKHGNLHCNKAAIYE
IESIITAAPIMIKSFASQDLSVCTPELVSADQRFSATITSPSGRCAVEIA
LYDERNTQVERLVKTIGTDPTVYTTDPLKPGGYTCTVRKTNDPLSGVTSP
FLVWARH
169631887YP_001705536.1 hypothetical protein MAB_4814 [Mycobacterium abscessus ATCC 19977]MSIEGTESLFLGFGMQTYCNQRLNELGGTAAEVHQVSQLVGDHFTPVVLQ
DATETQVRQELRSRAGYFSAGEGKLVMMWSGHGREGAGDDLYLLSHDDPT
IAGHVLTANEVAGHCAATGANQMLFIIDTCYSGRALSVGSRIDEYFRDHP
AASAATWCGVLVACGPRDAARTRVLGEAIVRLLRYGPRLDGPHAQDVRRR
WTVHQELIRGDDLCWTLIKELEQLQVEPLPTFDAIGHFPLPMIRNPLWRP
AATAATVREVLTATPSRRPFFGRRRAVSTISEWIEASHYGIYLITGGPGA
GKSALLAQTLRQVRTSSDRRSVAVSVNVSNLNLNRIVVCLEQALVDVGVL
DSLSHGRNPLELSGALKRLVDDGEPVPVVGIDGLDQATDVSRVIDELLTP
LSRAARVVVAARPIQVPSPQQRQVARPGEWSVQADHMPIAAVLTEPQRML
DLDASEQRASGWQAIKDLLKSRLAEIDTDIDHAAVFDALQRALEAGSTPP
FVLANLVVDRLRTASPGVGTHGFDIAESVGAALDDLVALSYNDAAPTRRA
KCLLQTLAFGLGAGLPEAEWLAIANGVSWLSEQLSREDIADVLAALSDYI
VEDSESGYATYRFSHALITQHFANQARAHDESAPLRVAAALTAAARALNP
APHLTNSPHLRRYLWCYVAQAAEPGLDLLRGNPLFAMDLVAAALAVSAAR
AQQRQLPEATHLAEEAVTLLTDLDHTTELDEVLPRVHLAAVQHAGGEITN
AVENQRRAVEIIDQHGVAGSWQNFDHPAILCNYANMLIDAQRPDTAITAA
RQAVELEEKSKRVGANNGHRLGAAHNTLSLAYNLARRHSEAVAASRDAVR
ALENSVSERDNALLAQALQNLGSRLADVGKCDEALNVTERSRRIARELTQ
VNPIWREVLLGVLGDLAVRHEQCGYQEQALALMATVVEEYSAVSLPTAHQ
AIDRARALSNYSHMLQQQDRSTAALKPAYEAVQIMEELAAREKAHQPALA
LTLNNYANALTKAGHHTLAMQATENALWYYRQAWQTNLGLNVELAKILCN
YSHRLAAAARFTDAINAASEAITVLQPTAADDPQKQAIVFGAQADINDYR
RQLGLPGQNASVTRNVTQQAVALAVTGAMSPSQLADLYTQTARSCADDPA
QALDHLEHAVAVLREAGMSNTSMYGRALRNTAMMLGETQQLESALNAASE
AVLVFSRLAQADSSHRYALASAQGTQAKLLQAARCPTQARDTAIESLDNF
CRVPQWTFEEVVECGRLLALLASILSDLGHGLAVLDAHVQRCASRLHGYL
YMVLHANVIHGLPASHPRTPRWIYEAISAIDVADPKQRFGLGQLARPIRS
TDPARFDELWQQDTGVDIPKWITIDDDKVQLALAWISCQNYTAAADFLQQ
HPELLGDDFTAAIDEVYALITTVEPARVDALRTIRELPHTSVAFDLAEAF
LAANLRHRLQMLNEHSTSLRVDWVNQHLQKRVDSPRLPAAAALLALHDLG
LGNQINAVITAVDRAEQLLTQLTVQYGTAIVLLVTTVLLDISSADATPEV
RITASFYVAAGLVDAGLLKQARELITTICQRAPHRVLAWKELCNSLSGVC
PHFPRVAALLDQSVGANE
169631886YP_001705535.1 hypothetical protein MAB_4813c [Mycobacterium abscessus ATCC 19977]MSSYRRRNWTPYGMAHILDESRQSVTRYLQFLRQEKDMGLDPRLVPMRAG
IELMSASPTLYWMNKTAVDVAAGLAARGVPDHTTEEVLASAKVSAHGFLC
FASPLGQWRWLTASDGKPREVTWDGLCWGHIYDRRRKTRRFSVEILSRMS
GQRSLISDVRGDAPLIGVGGFNFDSDEAMWEKNITSIDPTGPALTPAEYS
HGAALITSVLLTMGQPRMTSQTALGAADGVGAPRSSTDEPPKPPEVILID
LLRPPGTTARGAGLQSRDHDFRWWVCGYWRMQPCGPGNIERKLVYVRPHT
KGPADKPLVNPTRVYVVRPDPPNDLTGIVGQ
169631885YP_001705534.1 hypothetical protein MAB_4812c [Mycobacterium abscessus ATCC 19977]MTSGIDNWRDSFVESVVRMAASPEIQISYLQELGVGTDELALEFDSLYVP
ERLSLTDRQSVYAVDLDRLLTAMSEAPDVGQWSYEGLQSDDRWAEVRLLA
AELLASLRVSE
169631884YP_001705533.1 resolvase [Mycobacterium abscessus ATCC 19977]MPLQTSTTPWRHRNRMVHLACHLAQIPETQLDGVALDRVFIDQVSGKDAS
RPQLEAALAYVREGDTLVVHSMHRLARNLEDLRRPVRSRMRAAVSLSASL
APCSRGVGMSRDYWARLGCAAVFVLL
169631883YP_001705532.1 hypothetical protein MAB_4810c [Mycobacterium abscessus ATCC 19977]MTDTDREGSARYHGDEDPTQTLPTAPVPAPELAGVGAGIVGAVLTAVGVW
GLHVLTRGDGVAGAAGWVILLCLAFSALGKGIGLLRRALAPVSAVLSASV
APIPAPTRAVAGIGVGAAGLWSVLRGHAATWWAQLTGTDMTGTDAAWSLP
SQLAQVAIVAIAGVLLFGGAKVLGQLIFANSGTRQQHSLGNNNARDRWST
WWSSHVGLGLSLLAGAAALVLLSGYVVPRVSGWLTGDDPMAALAAIAAIL
SVAFLANTWWWRALSGWWTWAHTPNGPGGATPIGQIYAGAGVLALVAFSA
TAFGLATFSSYLPQTAAVASADPCGPDGCGGGGNGQGSYGPDTGNFQPPQ
MPNQMPDYQGGINQPPLDQNSGISIYNENPSAGQVPSQTGGQQSMQDPSF
RANPDGSWQARNGEWSPPNYQTATPGLTQGPGQPNPGWSGNQAPQINTPQ
QPVQQAPQAPQPAQQAPQQPAQAPQNPAGQQPVEQAPQQPAQQNWPQTGQ
NQTGQTQPGQQPQKEPEAPKKNPMDPTDLASAATRRGSQQAGEQAGQQAV
QQGTQQATQQAPKSTAQTQQAPQSTQQGQQTPKPAQQSQQAPQQTKPTNG
KPKGIDGAAKGAPEEQPWDVTGEVKPIHQEFPNGSQKVGVEGRYGLQNKD
PISLGESNVGQFDLGSSLQQKFGVEGEVSSMVNPPESGSNLLVPKAEAFA
GYNLENKNVIFGPGVQGTITNTLKVGPSLSKGATTGTPIGANAVFQNLGN
GKFFINLPVSVPYKAVEVGSTIQGVVDVPQLIQGTLGQAGQWITSGIPSV
FGG
169631882YP_001705531.1 hypothetical protein MAB_4809c [Mycobacterium abscessus ATCC 19977]MATLELGLGGHAPVGWSVNLDAARRGDTYLSFTRDSELGQQIAPEITVSL
LEASGSVTPLDVLAHDRRAAISEIYSGVRLRRGEYISERDPQMYGQEIWF
ETEPSSGDRVAVIQSEILFTFTGLEPRVLSFLLTSPESVFEDCLLDFKAV
FDSITVQESE
169631881YP_001705530.1 hypothetical protein MAB_4808 [Mycobacterium abscessus ATCC 19977]MTRPSIDPVSAGADGWSRPWKSGSVLANSGGEDTFQYVELHIDYLIELVN
APLLPLIRGPFVEKPAAFERPSSVVHLQEDRTTPTPTSTSSSTHAPSIRA
WAAVSPEMMKPGVHAVPAWSKRLHHKTSGNALDAA
169631880YP_001705529.1 bacteriophage protein [Mycobacterium abscessus ATCC 19977]MPQTGPWTGDPVWIVDILRAEGVNPVEYPGWRGRGHGDFKDIRGVMVHHT
GSDSASAASIAEGRPDLAGPLSQLHIARNGAVTVVAVGVAWHAGVGMYPW
LPTNMGNWHLIGIECANTGTSPTAPHRQNWPDAQYSTLINCCAAINRRLA
QTSARTIGHKEYAGRAQGKWDPGAIDMDVLRRDIQDQIGRVAIPAPTPRP
SVPVGEYADVLLFRGSKGPQVSQLQRRLNEHGADLVVDGIFGPNTEASVR
EFQRRARGLKVDGIVGPATAAALRLKAEPALE
169631879YP_001705528.1 hypothetical protein MAB_4806c [Mycobacterium abscessus ATCC 19977]MVRTHTVVAGDTLWQLALRFYGDAELYRLIATASGISDPGAIGVGRRLVI
PDVTRYTVVAGDTLSALALRFYGDAELYRLIAAVNGISDPGAIGVGRRLV
IPDVTRYTVVAGDTLSALALRFYGDAELYRLIAAVNGIADPTALDAGRVL
LIFRGRSDGFGLTIVDRNEDDPRLWYYRFQTDAIGWNPGVNVLLPDDYRT
SGRTYPVLYMLHGGAADFRQFDFLGIRDLTAGRPIIVVMPDGGQAGWYCN
PVGSFVGPRNWETFHMAQLIPWIEANFRTYAEYDGRAVSGFSMGGFGALK
YAAKYYGHFASVSSHSGPASLRRDGGLVVHWANLSSAAVELGGATVYGVP
WDEARVSADNPVERIESYRNKRIFTVAGTSPDPVNWFDTVQETQVLAGQR
EFRGRLSDAGIPHEFREEPGGHVFRPDMFVLDLDGIIARLRPASASVAV
169631878YP_001705527.1 hypothetical protein MAB_4805 [Mycobacterium abscessus ATCC 19977]MGSWYSREVVSEHLNLYREIHADSFVAANIWHVRGPDRDMVVDTGLGVSS
LRREIPTLFQRDPVAYVSHWHLDHSGGAHEFDDVRVFETGVPQLLRPPPA
SLRRHGLQKDLGLPEVGADALLLSQLPAPTYNPDEYRVIPVPNVKGISDT
GVLDLGGKTQFRVVHLPGHTHDSSALFNERTGELFSGDVIYDDEGEGLLD
TTSDSSVAQYVASFQKLKQMDVQTTYPGHGRTLDRQTLRSMITQYLQKHA
169631877YP_001705526.1 hypothetical protein MAB_4804 [Mycobacterium abscessus ATCC 19977]MLTRIAAAGVLVLCGVFTNMFTAVAHADDVVVRDANGVPWSWSTEASCIK
DGPDQHLANNADDAFLKYWYCLQHDDGLWYLHNTDSPSERVG
169631876YP_001705525.1 hypothetical protein MAB_4803 [Mycobacterium abscessus ATCC 19977]MVEIIETLGSGPLRFFLTFHDGVATEDDRHETYRRRDLPASAWVGYVFLI
HREPALGMGRLIGIIAVGMVVNGALPLSINLYLHGVISRPFLDLLQLAIA
GLIPIVGALLEPRPERISSTPELQR
169631875YP_001705524.1 hypothetical protein MAB_4802 [Mycobacterium abscessus ATCC 19977]MDDFAPTRTLRFALVLTLASGFMDAYTYLARGGTFAITQTGNMVLFAVDA
ATRNWDDARAHVWPIPAFMLGIAMAARIEAGHARLAHPLRWAVGAQVAAL
VAIGFLPASTPHAFVTVPVAFLGAVQIGLFRTVGDLTYMPAATTGNLMRF
VQQIYDALTHRGSAAWQAARIYGVLISSFAGGAVAGAFATQEWDVHASWA
AAGISAAMLVMLIIDPMRTTD
169631874YP_001705523.1 twin-arginine translocation pathway [Mycobacterium abscessus ATCC 1MQDSSGNQSLRHTSRPVTRRDALRYATAVSALAGLGAASLGTGAPTASAA
APTLIDFAMRQIPAEHIKAAGHAGVINYVSTSRPGSSMGAKPITRPYAQS
LTAAGLVIVSNFQYGKPGGTAPSDFTRGFAGGVEDARTAWQLHTAAGGGQ
SAPIFFSVDDDIDRGTWNDVALQWFRGINSVLGVQRTGIYGGVNPCQWAA
SDGVIGNSRSPGHVWAWQTRSWSRGQVFPGAVLYQRIVSTASNPGPVVGG
LEVDVSDALAQDVGQWNFHQ
169631873YP_001705522.1 putative beta-lactamase [Mycobacterium abscessus ATCC 19977]MKVPGSHATRVCAVATVLLALAGIPSCGRPAQPITAPSIVPTGPFAPITT
LVNDAVAAPRLPGAVVEIGHAGKIVFRQAFGWRKLPDEPGLNGSPAPAEP
MTDDTIFDIASLTKPLATSVAVLQLYEGGRVHIDEPVQAYLPDFNPTNDP
RRDQVTLRMLLTHTSGIGGDLSHQGPWGLKQADKADGIHRALTTPLAFDP
GTTFHYSDINFIILGALVEKVTGQTLDIYVQDNIFAPLGMNETRYLPAAK
ACGPHHIVGTAITLEEGPRAAPDCATGAWSTALLTRIAPTAHDEDTPGIN
PHYGRLIRGTVHDPTARRMGGVAGSAGVFSTAGDVGRYCQALLDRLAGRP
STFPLKRATLELMTSPAQPGHNDGQLKAANDAARLAIEKTSNSTDPLLAP
GYPAIAGQNLRGLGWDIDTELSKPRGMLFPIGSFGHSGFTGVTLWLDPGS
DTYVVVLANVIHQRGGPPIVRLSGHIATVAARMLDLYRN
169631872YP_001705521.1 hypothetical protein MAB_4799c [Mycobacterium abscessus ATCC 19977]MDWDELYRGEAVYAPGDPGWNIGEMQPELAALHRQGRFESPILDAGCGIG
STSLALAGHGYQVVGLDLSSGAIEKAKKAAEPLALDVVFDTADLTSDIGY
NDHFNTVIDGLVFHCLPAQIRGDYVRSLARSLKPGGRFFALVFATEAFPP
NAEFGPRPFTEQQLRDIVGRHLVVDEVRRARAWVNVPGQLPEGFEYRNVT
IGSDGRAQLPAWLVSAHRS
169631871YP_001705520.1 hypothetical protein MAB_4798 [Mycobacterium abscessus ATCC 19977]MPSPTDDFTRLTDPAVERALRAWQRADSTSWLDAFVDQPGLTDDGALRDF
GAFSAEIGNEYFTSIEKVSPDGHTVTGQFHSETWGNFRTFFRFVPDESGK
FRQLDIGQA
169631870YP_001705519.1 luciferase-like monooxygenase [Mycobacterium abscessus ATCC 19977]MRFDIKTANHNTTWQEILSVWKEADDIEVFHTGWLFDHFYPIASPSQRDH
NSAGPCLEGWMLLSALAQETSRLRLGTLVTGIHYRHPAILANMAATADIV
SGGRLELGLGAGWNEEESQAYGIELGTLAERFDRFEEACHIITGLLSQPR
TSFSGQYYSVTDAYCEPKCLQQPYPPILIGGKGEKRTLPLVARYAQHWNF
PDGTPTEFARKREILHAYCAAINRAPSAILTSAHVWLTSDTPEGISRLVE
ELAAFQTAGLDAAVIYLPVPLDPRVLNPLANALNGLTAPPKR
169631869YP_001705518.1 hypothetical protein MAB_4796 [Mycobacterium abscessus ATCC 19977]MPEKIDEVDQLIKQLAETFGRPIRSPILHWPDEYGLEYESVSFPSEDGVP
LDAWFIPCKGSNKIAIANHPIWHNRYGLPAHLEPWKQIGAAGGNDFEVNF
MADYKNLHDAGYNVLTYDMRNFGHSGIGNGGVGSNGIFESRDVIGSIQYV
RSRPDTKDMTLVLFSRCCGMNATFIAHDRRPEVFRDIRAIVSPQPVSLRP
FYERITEILGITERLDDIEREIQLITSFKFDDMSPIPYAKSMDIPTFLVQ
VRNDALTKESDVQTIFDSIPTNDKKLFWIENSTRRWDGYNYFPHNPEQLI
DWFDTHTS
169631868YP_001705517.1 LysR family transcriptional regulator [Mycobacterium abscessus ATCCMPEHSAGIWDDPVDLRRLQQFLSVAEHSGFTRAAQQLRLTQQAISQSVTN
LEKQVGAKLFDRSGRHIALTPAGEVLRDGSVVLLAAAQTLVRQVQNTAAE
QPRPFVVAHTPAITAEEVHQLLVPVRSALPNVSVTALQVFPNALEPAVIG
GSADIALRRGIATPKNLASRVIGYHALRVAVPREHLLAERDSVALRDLRN
ERIIVWAPPGVSHYTDFILSTCRSAGFEPAFVINHVQGTPPVTAVLDNDG
VAFVTAPTGPCLAGQVVVIDIVDPPQAPIQAIWLPHTQSAIRDALTSG
169631867YP_001705516.1 AraC family transcriptional regulator [Mycobacterium abscessus ATCCMRFTSDLARPPYRRPTATATMRTNTRQLTVWDGTRPRTPRTWQSRVSLAA
SGAEYVFATEQIATPTDWFFHEGRHVVVVHRRGRLRTMELEFEGGPSGRA
DPQVGDIWLIPADRRYSALAHGSTVEYCQMTLPPRFLEKADLEPSIRQRD
PLTYRVIEQISTVAGREDAFARLAAEWLTETLLRHLTKRFVTGSDSTPGL
YRDFGAVDRAALIEYLDECPDSMIGLSPLAAHVGMTTREFTKAFAAAFHT
TPHQLLLDRKITKAKRLLVESTASIAEISVQLGFFNPDHLWAAFAQRVGT
TPSGYRQSTAG
169631866YP_001705515.1 major facilitator transporter [Mycobacterium abscessus ATCC 19977]MATETPDIRPQADIRTAQPRAFLPVFLLAYFASAVALLAAGGVSIPLRLA
ELDPAHKTQALSLTMALGGIAIIAVTPPLGHLSDTSTSRFGIRRPYLVGG
TLVGALGLTALATAPSVGGVVAGWCITQIGFAATLVVFNALLADQISIAI
RARVAAVFGISTSLAPVVGSVFINVLPNDPRWWFGLPAVIALICNGLAAV
ILRDTVRMQGDPRSWQRILSSYWISPRKHQDFAWAWVCRLLVTMSVLLVT
VYMLYIVAGTLGLSEHEAAAKYGVIIGAFLVTNTLTAAVSAWWSDRTGRR
KGIVWTSCVITALGLVILLLFKDFHALLLGAAVIGAGQGAYAAVDLALMT
EVLPETESSGKDLGVVAMAYLLPQLLVPLLATALFGMHSAQGDFSILYIA
SMVLSVLGGLAVLPIKAVR
169631865YP_001705514.1 putative transcriptional regulator [Mycobacterium abscessus ATCC 19MYVPKNFAMQAKEITAVLGDAGLAHLVTHDDAGYLVTPVPLLYRPTSNTL
VGHVSRANPHWHRTGPSIAIFAGPQGYISPSLYATKAETGKVVPTWNYEV
LNVHGHLTAHDNPEWVRALVTELTDRHEHHRDSPWGIDDAPEEFTSAQIR
AIVGIELSIESVEGKAKMSQNQPERNRTGVIEGLRRSGDPAQQQVAEQVA
AQNYTR
169631864YP_001705513.1 hypothetical protein MAB_4791c [Mycobacterium abscessus ATCC 19977]MRFQSRRVWLAAVLIAPAVVTAGGIGLAAGSAVAPMADSHHAAAATIPDH
PTVSMRIMLASNDSGPNNPDSDISGPYDSDKTNIAPKAPSSGTGMACEDQ
GVACDHDQSGSVLSSDNDEV
169631863YP_001705512.1 oxidoreductase [Mycobacterium abscessus ATCC 19977]MSIRRTVQEFVQRRTLLPDRIDSLIAGPGRDVRGLTVVVTGASAGIGRES
VLQLRDQGARVIGVARRADELKALAAETGCEWHTCDLSHQDQIARLLEEL
TEQGVDVLVNNAGHSIRRRIVDASDRLHDYQRTMALNYFAAVQLSLGLLP
GMIERGRGQFVNVCTWALHANTFPRFSAYAASKSALAIFGRSLNAERPHP
GVHATNVHFPLVRTEMITPTEEYNDAAALSAQEAGRWIMRAVTHQPVEIS
PAVLRAVLPTIDLLSPTASDSTIASLT
169631862YP_001705511.1 hypothetical protein MAB_4789c [Mycobacterium abscessus ATCC 19977]MAELSERARSVRRRIMTEIMSRGTAPTMAELLAEFAMSKAEMARLMRDLE
GAICVALQDEEHAGAPTFQDEVLIEPQPPLGELVYARPFAAFRNHYAVTV
AGQQNWYAECAVEACAISGQFPGSEVIVDSVCRQTKAPVRLVGRDGFLVD
YTPRTLRVHLAYPVREMPHRVAGWCDYNSFFVSEDAVTQWRAAHPEIGGI
TRSPEQMACLITGSIGQGRHRYDYQPTLPVLTLARQMRMMGLTRTTRLGL
HVPDPFWLPTPKMLSDWRRNGMGNFIRLRFR
169631861YP_001705510.1 hypothetical protein MAB_4788c [Mycobacterium abscessus ATCC 19977]MSRARVYAMVQQEKRDLAALLRELTPQEWESPSLCAGWRVRDVVAHVLYD
GTPLLRYGSEVIRVRGSADRLNRLYLDRARGWSTEELLAAFEATIARSYS
ARIQPKLVLADLLIHQQDIRRPLNRLRTVPEGTLRMVLDNPDPFINPKRR
LKGLRWTATDIQWTDGTGPEVHGPGEAIVMAVGGRPAALAQLDGPGVEIL
RTRLDGD
169631860YP_001705509.1 TetR family transcriptional regulator [Mycobacterium abscessus ATCCMPTRTNAADVPATRRARQRAQTTDEIKALARRQLADGGTGALSLRGIARE
MGMAPAALFRYFETQAALITALCVDANGALAQAMSDGQKAAPESDSAARL
RAAFVAARRWALAHPGDFALLSGTPIPGYAAQPAETGPAAMRVIASFMDA
YLRAVAAGEAVPRRTRFRPSAPGPLLVAMFGEDTAPPIDPAIIGIGIFAW
ASITGYLAGEVFGSLGDLVADSDALYHDHVDTVLCGMGFAGV
169631859YP_001705508.1 hypothetical protein MAB_4786c [Mycobacterium abscessus ATCC 19977]MIEIGSTFRRRGADGTWATFTIRVIRYSPFPYVEAEPVGGGPRVALSVRA
AEGLSAARR
169631858YP_001705507.1 hypothetical protein MAB_4785 [Mycobacterium abscessus ATCC 19977]MLGSIFIVAGADGLTRPSASVAATEPLVSSLLEHTPESARRYLPSDPQTY
VRIHGATQLAAGLALASGKLPRISAWVLAGTLVPATLTDQAYWRQTDPAL
KLQQKTHFWKNISILGGLIIAGIDTEGRPGLSWRARRAARDAVAAVTSAL
PGVEQTSQSLGAKTLELGEATRERIPDLVEHARERGAEIAETAQRRGSQF
AETASRRGSELAERLSERGSELASAAEKGRHQVEALAADPPPRVRRFVHA
FIRR
169631857YP_001705506.1 hypothetical protein MAB_4784 [Mycobacterium abscessus ATCC 19977]MIILGVLLAVLGYVLAVPILETVGLVLIVAGAILWILGAVGRPVAGRKVW
F
169631856YP_001705505.1 PPE family protein [Mycobacterium abscessus ATCC 19977]MTAPVWMAAPPEVHSALLSSGPGPGSLFAAADAWRSLSTEYSSAANELTT
TLGSVRAGVWDGASAEQYQTAHVPYLSWLHETSAVSAGVAAQTETAATAY
SEALATMPTLGELAANHATHGALVATNFFGINTIPIAVNEADYIRMWIQA
ATVMSTYQAVSESSVSAAPPTSPAPPVLSPDSGAAARTAAQDATKPPPIV
PDPNDPIEMLLKNSQHFLGMYRALKGLITDPVGTIVRIIIDFSTNPAAAI
VTWTPLFYVFAYAATFAVMGTPIYAAIMGPAAGISIPLAITLASLSQMPE
APPVDAPAETVPARIDQPHAVAMGGAPAPTASTAAPTPTTTSPATPGSAP
APTPPPAGAEGLGYAVRGDGPGFGFGPTIGASTGATAHAPSSAVSAAAAL
ACNPATGKSRRRRRRTIDDRGYRHEYATMDDHTPTGPQDPVTAVASGTGA
GRLGFAGVHTATTAVEATGLSTLDGDAENRTIPMLPGTWDVTDDDR
169631855YP_001705504.1 hypothetical protein MAB_4782 [Mycobacterium abscessus ATCC 19977]MHHSSAPGRHSGSSLVSRRDALRYVLTAPLLAGLPVFAAPQAAADGLRLI
DFTERLVTPEQIKAAGYAGALVYVSELRPGADFDFKPVTRDYADGLRAAG
LHIVSCYQYGKPGWPTPSDFTRGYDGGVADAQTALRLHGAAGGPATAPIF
FSVDEDIDERIWKTQAAQWFRGINSVLGIRRTGIYGHARACGWAIGDDVI
GHSTTAGYRWAWQTRAWSGGVREPAAVLYQTAVNTASNPGPLIGDVHVDV
DDVLATDFGQWSLSR
169631854YP_001705503.1 ABC transporter ATP-binding protein [Mycobacterium abscessus ATCC 1MTATLVAKNLAGGFAHRTLFEGLDVTVAPGDVVGVVGANGAGKSTLLRIL
AGDLQPLSGTVGVAPGDAFIGWLPQEHERIPGETVAAYIARRTGCIAATE
AMESAAAALADQVQGRADLADEYSVAFDRWLACGAADLEDRVPAVLNDVG
LGPDTVRPASTLMTSLSGGQAARVGLAALVLSRFDVVLLDEPTNDLDLDG
LARLEDFVRDLRGGVVLVSHDREFLARSVTHVLELDLAQNRTTVFGGGYE
SYLEERAVARRHRREQYEEFAEKKADLVARARIQREWSSQGVRNAIRKAP
DNDKIRRRAASESSEKQAQKVRQMESRIARLEEVVEPRKEWVLEFTIGAA
PRSSAVVATLENAVVRQGEFVLGPVSLQVDAGERIGITGPNGAGKSTLLR
LLLGRQQPDEGRASLGANVAIGEIDQARADFTGTDRLVDRFEQRVPAWST
ADARTLLAKFGLRADHVERTVDELSPGERTRAGLALLQACGTNVLVLDEP
TNHLDLAAIEQLEQALETYDGALLLVTHDRRMLQNVRLDRAWAVDNGCVT
ER
169631853YP_001705502.1 MaoC-like dehydratase [Mycobacterium abscessus ATCC 19977]MTAPVDGSALEARVGHYYQMDNPYLVGREKVREYARAVQDYHPSHWDAAA
AADLGYSGVVAPLTFTSTPAMACNRRMFESVVVGYDTYLQTEEVFEQHRP
IVAGDELHIDVELTSIRRVAGRDLITVTNTFTDMAGERVHTLHTTVVGIT
ADEISPGTMAAVQKAMMHDVDFSGIGAPGDSYIKTVRPAGEVRVAQDTAR
NPGTPSFDDVKVGDELPVHHTRLSRGDLVNYAGVAGDANPIHWDEEIAKL
AGLPDVIAHGMLTMGLGAGFFSAWSGDPGAVTRYAVRLSAPAIVSAAEGA
DIEFGGKIKSLDPQTRTGIVVVTAKASGKKIFGLATMSVRFS
169631852YP_001705501.1 hypothetical protein MAB_4779 [Mycobacterium abscessus ATCC 19977]MVHSLPSVGTTPDNDFSTECSGVGGQRSIFEFTTAGTSGNVILVIRVLGT
RHI
169631851YP_001705500.1 hypothetical protein MAB_4778c [Mycobacterium abscessus ATCC 19977]MCEEENAVGDCIRDTPGEQTGGDSCVLINELGACEDQQEVDDPAHTMLR
169631850YP_001705499.1 cellulase CelA [Mycobacterium abscessus ATCC 19977]MAVLSLGIFLGPVAEADNPLDGQGFYVNPNSAAMRAAQGAGSPELTSIAN
TPQAYWMDNVSSPSVDAKYISAAQASGATPVLALYAIPHRDCGSFAAGGF
GSADAYKGWIDGVAAAIGAGPAVVILEPDALAMADCLSGAQRQERFDLMR
YAVDTLTRNPATALYIDGGHSRWVSADVMAARLNEVGVSKARGFSLNTAN
FFTTDEEIGYGDAISGMTNGAHYVIDTSRNGAGPTSDALYWCNPSGRALG
TPPTTATASPNADAYLWVKRPGESDGSCDRGDPRAGTFVNQFAIDLARNA
GR
169631849YP_001705498.1 TetR family transcriptional regulator [Mycobacterium abscessus ATCCMPKRRQVFAEVGYVKATIRGIAAVADVDKSSVTQYFGSTSNPFREAVQWR
IPVDELTVPDLAVTAENYLRGLLSGWAAEPAGPMAVLLRNSMTSDDALEL
LREQVTDHAVSSVAATIDQPDARLRAALLSAVLMVVASQRYLLRLPDLAG
ASDDDIVALVAPLLTALIAPENAS
169631848YP_001705497.1 hypothetical protein MAB_4775c [Mycobacterium abscessus ATCC 19977]MVVAVSVVEAALAGHVVGVETTAVSLPLDMSVRSIAPMPDRRVGIAHPVV
VTFNEPVADRGAAERALGITSTPPMTGRYEWLDNNAVQWSPDRFWPPHST
IKLMVGGKPAEISTGPALIGIASVSRHTFTVSYEGVWRRPSDGAAGLPAP
HHLPRLGEEGVFPASMGRPEYPTPLGTYSVLGKERSVLMDSSSVGIPVTA
PDGYKIDVENAVRFTTRGLFVHSAPWAVPAMGYENVSHGCISLPPAAAEW
YFNNVNIGDPVVVQE
169631847YP_001705496.1 hypothetical protein MAB_4774c [Mycobacterium abscessus ATCC 19977]MPPTGPAATAPSRGAAAAGTTAGAAGTTGAAGTIGAAGTTGAAGTTGAAG
AATGPGRIGTPATGAAPAAGPPISAPLPEPPAPSSMEYCPPISSAAVAWG
LNTMAATPKPAPAII
169631846YP_001705495.1 heme oxygenase [Mycobacterium abscessus ATCC 19977]MNVSSSTVPESLSLAMRDGSRAEHDAAEQSPFISELLAGRVNTDGYVDYL
MRLQMIYTAIEDAVRTHREDPLVAAVYDPVLERHHALAADLEHWAPGTRR
QVNSAAAQAYQDRIAKADWTGALVAHHYVRYLGDLSGGQAIGRMLDRAFG
LGGAGLSFYDFPMRPKPYKDAYRARLDELGLSPRENVRIVDEVKIAFGLN
QAVFDELSDNLTAYRR
169631845YP_001705494.1 putative regulatory protein TetR [Mycobacterium abscessus ATCC 1997MPRISASSVEEHREQVHRRVFQAFADLMSEQSFDAITMAKLATAAGIGRT
AIYHHFADKEAVIVEFASHETSRYLEGLRAALSDISDPAQRLSVYIRHQL
EAGQQFHMGLGNQLYGTLSRDAAVAIREHVVAVEEVLLEILRDGVAAGTF
VVEDRAATISLIHACLAPRHLPIEAIQRFVLRALGATP
169631844YP_001705493.1 putative adenylate cyclase [Mycobacterium abscessus ATCC 19977]MPESDELNAVVDAAVEQVLLGGPRRYTRSQVSQLSGVPVERARTLWVALG
FAAADSDDEVAFTDADVSAIRTFAALGSATAANQQSQIAAARTLGQAMAR
LAEWQADLLTREVGGRLAAEGDDASAESSANAATQTIATLTALQNYAWQR
HLAAALHRANETGSTTRQLLVGFADMVGYTRLSRHLDPDELASLLETFET
ALTEAITTHGGWVIKNVGDEVMFAAASAAAGARIAVAMNTAITEAAQTIP
DMPQIRVGLAYGQVLSRFGDLYGTVVNIAARLTGVARPGTILLDDGAAAA
LGDDGEFSLRHLRGVRVKGFSRLGSHVLRARKR
169631843YP_001705492.1 hypothetical protein MAB_4770c [Mycobacterium abscessus ATCC 19977]MNWNFLGHNWHLFGNLAVLAFVALLVFATCMSVYTARLRKRAVSPLAHSV
GGYPFVLSKVRKREQMSTDELSFARQAIADRGSLWAFSIPATIFSLGCFY
VLGSLEQLHGATPSERTFLGVIPMVSSINITAQVLRMRRLKGRLPRASVP
PV
169631842YP_001705491.1 membrane protein MmpS [Mycobacterium abscessus ATCC 19977]MSPRSVGRTALARAWMPLVAAIALGVASVSMWKVHQMSAPEPVITVNQPQ
APPEFTPKTLTYEVFGAPGEGGMLSYVDIDGHPHQENVTTLPWSHTETTT
LTVVSGSISVQVRGGQVGCRIRVNDVVRDQMSDDHADANVMCRVKSA
169631841YP_001705490.1 putative membrane protein MmpL [Mycobacterium abscessus ATCC 19977]MSEQSKHSVKRPLIPRMVRVLAVPIVVFWAIVAVTTNTFVPHVEDVAEEL
AGPMIPHYAPSQRAMLHIGEKFQESTSTSLTMLVLEADRPLDGSDHQYYD
DLVRRLKSDTEHVQYVMDTWGKPITAAGAQSLDGKSAFVLLRLAGDIGQT
QANKSVEAIKETIDKDTPPRGLKVYVSGAAPLASDTLSVANSSLNNITIV
TIFLIIFMLLMVYRSVTTMLVPLFGVLVEMLVARGVVATLGHFGYIELSS
FAVNIVIALTLGAGTDYGIFLLGRYHEARNAGLDREDAFYSAYRGVSHVI
IGSGLTIAGAGLCLSFARLNYFHTMGPAVAIAMLLTIAAALTLGPALLHL
GSLFGLFDPKRRVKARLYRRIGASVVRWPKPILVASAAAVLVGAVFVPTY
QVNYDDRAYQPPDAPAKQGFAAADRHFPPSKLFTEMLMVESDHDMRNSAD
FISLDRVSKSLVRLPGVAMVQSITRPMGRALEHASLPYLFTTQGSGNGQQ
LPFTKAQNANTDRQAQIMAHSVAVLRQTTDLTQQLADEMHNTVVTMEDMQ
QVTQDMNEKVSNLDDFMRPLRNYFYWEPHCFDIPVCQSFRSLFDMLDSID
KLAADIKDAVGSLEVVDRLLPQMVALLKLTANDQEALQALIVNTYGQTNL
QATATDQTFDDMINVGNDFDASRSDDFFYIPHEAFDNEDIKTGMTLMMSP
DGKAARFIVTHMGNAMGPEGIEHVNDFPDAITTALKETSLAGAQVYIGGA
GSNNKDIKQYAASDLLIAAIAAFTLIFLIMMVITRSLVAPFVIIGTVAFS
FAGAFGLSVLIWQHLVGLPLHWLILPLTFIILVAVGSDYNLLLIARLKEE
TDAGLNTGLIRALGSTGGVVTSAGLVFAFTMLAMLASDLRTIGQVGTTVC
IGLLLDTLIVRSFIVPALVRLLGTWFWWPTRVLARPRREPVRS
169631840YP_001705489.1 hypothetical protein MAB_4767 [Mycobacterium abscessus ATCC 19977]MSLKTRRALVLSHRWIGLICGLLVVIVSTSGALLVYQPELVRALHPEMFH
STPTDNPVGFTRAIAEARSQYPGIQLASASLKDGVYLLRASSETHDTFFV
DAGTGVLNGRLDLGAGILGFLVNMHDCGFTCEGYSGYLPFLAQPCPLGKL
GAFSGLSWGSALLACAAAVLLLLVLPAPFIWWKAIRKLRNALRVRWGSGR
FARDFDLHAIIGIVATVPLLIWAATGLQFEAPGLTTLWYSLTGGHPAERT
STASRGVEDVSVGQAISAAASHFPGAEVTWVGLPDEENPYYRIDLLDPDS
PDLRAHSLNYHGNRSVGVDAHDAAHVQILRARPMSVSNAIADEWAGPAAH
FGLAVNGYWRAIWFVLGLTPLLLALTGISTWQWRRRARSRAAVKIARVPA
AAGPTPASATRTTSPAAEQARAR
169631839YP_001705488.1 oxalate decarboxylase [Mycobacterium abscessus ATCC 19977]MKSINRRTVLGGVGVAGVAAAAGAGTDWAFSPPRSHDNPEDVTVTDDAAR
FGDPRLPAELNTAQPHLFHLGALAPQTFDGGDLRQAHEGNFPILTGQQAS
VVMVTLQPGGIREPHWHPSAWEINVITSGVATWTLLDPMGHSETFDAHVG
DVVFAPQGSLHYFENKGPDDLKLLIVFNASTAEGKDDIGIGASISKLPPD
VLSAVFGVPTETFAKFKKINESVTILRRPQT
169631838YP_001705487.1 putative regulatory protein TetR [Mycobacterium abscessus ATCC 1997MARRRGWDGQPPSSDEEAAERIVAAAVKLIGETGSAVSLADVAAELGVIR
QTVYRYFPTADALMHAASLASVDGFLDRLTHVVRGITDPAEALTEGVLYT
LEEVTRTPHLGIMMSEPYAHSHTSDMTSDEAQAFGLRMLDRFDVDWVQYG
YDDAAKRELVEFALRIMLSFFVSPNEATRSRDELRGFLKRWLGGAVLAQG
R
169631837YP_001705486.1 hypothetical protein MAB_4764c [Mycobacterium abscessus ATCC 19977]MTELIVRKLRFAFADHHVPFLWNESNPAFSSMANAVSFLAIAFEKMIGQM
IPEAMPLIADPVIAEEADAFVRQEGQHSMGHRQHAKGLIKSYPGLKETLD
EVIASFDDLTANKPLKYRLAYTADLEATFTPVFKLMLDHDDTLFAPGDDR
VASLFLWHFVEEVEHRSSALIIYDAVVNDPWYRMRMAPSIFRHVWSVLRI
ACEGFNKHVPLEDRKVDALSMFGMQARKKSLLQRLPFVDAPNDGPIENAF
RHLPAREVMVAMSGAVRSQIPGHNPAHEKLPALADEWFARYEAGYEVTQW
YTAGKATGVGV
169631836YP_001705485.1 hypothetical protein MAB_4763c [Mycobacterium abscessus ATCC 19977]MSGLCTPTFADLAARLGFSCDTAGGIAVLRNPSSLENWTLPVLELTVIGG
AILALFYAIIRLRRHNDPTNIAVWFGAIAYLLIIEPPLYFPGPFGISEHV
DTMFAHNVFTVDFLWGRLPLYIIAIYPMMATVAFEIVRTLGVFRRYGVLV
GAACVGLVHHAFYEIFDHLGPQLRWWEWTLDNPLNKPFFDSVPMGSVVVF
AALWPMSLAFCAQLFVGRHVDEGRSFTGGQIVWRTVVIGLLASIGTAVLP
MPATIAGLITDSTAVVGVVYAAELLTLVAVAVPVLVRQWLALRGGGTDGY
VTHPSILGYAVVYLAVMTVLWVSALPDYFGATNGLTAMGDPVGSLWYGAI
CLGIAAASTIAAWTVAGSGRRGGTGQRERMVASRAAES
169631835YP_001705484.1 hypothetical protein MAB_4762 [Mycobacterium abscessus ATCC 19977]MLAGLAFGSEIKRFGRSRMTRAAIVVLMLLPLVYGALYLWAYWDPFGHVN
KMPVALVNADKGATVSGQHVNIGEEISKSLTADGSMDWHVLSLDEARSGV
DHGNYYFMLELPPDFSEAIASPLTGEPKQANLVAVYNDANNYISSSIGRT
AIDQVLNAVSTRISGQAVNQVLSVVVSSGAGIQQAADGARQLADGAAKVD
DGAGQLATGLHTARPGSAQLATGAKQLSDGINQATDPLLTVTKAVANIGG
STDKLQQGAEALRQANDQIDGIAKAQDSAANALTAVIDQLAGRQDPAANT
LRGIQDQLREHQFTPQVRQQLTDAENASIAMTETLRGPGSPLKSALDQVG
GKGQELTNKLTQLRNGAQQLATGNAQLSSGIAKMDDGAQQLKSGTAQLRS
GSAELATKLTDGAKQVPTWSNQQKNAIADTIGGPVHLETAHENAAPNFGT
GMAPFFVTLALFFGALVLWMILRPLQTRAIAAEVLPLRVALSSYLPAATI
GIFQAIILYCVVRFALGMHAAHPVAMLGFMVLISFAFVAATQAINALVGP
AVGRVLLMALLMLQLVSAGGMYPVETTSRPFQILHKYDPMTYGVNGLRQL
ILGGIDGRLWQAVITLLFILLGGLLITSLSARRNQLWNLTRLLPSIKM
169631834YP_001705483.1 hypothetical protein MAB_4761 [Mycobacterium abscessus ATCC 19977]MNAQDEPATTPDETDIAISKETNDQAPVLITATGLGVDGEHGPLFSGIGL
ELTSGFHAIQMPGGPAQHCLLLTLAGRLKASHGTVNVMGDTEPRAIRRHC
AIAAFADIDELEETVTVQTVLAEQRRWLAPWFSRVPADTGRDKLDEVFGE
LPPPSGETFIVELSDLDLFLLRITLALLSDRPILVVGDLEQVRDNARRTL
AVERLGVIAQNRTVVVGVTNPLGTDAPVHDLHDHRILTGRD
169631833YP_001705482.1 nitroreductase [Mycobacterium abscessus ATCC 19977]MVPESVAAPLRTAGAVLVVCVDLRLVAAVDQDLERVGVVGGASIYPLVWN
ILLAARAEGYGGALTTMAVAEEPKVRELLGIPDTYAVAAVLPIGKPVKQL
TRLRRNRAAEFVTRERFDGPPWRTTTGEHHSESPRYPRSH
169631832YP_001705481.1 nitroreductase [Mycobacterium abscessus ATCC 19977]MELYDVMRTTFAAREFTRDPLPDNVLDRILDNARFAPSGGNRQAGHVIVV
KDPATRESLVEATKPGARRYFAQVVAGESP
169631831YP_001705480.1 patatin-like protein [Mycobacterium abscessus ATCC 19977]MTTAFVLSGGASLGSIQVGMLLALAEAGIAPDLIVGTSVGALNGGWISSR
PDIDGINGLADLWRSLSRKDVFPTNLSVGFLGFIGQRQSLVSDSGLRRLL
KEHLLFRRLEDAPIPLHVVATDVLTGKDVLLSGGDPIDAIAASAAVPAVL
PPVRIDGRDLMDGGVVNNTPLSHAVALGATEIWVLPTGYACALTETPRGA
VPMALHAMTLAINQRLVADVNRFEGSVDLRVVPGLCPVRTSPADFSHADE
LIGRAHEQTRRWLLMPRFKINQADLLEHHHG
169631830YP_001705479.1 TetR family transcriptional regulator [Mycobacterium abscessus ATCCMTEDLVNAALQAAHALGKDVADVPLVEVARAAGVSRSTLLRRLGGTRQAL
DAAVRETGVDPGGRAPVRERATVAAAELIDERGLAAVTLEAVATQADCSV
HSLYAAFGGRDELLRATFDRFGPIVDIEDTVGDSSVGTEEKLHRIYQRLV
QAFSQKPRVMPAMYAEIMARPFDPSVRKLIEHNAPRMLGSVGLWLSGEIA
AGRIRDLPVTVLTQQLLAPVVMHTALRPAAEGVLGLELPDIQEVCKIFAD
AFLHGVRVPEPPRG
169631829YP_001705478.1 hypothetical protein MAB_4756c [Mycobacterium abscessus ATCC 19977]MSEKTTCVVVGGGPAGIFAGLLLARAGVEVVVLEKHGDFLRDFRGDTVHP
STLRLLDELGLFDRFDKLPHTKLQRMRVTRPDGEQIVMADLTRLRTPHPY
IAMVPQWDLLDMLAEVGSEEPDFNLRMRHEVTGLIWDECGRVAGVRYESP
GGAGELRADLTLVCDGRWSLCRQEAGLVPREFSVGTDIWWFRAPRVPGIG
EELVPRFKDGKLLGIIPRQGYLQIPQFIRKGDDARLRARGVEAFRRDLVD
VVPELTDVAGEIGSMDEVKLLDVRVNRLSRWYTDGLLCIGDAAHAMSGLG
GVGINLAVQDAVAAARILAAPLRRKRVTCADLAAVQRRRMFPAVVTQAAQ
LFAHRYLVDPVLTEKKFRGPGWLVPIISRFRWLTVLPAYFIGIGVRPEHA
PDFARRAAVGTPGSMVSG
169631828YP_001705477.1 hypothetical protein MAB_4755c [Mycobacterium abscessus ATCC 19977]MSGIERVITRGTFELDGGSWEVDNNIWIVGEGDDVVVFDAAHSAQPIIDA
VGGRNVVAVVCTHGHNDHITVAPELSQALDAPVLLHPADDVLWRMTHPDK
DFRAVEDDMVLPVGGLELHALHTPGHSPGSVCWYAPELRAVFSGDTLFQG
GPGATGRSFSDFPTILRSISGRLGPLPEDTVVYTGHGDTTTIGDEIVHYD
DWVARGH
169631827YP_001705476.1 AraC family transcriptional regulator [Mycobacterium abscessus ATCCMSDERLITIVVFDGMKLLDLAGPAEVFAEANRFGANYRLVVASVDGRDVS
TSIGSPFSVTETIDSIECADTVLVAGGDVLIGSPLNPTLVAALAQLQARC
RRIASICTGAFLLAQAGMLDHRRATTHWRHTGLLQRAFPNVTVEPDAIFV
RDANVFTSAGVSAGIDLALALVEDDHGSEMVRDVARSLVVYLKRAGGQSQ
FSVFVESALPTGSALRPATDAIAADPAADHSVAKLAARAALSARQLTRLF
HSELGTTPARYVELVRIDAARGALDAGSTVTEAARIAGFGSAETLRRAFV
SELGVSPKAYRERFRTAAR
169631826YP_001705475.1 putative metal-dependent phosphohydrolase [Mycobacterium abscessus MTEIAGVEIPDTPLVREITEYIHDTEDDLLFHHSRRVYLFGVLQGQRRGV
KPDLELLYAGAMFHDIGLTDGYRGSPLRFEVDGANAARDFLIERGVGAED
AQNVWLAIALHTTPGITEFLSPEVALVTAGVETDVVGIDRDALSGKDLDE
VVAAHPRPDFKNRILRAFFEGNRHRPRSTFGNMNADVLAHFDPSFVRDDL
VDLIHANSWPE
169631825YP_001705474.1 hypothetical protein MAB_4752 [Mycobacterium abscessus ATCC 19977]MFDELGDVELIDLIASAQRAEAQACARKLDAIGVLVDRHADLGKPDERDH
HALDRWDRVASEVAAAQGITHALASSQMRYAQVLRHRLRAVAERFAAGDL
DFRTVALIINRTELVDDEAVVARVDAAIVRALPRWARWSHKRITAALDAL
VLHFDQDAVRRNRSATDKRHLEIRPLGNGEPVAEVWGTLQAVHAVALDKR
LDLLAGTVCPADPRSKTQRRADAVGALTQGLNRMRCACGHPDCSGRDTAD
VPVVVNVVINQSTLAGSDDCPAHVPGFGVLAAESARAAVAGTPTRNLTDS
RSTGYRPSAKLAAFVRSRDQLCRFPGCEAVADRADIDHTVPWATGGPTTG
ANLKALCRKHHLLKTFGQWTELQEPDGTVIWKSPTGHRYATTPVSWFLFP
ALTRHHTRQQARDRRRRTERNLNREQRLQREAALAALAAKDPPPF
169631824YP_001705473.1 hypothetical protein MAB_4751 [Mycobacterium abscessus ATCC 19977]MTGEASTGVPGTKIALALGAGGARGYAHIGVIQELHERGFEISGISGSSM
GALVGGLEAAGALDEFALWATSLTQRAVLRLLDPTWTSPGFFRAEKILDV
VRELLGDVAIEDLPIPFTAVATDLIAGKSVWLQNGSLASAIRASIAIPGM
ISPHVLNGRVLADGGVLDLPAVAPLAGVHAELRVAVTLSGGDERRAPAPP
EPEPEPREPRVTTEWLNRLLRSTSALFSTDDPEVAGQPDPAAKLTSFEVM
NRTIEVMQSQLARMQLAAHPPDVLIEVPRSVSRSLDFHRATEVIEVGRRC
AAEALDAYAHTN
169631823YP_001705472.1 putative short chain dehydrogenase/reductase [Mycobacterium abscessMQISGNTVFIPGATSGIGLELALALQAKGNTVIVGGRRIELLDQIRRDHP
GVSTVRIDISDPASIDIAAQQVLTDHPTLNILVTMAGIMRVEDWHHPESF
LQSAEEIVTTNVLGPIRLIAAFIEHLQVRPEATIITVSSGLAFAPLKVTP
SYNASKAAIHMLSESLRLQLADTRVEVKELLPPAVRTNLMPGQQESEFAM
PLKDFIDEVIALLESEPDAHEIQVERVKFLRYGEVRGDYDDVVATLNASD
PHARR
169631822YP_001705471.1 TetR family transcriptional regulator [Mycobacterium abscessus ATCCMNGTRPRQPRRGRRPTEEVREEVLQAAGELLFTEGMGGFTIDKVAALSGA
SKMTIYKWWPSKGALALDGYFRKVEPDLNFPDSGEIERDLRAQMRAFLGV
IRDTAAGAIIGELIGQAQVDPELKAAFLQRYSGPRRALAVAAIRRAQERG
QLRANVDPEVMVDQLWGACYHRLLVPDQPLTAGFVDALLDNLFKGIGA
169631821YP_001705470.1 hypothetical protein MAB_4748c [Mycobacterium abscessus ATCC 19977]MPRKFTEAERHDFLAAKHVAVLSVATDDGRPPASVPIWYDYTPGGNIRIN
TGAGNRKARLIERAGAITLTVQHEEPPYQYVVVEGTVVDTERPASAGPRE
EIAIRYLGEEAGREFARSYDNTDTVLFTIKPDRWFTADFSGEL
169631820YP_001705469.1 hypothetical protein MAB_4747 [Mycobacterium abscessus ATCC 19977]MIDDQDSISAILSRLRRAQGQLNGVINMIENGRDCKDVVTQLAAVSRALD
RAGFKIVATGLRECIAADKSGNTAPMTEAELEKLFLALA
169631819YP_001705468.1 putative membrane protein MmpL [Mycobacterium abscessus ATCC 19977]MSGESRVSAPAPERPAFMRFVRRFAVPILTTWLFMTVAVNVLVPPIESVA
REHAVTMSPHDAPAMIAAKHIGQKYHESDSDSIAMIVLESDDPLGERAHQ
YYDNLVLALQADTRHVQHVQNVWGDPLTASGVQSRDGRAAYVQVNLAGDQ
GSTLGNKSVVAVREIVDNSTPPQGVTVYVTGPAALTTDMNEAADKSMLIM
MGVTGAVIMIMLLITYRSVSTMLLVLVMVGFEMGTARGIVAILGNYDLLG
FSTFVVAMLSSLAIAAGTDYAIFLIGRYQEARQVGQDRENAYYTMFRGTF
HIILGSGLTIAGATLCLHLARLSYFKALGIPSALGLLVVVVGALTAAPAV
VVVAGRFGLLDPKRPVNVRRWRRIGTATVRWPGAVFAASSAIALVGIAIM
PTMKVSYNDRFYIPEDLPSNIGYTAAERHFSSATMNPDILMIESDHDMRN
TGDMIILDRIAKEVFRSPGIAMVQSITRPLGGPIEHTSIPFQISAQSIPI
QQNLQFMKDRAADMLSMSKDLDALIGAMERMQSLLGQMSSATHRMSANMT
DAKTTLEEIRDHLADFDDVVRPLRNYFYWEQHCFDLPACSAIRSVFDALD
GVDAFSDKMRALTTDIGNVDAVIPQMAAQLPPIIAVARSMQDTLLTMHSS
FSNLITQMAHMTDTASAMGQAFDASRSGDYFYLPPEAFQNPDFQRGLKLF
LSPDGTAARFIITHDRDPATPAGISTVTSELEAAHQAVKGTALTDAKFYL
AGTAAIYRDIQSGSRYDLLIVGIAAVTLIFAVMMIITRAFVASLAIVGTV
LLSLGAAFGISVLVWQHIFGLELNWIAPVFGLIILLAVGSDYNLLLVSRF
QEEIGAGLKTGIIRSMGGTGGVVTSAGLVFAFTMMSMVASDLSSIGQAGS
TIGLGLLFDTLIVRSLMTPSLAGLLGPWFWWPLRVRTGPTAEARPNGRRP
YTQEGILNIATGPER
169631818YP_001705467.1 putative membrane protein MmpS [Mycobacterium abscessus ATCC 19977]MRTATASVLKRAWVPAVVACAVGLGAIAVTNLRGAFGSEPIFSATGTSAE
PLASSTIKHVRYEVYGPSSATGAVSYLDKDARSQRVDFTSLPWTHTIETS
APAVIASVVAQGNSPSLGCRISVNGRVQDEQSTEGHRAQTSCLVKAA
169631817YP_001705466.1 hypothetical protein MAB_4744c [Mycobacterium abscessus ATCC 19977]MPADGDAAASGPFDVRIWLDPVCPFSWNTARWLDAVAIGSGIPVDWQLMN
LAVLNEGRELPDVQQARMRDSRRVGRLMAGIQCELGQQGLRTAYFAFGRL
YFDESLPLDAELADRVLGAVAPLTTTRETLSDASLDAEVRRSHEAGQRAL
GDVGGSPLMQVNGRTSFGPVLTAVPEHDSARALFDAVAALARVPEFAQLQ
RPRPAH
169631816YP_001705465.1 putative dehydrogenase/reductase [Mycobacterium abscessus ATCC 1997MKKIVILGAGIGGLSVINEIRQSDVPLDGVDITVVDEDFSHFLGFTLPWV
MRGWREVESVPIRPNAESLSGVTAITGSVTAIDPNAHTVTLSDSSTLSFD
ALVIATGARNALDKVRGLAESAARGDAVHYYSVAGAGDARRALADFSAGK
LVFLVTSQPFRCPVAPYEGALLASDLLNEKNVRSAVEISMYTPEVHPMPS
AGPYAGPQLVQLLKDNGITFHGERTTECIDPERKVVVFGDGTTASFDLLV
FVPPHEPSVTIDGQGWIAVDAETMQTQYDGIWAIGDTAAVTSPSGKPLPK
AAIFAKNGAKAAAQNVLHYLGRSDRKAVLSGLGYCYLDTGQHRAAQGKGD
FFTLPHPAITLTEPSVGQHHDKRDEEAQWRDMWESRSGA
169631815YP_001705464.1 hypothetical protein MAB_4742c [Mycobacterium abscessus ATCC 19977]MTAPSANPVPETTEEFSERLTAAIDNAALVLLMSIGHQTGLLDTLAASAG
STSEQLADAAGLEERYVREWLAGMTVAHVVDYEPVSAIYTLPSHRAATLT
REAGLNNLARLAQYLPLLSEVEQKILGCFRRGGGLQYQDYPRFHAVMGER
SREVFDKALIRTVLPLVEGLPEGLEGGLDVADFGCGSGYAINLMAQAFPA
SRFTGVDFSDEAIATAAADAERLGLRNASFLSADVATLNAPATYDLITAF
DTIHDQAHPAAVLANIHRALRPGGVLLMADIKASSRLEDNIGVAMSTYRY
TVSLTHCMPVSLGLEGAGLGTMWGRQLAESMLAEAGFSDVTVREIEQDTS
NYFYIARR
169631814YP_001705463.1 putative terminal quinol oxidase subunit I [Mycobacterium abscessusMNTKSNGSTWRDSAGLAVLPIRLVVGWTYFSAFWRRVALENKLDPDVSGY
VGEKFNHFLPQALGIKPIIAFLVEHPDLLKWSMVVFTVVEGVTGLCLMAG
ILTRAMSVSVFLLALGILLGSGWLGTTCLDEWQIGILGISAGLTLFLAGG
GRYSLDHVVVERNCGVAESCWFRWLASGPLDVRRRQVLGGAAAVLTIALC
TNQYFHGGLYGPLRNKSVAPIIEVSNARISDRNLRFTVYRTEGVDVYGSF
LVGVTVTESETGRAVVVLRAEQLSSLPAHSITNRYIAAVKPGAYGVIVPL
GAKAELNIDGLDIRIDPRHHYNLSLADVSGAVWTQALQIDD
169631813YP_001705462.1 beta-1-3-glucanase [Mycobacterium abscessus ATCC 19977]MDRRRMMAFSGLGMLAAAASMPQAWAQPSPLGPPNRPPAAPPTGKYVFVD
EFDGPAGSAPDGSKWAISKARETMKDPTFWELPENVGQYRDDRKNVFLDG
NSNLVIKAAKEGNTYYGGKIYSTTELGIGYTWEARIKFNCLTPGAWPAFW
LGSDQDGEIDIVEWYGNGSWPSATTVHAKANGSEWKTHNISLDSGWHTWR
TQWDDKGIRFWKDYTDGATPYFEVPANSLADWPFNNPGHKAFAVLNLAVA
GSGGGDPRGGTYPAEMLVDWIRVW
169631812YP_001705461.1 FAD dependent oxidoreductase [Mycobacterium abscessus ATCC 19977]MAEEINPYLRPGYTQLATVDLTPMELDVHGLHQGYVRGLRRRGGTIVKSA
GIVSGARRHGRWALRDSSGRVFEAATVINAAGAWCDELAHLLGARPVGIQ
PLRRTAFMASAPRPNATGSLPMTLDASDAFYFKPDGAQFLCSPADETPQP
PGDPRPDELEMARAIGMINEATTLGIRSVNSAWAGLRSFTADRTPVVGAD
PGVEDFFWYAAQGGYGIQMAPALARTGAALATGAALPDDLAARGLTAAML
APGRDSLHTGQ
169631811YP_001705460.1 putative amidohydrolase [Mycobacterium abscessus ATCC 19977]MSITLPHNWADDLGDLADFYRDLHQNPELSFQEHRTAGKIEEAIAPLGLE
VTAGIGGTGVVAVLRNGSGPVIWLRADFDALPVQEQTGLPYASTVRATNP
DGKDVPVMHACGHDMHVAALVGALRLLDQLKATWSGTVVAVFQPAEEVGG
GANAMIADGILDRFPRPDVVLGQHVGPLPAGMIAYKTGTALAASDSLKLQ
LFGRGGHGSQPESTIDPVVMASSVVQRLQTIVSRELSPFEPAVVTVGYVH
AGAKDNIIPDDAELGINVRTFNEEVRKKTLASITRIAQAESIASGADKEP
AVTSMHTFPVTVVDDGAMQAIAAVFREHFGAERVVESPSPLAGSEDVGIF
GTTAGVPTAFWFWGGYEQQRFEEAAAAGKPVPSNHSPEFAPVLEPTLSTG
IEALTVAALSRLTARA
169631810YP_001705459.1 putative citrate lyase/aldolase [Mycobacterium abscessus ATCC 19977MNSKVSRSWLLMNPSREASLEAAIASTNADEVILDLEDAVAPNEKEPARG
RVLEYLNSGGNAWVRVNDASSDFWSADCRALADARGLKGVVLAKTEGGNH
MWDTSNRLGGETPVIALIETARGLSRVHDIAAARPCFRIAFGVNDYTLDI
GVDQDPLALAYSRSQLVVASRAAHIPGPIDGPTRDPAELPEAVSLTRRMG
MTGKLALRSSDADTINTGLSPSDEDVSWAQDFVDRFNSQGGKPKDGSDLP
RLNRARIILERARMLGLITP
169631809YP_001705458.1 hypothetical protein MAB_4736 [Mycobacterium abscessus ATCC 19977]MHAAKRLTTILGLLTAVLIWGPNVGLARAAEAAPAGDVLSIGAPEAPGQI
DLYLDPLCPYSGKMVQDQGEEIARLIESGRLHINLRFVDFLDKYSASGTY
DTRAIYASFVVADQSRSSETTWRFIQQIYAKDAQPKEEGDTDLTNDQLAA
LAERVHAPQGAQDLIRLGLPVPFDARAIAANNLPLLRAFPKSGVPMVVIG
NQPVDGESDWLSRIPR
169631808YP_001705457.1 putative starvation-induced DNA protecting protein/Ferritin and DpsMTNTARLSESDIKHFSASSTLSDNLQRVLVDLIELHLQGKQAHWNVVGTN
FRDLHLQLDELVEFAREGSDTVAERMRALYAVPDGRSDTVAASTTLPHFP
PYERSTADVVDLITVRVHAAVNTLRAVHDAVDEEDPTTADILHQLIDGLE
KLAWLIASENRKV
169631807YP_001705456.1 dehydrogenase [Mycobacterium abscessus ATCC 19977]MSTAVIVGGGPNGLTAAILLAQQGVHVTVLEAADSVGGGVRSGAATGPGL
IHDYCSAIHPMAVGSPVLAGLDLEKHGLQWLWPEVDCAHPLDDGSCGVLY
RDVAATANGLGRDGRRWRALFERPARNFDLLTADIMGPLLRIPRHPLALT
RFGVPTVLPAAATAQLFRTRQARALFGGIAAHAFRPLHYPMTSAIGLGII
TAGHRHGWPVAAGGSQSITDALSSLLAQFGGRIETGVHVTSFTQLPTADV
TLFDLSPTQVADILRDHLPTSVARGLSRFRYGPGAFKVDFAIEDGVPWTN
PDAGRAGTVHLGGTFAEVASTERAVHAGRMPERPFVLVGQQYLADPGRSN
GNIHPLWTYAHVPHGFTGDATQALIDQIERFAPGFRDRIVATAVRSTTDM
TVYNPNYVGGDIVTGAKDIRQLVFGPRTTAHPYRLGIPGMYICSAATPPG
PGAHGMCGAHAAAEALRHLRASI
169631806YP_001705455.1 putative RNA polymerase sigma factor [Mycobacterium abscessus ATCC MDLIEKFEAERPRLLSVAHRILGSRHDAEDAVQSAWIRAQSAAPNRVDNA
PGWLTTVTARLCLDQLRARERHGEVPLTAEHISDTQFAADEEFLRREEVS
RAVLVVLDELSPKQRVAYVLHDLFAVPFGDIAAVLDTTAVSAKKLASRAR
ARLGAADPERAREVGSQLEIVEAFLSAARGGDIERLITLMAPDVIRTVDH
TLIPSGAATLVRGAQAVAEETRSFTDRIAVAAILLIDGRVGAVIAPGGHP
FALIRMDTDGRLVTCIDIAPYTSGDAALSLIATAGSKVSYSPGESGRRID
PRGSGLPRVDH
169631805YP_001705454.1 hypothetical protein MAB_4732c [Mycobacterium abscessus ATCC 19977]MSVQMVRFSTDAQRAHEVEEAIATLFTAVAEAAPAGVTYTAGRVGDGSDF
VFMLQLAEGVDNPLVDIPGALDFRARVAGWAGEAVAPQLFTVLGRYEG
169631804YP_001705453.1 hypothetical protein MAB_4731c [Mycobacterium abscessus ATCC 19977]MSILETGLLITTVLCIATNGFEVVAKAVKAQFVVQNSGEVGLAPRWLPYL
AVVEGAGVVGLVIGLAGVRQIGLAAAIGLVAFFIGAVGAHIRSNVLHNIA
FPGVFLALALGSVAYFTLPD
169631803YP_001705452.1 LysR family transcriptional regulator [Mycobacterium abscessus ATCCMLDPELLRTFLTVERAGGFTAAGRILGLRQSTVSGHIARLEQSVGRELFR
RDTRNLAPTADGAAMVGFARSILDAQAQADRFFASSELTGLIRLGASDDL
VARELPDVLVEFQNSHPGVDLELVVGLSEYLKTRMTAGELDLMVAKRLPG
ETHGELLWRDKLVWAGRPNTHHVRDPVPVVTYPPPSLTRHAALRALEREG
RTWRIACVSDSQLGLRAAALAGMGVIAHAESLLPSGLVKVSDDSLPDLGE
LEFVLLRRRSVLSEPEQALCDAIVASTHRLHGDFGFTKGAGAGH
169631802YP_001705451.1 putative Na+-dependent transporter [Mycobacterium abscessus ATCC 19MKWLAKLRIDGFLLGLFAAMGIGLVLPARGDAADVLDWATKIAIAVLFFL
YGTRLEPREALEGLKHWKLHTTVLAATYVLFPLLGLAMRLLVPSVLTDDL
YTGVLYLCLLPSTVQSSIAFTSIARGNVAAAVVSASVSNMLGVFMTPVLV
MLLMQTTGEATVSPTAILEIVVQLLLPFVAGQVLRPKLYRVLSHTTLTKV
VDRGSVYLVVYAAFSAGMVEHVWQGLQISRLLAVVGVSVGLLAVVLGVTA
GAARLLRFDRADRIVVIFCGSKKSLATGLPMATVLFAGHPVGLIVLPLMI
FHQIQLITCAALAGRWGRAAERADEGDIGSQAVAAA
169631801YP_001705450.1 putative DNA glycosylase Nei [Mycobacterium abscessus ATCC 19977]MPEGDTVFRTAKLLDDALGGRILTGCDIRVPRFATVDLSGQRVEGVIARG
KHLFIRVGGASIHSHLKMDGSWRIMPAGRPGPTWNHRIRAVLTTDDSVAV
GTSLGILDVVDRRREGDVVGHLGPDLLGTDWDPDVAVERLIARSDEALSA
ALLDQRVMAGIGNVYSNELCFLAGLLPTTAVGRLGDPAGLVERAHTLMHA
NKDSYRRTTTGDPRSGRELWVYGRHGKPCRRCGTPIARDQGLPRVAYWCP
NCQR
169631800YP_001705449.1 hypothetical protein MAB_4727c [Mycobacterium abscessus ATCC 19977]MMLQRFRRRAARMRRRLSRAFVTLVVVVLTGPVIALIMWPAVLVYRHTGD
PALAALAQAAYLAAPYAVYLGVRGAGWALRRLGEAMVRRRDEAQWQRYAR
LSGLAEIDGMSGVDFERFVAARMHSAGWHIETTRVSGDYGVDLIATNRRD
VVAVQCKRYSKTVGVRAVQEVVAGARHYDCTRAMVVSNQDFTRQAQALAA
TSRCELIGRDRLPRWLVHGEKSAFANAAPPR
169631799YP_001705448.1 hypothetical protein MAB_4726 [Mycobacterium abscessus ATCC 19977]MTETFEASAKTNRKPTLLEQSGGLSGLVYAGLPSVTFTMGNSAFGLVGAI
WISMATAAAIAAWRWLRNQALQPAVSGVLGVAVSAAIAVQVGSAKGFFLM
GIWTSLIAAVVFAMSVVIGWPLVGVIWHGLTGGGQRWREDKPSRSAFAWA
TLALSAVFASRFVVQQWLYTQDSVGWLATARIVMGYPLLGAALLVVIWAV
RRSQRRISPHEPATGATDPGR
169631798YP_001705447.1 peptidase [Mycobacterium abscessus ATCC 19977]MGLPKLITVEEFFEPPVRTSASISPDGTMIAYLAPRKNRLNVWVQGIGST
EARCVTHDETRSVTGFFWVDDPRWLLYVQDSGGDENWHLYRVDLSTPDAT
AVDLTPFPGARLLGLERPYGRSGKVYIQLNHRRIDQIDLYELDIASGELT
MLAENPGGVMAWFCGPNHEVFAQSLTPGGDIEFSRYESGALRPLCVYDGA
DYPVGMNPTQMTPDGSGMWLGSSRDTDRTRLVRLDLATGAESTIDSHPAY
DLAAALGLPPTLIRHRKSGELLAARYLGARQEIRVLDPDFGPVLEKLQEL
SDGDLAEVSSDEDGRRWVVSFTHDRDPGVTYFYDHATGESHQLFRPYPHL
DPADLAPVVPVTITARDGLTLNSYLTLPVGTEPEGLPLVLVVHGGPWHRD
SWGFDPTVQLLANRGYAVLQVNFRGSTGYGKAFTKAAIGEFAGKMHDDLI
DAVDWAVEQGYADPGRIAIFGGSYGGYSALVGVTFTPDVFAAAVDYVGIS
NLANFMRTLPPFVRPNLANNWYRYVGDPAVPEQEADMLARSPISRVDRIR
TPLLVAQGANDVRVVQAESDNIVAALRARGVEVEYMVKADEGHGFLNPEN
QIDLHRATERFLAQHVGGRQVS
169631797YP_001705446.1 Sodium/calcium exchanger family protein [Mycobacterium abscessus ATMPTTASTPAVVGGLRRQLLRSICTTALFMAPALITRVGGLHPSPVLALVI
YGAAVVAASFVLAWAAEAAQIDVSGGLAIAVLALIAVLPEYAVDLYYAYI
SGHVPEYTQYAAANMTGSNRLLMGLGWPVVVLLALAVARKTSGHPVNLLS
LEPSNRIELGFLTVAGVVAFVIPASGQIHLALGIALLAWFGFYLFTISRG
EAEEPDLVGTAAAIGMLPKHLRRSTVVTMFVLAASVILLCAEPFANSLVS
AGTQLGVDQFLLVQWLAPLASEAPEFIIAAIFAARGKGTAAIATLISSKV
NQWTLLIGSLPLAHLAGGGGFSLVLDARQVEETLLTATQTMMGVALILAL
RFHRATAWALLALFVVQFPITSTHGRLILCGVYGVLAIAGLIVNRHHILA
TIRSPFHRSATLQLTVP
169631796YP_001705445.1 MerR family transcriptional regulator [Mycobacterium abscessus ATCCMATDAEGVAVGWSTRELADLAGTSLRTVRHYHDVGLLGEPERRPNGYKSY
GVAHLVRVLQIKRLTGLGLSLKQIAEMDEADENQQEALRALDAELAATID
RLQGVRDELAQIFSSEIAADLPREFGAAAVDMNFSETDRSLAFVMSRVLG
PAGLQAFVGMFLDQQDRALDHELENLPADAGERTRADLAERMSLHAKRLY
ADHPGMLNSTADAPRGQRFAESTVARALLDLFNPAQLDVLIRVGAAVRSE
PGEG
169631795YP_001705444.1 hypothetical protein MAB_4722 [Mycobacterium abscessus ATCC 19977]MRYAGVLLAIWLIIGAIAVAQRGYFTNSPQTCASAGTIALTVIAGPLNYA
GLNPSVSRCNIPQPSN
169631794YP_001705443.1 hypothetical protein MAB_4721 [Mycobacterium abscessus ATCC 19977]MIILGAILLAAGYFLDIGLLWTAGVVLMVIGLVLLVAGRMGHAVGGRRHY
Y
169631793YP_001705442.1 hypothetical protein MAB_4720c [Mycobacterium abscessus ATCC 19977]MRPSVGIASACTAAMLVAGGCGQAGPGGSQTGSIGVALPTTSGEATTSVT
GGRGISVASARQALQTAGAAVPGGRPFDLETGSDEGQRVLEVKVASRGEE
FKVVVAADGQQVVRQQQADKPSDDVAKAEGAKVDARRALQAAAGTDPGST
LSEMEIDTNYDGAVVWQVALVHRDGSTLQIDVDAKSAAISAR
169631792YP_001705441.1 hypothetical protein MAB_4719c [Mycobacterium abscessus ATCC 19977]MTGVDEQVGIGQLVDDLQGRHPSVTRDVVDAVVRAVHARFDGSPVRDYVP
LLVERRAREELALLSV
169631791YP_001705440.1 putative potassium uptake protein [Mycobacterium abscessus ATCC 199MVERKMRVAIAGAGKVGRSVARELVDYGHKILLIERERSNFEPQSVAGAD
WLNADACELDTLEEAGTETCDVVVAATGDDKANLVVGLLAKSEFGVPRVV
ARINDIRNQWLFGQAWGVDVAVSTPGAMVAGIEGAIDIGHLVRLMGLREG
RADLTKLTLPQDNPLVGRRVADLELPPNTALVTVVRHGTVVTPSPGDLLE
AGDEMLFIANSDVEYAIRAAIHGTGVLPES
169631790YP_001705439.1 potassium/proton antiporter [Mycobacterium abscessus ATCC 19977]MSLHQLYLDLLIGGLVLLASIVGTRVATRIGFPSLLFFLLVGVVLGEDGL
GLEFDNVELARNVCTAALAVILVEGGLTTRFADIRKVLAPAGALATVGVV
VSTVVTAFGAHVLLRMDWQLALLLGAIVSSTDAAAVFSVLRVLPLPRRLA
GLLEAESGFNDAPAVILVLMFSIVPFVFEPKSTAVQIVYELLAGSAIGLL
CGFLGAMALRRVALPASGLYPIATFGIGLVAFAASGTVHASGFIAAYLAA
VVLANSGLPHRSATRSFAEGLGWLAQIGLFVLLGLLVNPSELMDDLLPAI
LVGLVLLLVARPLSVVVSLIGFGVPWREQAFLSWAGLRGAVPVVLATFPI
VAGVPDSYRLLNIVFVLVVVFTLVQGPSLRPVAHLLGLITREATREIQVE
AAPLDVLDAELLTMKVQPASRLRNVTILELRLPDPAVVTLIIRQGNTFVP
LPDTRIEPGDELMIVTTSKTRALTESRLRAVSRRGKLAYWFDEYGDVG
169631789YP_001705438.1 membrane transport protein [Mycobacterium abscessus ATCC 19977]MDSAHVGDIVGALGTIGQHENIEGRSRWQRFRMLLAVLGPGLIVMVGDND
AGGVATYAQAGQNYGMALLWTLALLIPVLYVNQEMVVRLGAVAGVGHARL
IFSRFGRFWGAFSVGDLFVVNALTIVTEFIGVAMALSYFGLPRWISVPLS
AVLLFAVVAGGSFRRWERFLFALIAINIVMIPMAILVHPSVSKTASGFVP
SFPGGLNAELLMLIVAIVGTTVAPWQLFFQQSNIVDKRLTPRWIRYERVD
LAVGIVVVMIGAVCIMGAAAFGLAGTDAGGDFTDAGAVARLLHEHVSPTV
GALFAILLLDASLIGANAVGLATTYALGDTFGKRHSLHWKPTEAPVFYLG
YAMLLVVAAAVSFSPDPVLGVLTQGVQALAGVLLPSATVFLVLLCNDKAV
LGPWVNSTRQNIVAGVIVWVLVLLSLSLTAATFFPDLTTTQLKVFFVVGA
GVGLLGGLFVSLAKSRAEHAAASAVAAELGGLDPDQVQDLDSMPRDRVLR
RDIQWQERESWRTPALETLERPAWSPLRTAGMIALRGYLVVAVLLVGVKV
AQTIIG
169631788YP_001705437.1 hypothetical protein MAB_4715c [Mycobacterium abscessus ATCC 19977]MTRNQEEGAAARDVSWCETVAVAQALALGDKVSAAHMLRTSRRLLMVSEG
LLHLLSLLMRGAPAGDTNRLLDAARIRTAPPPIPNLVPVQPFQEVSHTMS
TLTDEMKRMLGAQLAILATVTDGTTPNIGPKRSLRVRDDRSLIFNENTGG
QTLANIHAGSKVSVAVIDREALDGYRFVGSAQIHESGPAFDNAVAFAQER
GMKHPRCAVVIDIEDIYTLKPGAGAGKRVRTGGHG
169631787YP_001705436.1 fatty-acid-coa ligase FadD [Mycobacterium abscessus ATCC 19977]MTETISTAAVPTTDLEEQVKRRIEQVVSNDPQLAALLPEDSVTEAVNEPD
LPLVEVIRRLLEGYGDRPALGQRAFEFVTGDDGATVIALKPEYTTVSYRE
LWERAEAIAAAWHEQGIRDGDFVAQLGFTSTDFASLDVAGLRLGTVSVPL
QTGASLQQRNAILEETRPAVFAASIEYLDAAVDSVLATPSVRLLSVFDYH
AEVDSQREALEAVRARLESAGRTIVVEALAEALARGRDLPAAPLPSADPD
ALRLLIYTSGSTGTPKGAMYPQWLVANLWQKKWLTDDVIPSIGVNFMPMS
HLAGRLTLMGTLSGGGTAYYIASSDLSTFFEDIALIRPSEVLFVPRVVEM
VFQRFQAELDRSLAPGESNSEIAERIKVRIREQDFGGRVLSAGSGSAPLS
PEMTEFMESLLQVPLRDGYGSTEAGGVWRDGVLQRPPVTDYKLVDVPELG
YFTTDSPHPRGELRLKSETMFPGYYKRPETTADVFDDEGYYKTGDVVAEL
GPDHLKYLDRVKNVLKLAQGEFVAVSKLEAAYTGSPLVRQIFVYGNSERS
FLLAVVVPTPEVLERYADSPDALKPLIQDSLQQVAKDAELQSYEIPRDFI
VETVPFTVESGLLSDARKLLRPKLKDHYGERLEALYAELAESQNERLRQL
AREAATRPVLETVTDAAAALLGASSSDLAPDVRFIDLGGDSLSALSYSEL
LRDIFEVDVPVGVINSVANDLAAIARHIEAQRTGAATQPTFASVHGKDAT
VITAGELTLDKFLDESLLKAAKDVQPATADVKTVLVTGGNGWLGRWLVLD
WLERLAPNGGKVYALIRGADAEAARARLDAVYESGDPKLSAHYRQLAQQS
LEVIAGDFGDQDLGLSQEVWQKLAKDVDLIVHSGALVNHVLPYSQLFGPN
VAGTAEIIKLAISERLKPVTYLSTVGIADQIPVTEFEEDSDVRVMSAERQ
INDGYANGYGNSKWAGEVLLREAHDLAGLPVRVFRSDMILAHSDYHGQLN
VTDVFTRSIQSLLLTGVAPASFYELDADGNRQRAHYDGVPGDFTAASITA
IGGVNVVDGYRSFDVFNPHHDGVSMDTFVDWLIDAGYKIARIDDYDQWLA
RFELALKGLPEQQRQQSVLPLLKMYEKPQPAIDGSALPTAEFSRAVHEAK
VGDSGEIPHVTKELILKYASDIQLLGLV
169631786YP_001705435.1 glyoxalase/Bleomycin resistance protein [Mycobacterium abscessus ATMSMTTSTPSVWLTLKAKDAPALIEYYVDTFGFLLAARYGEGDRVDHAQLN
WPEGTGGIMLGSHRPGGEWALEPGTAGAYVVTRDPDGLYQRIVAKKADIV
RPLAKTDYGAHEFAVRDPEGNLWSFGDYTGEPAPE
169631785YP_001705434.1 putative transcriptional regulator AraC [Mycobacterium abscessus ATMAGNEAPNWDFVVAPVRSVPGVASMVGYRARDIPDGIHLGMPSATLTFIV
SLDDGVESADSAAALDDARPNPLVLGGLHTRAPHIRQRPGQAGIQLAVHP
LASRALFGVPSAELPVTDFQGLEILGGAVAGLPERTARQRRWSDAFDTVA
TYLTESRRQRSVAPVRSEVVQAWHLLERSQGRITVSTLASRVGISSRYLT
TLFQREVGRSPKTVAMLMRFQRATSLLALSARRGRVDLAAIAAETGFSDQ
AHLTHEFVRFTGVPPRTWLAAEFRNIQDGGHSFGSECEHDYLDAQRVADP
169631784YP_001705433.1 hypothetical protein MAB_4711 [Mycobacterium abscessus ATCC 19977]MGIHVVVGANGATGTVLCRELLAAGHTVRAVSRSGRGAPSGVDEIAADAT
DAVRITEICAGATSLYHCALPPMGSWLPTYVDLTRSLITAAGNVGARLVY
ADDTWMYGKVNGPMREDSPVRPVAYKGALRALAAEMIASAYARGQTESVV
GRAAELYGPRVESLLGAGVFAAGITGRKAIWPGDPDLPMTATFIGDFGKA
LADLGQHPAVVGQVFHVPVAPAITGRQFIELIASQAGTVPKVGRLTPPMV
ALLKVVAPIVREGAELLYQFEQPFLVDDSRFRALTGRTATTWRAGIEQTI
TWYRADPERIKYRLLPGKSR
169631783YP_001705432.1 TetR family transcriptional regulator [Mycobacterium abscessus ATCCMADDRRTQLADAGLAVLAAGGARGLTHRAVDRSAELPEGSTSYYLRTRVA
LLQACATRLGERTMTAVVPLAEPVHLDISALTQLAVRAVRAWIADGGVLV
LARHELLLESAQHPQMRSVLDAATDHIRGLLERRLIALGISDAAERTGDL
IACLDGIALAYAVRGVAAEDALRRSVTRVVSGLLAVRD
169631782YP_001705431.1 AraC family transcriptional regulator [Mycobacterium abscessus ATCCMLFGTNLGTVTSAGEEQRLRDLARLRRVRDRIDREYAQPLNVEALAREAQ
MSAGHLSRQFKSAYGESPYSYLMTRRIERAMMLLRRGDMSVTDVCFAVGC
SSLGTFSTRFAELVGMSPRTYKERIVDHAGIPSCVVKQVTRPIRNREATP
AVRG
169631781YP_001705430.1 putative glyoxalase/bleomycin resistance protein [Mycobacterium absMSSSRSPDRSGIEKQRLQCAASVTGMDITINASFLPHTDAEASLAFYRDA
LGFEVRKDVGYEGMRWITVGPAGRPDMNIVLTPPAADPGVTDEERRTITE
MMAKGTYASIMLATDDLSGLFERVQAAGAEVMQEPTDQPWGARDCAFRDP
AGCTVRIQELA
169631780YP_001705429.1 putative lipase [Mycobacterium abscessus ATCC 19977]MGKSPYAVLGGAALAGVGAAVAGIAGSAAALRSPAVLRRLNKWAAHRLTD
EQRADRHAAILPTPIPGPSFYSDPGDLAGRVNGEVIRQQYVRPRLPVPGA
SVQRFMVRSTNTAGDAVPVTATLIEPKRPWRGPGARPVVVRNQPINSLGL
KAAPSYRIARGMYVDVPPLAPLLLARNYAVLIPDHEGPRMAYSAGVMAAH
AVLDAVRGMHGMRADLVDAPMVMDGYSGGAIATVWAAQEQPTYAPELRFS
GAVAGGTPTDYALLYRSMNGALGSGLFAAATIGQAREYPSMVELFGDFAF
YMSTLVKDLPQPALAAAGVARIDLDVLAAVPAPFDSDIAQDVIAANKPGA
AAPNMPILLYHGSRDRFLGDQFIPEQGVTELVGSWRSKGAMVDYLPVPGE
HMIAAGWAMPRVLRWMRDVLGD
169631779YP_001705428.1 hypothetical protein MAB_4706c [Mycobacterium abscessus ATCC 19977]MTQGFPGGAGVYATASLAAMTSIAPEQSGTSESEAVRGPARWTSLQKIGF
RVLFTVGGGILLLSVYDNLGLFGLFEPVLWLSAQIGSFLIRGHGIELTVS
SGGDLLWLWCYHLGWVVIALAIVAIWTLSDRHRAHYRRLSASLWVFARFG
LALSMIVYGMAKAIPTQMGYMTLPDQQLQLVGDTSLFNTLWGFMGASEPY
SIATGLVELAAGLLLLWNRTWVLGALGSVFAMAQVFLLNMTYDVPVKQVS
GELFLIAVAITAPLWPNLVRVVFNRGTRPVRLWSPLGTGRRWLLRTGIVL
KFVLAAALTVQCAFLSTLIYSTYKTPTSSLDGVWRATSFTVDGHEATVGQ
TSPAPWSNVAISHRDKVEEFGVRAFVSQTPDGRTSRWMLEVNGDQLELRK
RKSEAPQQVLHAHQSDPDRLVLSGVVEGKQIAGTYERRFMERSKYGFRWV
QPEMDPDVVAVGE
169631778YP_001705427.1 membrane protein MmpS [Mycobacterium abscessus ATCC 19977]MWIPLVLVVVGIAGGFTVSRLHGVFGNERRPEYATADREEKRPHDPKYLV
YEVFGPPGTVATISYFDADAEPQVIRQAALPWSVEFPITEATAMGNITAQ
GDTDSIGCRILVGDKVKDEKIRYGVSALTFCMLKAA
169631777YP_001705426.1 membrane protein MmpL [Mycobacterium abscessus ATCC 19977]MSNRNEPPTEPLPTLSRPSFLARMIHRLAVPIILGWLAIAVVLSISVPSL
EQVEKDHAVAMNPDAAPSFQATQRMGKLFDESNSGVVAMIVVEGQQPLGE
DTHRYYDDLIRQLKADTTHVQHVQDFWGDDMTQAAAQSLDGKATYVQVAL
TDPRQGVSANQSVEAVRGIVDRTQAPQGVKAFVTGPAAFAADLGPAGNRT
VLLVTGLSLAVIFTMLLLVYRSVVSVILMLVVVGIELTVARGFVALLGNL
GFIGITTFVVNLLVALAIAAGTDYGIFFTGRYQEARRNGEDKEAAFYTTF
RSVAKVVLGSGLTIAGAVLCLHFTRLPVYQTLGVATAVGMVVAVAVAITL
VPAVIAVGSRFGLFEPKRKVTVRRWRRIGAAIVRWPAPILVATCAVALIG
LLTLPVYQPSYNDQKYIPQDIPANVGYAAASRHFPQSLMMAPDILLIEAD
HDMRNPVDFLVLNKLARGVQAVPGVSRVQAVTRPGGEPLKHTTIPFMLSM
SSASQSHLMPFQRNRMDDLLVQADDMLKTIAIMKRMQALTEQMVGTTHDM
VGTTHELEDIMNDLRDHVMDFDDFIRPLRNYLYWEKHCYDIPVCQALRSV
FDTLDGVDEVSDKLSDLVANLDRLDELLPQMAEQFPVMIETMESTRKMML
SMHSTMSGIFDQMEQTTNNATAMGKAFDAAQNDDSFYLPPEVFENEDFKR
VMDIFLSPDGKAARLLISQRGDPATREGMSLVQPIETAAVEALKGTPLRN
AKIYMTGTAASVKDIVDGSKYDLLIAATAALCLIFGIMLIMTRSFVAALV
IVGTVALSLGAAFGLSVLIWQSILGIPLNWVVLAMSVIILLAVGSDYNLL
LVSRMKEELGAGINTGIIRAMGGTGKVVTSAGLVFAFTMLSMVVSDLVTI
GQLGSTIGIGLLFDTLVVRAFMTPAVAALLGRWFWWPQRVRQRPARAFHA
SAGPRPLMSFLLQKQER
169631776YP_001705425.1 membrane protein MmpL [Mycobacterium abscessus ATCC 19977]MSGRPPLLAGLIRRLSVPIILGWLGMIAIVTFAVPSLEQVGRESSVSLVP
QAAPSFRAMQRMGEVFGESNSDSVAMVVLEGQQPLDDEAHAYYDSLVRQL
GADTTHVQHIQDYWGDPLTASGVQSGDGKSVYVQISLAGNQGQALANKSV
EAVRSIVERSAPPPGVQAYVTGPAPLVTDMNDAGNSSIIKITAVTLVVIF
TMLLFVYRSVMTVILLLIMVGIQVQAARGIVAFLGDQGVIGLSTFSVNLL
VSLGIAVGTDYGIFFTGRYQEARQCGEDRETAFYTTYSGVAKVVVASGLT
IAGAIFCLSFTRLPYFQTMGIPAAIGMAVAVAVAVTLVPAVISFGSRFGL
FEPKRRMMVRRWRWIGTATVRWPGPILAAACAVGLVGLLALPGYQTSYDD
RLYVPQDIPANVGYAAAQRHFPESRMTPDVMLLEADHDMRNPADFVVLHK
LAKGLFAVPGISMVQSITRPEGSPIERTSIPFQISLQSAGMLQILPFGKE
RVDDMLKQAEDTTKMINQMQHTYELMSNISGITNETVVMNRELTATVDRL
RDYIANFDDFFKPLRNYLYWEKHCETIPICFAIRSVFQALDGTDLLSERT
HRILERVEEMNLYQRELIALFPPMITTMKSMRAMMLTMHSTMSGIFSLID
QTAANASAMGKIYDGAQNDDSFYLPPEVFENEDFKRAMSLFFSPDGKAVR
LILTYRGDPGTPDSLSRVNAVRLAAQEALKVTPLENATIHLAGTAATFKD
LRDGSAYDLLIAGVAALCLIFGIMLIMTRSFVAALVIVGTVALSLGAAFG
LSVLIWQNILGIELHWLVLAMSVIILLAVGSDYNLLLVSRMKEELGAGIN
TGIIRAMGGTGKVVTSAGLVFAFTMLSMVVSDLRVIGQVGSTIGIGLLFD
TLVVRAFMTPAIAALLGRWFWWPQRIRRRPAITSQAPAERRMRVLLDA
169631775YP_001705424.1 hypothetical protein MAB_4702c [Mycobacterium abscessus ATCC 19977]MLRLSLRGLSAVLGGLVLSSTVGAGIASADPDLDLAINTTCSYPQVIAAL
NAQDPQFGKALSQSPILQRGLREFLAAGPEKRAQTAQDVANAPAFQPYLG
VMEQAYRTCHNF
169631774YP_001705423.1 hypothetical protein MAB_4701 [Mycobacterium abscessus ATCC 19977]MPGQIRHMRKSLSRRRTSKGAAAMDNRLALADEALLAEHHAAGMNVIIQV
TWLYSHAIDLDALQRFRHNLGRGLLGRRIEAPALPIARHRWVIDHGPADI
DIEERARPRAEFSEWVDERSQLHIDPESGPGWHIGVLPLQDGTTAISLVL
SHNLIDGLGLALVIVEAVMGRTRDLGYPLPLSRRRLRALGQDVRQTARDV
PQATRALVAAVRLGRKQARDKNLPGLAPVAVRPAGSTAPSDEVVLVPAIT
IYVGLDAWDARAEALGGASHTLAAAFAARFGERIGRRRAHDGAITLQIPI
SDRTENDTRAMALSYARVSIDPVSLTTDLREVRAAIKQTLKTLKESPDES
KLLLWLPSFAPERTLKRMVARMPADPDQSVFCSYLGDLHSMIGWPAGTLA
DFQNARATGQRERRQLLERTGGRMFILSGRLNGKIFISVGAYQPGATNTK
EALRELAELTLADFSLPGEIH
169631773YP_001705422.1 hypothetical protein MAB_4700c [Mycobacterium abscessus ATCC 19977]MFYVENSARDISSMPRGGPNASWLDRRLQTDRLEYLDRDDVDDLKRRVMQ
SLDRAGRRRWIGIHEKCARMAIREVADVDRPKILELGAGLGGLSHKLLEM
HSTAQVTVTDVDPSFVAAVAAGEIGSHPRATVRQLDATEIDSPGGYYDLA
VFALSLHHLPPELAARVFATGTRVARKLLIVDLPRPPVPLHLALLAVVLP
LVAISPLQHDGFISSLRAYSPSALRALAHHADPAINVEFRSRRGLGPTVV
VASRP
169631772YP_001705421.1 hypothetical protein MAB_4699c [Mycobacterium abscessus ATCC 19977]MSPDGQGRPVLLFVMGMARSGTSAITRVISLCGGVLPAALAGANPANPRG
YWEPRKAIILNERILHRNGSSRFDTTLRLQEPDAFSAVEKTACIADIQGY
LATLPPAPLVVIKDPRINLLSDMWFEAARKSGFDVATVIAVRHPTEVVAS
VAAQAAASPEFSSALWLKFNLLAEAHTRDVPRVFVGYTNLLEDWRTEMKR
ISVALGVNLDARDDMAIEAFLETDLRRQKYCGPVTEPFGTDWMSVVYETL
CVAASDGPWDSAELDRVLAAYRSSERGFRMMVEDFQKFQKLSRRTRPSMM
KLIYEVMAAANGRRGTWA
169631771YP_001705420.1 hypothetical protein MAB_4698 [Mycobacterium abscessus ATCC 19977]MDSVGSDTPSPDAKAKTIRTQRFARSPIGIAARIGCEFPQENAPVSVVFG
PVWGLLLAMAIMFAVNPVLLAVIVLMISRPRPVQNLAAYWLGSMIVSLAG
LLVPLAVLHVAPSFRSFVENMAVPGSNVTTRVVNLGMGLLMLSIATLLAV
RALRERTHIPVAASNVPTVDSEKPRPITSPFGVSSNSGVAAGSIFRRVLR
HLQIAWEQGALWVAFVFGLCGLPPPMLVIFVLTPVVASGSTIGTQIIAVI
AFVFGMFTVAELTLICYLIAPARTIAVLQPLHDWALAHRRQMLITIFSIA
GIIQVINGVA
169631770YP_001705419.1 hypothetical protein MAB_4697 [Mycobacterium abscessus ATCC 19977]MWGSVLALVVLVALNPIRLGITLLVISRPKPVPNLLVYWAGCLIGCIPAV
VLPLTLLHVTPVFRSFAEGVAISPTIRHIQVGMGLLALSVAVLIATRPLL
RQRQYHMAISGNVPPTDADSPAPNPLSRLLGHADDDTSQDRSPFRRMLNR
ATFAWETGSLWVAFAIGLLLGGIEPDAGLFLIAILVTSGANTATQIIVAA
VFALGVLAIVELTLISYLVAPTKTHAVVQRVHDWALTHRRKILIAMCMVA
GISLLIHGLGGI
169631769YP_001705418.1 methyltransferase [Mycobacterium abscessus ATCC 19977]MMFGTREVFEYFSCSACDTLQIVNVLEGEDLMRHYPATYYSHNGSGQPSA
LQWLVTQRDRRKLDGGGRVFGALMSRPIPEGIFRVLLGGDAVNMLAELGI
GRDARILDVGCGSGALLDRLARVGFSSLLGADPFIAADGQSREGIPLLRR
YLGEVTGEFDLVMFNHSLEHMPDPVSTLQIAARKLTTGGMCLARVPTTSS
EAWSVYGADWVQADAPRHMVIPSRRGMALAAERAGLRVLRAFDDSTFGQF
TGSEAYRADVPVTDPKILTMFRPKQIWEWEKRAKRLNQQHRGDQTGFVLR
VK
169631768YP_001705417.1 putative glycosyltransferase/rhamnosyltransferase [Mycobacterium abMVVPPDLVGFAEEAGLAAVACGPDVRVWQDVNRDFWSRFLRNFWRNFWRI
RDLKELLREDWRFLTQCWQEVSSTLRSQAKDADLLFTGVLGEESAGNVAE
FYGLPFATLHVFPIRANGQLVPGMPARVGRSIMKLSEWLGWPLFKKLEDP
QRRELGLPKATKPSPWRITERGSLEIQAYDEACMPGLAAEWAEFGGLRPF
VGALTLDLPTASDDEVAAWIAAGAPPICFGFGSMPVESADRTLAMISAAC
DQLGERALLCAGGSDFSQVRHVENVKVVAAMNYSTIFPACKAVVHHGGAG
TTAASLRAGVPTLVLSTDLDQTLWGARVKRLKVGTARRFSASTERTLVAD
LRSILDPQCVARAREVATRMTKPAESPVTAADLLENFARVRRAD
169631767YP_001705416.1 glycosyltransferase [Mycobacterium abscessus ATCC 19977]MKFVLASYGTRGDIEPCAAVGRELIRRGHDVCMAVPPDLIGFVEAAGPTA
VPYGPDLRNVLDAHREFWTHFFRNFWRVQELIEKRREVVEPFLLCWKDIV
GTLTSLAEGADLLFTGVNFEDAAGNVAEYHDIPLATLHLFPLRSNGQFVP
FLPARLGRSAMKAGEWLAWQNAKKVERVQREELRLPRATKPSPWRITERR
ALEIQAYDGMCFPGLATEWGGFSSNRPFVGALTLDLPTDFDEEVAGWIAS
GTPPIFFGFGSLPVESADQTFAMISAACAQLGERALVCSAGSGFGDAPDA
ENIKIVHAMNYSAAFPKCRAVVHHGGTGTTAAGLRAGAPTLILSTDLDQT
LWGRRIKELKVGTTRRFSSTTVKTLTSDLRAILDPQCAARARELATHMTK
PIESVTKTADLVEGLAASYRCGSRA
169631766YP_001705415.1 cytochrome P450 [Mycobacterium abscessus ATCC 19977]MSKTAKIALPPGPPLPLAVQSILMASYGLRFLAGCQRRYGNMFTLRIPLS
GKVVYLADPADIKTVYAGDPHVFHSGEAHWFFRGLLGDSSLFVLDEDEHH
HQRRLLMPAFHRDAVARQATQMAQIAAANIAEWPVGESFPVAPRTTDITL
EVILRTVIGASDPVRLAALRKVVPRLLYMKPWETPAITNPGLRRYWPWTA
VGRRMAETDALLYAEIAERRADPNLTERTDVLAMLVRATDDDGRTMSDQE
LRDHLLTSIAAGHETTATALSWVLERLTRHPDALLKAAQAAEASAAGDPA
GDEYLDAVVKETLRIRPVIFSSGRVLKESVEVGGYQLPVGIMVDPAIGLV
HASGAVYPDPARFDPDRMVGTTLSPTTWLPFGGGNRRCLGATFAMVEIRV
VLREILRRVELNTTTAPDEKQQAKHVTFVPHRGGSISVRAIRTCAPAVTP
TCPADVHGTGQARDPQR
169631765YP_001705414.1 MbtH-like protein [Mycobacterium abscessus ATCC 19977]MVSGELLSINPFDDDNGSFFVLVNDEEQHSLWPAFVDVPAGWRVVFGAAD
RAACLDNIEQQWPDIRPKSLRERVAQGRTVEQ
169631764YP_001705413.1 non-ribosomal peptide synthetase PstA [Mycobacterium abscessus ATCCMDSNAGALSLTRGQLDIWLAEETGRSGAKWHLGMLGRIEGIIEHGLLEQA
VRQVIHEAEPLRAVFSELNGQVFQTVVDYPDTELAHHDLTGSPDPVGDAY
RIAGSIQKAPMPLDGPLFRFALMQVRPDDFYFFVCCHHIVTDGIGMGLLC
HRIAAVYSAIATDAPVPAPIFGSLRSLVESESDYEGSEDYLDDAAYWASC
GPLDDELRYGTPPAAAARLAEYEPSAPIQLDPAVVAKARELSHALGVRRA
AVITAACALLVHGEVGGAEVVLDFPVSRRVRPEALLVPGMSSGVVPLRLT
TSPYTSVADFCEHVATRIQEALRHQRFPLRDIESKTGFQRGGWPSRHAAV
NFIPTTRLADFAGAAGSGTVTHTGLVDQFGLVFIKNDDELFLSTTGVGEL
FPDCDARTLADRFERVLSEMTADPRRPLSAIDVRAEAQCPQLDLWSNRGA
LTHPVPRPLSIPELFAEQVVRDPGAVAVSCGGRSVSYRGLDEASNRLAHL
LISHGVGPGQRVALLLSRSVEAVVAIMGVLKTGAAYVPIDPSVPDARLRF
VLCDAGPVVVVTTAELADRLAGHGLTVVDIDGRAVYGQPSAALSIMPHPD
DVAYLIYTSGTTGTPKGVAIPHHNVTRLLEAIDADLELVPGQGWAQCHSL
AFDFSVWEIFGALLHGGRLVVVPEGVTRAPEELHALLVHERVSVLSQTPS
AFYALHAVDTASPEQRQLALSVVVFGGEALEPARLSDWFQDHPQSPRLIN
MYGITETTVHASFREITVSDVVGTSSPIGAPLADLSFFVLDDWLRPLQAG
AVGELYVAGAGVGYGYAGRTSLTATRFVACPFGGRGTRMYRTGDLVCWGS
DGQLRYLGRADEQVKIRGYRIELGEVQSALAALEGVDQVAVIAREDRPGD
KRLVGYFTGSADPGELRETLTDRLPSYMVPAAIVVLESLPLTVNGKLDRN
ALPAPEYRAVERYRRPATVVEETLAAIYAQVLGLERVGADDSFFELGGDS
ILAMQVSSAVRMAGLACRPRDIFVQQTVARLAEVVVAGDTIAEPLDEGTG
PVTATPIMRWLKEIGGPVAEFNQTVVLQAPDGVTGAAVIAMLQAVLDRHA
MLRLRAEDHGNGGWLLSAAAPGAVEAAQCLESIDRLTDEALLAARSRLDP
AAGAVLSGLWVDSTHRLVLIVHHLAVDGVSWRILLEDLNIAWTQQQDGRP
IALPRPGTSFRQWAELLSEYTRSEPVVEQAQRWQTVSAVPALLPPVDPEA
DTYETAGQLSAALDTETTRLLLGAVPAAFHAGPQEILLIALGLALAEFSG
TTQIAIDVEGHGRHEELGELSGAGARSIDLSRTVGWFTTKYPVSLDLDGL
AWSSVVAGDAALGAMIKAAKEQARALPDGLTYGLLRYLNPAVDLAASDPS
IAFNYLGRVSGLTGAGWQLCPDSASLSRAASRVPTPLGHPLELNAIVIET
EAGVLLNADWTWARSALDQTQVGRLNELWFQALTGICAHVRSGGGGLTPS
DIAPAVLNQGQIDELSRQHHFTDLLPLTPLQQGLLYHSGTARGCDDVYAM
QLSLVLDGQLDPQQLRDAVQSVVDRHPHLAARFYERFDPPIQAIPTDPVV
PWQYLALDFNGTDIDGQVQEISAAERVAVGDLANRCAIRAALIRTADEQH
RFILTTHHIVLDGWSMPILIQEIFASLRGQRLRPAASYRSFVTWLSERDQ
VAAQHAWRKAMAGFDAPTLVGPSTPDGPGHRGVESFQLPEEITKNVGELA
RSRQTTVNVVLQGAWALLLSSLCGHGDVAFGTTVSGRPAEVLGAESMVGL
LINTVPVRATIGAATTTAELLGQLQGRHNDTLEHQHLALSDIHRITGQER
LFDTLMVFENYPIDVTERWDIEGLAVTGFDFRESNHYPLAVQVLPGSALG
LRIEYDSGVFDCAAVKALFGRLTTILSAMTADPGLPLSSIDLLDDAVRTQ
LDTWSGRESLIDPPAVKSIPELFGEQVERSPGAIAVTCDGRSLTYRELDE
SANRLARVLADRGAGSGETVALLFSRSAEAIVAMLAVLKTGAAYVPVDPA
LPLARIEFMVADTAPILAVTTTEHRPRLGDIELCIIDINEPSPDVQAETA
PPGPTPDDIAYIIFTSGTTGTPKGVAIAHRNVPGLFDALNAQVPSGTGQV
WAQWHSYSFDVSVWEIFGALLHGACLLVVTEQAAASPGELHELLVTQRVS
VLSQTPSAAGMISPQGLESTALVVAGEACPPELVDRWAPGRVMVNAYGPT
EATVYASISAPLQSGSPVLIGAPVPGVALFVLDQWMRPAPPGVAGELYVA
GRGVGLGYWRRTGLTSTRFVACPFGEPGGRMYRTGDLVQWDDGGQLRYLG
RADEQVKIRGYRIELGEVQAALATLDGVTQAVVIAHEDQGGTLRLVGYVV
GKADPDRIRTQLAARLPGYMVPAAVVVIDALPLTVSGKLDRRALPAPDYV
DAARYRAPSNPTEEILTDIYARVLGHERVGIDDSFFDLGGDSLSAMRLLA
GINAALNTGVTVRTLFDAPTVAQLCTRISRDETRVAPLTARERPARVPLS
FAQSRLWFLDQLQGPSAIYNMTAAFRIDGELDADALAAAFTDVVARHESL
RTLFEAPDGVPHQMVMPAGGAEPGWEVIDAGDWSVGQLREAIDEISRHAF
DLSAEIPLKAALFRVTDNEHALVVVVHHIAADGWSIAPLMADLGTAYASR
CAGEAPAWADLPVQYADYSLWQRAQFGELQDSDSPIARQLRYWHGALAGL
PERITLPTDRPYPLAADQRGATIAVNWPVELQRQIAELAAENNATSFMVV
QAALLILLSRLSANSDVAVGFPIAGRRDPALDQLVGFFVNTLVLRADLAG
NPTICEVLEQVRVRSLEAFDNQDVPFEVLVDRLNPVRSLAHHPVVQVALA
WQNFAGRHVNDSAAGVELGDLRISQMPVETRTARMDVNFSLAERWTKSGE
PAGIGGTVEFRTDVFDARTIQSLVTRLQRVLTAITANPAARLSVVDLLDD
DERCRLSVLGNHATLARTPSRPASVTGLFAEKVSRTPEAVAVSCGERSWT
YRELDSAANRLAHLLIDQGAGPGQVVALLSNRSAEAIAAILGILKTGAAY
LPIDPAVPDARLTFVLADAGPVVAVTTTDLADRLDGRGLAIIDIRGVGPH
PPDAGFDGAIPDPEPDHTAYLIYTSGTTGVPKGVALSHRNVTQLLDSLDA
GLPHPGVWSHSHSLAFDVSVWEIFGALLSGGRVVIASEGATSSPEDLHAL
LIREHVTVITQTPSAARALPREGLDSAALVVVGEACPAEVVDQWAPGRVM
INAYGPTETTMCVAISAPLTAGQGVPIGTPVTGAALFVLDESLRQVPVGV
VGELYVAGRGVGYGYVGRAPLTSTRFVACPFGDPGTRMYRTGDLVCWRPD
GQLNYLGRADEQVKIRGHRIELAEIQAVLASLGGVEEAVVIAREDRPGDK
RLVGYITGTADCGGLRMAIADRLPAYMVPAAVVRLDAIPLTVNGKLDTRA
LPAPDYGDHGRYRAPANAVEEVLADIYAQVLGLERVSVDDSFFDLGGDSI
LSMQVVSRGRAAGLLCRPRDIFVEQTVARLARVVQVTAGSRGPIDEGLGH
VVPLPIMLWLKGIDGPIEEFNQSVLVQAPEGVAEDDVVTLLQSLLDRHAM
LRLRVSGDGVGGWSLTVPEPGSVDAATCLHTAEYLSDSAVVTARSRLDPA
AGVMLSALWVTSTSQLVMIVHHLAVDGVSWRILLEDINLGWAQHRDGQSV
VLPAAGTSFRRWAELLTALAHDPGVVEHARTWREVSAAPAIFPAVRPDTD
THETAGQLSVSLDVETTRMLLGAVPAAFHTGPQDILLIAFGLALAEFAAT
DTPIGIDVESHGRHEEIAAGIDLSRTVGWFTAKYPVSLSGRGVRWSDVVA
GNEALGAALKDAKEQLRGQPEGLTFGLLRYLNPGANLATSDPTVGFNYLG
RLAGGAAAMSDDLWRIPADGMSAVSVAAAIPMPLTHTVALNAGAVETDDG
PQLQANWTWASSALDRDQVSRLSQLWFDALTGICAHVRAGGGGLTPSDIT
PARLSQRQLDELQQQYLIADVLPLTALQQGLVFHSGAGNGPEGDLYVVQL
DITIDGALEPERLHGAVHTVAARHPHLAARFCGQFEQPVQLIPAEPTVGW
RYVDLSAEWNCADKDEELQRLCAAERAAVCDLTEPPAFRVALIRVAAERY
RFVLTNHHIVLDGWSLPILLQEIFAAYRGQRLPAATPFRNFVSWLAARDT
AAAQAAWGEVLAGFQTPTLVGPPQKSGLGRRGVRTHQLSGRLTGALGELA
RAQHTTVNTVLQGAWALLLTSLTGQQDVVFGSVVSGRPADVPGAESMVGL
LINTVPVRANISAATTTAGLLDQLTKEHAKTLEHQHVPLSEIHRIAEQER
LFDTLFVFENYPVDTGVLSGADGFAIDEIISHESTDYPLTMQAIPGGELR
LRIEYDTALFDVCGIETFVKRIESVLSAMVADPRRPLSAVQILDETERDR
LQRWGNQGVLTHLAQPASIPELFARQVTRSPKSIALVCEDRSLTYLALDE
ASNRLARFLIGRGVGPGERVALMFPRSAEAVVAILAVLKTGAAYLPIDPA
LPGARVEFMVSDAGPMAVVTTAALAERFSGFGLPVVDVQDPAIAAECGAG
LTMPSADGMAHIIYTSGTTGLPKGVAVTQRNVTQLFDSLQIGVPLEPGQV
WTQFHSYSFDFSVWEIWGALLHGGRLVVVPETIARSSRDFHRLLVREQVT
VLTQTPSAVSMLPVDGLDVATLVIGAEPCSPELVDRWAPGRTMVNVYGPT
ETTMWLCASAPLAPGLGAPPIGSPTAWAAFFVLDEWLRPVPAGVVGELYL
GGAGVGIGYWRRSGLTAARFMACPFGEPGSRMYRTGDLVRWRADGQLDYL
GRADEQVKIRGYRIELGEIQSALAALDGVENAAVIAREDRPGDKRLVGYI
TGAADPVGARTALAERLPGYMVPAAVVGLAALPMTVNGKLDVRALPAPDY
QDVDRYRAPVGAVQEILAGIYARVLDVERVGVDDSFFDLGGDSVSTMRLV
AAVNAALNADLSTRTVFDAPTIAQLALRIGEGAGGPEPLVVVERPEVIPL
SFAQNRLWFVDQLQGPSPVYNMPVGLRLYGRLDAAALGAALSDLIGRHES
LRTRFDAPGGNPRQIVLPDGPIDFGWEIIDATSWQTGQLDEAIAATVCRS
FDLAIEIPLYARVFRIAEEEHVLVAVVHHIAADGWSLTPLMHDLSVAYAS
RCRGHAPDWAPLPVQYVDYTLWQRAQLGDLGDGDSPISAQLAYWEGALAG
LPERVALPTDRPYPPVADQRGSTVEVQWPPELQQQVRATAREHGATSFMV
MQASLAVLLASISGTSDVAVGFPIAGRRDTALDQLVGFFVNNLVLRVDLS
GDPTVAELLTQVRQRSLAAYENQDVPFEVLVERLNPIRSLAHHPLVQVAL
AWQNLPWQDTGPADGLRLGDLRVEPLSVDTQTARMDLTFSLGERWTMAGE
PAGIAGAVEFRTDVFDADSIEALIARWQRVVASMTADPSRRLSSIDVLDE
AEHTRVDRWGNRELLNRPPAVRRSVPALFAEQAARVPHAVAISFNGRELT
YREVDQASDQLAHRLIAQGVRPGESVALLTERCPEAVVAMLAVLKTGAAY
LPIDPALPDVRVEFMIGDAAPTAAITTADLTDRLAGYALTVIDVGDIAEG
ASSGAGSSLPLPSPDDIAYIIYTSGTTGVPKGVAIAHHNVTALMGSPATF
LAGHTWAQWHSYAFDASVEEIWGSLLHGGRLVVVPESAAHSPEHLTALLV
AEQVTALSQTPSAVALLTPESLDAVSLLVAGEPCPGEVVDRWAPGRLMVN
AYGPTETTICASRTAALVGGTGSPSIGAPVPGAAMFVLDGLLRPVPPGVV
GELYIAGHGVGVGYAGRTGLTASRFVACPFADAQLPGQRMYRTGDLVRWR
ADGQLEYLGRADEQVKIRGYRIELAEIHSVLTALDGVDQAAVIAREDRPG
DRRLVGYVTGTANPAKLRAQLAEQLPAYMVPVAVVVLAALPMTVNGKLDT
RALPRPEYQDIDRYRAPGTLTEEILAGIYARVLGVERVGVDDSFFDLGGD
SLSAMRLIAAVNADLNAVVSVRTVFEAPTVGQLAPRIADASSSLSPLVAA
ERPAQIPLSFAQARLWFLDQLQGPSPVYNMATALRISGALDVDALGAGLA
DVVARHESLRTQFRATGGVPQQVVVPAADAHFGWDVVDATGWTTSQLREA
IGEAARHTFDLSNEIPLYARLFRITGDEYVLAAVVHHIAADAWSITPLVT
DLGVAYVSRRAGHAPGWAPLAVQYVDYTLWQRAEFGDFADGGSRIAAQLD
YWQDALAGMPERVELPTDRPYPSTADQRGSTMAVQWPAALQEQIARVARE
HNATSFMVLQAALGVLLSKLSGNTDVAVGFPIAGRRDPALDELIGFFVNT
LVLRLDLSGDPTVAELLAQVRARSLAAYENQDVPFEVLVERLNPTRSLTH
HPLIQVALGWQNVPGQDNGSSGPGLALGDLEVTPMDADTQTARMDLSFSL
AEHRTRDGEPAGIGGTVEFRTDVFDPASIERLLGRFELVLTAMTADVESR
LSSIDVLDPAEHARLDSMGNRALLEQRAINPVTVPALFADQVARTPEAVA
VTCGGHALTYRELDDAANWLALRLSRAGVVPGGCVALLLERSSQAIVAML
AVLKAGAAYLAIDPVMPSARIDFMLDDAAPTAVVTTSGLAGRFDGREMSV
IDIGELADVDDAEMEIVHSPANPGPEPDDIAYLIYTSGTTGVPKGVAVTH
HNLTHLARSTPAQLPANQVWTQCHSYAFDFSVWEIWAALLGGARVVVVPE
SIVSSPEDFHTLLVRERVNVLTQTPSAAGALSPAGLDSVALLLGGEACPG
EVVDRWAAGHTVINAYGPTEITVYASMSAPLAAGSGAAPIGAPVSTSALF
VLDEWLRPVPVGVVGELYVAGEGVACGYLGRSGLTSARFVACPFGVPGAR
MYRTGDLVSWRPDGQLQYRGRADDQVKIRGYRIELGEVQAALSALSDVSQ
AAVIAREDPPGVTRLVGYVTESVNGVAEPDRLRNALANRVPGYMVPSAIV
VLEALPLTVNGKLDIRALPAPEYQDAERYRAPADAVEETLAGIYAQVLGL
DRVGVDDSFFDLGGDSILSMQVVARARACGVVCRPRDIFVEQTVARLAQV
VGVVDEDSGPVDEGVGPVAATPIMRWLRDVEGTGAPTDQFNQTAVIQAPA
GASESDVEMVLGALLDRHAMLRLRVENWMLQVPEQTLTAPCLQSVEVLTD
AELLAARARLNPAAGQMVSALWVASTGQLVLVIHHLAIDAVSWRILLEDL
NIAWGQHRHGQPVALPKAGTSFARWAALLEEHAYDRDVVDQTDRWRRVLA
TPPALPAACPELDTYASAGHYTASLDVETTRALLGAVPAAFHAGVQDILL
IGYALALTEFLGVTLPVGIEVEGHGRVEDLGGCVTEIDLSRTVGWFTTKY
PVALAVSGKPGRSAGRLRWDQVVAGDPLLGAVIKDAKEQLRSLPEGMTYG
LLRYLNSDVDLTGAEPTVGFNYLGRLGGGGAGRAEFHDQLWQVSPDTAAV
AAAVTALPMPLTHTVELNASTAETEDGPSLYAAWTWAPSVLDEVQAARLS
RLWFDALAGICAHVRSGGGGLTPSDIVPARLTQRELDDLARDHAIDDVLP
LTPLQHGLLFQANTSRGNSDDVYAMQLDITITGPLDADRLREAVRAVVNR
HPNLAARFDKRFDEPVQIIPANPTAPWQVVEIDVEQADYEQRLQGLCAAE
RAAVCDVVNQSAFRAALIRIDENEHRFVMTYHHIVLDGWSLPILLREVFA
SYYGQRLPVASSYRRFVTWLIERDVDGARRAWCEVLKDFDRPALVAPKGR
LPGRRATETFRISADISDAVGQLARSQHTTANTVLQAAWAQVLMWLTGRH
DVAFGVAVSGRSAEVAGADSMVGLLINTVPVRVTVTPDTTIAELLANLQR
QHSDTLEHQHLALSEIQHAVGQEQLFDTLFVYQNYPVQTMASSMPDGLSI
TAVSGREYNHYPLTLQAMPGNELVLRVEFDTGLFGESRVRKVVERFQRVL
EAMTGEVR
169631763YP_001705412.1 non-ribosomal peptide synthetase PstA [Mycobacterium abscessus ATCCMKADATRRLLSMDLDDDDERAEWEEWGNRAALERSAPSLSIPELFAEQVV
RDPGAVAVSCGGRSVSYRGLDEASNRLAHLLISHGVGPGQRVALLLSRSV
EAVVAIMGVLKTGAAYVPIDPSVPDARLRFVLCDAGPVVVVTTAELADRL
GGSGLVIIDIDDVSSGPGAAQTDGPQLSAPCGSDIAYVIYTSGTTGTPKG
VAIPHHNVTRLLEAIDADLELVPGQGWAQCHSLAFDFSVWEIFGALLHGG
RLVVVSDSVVRTPDRLRALLIDERIGVLSQTPSAFYALLAADADRSQDAR
LGLDVVVFGGEALEPARLSDWFQDHPQSPRLINMYGITETTVHASFREIT
VADVVGTSSPIGVPLGHLAFSVLDEWLQPVSVDVVGELYVAGSGLGYGYV
GRAPLNATRFVACPWGGPGTRMYRTGDLVSWGTDGQLRYLGRADEQVKIR
GHRIELGEIRSVLNGLNGVGQAVVIAREDRPGDKRLVGYFTGTADPAELR
AALTDRLPSYMVPVVLVALPRLPLTVNGKLDLDALPAPEYQSVDQYRAPT
SPSEEILAGIYAQVLGLDRVGMDDSFFDLGGDSLLAMRLVAALNRSMDAG
LEERAVFDAPTVAQLMLRIGGGEHTLEPLIAGERPAVMPLSYAQSRLWFI
DQLHGPSPVYNLAVGLRLQGVLDADALEAAFTDVLDRHESLRTMFPAVDG
IPQQLIVPVEHVEFGWEVIDACDWQTDRLDSAVAESAQHSFVLSSEIPFK
ARLFRVAADDHVLVAVVHHIAADGWSITPLVADLGVAYASRCAGQAPDRK
PLAVQYADYTLWQRAQLGDLDDSESRIARQLTYWENMLAGMPERLALPTD
RPYPLVADQSGSRVDVAWPAELQQRVNGLAREHNATSFMVMQAALAVVFS
KLSASSDVAIGFPIAGRRDPALDELIGFFVNTLVLRVDLAGDPSVAELLA
QVRARSLGAFENQDVPFELLVERLNPARSLTHHPLVQVMFAWQNIPGQID
DSGREMALADLELTQLPLDTHSARMDLAFSLAESWTEAGEAAGISGTVEF
RTDVFDARSVEILIDRLRRVLDTMTADSARPLSAIDVLDAEELARLDEWG
NRAELAQPVTSVSIPALFAQQVSRVPGAVAVSSAGGHLSYQELDEASNRL
AHKLIEYGAGPGERVALLFARSAEAIVAIMGVLKTGAAYVPVDPSVPDAR
LEFVLADAEPAVAVTTSDLMDRLDACGVVVIDVDDPELAVQPAYTPLTRL
SADDIAYLIYTSGTTGVPKGVAIPHKNVGRLLHVLGGDLELSAGQVWSQS
HSLAFDFSVWEIFGALLHGGRLVIVPETVVRSPEEFHALLVDEQVSVLSQ
TPSAFYALQTVDAMVPERAGQLGIEVVVFGGEALEPQRLKPWMERHPVLP
RLVNMYGITETTVHASFREIVSADTEVTVSPIGSPLAHVGFFVLDRSLRP
VPAGVVGELYVVGAGLGYGYVGRAGLTAARFVACPFRVGASGQRMYRTGD
LASWGPGGQLQYAGRADEQVKIRGHRIELGEIHSALTAAPGVEQAAVIAR
EDRPGDKRLVGYVTGTADTARIRAQLAECLPSYMVPAAVVSLAALPLTVN
GKLDKKALPAPEYSDIDHYRAPATLVEEILAGIYAQVLGLERVGVDDSFF
DLGGDSISAIQVVWRAHGAGLIGRPRDIFVQQTVARLARVVRMADGSDGV
IDEGVGSMVATPIMLWLKGIEGPIDEFNQTVVLQAPAGVTEAAVLIMLQA
LLDRHSMLRLRAADDGAGGWALTVPEPGTVNAADCLHAVDVLSDETLVAA
RSRLDPAAGVMLSGLWVAATGQLVLIIHHLAVDGVSWRILLEDLTIASTQ
LRGGQQVLLPPAGTSFQRWSDRLAEHARHPDVVRQAGAWRQVGSIASSLA
APRPTEDTFATAGRLTEFLDAETTHMLLGEVPAAFHAGVHEILLIAFALA
WAQHLGTGAAPIAIDVEGHGRHEDLPARSGTSEGNIDLSRTVGWFTTKYP
VSLAVGGLRWTQVVAGDAALGAVIKEAKEQLRAMPDGLTYGLLRYLNPDV
DLPESDPAIGFNYLGRLGSPAAYASGDVWRFSQEGLSLTGAAGAMPIALP
HTVELNAVTIDTDTGPHLNATWTWAPTALDRMAVTRINRLWFDALAGICA
HVRRGGGGLTPSDILPARLSQQQIDGLQSHFPVADVLPLTPLQQGLLFHA
GIAKSSGDDVYAVQFEIALGGVLDAERLHEAVQTVVARHPHLAARFCDQF
EQPLQIIPAQPVAPWMYIELADGIADSDTEEQIEKICAAERTAVCDLAEQ
PAFRAVLIRVADNRYRFVLTNHHIVLDGWSMPILMQEIFAGYHGVRLPPA
ASYRSFVTWLSERDQVAAQHAWRKAMAGFDAPTLLGPPQKLQFGRRSVDL
FRVPLRTTRALTKLARSQQTTVNVVLQGAWALLLSSLCGHGDVAFGTTVS
GRPAEVLGAESMVGLLINTVPVRATIGAATTTAELLGQLQGRHNDTLEHQ
HLALSDIHRITGQERLFDTVFVYENYPTDTRAAADVNGLAITGLSSRDYY
HYPIAVQAGPGRELELRVQYDTDVFDAESIKELIERFKQVLVAMTAHPGR
QLSSLDLLNGIGRDRWSERSSRVEGQSVDTRDTNSTYCRPATLNEQILSS
IFAHVLGVDRVGVDESFFDLGGNSLGAMRVVAAINTALNANLTMLALFDA
PTVRNLAQQLESTSAR
169631762YP_001705411.1 hypothetical protein MAB_4689c [Mycobacterium abscessus ATCC 19977]MKTGGLVKAIAKVVAFGVVELAVFGLVLFLLAGTVDYWQVWTFLVVFALS
TWIPTVYLQRADPAAHQRRKRAGPVAETRSLQKVLIGSWYFSLAAMVVIS
ALDHRFGWSSVPPAICAAGDVLVAVGLGVTSLVVVQNGFAASTVRVETGQ
TLVTTGLYGLVRHPMYTGNFITIVGFPLALGSYWGLACVVPSLLVLIVRI
VDEEKLLVEELDGYRAYTRAARYRLMPYVW
169631761YP_001705410.1 hypothetical protein MAB_4688 [Mycobacterium abscessus ATCC 19977]MIASGYVLSTDTAVTLLAAGLIFLLSLVLGVWKYRQMVTGPNHLAHPYVD
TAHRAALLYSFATLLTAVFVELSAWPSWVNLTAAMMLVFFFVAAIASYIA
HGALRDTTNQFEKPTIGLYLAMALLILGEIGGFSVLLAGFARAQWFS
169631760YP_001705409.1 TetR family transcriptional regulator [Mycobacterium abscessus ATCCMTDERRMRGRPPLPMETIVDAALQIVDEEGGEALSMRALARRLDSGTATI
YRHFANRTEVVAHVVDRVFGEVQLDDPALARMPWQDACIVSSRALFDALR
RHPNVAMLLADQIPVGPNVFMIREHTLTLCLQAGFSPAEAIRIYMTLGRY
VLGFANQIGAEHRASEADIAMLTRLVENIDLASYPSTLATAGVTLVPLDE
EFDFGLGLIVAGLEGLRHGE
169631759YP_001705408.1 glycosyltransferase [Mycobacterium abscessus ATCC 19977]MPRPAGWRPGLEICGYWWPQTDPQWRPDAALVDFLRAGPPPVYVGFGSTM
TSAKQSEHISQLVRSALRRAGVRGIVQAGWAGIDVGDETTLTVTEVPHRW
LFPHVAAVVHHCGAGTTAAGLRAGVPTVAVPGLGDQPFWARRLRDLGLSA
DTVPQRTLTVERLAAAIRTAVTDPGIKIRARRISDLLAAEDGAAHVVSSV
NRLLG
169631758YP_001705407.1 glycosyltransferase [Mycobacterium abscessus ATCC 19977]MADIVIAALGSHGDVAPLTGVGARLQQAGHRVTLTAYDRFASLVRSCGIG
FRGVSEPRESSDEADVDVTGALFQFLAPQGMRSLGTALLTALQDTPTDIL
LLSPFSELAGHPLAEAKGIPCAGIRFQPYSATADFPPATLGGWSAGPTGN
RLASRAGLSW
169631757YP_001705406.1 TetR family transcriptional regulator [Mycobacterium abscessus ATCCMIYNSIMRSKRGRDRTFTETARRQQIIACAIDVIAEVGYPQTTIRKIADR
AGIAMSVVLYHFGTKDGLIEAVIASMYQAALETVPPAINRARTQTDKLAA
YIRSSIDYFDTHRPQLTALAQLGTSYKPHSGKHFGDLGLTPELSEQLAQL
DPATLLRAGQKTGEFCYFPVDSTAIALQAAVNAVVEKILRDPEFDVHRYS
DDLVKMFSRMVRNA
169631756YP_001705405.1 hypothetical protein MAB_4683c [Mycobacterium abscessus ATCC 19977]MNKSIVAMLGGVGVAATVALLGAPIAAAGPTPPPGCYAGKSSVNNPQGSC
VTPGGVAYEQGAHQPTYEGANPHVPLGTNPHVPYGTYKINPSQSPSPDNA
169631755YP_001705404.1 hypothetical protein MAB_4682c [Mycobacterium abscessus ATCC 19977]MKKIMAVTGAALSAAGLSLATAAVALAGPTESPDSVINELKSNGYRVIVT
KVGSEHPSQCTVQGVSQQSGVQNVQPGRNMRNQPTTVPTAGQKVAYVTLA
C
169631754YP_001705403.1 hypothetical protein MAB_4681c [Mycobacterium abscessus ATCC 19977]MSDLAALLAFIHQVSGTPYISGGDTARGTDCSGLASWVANVATDRPAFGS
RFNTGNQERALLARGFKYGTAPGALVIGWNGGHTAVTLPDGTAVSSGEGG
GVRIGGGGAYQPQFKRHMYLPMDSDDAAGSAPLDVPADAEGPEVIPASVL
VPQPESVPADEAPAQVAPVEI
169631753YP_001705402.1 putative short-chain dehydrogenase/reductase [Mycobacterium abscessMNGNSALLQGKNVIVTGGARGLGAAFSRHIVSQGGRVVIADVLDGDGRQL
AAELGDAARFTHLDVTDAEQWRELIDTTLAGFGTITGLVNNAGISSAAMV
ADEPLEHFRKVIEINLVGVFIGMQAVIPAMRAHGCGSIVNISSAAGLVGL
ALTSGYGASKWGVRGLSKVAAIELGRERIRVNSVHPGVIYTPMTAKEGFR
EGEGNMPIAAMGRVGNADEVAGAVAYLLSDAASYVTGAELAVDGGWTAGP
TLTTITGQ
169631752YP_001705401.1 putative dioxygenase [Mycobacterium abscessus ATCC 19977]MYTISINGTQLTFDDQGLDNGPAILLLTGWGHDHRAYDEILPYLVPHHRV
IRMDWRGHGLDRTPVADFGPAEQFSDIIGLLNALSVRSFVPVAHAHAGWT
ALELADRLGTTRVPAVMLVDLIMTAAPPEFLQGIRAFRDPMGWQSSRLEF
LRAWLAGSDNAAVNRHIRSEMGGFGFDVWARAGRVIEDAYVTWGSPMSRM
EKMAEPPHVHHIFCTRERTGYDDLHDEFQHRNPWFSYKRLNGATHFPQLE
LPARVAEEVLGLLKAAGGNH
169631751YP_001705400.1 hypothetical protein MAB_4678 [Mycobacterium abscessus ATCC 19977]MTSIHDATVRKFLDSDPALVGQLGYLGTDGRPLILPVWYRLTDDHLQFVT
HLKTLKVKAVQRDPRTVITVATQAEPYRYVQVQGEAKVDTDESGVRTALI
DITARYLGADRAEAYVDEHHSGPGEVIVRVCPLRVHAAL
169631750YP_001705399.1 hypothetical protein MAB_4677c [Mycobacterium abscessus ATCC 19977]MGLGPARCDSGVADIYRIPPNQAACGDNGRVMRQIAFGVTAIALVVVGPS
SGYARADPQACVPGDVARPQGELFASNNTATITDPADARLQDPLDDFSVQ
VSAMTVQNLALPVRSTRVDGVYWSQDNDRMTYERSRAFELACVDGDDLYS
IGEQVGRRFGQESVLTFEYLPAGDARVNAVAVEVPGVDRVRFHDVLLTDP
AARAALSGGSVTEDGWLILIADVKDIGIARRLVDAAGGRWQDVAIQYGKR
EFVETAP
169631749YP_001705398.1 putative carboxyl transferase/pyruvate carboxylase [Mycobacterium aMADEQLREDHVELLARRALTEDAARPDAVARRHAAGGRTARENISDLVDA
GSFVEYGRFAIAAQRRRRELADLIARTPADGLVAGTARVNGNLFGADRSA
CAVLSYDYTVLAGTQGALGHHKKDRLFDLIERMKLPTVFFAEGGGGRPGD
TDYPVVSMLDVRAFKLWAALSGVVPRISVVNGRCFAGNAVIAGCSDLIVA
TKDTSIGMGGPAMIAGGGLGEVHPDEVGPIAVQSTNGVVDVVVDDEEQAV
TVAKRLISYFQGAVAPGDGADQTALRTMIPERARRAYPIRPIIETLADTG
SVTFLREKFAPEMATALARIEGRPIGVLANNSMVMAGAITAAASDKAARF
LQLCDAFGLPVLSLVDCPGYMVGPAAEAEALVRRASRMLVAGAALRVPLV
SVILRRGYGLGAQAMTGGSLHEPLLTVAWPNAHLGPMGLEGAVRLGLRKE
LEAIADESAREEAVRQATAAAQENAKAINAAQIFEIDDVIDPAETRSLVA
STFAAAMREPLPLRRSVVDTW
169631748YP_001705397.1 acyl-protein synthetase [Mycobacterium abscessus ATCC 19977]MDLVTMLGMPGEALRVTREEWRRSLTDVLRESFALHFERNGFYRAQCDAA
GLIPSGIRDGADLHRIPLLPVSMFKQAGAHVLMTCGLEDVEIEIRSTGTS
GVPSVARRDSMTVTRASVGIFGGYRDFLGISQGAGLFLCPSTAEVPEMGM
VKIFNLLTGMLDDHRYVVREYSFDPDEALAQLRNWEGKMTRHLIGPPFII
ARFMKYLELEEIPLTLDPDSLIIMLGGWKQYTGNSISRDDFNEKAQRVLG
IDPTHIRDMYGMIESNMLAIECEHQRKHVPPWCYVSIRDVTDASVELEPG
KTGGIAILDALNTAYPGFLLSDDIGEVDESDCPCGRTGQTVKFRRRRQGA
ELGCCAVSIEKYIDSQEVVAECELVPAGATPGATG
169631747YP_001705396.1 nitrogen-fixing NifU-like protein [Mycobacterium abscessus ATCC 199MPRFSPAVIDHFTNPRNAGRLDQADVTAFIGNPVCGDQILLSAQIRDEVV
SRIGFEAYGCSASLAVASILTERLSGMPVRDIETIQAAQVIEWSGGLSPE
QQHVAALGADVAQRLANNYRNGIHEDVSALPGS
169631746YP_001705395.1 putative aminotransferase/cysteine desulfhydrase [Mycobacterium absMSAPSQVLNPPTQVAPTEIYLDYAATAPLHPRAAQAVLNGHQLVGNPSSR
HGAGRDAADALAAARKTVARLLGADAEEVVLTSGGSEANTLALWGTFAAV
GFRGHLVTSSIEHPAVLANAHALRDLGVQVTLVDPAPSGHICSADVAQAL
RPDTTLVSVMHANNETGAIQPVWEIADIARQSGVAFHTDAVHTAGKLDLT
VVGATMMSVSAHKFGGPRGIGALLVRSGHRLLPVTRGGPQENRLRAGTEN
VPGALGMAAAADVCLRTVEREYRLGMRKRREQLIDGLRAVGGVHLNVTEP
VLEETVSVRFDGVRADTLADHLDMHGIYVSTGSACHAGEDTVSHVLRAMC
LTEDQARGTVRFSLGPGVSPADVDTVVAVTVQAVHRLRATAGGMIR
169631745YP_001705394.1 ABC transporter permease [Mycobacterium abscessus ATCC 19977]MIVAVKNLVAERARFVLSVVGVAVAVILVLVMSGIFVGTTNQVTTYIDHS
KGAVWVVQPGVSQMFRAVSWLPAEGKDRLLKVPGVQSAEPILGLPSDFVH
KGGHTAYFVVGYDTATGIGGPWSLAEGRNVAGSGEVVLDRVLAKKNKIHL
GDTVRLVDGDFTVVGLSKQTAAVGNFYAFISLVDAAHLLRAGNRVSYFLV
QPTVGFTGDQVVDSVRKSVPGMDAFTSETFAENSRAIVISMIGRPLRTMI
GIAALVGVALVGLTVLAVTTEQMSDFGVLRALGVRPVQLCRTVIAQAALI
AGLGYILGAGITYGVQFLVKDRLGDVTVEVTPAMLAGMAAATGVMAVIGS
LIPVRRVTRIDPAQAFRR
169631744YP_001705393.1 ABC transporter ATP-binding protein [Mycobacterium abscessus ATCC 1MNSPERPNVSPEPVLQLKGVAHQYGTGAAAVHALRGLDLTVNTGEVVLVV
GPSGGGKTTALLVMGLLLTPVSGLVRIGGRDVGELAERDRAHIRLEKLGF
LFQEYNLLNALTSAENVALPLRYAGVSKDKAMSRARGLLADVGMEHRTDH
RPPALSGGEKQRVAAARALVARPGLVLADEPTANLDSATGKRVAAQLADA
ARSQGAAVVIVTHDLRLTDIADRVLHLEDGVLLEKENQ
169631743YP_001705392.1 hypothetical protein MAB_4670c [Mycobacterium abscessus ATCC 19977]MTEMVVLPEDAEIIGALRGALIKLLPPEDLAQVDLDAVNAQTALLGLPVD
SVVLMALMNEMEDRFTVFIPEEDAFAFSVVGDIGAFIRGRLRAKAVRREQ
A
169631742YP_001705391.1 AMP-dependent synthetase and ligase [Mycobacterium abscessus ATCC 1MSDRGIRQHVEINAPAMRSGAIDYPGLLRAGLEELDFYDSRRHLYTRAGA
DLVVDIRIRAAALRERGLRRGDRVAMTAASDEEYLATLLAVLLLGAVPCA
IAPPPTPSRPDSAGVAHLRAALEVLSPAVVIAQPRVMVAVVHPNVLAYDQ
LGDANPIEWELLSTAHPADVHHIQLTSGSTSAPKAVVLTHGNVVHNASAI
AYGTRASRRRDRVFSWLPFYHDMGFIQVLAALLYGLRVGVMTPMGFLRDP
ISWLRHMSHHGSTHTAGPPFAYRAVSDAIGRGDPLVDVDLSSLRHAYVGA
EPIPYPVVCDVTARLGLLGMRNDVLVPCYGMAETVLATSIALQPYPPGET
AFGRVYGRRSPENGQLVVSCGRPVDGLRLRVLSAEGEVLADGAVGDIQVS
GPSVMRGYLRPDGGVVAPEGGWHSTGDRGYLDGGELFVVGRRKEMLIVRG
RNFPPYDVERQIDQLSGAGGVSVVFTVQDERRARESVVAVVGTRAAAREY
EGLRSRVAGGVRAAFGFSLDDVVVVPARAIPRTTSGKRQRLKVREAYLSG
LLSPAGG
169631741YP_001705390.1 putative amidohydrolase [Mycobacterium abscessus ATCC 19977]MSESAFDPAPVRQIWQELGIPGIVDVHTHFMPKSVMDKVWAYFDSAGPLV
GRPWPITYRADESQRVTTLRDFGVLRFTSLVYPHKPQMAAWLNQWAAQFA
AQTPDCIHTATFFPEPGAADYVREAIDAGVGVFKVHVQVGAFSPTDPLLV
PVWGLIEDAGVPVVIHCGSGPAPGEFTGPDPVTALLKQFPHLRLIVAHMG
MPEYSEFLDLCEQHDEVRLDTTMAFTAFSNEKAPFPESDYPRLVEMGHKI
YFGSDFPNIPYGYAEAITALRRMPGIDDAWMRDVLYHNGARLFGVDTSAS
GR
169631740YP_001705389.1 hypothetical protein MAB_4666c [Mycobacterium abscessus ATCC 19977]MSATETYDWNLKGDWFDVCSCKLPCPCSFAQAPTHGDCLFTLVWHVSEGH
WGDVDLSGLGVVAQGEFQGNMWIGDPDATMKLMFYIDEDADARQRVALER
IFTGKEGGWPAEFASLIEELRGIEYVPIKFDKAEDLASWSAEIPGKVDLH
VEALTGPTADPNRRVTTANAPGAEVGPGQIATWGVVKKDHSVGFEWSHEH
SGGSSKHFPFDWRPDGAVPTVSDELAGAQQGGCCCSN
169631739YP_001705388.1 putative short-chain dehydrogenase/reductase [Mycobacterium abscessMRQLAASGARAVVNGRSQERVDAAVAEVGLQHGSVSGVAADVSTADGVER
LLKQLPEVDILINNLGIFGATPAREITDEQWRNYFEVNVLSAVRLIRAYL
PAMIGAGWGRIIQIASDSAIVIPQEMIHYGVSKTALLGVTRGFAKDAAGS
GVTINSVIAGPTHTAGVEDFVYQLVDKSLPWDEAQREFMKRHRPQSLVQR
LIEPAEIANLVVYLSSPLASATTGAAVRADGGYVDSILP
169631738YP_001705387.1 hypothetical protein MAB_4664 [Mycobacterium abscessus ATCC 19977]MTAITANSQAISTSVRRVVAAAGIGLAILVPTYAAIELTTAPTSSLAAGA
GNNGNGGGNRDHARLGTGQYTMNNSGPQMRYTPPPSGQYIGGIN
169631737YP_001705386.1 hypothetical protein MAB_4663 [Mycobacterium abscessus ATCC 19977]MYTPRASFTRSVIRSAVSFLVALAALAAMAVASFTSSAQAAAAGGGGSSA
SDTVDKLQAQGYTVQLNGIPTAPLSECVVTGIEGLRGATAFSTVYVDISC
PSYN
169631736YP_001705385.1 hypothetical protein MAB_4662c [Mycobacterium abscessus ATCC 19977]MGTSTAGTIAAVLGEPLPVELMNTIRGGRGDLRDALDSDESVYEWLMAMA
DRILAESGAHTIAFSPEDARLVARDLRALRDALRSLAAEITEDPRPATSR
MTHTQAVATINALADARAELVWPADGEPIRAAAVRGSQARLAVGLIARQA
IDFFGGPPRHQLRACLAPRCVLYFVKEHPRREWCTPKCGNRARVKRHYDR
QSTGS
169631735YP_001705384.1 hypothetical protein MAB_4661 [Mycobacterium abscessus ATCC 19977]MDMGLAPADVMDPMYWLGEGGLFGGAVLAGVMVIVFIETGLLFPFLPGDT
LLFSAGLIAAQPNSPVAIQVLAPCAALAALLGSQCGYFIGRRLGPALFKK
EDARFFKQRYLTVSREFFDKHGPKTLLIAQFIGVVRTFTPVIAGMSGMRY
PTFLLYNAIGSAAWGTGLTVVGYFLGNIAFVGEHLDIIILVIAILSTLPA
AATAAKVYLEKRRAVTENG
169631734YP_001705383.1 hypothetical protein MAB_4660 [Mycobacterium abscessus ATCC 19977]MRVLAVTPLYAMFLAWGGIHGIDTPRAVAGTSSTAATEVPPSSLSSDFEN
DPRIVDSRPITFQTWSRTPSGDAVLVYFTTGTPQCHGVHATVHETDDAIE
IALRGGTPPDAVGKMCTMIAVQGSLLVPLENPLAERRVLSVV
169631733YP_001705382.1 hypothetical protein MAB_4659 [Mycobacterium abscessus ATCC 19977]MSDTHRMFSDRQDAGRVLAGMLAPRKLRSIVVLALPRGGIPVGREIATAL
NAPLAVLVVRKLGVPGHEEYAMGAIASGGEVILDDDIVRSMGVTPIQLDE
VTDRERRELARRERIYLAHRSVEIRDKTVILVDDGIATGATMRVALLTVK
RASPARVVAAVPVAPRSAVGRFGSLVDDFVVATCPSRFQAVGDAYRDFHQ
ISDREVRELLSAPVIR
169631732YP_001705381.1 LysR family transcriptional regulator [Mycobacterium abscessus ATCCMSATPEGSSLADLLDSRRLFQFVVAAEAPTLAAAAADLFITQQALSSAIR
QLERDLGVELFSRAQRSLQLTDAGHELYTGAKPLLAGIRVLANATRNISN
PQRAFVIGHSPAISGEEVYRIIEPIVVADPTASITVRQVFPSTMRDGLLD
GSLDLALRRGVDMPADLATDTLLYQPLRIAVVQSHPLAAQDYVDIGEIAE
HPIVVWAPPRHSFYTDLLVSHCRRSGFEPRLLINPVQGTPPHTAVLAHPD
HCAFVTDDPGNVYHRKVRVIEIANPPLVPVQAVWLPHSVSAIRTKLFAAV
RESGVVSTPPRTEDGTIPGRSHVGYTSDVQ
169631731YP_001705380.1 putative short-chain dehydrogenase/reductase [Mycobacterium abscessMTDHSLNGKTVLITGGGKNLGGLIARDLAANGAGAIAIHYNSPSSKDAAE
ETVAAVQAAGAKAVAFQGDLTTGDAVSKLFADTVAAVGRPDIAINTVGKV
IKKPFTEITEEEYDSASAVNAKSAFLFLKEAGKHVNDNGKIVTLVTSLLG
AYTPFYAAYAGTKAPVEHFTRAASKEYGERGISVTAVGPGPMDTPFFYPA
EGEDAVAYHKTAAALSPFSKTGLTDIEDIAPFIRFLVSDGWWITGQTILI
NGGYTTK
169631730YP_001705379.1 hypothetical protein MAB_4656 [Mycobacterium abscessus ATCC 19977]MNTAYRIALTVSLAVSGYTHSHLYIVGYQYIPSIGPAFLVQAGAFFAMSV
LIIVGAPNWMVTAAGLGSAGTLVAFALSRTIGLFGFSEHGWDPAPYAMLS
VLTELAAVALASVLLAKHVRRPVPATPTSRAESLPQQ
169631729YP_001705378.1 hypothetical protein MAB_4655 [Mycobacterium abscessus ATCC 19977]MTGEQDPNSMSRRELIRHTAWFGAAVALTVTGGEVISHVAGSAAAAAPAR
PALRFAQISDSRLGFTGTANANVVDSFGHAINQINNLGYTPDFVIHTGDL
THVATGAQFDQAKQMMSGLSTPHVFTVPGEHDSIDDAGRKYRSVFGGGTR
GDGWYSFDIAGVHVIALVNTLNLKKLGHLGNDQLEFIEKDLAPVSSDTPI
VVFSHIPLFAMYPEWGWGTDDSAQALSYMKRFASVTCLNGHVHQLFTKTE
GNITFYSGTTTAYPLPKPGDGPAPKPVTLPAGRLHDSLGIREVSYLRGTQ
PLALKEDRLT
169631728YP_001705377.1 hypothetical protein MAB_4654 [Mycobacterium abscessus ATCC 19977]MYLSSLCHTALAVTILIPLSACSGGTATTPDAPPSITVASDVSETPGMQG
HAMPKMPVTTSMPTAAGAPSLPVPAGPAVNIENFAFSPPTLTVPAGTTVT
WTNKDEEPHNVVAEDGAFRSPGMDAQGTFSHQFTKAGTYTYVCGIHPFMK
ATVVVR
169631727YP_001705376.1 hypothetical protein MAB_4653 [Mycobacterium abscessus ATCC 19977]MNPRGLRRYVDDLLRGRRPKSFRPDDFEAAQIRTAIELRASRPGDDAPSQ
EFLAELGRRLAEQISDTPVSSAPRRWQAPRRTVLVGTSTAAAAAAVAVTA
DHLMTPTPQTDTHQAPGEIVPNTGSWQRVAVSNAVPDGGVHPFDLGFVNG
FVRRVGGRVEAVSGVCTHQGCKLWFDGTNNRLQCPCHTTSFTTDGRVITH
QLPIAPKPLPTLQVRETEGHIEVFAPDRPV
169631726YP_001705375.1 putative RNA polymerase sigma factor [Mycobacterium abscessus ATCC MMTQRDPTTRRGLRAVSSGGDHYADWQSVYEDNAVWIYRTIYARVGNKPD
AEDLTAEVFLAALRPLRLTVTKAEVRAYLRTTARTVLAAHWRETLGREIT
SIPDTQDIADQPPEADEPISTAPEHARAVLAALPENYRRILELRFLQCCS
IKESAARIGTTVANAKVLQHRALRLAAQINDQDAS
169631725YP_001705374.1 putative L-carnitine dehydratase [Mycobacterium abscessus ATCC 1997MTGALDGIRVLELGTLIAGPFAGRLLGDMGAEVLKIEPPGAPDPLRTWGQ
AEVDGHHVFWTVHARNKKAITLDLRTEAGRALFLDLVDKSDVIVENFRPG
TLERWGLGYDVLAQRNKGIILVRVSGYGQTGPDAHKAGYASVAEAASGLR
HLNGFPGGPPPRMALSIGDTLAGMFAAQGALAALYRRTVTGRGQVVDAAL
TESCLAVQESTIPDYDVGRVVRGPSGTRLEGIAPSNIYQSADGSWVVIAA
NQDTVFRRLCEAMGRPELSSDARFANHVARGRNQDDLDAIIAQWAAQRLP
TDIIDVLSAAGVIAGPINTVADVVQDPQLKAREMLVEHFDERLGRSVLGP
GVVPVLSESPGGVRNAGPARPGQDNDDVYVGLLGKSAQDIERLRAEGVL
169631724YP_001705373.1 putative pyruvate carboxyltransferase [Mycobacterium abscessus ATCCMSLPEHVSIREVLLRDGLQLETPIALADKLKLLEAVAATGVREVEATAFV
SPTKMPALADAAELAAQLHHYPDIEFSALVASPNGAKRALAAGFTSLEYV
VSAADGHSRANVGISSAEAIARIQEIVTLARGADATVEVIVACSWDCPFD
GPTAQKRVLDIMQRARDWGADRYALADTIGTATPRRVANLIAAVRSIIGD
APLGAHFHNTRGSGLASAYAAVQSGVTRLDSSIGGLGGCPFAPGATGNIA
TEDLAYLLRDSDVNVDINLDAAIAAAQIVQEVVGHEVPSALLRAGDRLLN
169631723YP_001705372.1 hypothetical protein MAB_4649c [Mycobacterium abscessus ATCC 19977]MSTPVLVGIVVGAVAIGALLGAAVLFALASGDGGPRRFGVTMPDPDFFDK
AASFAVTAQISVPGPVERVWAQVSEGGYLDSIPFVSGPVWSADRGVTRTP
LLAFTEKAVHNEAGRKLVTIGTGISIPLLINAFGERWEFAAEGNKVQVRW
TVAVTPKWVGWLPLRWTAFAVRPFQRALLGLTIR
169631722YP_001705371.1 TetR family transcriptional regulator [Mycobacterium abscessus ATCCMATRRQMYAEQTRSDLLDSARRHFTTTGYNSVTVDDIVSSIEVSKGTFYY
HFSDKQAMFTALLTECLTETADTVTTGIRLLDKPGANGPQVAATSAWVYL
SRSLHDRTYRELMRQAPMVLGEETYRHIDETIVLPPLVTLMDTLAARGEL
KAGVHTHMAARMLMTMFVTANSIIAESDDPATTMTEVADTIATMFSGIVL
GDVPLSRAAANG
169631721YP_001705370.1 TetR family transcriptional regulator [Mycobacterium abscessus ATCCMTTLLRVTTSAPPTDAVLDAARTEFERHGMRRANMDAIARRAGVSRRTLY
RRFPTKEALFEHLIEAESITVFGQLAVAANGQDAPGAIVECFTLAMRLIT
ESRLAGTIIENEPELVIGLNTPSGDKAIVRASALVASSLRHSGATMPDDA
VLAVSEILVRLVGSLLTNRAGVLDITDTAAVRHYAQTYLARLVW
169631720YP_001705369.1 hypothetical protein MAB_4646 [Mycobacterium abscessus ATCC 19977]MVDQSALTLDEGLREAIPMPVEDKPDEPSLRLGADSLVWKFYGDIRGVLG
FQRLAGTENCIEQLGKAVEDHSVIFTDTIGRARRSGPPIMKTIYSADPQK
WGRMVRDFHKPITGTISDGTRYHALNPELFYWAHATFVDQVLYITDTFIR
RLSYEEKVRIFEESKVWYSLYGVSARNQPQTYDEFVTYMESMFDRFVPTK
TILYATGYIRQGLPGPRQIPRPLWKVLSAPLNAFIRTVVVGTLPPQMKDV
CRLQWSDKKERNFRRFAALMRALNPVFNRLPVRWLYLPWAAEGWKREGVD
PRPLHNRVA
169631719YP_001705368.1 hypothetical protein MAB_4645 [Mycobacterium abscessus ATCC 19977]MRSVFDIRNVIAALLGSFGLILIGVGIHDASAHNLAKAGGNVNLWTGIAL
TVVAAACVAWAVRRPIQDDTSDES
169631718YP_001705367.1 GntR family transcriptional regulator [Mycobacterium abscessus ATCCMHPRLSSQSLAEQVANILAAQIGDGRWSTGAKLPGEVALCEEFGVSRATV
REAIRDLKTKGLVSTRQGAGVFVTSDRPLGQWDRVLAAAEIDAVVEIRRL
LEVQAAGLAAERRNRSDVAAIRRALVARAKAESAGDDIEYVDADLEFHRA
VVAAVHNPLLDELFDSFSVRMREAMLALLAGSAERPHDQEHHQWLFDAIV
DGSTRRAVELATDQLQHVRMR
169631717YP_001705366.1 amidase family protein [Mycobacterium abscessus ATCC 19977]MEVADAVLRRIEKVNPLLNAFVFHNPEQVLRDARRLTEDLTKRTTLPPLY
GIPYSVKEVCAVAATPVTSGVVAFKDMVADRDEPVSARLRASGGLFLGKT
NIAEGGYKASSDNHLYGSTRNPWHPGMTAGGSSSGAGAAVAAGMGQLAQG
TDGGGSIRIPAALNGVVGFKPSLGRIPQTRLAGRFHTFAFHGPITRTVAD
AALMLTTMAGFDDEDPLSLPSDGVDYLAALDQPIESGRMAWSPDLGISKC
DSEIQGICEEALIAFVEMGWTVEEDRPDWTDPAKTMWEGVWGPVYAGKLD
AANWDDQAGHVDQELVQVIRDGARLTTVQVQRADAARGKMVDTLREFLRR
FDFLVTPVTTAQAFGHDEFCPAVLAGAPLLERLMGWVLTYPFNMTTNPAI
SIPVGFTRNGVPVGLQIVGRLRADADVLRLAAAFEAVRPWAQRRPSDAVL
NGENP
169631716YP_001705365.1 hypothetical protein MAB_4642c [Mycobacterium abscessus ATCC 19977]MAKTLEHKNIQPAVRSKDIFMTTLLERTFHRNPGMLAAAVELHQSGALPA
ATQLIDLDMIARNARLTAEAAATHGLRVFAMTKQNGLNPFMTRVLLDAGI
PSTCAVETLQAHRIHRYGFPLGNVGHIQNIPAAQVPAVVAMRPEFITVYT
HQAAQRVSDAARELGIRQRVYVRVTNQAVTGSAIVGADDGAFAGLVGGWT
EDSCVEGVRALLDLPGIEIAGLTQFSAISYGETGDPSAIRPTDAFFTMLR
GKELLEKRLGLEDLHLNVGGNANVGTFPTLASYGVTEVEPGVSLAGSGGF
HAKQDMAEGPAQVVVTEVSHYWGDNVYTPGGVFSFVSDLYDPEPMWAAVG
HDLDTARRTRIPYLYNQMVDAHGVFGGADPMPAIGDTVLVVHHPQAFVER
GYTAAVSGISSGAPSLEGIFDSACNQLGPDFNVLPLDDTLEHLAVLSAKY
RGGR
169631715YP_001705364.1 putative DNA-binding protein [Mycobacterium abscessus ATCC 19977]MAGTDERRRELGAFLRVRREHLVRADYGLPPVGRSRTTGLRREEIAYLSG
VSVTWYTWLEQGRDINPSRQVLEAIALEMRLSAAERTYLLELAGFAPLPH
SATPDPAPVPDHLLRLVENLVPSPAFVVSADWSIGGWNRAYELLYPGIAS
IVPADRNLLRFIFTDPYVRQMLPDWPITSRRFLAEYRAEAGALLGDPRHR
ALVDRLQQQSPEFARAWAEHEVGRFTSRERRFHHPEAGELIFEHHRLSPS
DLPDLHIVIYLPLDGTNTRTKLEALLSGGR
169631714YP_001705363.1 dihydroxy-acid dehydratase IlvD [Mycobacterium abscessus ATCC 19977MAGARALLRAAGVAASDFGKPIVAVANSFAEFVPGHTHLQPVGRIVSEAI
AAAGAVPREFNTIAVDDGIAMGHEGMLYSLPSRDLITDSIEYMVEAHRAD
ALVCISNCDKITPGMLMAALRLNIPAVFVSGGPMEGGRATLRDGTVRTGM
TLITAVAESASDSVSDEDLARIEDQACPTCGSCSGMFTANSMNCLTEALG
LAPPGNGTTLATHTARRGLYEQAGSLIVELAQRYYGSDDTTVLPREIASR
RAFENAMCMDIAMGGSTNTVLHLLAAAHEAELDFALADIDALSRRVPCLS
KVAPNGAYLVEDVHRAGGVPALLGELNRAGLLHRDVHSVHAPDLTTWLTQ
WDIRGTAPSPEAIELFHAAPGGERSARAFSQSQRWHTLDLDAENGCIRDT
EHAYSADGGLAVLTGNLAPNGCIVKTAGVDEKIRVFSGPAVVLESQEAAV
EAILNDRVRPGDVVVIRYEGPRGGPGMQEMLYPTAFLKGRGLGASCALIT
DGRFSGGTSGLSIGHISPEAAAGGPIALVEDGDIINIDIARRSIVVAVDP
QTLQRRRALLESGNGYRPVTRERHVSAALRAYAAMATSADKGAVRSLSG
169631713YP_001705362.1 putative Na+/solute symporter [Mycobacterium abscessus ATCC 19977]MTGSLRLDAGPVDYVLIAIYFVFVLGIGLLARRGVSSSIDFFLSGRSLPA
WVTGLAFVSANLGAVEIMGMSANGAQFGMVGMHYFWIGAVPAILFLGIVM
MPFFYGSQVRSVPEYMLHRFGVGAHLVNATGFAVAQVLIAGVNLYLLGTI
VNVLLGWPLWVSVIAAAAIVLCYITLGGLSAAIYNEVLQFFVIVAALLPL
TIVGLHQVGGWQGLQDKVSAGQMSSWPGNELSGFSDNLLSVIGIVFGLGF
VLSFGYWTTNFVEVQRALASESLSAARRTPIIGAFPKMFIPFIVVIPGMI
CAVLVPQMVAYKAGQPTSDPNLTYSNSLLYLMKEVLPNGVLGVAITGLLA
SFMAGMAANVSAFNTVFSYDLWQRYIRKDRPDGYYLRIGRIATVGATVIA
IGTAFIAANYNNVMNYLQTLFAFFNAPLFATFILGMFWRRMTATAGWAGL
VSGTFAAVGIWSLFETGVYTLAGQGSNFIEAGVAFTVDIVVSVAVSWTTE
PKPAAELAGLVYSETPHAFSSDEPASGWFRQPVKLAMTALILVVALNLIF
H
169631712YP_001705361.1 galactokinase [Mycobacterium abscessus ATCC 19977]MTGTWSAPGRVNVIGEHTDYNGGLSLPIAIPQHVDCTLTPRDDQTVRVTS
QQHGRDWVEVPLDRLAHTDIVSWARYPLGVVHEFVKRGNDIHGMDLRLDG
DVPVGAGLSSSAAVECAVAAAIRDTFATELSDSELVDITHRAENDFVGAP
TGLLDQSASILCTAGHALFLDAETGAHTQVPFDLAAAGLELVVIDTGTRH
NHVTSEYATRRQQCQTAASLLEVHSLSAVTDAGVLDTVADPMLRARARHV
VTENARVREVVAILQSGRDPRSIGPILTRGHGSLRDDFAVSTPQLDAAVE
ASCDSGAHGARMTGGGFGGSVIALAEADSSARIGTAVAQHFSAQHWPIPQ
VFVVTPSDGARRIR
169631711YP_001705360.1 galactose-1-phosphate uridylyltransferase GalT [Mycobacterium absceMWRTRRELADGREILYFDSIPTERAAVDRRDLPPVSTQSQIRFDPLLGDW
VTLASHRQTRTFLPPTDLCPLCPSTPERPTEIPEHAYEVVAFENRFPSLS
LHAQAATPPAGAGFGRCEVLCFTSEHDTSFAQLEPRRARLIVDVWAERTK
ELSAIDGIEQVHCFENHGEEIGVTLAHPHGQIYAYPFITAKTARVLSNVD
THRKQHGTNLFGEILAAERATGTRVVTANDEWTAFVPSFARWPYEVSLYP
HRQVADIPDLDDAARSAFAELYLDVLQRFARRFDNPMPYIASWNQAPTVA
SGAIRDNWWLHLQVFSIQRAPRKLKYLAGSESGMGAFISDTTPEQVAAEL
RDVI
169631710YP_001705359.1 hypothetical protein MAB_4636 [Mycobacterium abscessus ATCC 19977]MDHDPAAPQEQRRRSIPKKEKFMTDKTLRKFRRERAMGRYLLNPAVGALA
KLGVRTALASELETTGRKTGQLRRVPVSVQFDSTGAWVICQHGTRSGWGS
NIAANPNVRVRQGNRWRTGTAQFRPDDDVVARGRGFGVIGARVVKALETT
PISVRIDFTD
169631709YP_001705358.1 NADH:flavin oxidoreductase/NADH oxidase [Mycobacterium abscessus ATMPDIHDPLALANGQVLRNRLMKSALSEALGNAEQGPDHRLVQLFSRWGAG
GYGLIVTGNVMVDHNHLGEPGNVVIEDDRHLEGLSRWAKATKDGGGLIWM
QVNHPGRQANPLATKHQPVAPSAVRMSVPGWQAPRELTDVEIEDIIDRYA
RTAVVADTAGFDGVQIHGAHGYLVAQFLSPNTNRRTDRWGGDAQRRMRFV
LEIVRRTKAAVSPGFAVAIKLNSADFQRGGFTEEESRGVIAALAAEGIDL
IEISGGTYESPAMEGRPVVVSTSTQAREAYFLEYATTARAVAGDVPLAVT
GGFRTTAAMNEAIESGACDVIGLGRPTTVNPEAAIELLSTRRDRLTVPDA
ALPLPARLAATARAKAFLSAHELQWHGTQMHRLGAGSDPDPSIGPWITTL
RLLKNNGVEAFRKRRSS
169631708YP_001705357.1 TetR family transcriptional regulator [Mycobacterium abscessus ATCCMSARDTLIASVTGLVRRRGVAGTGLNALLEDSGVSRRTIYLNFPGGKQEL
VAEATRLAGNELTAIIKAAGDDVDPARGIQLFIELWKAQLAETEMQAGCP
VVAAVLGRTEAPEAAAVAADAFESWQKILIDRLVRYDVDGETARSLASTM
IAAIEGAVIMSIAAQSTEALDDVGQRLVELVQLYVPADAKPKPHVD
169631707YP_001705356.1 hypothetical protein MAB_4633 [Mycobacterium abscessus ATCC 19977]MTKTRVAVWGTGNVGQHALAGVITDPSMELVGVWVSGSNKAGKDAGALAG
LDILTGITATTDAAQILALRPDCVVYTAMTDNRLMEALKDLTDLLSAGIN
VAASAPVFLQYPWGVLPENMLTPIENAAREGNSSIFAGGIDPGFANDLLP
LALMGTCQRIDQVRCIEIVDYATYDSATVMFDVMGFGKPMEETPMLLQPG
VLSLAWGSVVRQLAAGLGVELDEVTEVYEKLSAPEDFDISSGHIPAGTMA
ALHFEVRGIKDGRAVTVLEHFTRLREDLAPNWPQPAHEGGTYRVEITGEP
SYLLDLGSFSARGDHNYANLIATAMRVVNAVPAVVAAEAGIRTTLDLPLI
TGKGRAV
169631706YP_001705355.1 short chain dehydrogenase [Mycobacterium abscessus ATCC 19977]MILDRFKLDGNVAVVTGAGRGLGAAIAEAFAQAGADVLIASRTESQLREV
AAKVQAAGRQAEVVVADLSDTEASAALAQKAVDRFGRLDVVVNNVGGTMP
KPFLDTTNDDLAEAFSFNVLSGHALLRAAVPHLLKSDNASVINITSTMGR
LPGRAFLGYCTAKGALAHYTRTAAMDLSPRIRVNGIAPGSILTSALEVVA
GNDEMRNTLEQNTPLHRLGDPADIAAAAVYLASPAGSFLTGKVLEVDGGL
IAPNLDIPLPDLA
169631705YP_001705354.1 IclR family transcriptional regulator [Mycobacterium abscessus ATCCMPASSPPTARVVRIVEMLAAAMQPKTVSEIAASTGISRATATAVVNELEA
AGWVARDDELRYRIGASLPRAVDTSMPREAQQLLARIAAEAQAGATISRI
SAKALTVVAKAQAGRRAVTGFAVGQSIPLAFPAGSAVMPWRAAEECEQWL
GTAAGLSARSGQRLLQQVSDCGYVVYRPDHDDTGMVDLLSDLLGSVGSEV
MEAALRERLLRQLSRLTSRPYSRDELTSDEVLPISYLAAPIFDGAEARYE
LQLGPLLPRATRVVRETLIATLMRGARELSVVLGDR
169631704YP_001705353.1 hypothetical protein MAB_4630 [Mycobacterium abscessus ATCC 19977]MTTPNSGSWQPDPDGRYEFRWHDGQRWTDQVAHQGSVSTAPLGGAAAQPA
APDQPAGDQFSGISGDLVDGRFSENEAKPISNQNAKLLRVRLGEPFLARQ
GSMVAYQGSVDFAFEGGGAAKFLKKALTGEGLPLMRCSGQGDVFLAERAF
DVHLLNLNNAGLSISGKNVLAFSAGLNWNIERVRGASVVTGGLFNTTLRG
TGWVALTTDGPPVVLNAAEAPTFADTNAVVAWSSNLQTQLKTSFKAGALI
GRGSGEALQVSFQGRGFVIVQPSEGIPVVTAG
169631703YP_001705352.1 hypothetical protein MAB_4629 [Mycobacterium abscessus ATCC 19977]MITELDSVLLDVPNLGEAKDAYSRLFNSSAPHPQLHLGLPRWASHPGMLF
RVDDLDCAARTVARRGLALTVHGDLATGESNGVTLGLSGQPPAVPQPDAD
SCQIDHLVLFSPNRDRIIATLCGRLGFDLRLDRLQSWGVHQLFFRGAGLV
VEVVLRDDDPSGPDSLWGIAWRTADIEASHARLSGAGATLGDIRNGHKPG
TRVVTVKDPALALPTILIEQR
169631702YP_001705351.1 luciferase-like monooxygenase [Mycobacterium abscessus ATCC 19977]MRFQLLDIVFHLPNPATRALAPAAERLNRVIETAVLAENLGFDSFAVGER
HAGDVLSSAPTVLLGAVAAATDRILLSTGVTVLSLLDPVRAAEDFATIDQ
LSRGRLEIVIGKGNEDRQYPLMGLDIAKQYEYLQENYELLRRLLREEHVD
WVGVHRHPLADATTLPRPYDGPFRIWHGSATSTFAVELAAKWGDPIVTAN
ALQPKENYRVLIDRYRELYAHHGHDPAQLYVGAGSGGLYLADTTEQAIAQ
YRPIYEARLAQMAKLKAHPKAVGKFPSFESIEDAADRGPVLAGSPERVAE
KILDWHEAFGHEFQSISLSPEADFEEQKDTLRRFAEEVVPLVRAEVKSTL
WGPLDTRRAKGFTAA
169631701YP_001705350.1 hypothetical protein MAB_4627 [Mycobacterium abscessus ATCC 19977]MIRSTASGALFIAMMTFAPAFAGADPADPDPFNPGDCIGNANAVCNVGPY
GPNSMSNPANPASPLNPNNPANPASPLNPNNPANPASPMNPNNPANPASP
LNPMNHPGQP
169631700YP_001705349.1 acyl-CoA synthetase [Mycobacterium abscessus ATCC 19977]MPDPFDPLHGSINSGHLLVSALKRNRDAPALVLGDVTLTGAQMADEISKY
IQAFIELVPDPTDGQGMLALNRPEVLLVIGAGQLLGTRRTALHPLGSLDD
HAYVLADAKITTLVIDPTPQFVERAAALVAKVPTLTRVLTLGPVPAELAE
VGQDLVAAAAGFAARPLTPINLSPDHINGLTYTGGTTGKPKGVIGTSQSI
LTMTQIQLAEWEWPERPKFLMCTPLSHAGAAFFMPTLMKGGSMVVLPKFD
AGAVLAAIEEHQITATMLVPSMIYALLDHPDSRTRDLSSLQTVYYGASAI
NPVRLAEAIERFGPIFAQYFGQSEAPMVISYLAKGDHDAKRLSSCGRPSA
FLRTALLDENDRPVKQGEPGEICVAGPLVAGGYWGLPEQTAETFKNGWLR
TGDVAREDEDGFWFIVDRTKDMIVTGGFNVFPREVEDVVAEHPSVAQVGV
IGVPDEKWGEAVTAIVVLRSDASSDEEAVALMTSEIQSAVKERKGSVQSP
KHVIIADSLPLTALGKLDKKALRQKYATV
169631699YP_001705348.1 TetR family transcriptional regulator [Mycobacterium abscessus ATCCMGRKPQYSADDILDAALGLVAAGGPSAATATAIGRVLGAPSGSIYHRFPS
RDELMARLWLRSIARYQDGVLTALALPDADDALAAAIDHAFDWTASNHNE
ALLLLQYEKADLVAHWPDTLATELKSLNSRVRKTLREYTDRRYGKVTTER
IDKVMFALIDMPYAAVRRHLPDKGEPAPWLREFVHTSAHALLARACLNEP
169631698YP_001705347.1 putative phenylacetic acid degradation protein [Mycobacterium absceMITLDQAQQVLDAQPFSRLLGAAITRVDERGIQLSLEIRDELRQQSGFIH
GGVLSYLADNAITYACGLGLGADIVTSGYTIEYVAPARDGARLVADASLV
SAGRTKALGRCEISVEDHDGTATLVAVAQGTSMVRRSGT
169631697YP_001705346.1 5-methyltetrahydropteroyltriglutamate--homocysteine S-methyltransfeMTTQPLKATTLGSARIGPRRELKRATESYWAGRISRAELEDVAAGLRRDN
WTALAAAGLDSVPVNTFSYYDQVLDTAVLLGALPPRVAGITDDLDRYFAA
ARGNADVTPLEMTKWFDTNYHYLVPEIGPGTKFELNDAKLFGELKEAQAL
DIPARPVVVGPVTFLALSKPIDGADAPIERLDEVVTLYEQLLVRLAEAGV
AWVQIDEPVLVTDILPNGPELAERVYGRLGTVADRPAILVATYFGDLGAA
LPALARTPVEAIAVDLVYGSVSTVTAVPELSGKTVVAGVVDGRNIWRTNL
ESALGSLATLVGSAGAVAVSTSCSTLHVPYSLEPEAQLDDQLRSWLAFGE
EKVKEVVVLARALSEGRDAVAAEIAASNAAAESRRTDPRLNNGQIRARLD
AILADGVSRGDAAERRRSQDERLRLPTLPTTTIGSFPQTVEIRKARQALT
RGEIDDAEYVRQMRAEVANVIALQEKLGLDVLVHGEPERNDMVQYFAEQL
DGFFATQNGWVQSYGSRCVRPPILYGDVARRKPMTVEWATYAQSLTQKHV
KGMLTGPVTILAWSFVRDDQPLGDTANQIALAIRDETVDLQNAGIAIIQV
DEPALRELLPLRNSEKQAYLDWAVGAFRLSTSGVSDATQIHTHLCYSEFG
EVIGAIADLDADVTSIEAARSHMEVLDDLNAIGFSNSVGPGVYDIHSPRV
PSTEEMATSLREALKAVPARRLWVNPDCGLKTRKVDEVTSSLANLVAAAA
SVRADA
169631696YP_001705345.1 hypothetical protein MAB_4622c [Mycobacterium abscessus ATCC 19977]MNTVALEMVPPNVDGGLDRAAEELRKLRQFSAEFGIDRRIAHVMIPSMIV
EDGDRPLEMKPKLDVVDYWSIIRAELPAVRGLCTQVTSFSDETSLRGRLT
DLTDVGMDGVIFVGVPRTMNDGDGAGIPPTDALSKFDDIVQNRGAILIPT
RAGEQGRFSFKCDKGANFAMTQLLYSDAVVGFLHEFAHTSDHRPEVLLSF
GFVPKLESKIGLIDWLIQDPGNEAVAREQDFVKALAAREPGERRPQLVDL
YKRVVDGVGGLGFPLSIHFEAPYGLARPAFETFAEMLEYWSPAVS
169631695YP_001705344.1 putative acetyltransferase [Mycobacterium abscessus ATCC 19977]MEPVELQTDRLMLRAVADADAAAIVDACNDPEILHYLPLPVPYTVGDARS
FIAASAQEWVAGTRYGFGFFVMDTGELAGTCSLKPVTSGVLEVGYWSAAQ
HRRKGLTTEAVQRLCQWGFDVLDAHRIEWWAVVGNEGSRAVAEAAGFEME
GLLRQRACRRQEPADWWVGGLLPRPE
169631694YP_001705343.1 hypothetical protein MAB_4620c [Mycobacterium abscessus ATCC 19977]MASAAAVDWDEGREIIRFPYGCAGWDPALGDPAHRLVTLWATWHEGQNWP
RLLGVVEELYDVSAVSYRDESDCIRCRPSSFQYRSVELATRWPEESSRGE
LGRRVITGCVVGLRVMSVVEPEDADIQARQEERDRARRTLDLFGPPGVFG
AVIPSRGDRVTVDLADPRLSVNDTRGYAGVVTGIAGQVSRAVHSPDGFYT
GLLDINSEAPPPDELFVQLLCDREPE
169631693YP_001705342.1 citrate synthase [Mycobacterium abscessus ATCC 19977]MTIATPTIHKGLAGVVVDTTAISKVVPETNSLTYRGYPVQDLAVQCSFEQ
VAYLLWHGELPNDGELALFNQRERAQRRLDRSLMALLAKLPETCHPMDVV
RTAISYLGAEDPSEDDSTPDANYAKSLRMFAVLPTIVASDMRRRRGLDPI
QPHSHLGYSANFLRMCFGEIPDPVIVKAFEQSMILYAEHSFNASTFAARV
VTSTQSDIYSAVTAAIGALKGSLHGGANEAVMHDMIEIGDASKASEWLQS
KRSRKEKIMGFGHRVYKNGDSRVPTMRAALEDVARVRDGGQWLEIYKVLE
SEMDAATGIKPNLDFPTGPAYYLMGFDIPCFTPIFVMSRITGWTAHIMEQ
AAANALIRPLSEYSGKPQRTLAC
169631692YP_001705341.1 carboxyvinyl-carboxyphosphonate phosphorylmutase [Mycobacterium absMSTLLASATDAATKRAAFRQGLSSGELLRLPGAFSPLVAKLIQEIGFEGV
YVSGAVLSADLALPDIGLTTLTEVSARGRQIASVTDLPTLIDADTGFGEP
MSAARTVAVLEDSGVAGLHLEDQVNPKRCGHLDGKAVVETVEMVRRLHAA
VSARRDPNFVICARTDAAGIEGLPAAIDRARAYADAGADLIFTEALTDIG
EFEKFRAAVDIPLLANMTEFGKSELVTADRLREVGYNVVIYPVTTLRLAM
YAVEQGLHEINSAGTQSGLLEQMQHRSRLYELLHYAEYNRFDTEIFNFSL
DGGQ
169631691YP_001705340.1 methylcitrate dehydratase family protein [Mycobacterium abscessus AMPVHSVRTRRSAEAFPRDQHLAWKIAEIASDPVAVPADTAAMVINRVIDN
AAVSAASVIRRPVTVARRQAQAHPAVPGAHVFGIGGGYSAEWAAWANGVA
VRELDFHDTFLAADYSHPGDNIPPLVAVAQQLGIGGDDLIRGLATAYETQ
INLTRGICLHEHKIDHVAHLGPSVAAGLGTMLKLDTETIYQAIGQALHLT
TATRQSRKGLISSWKAYAPAWAGKVAIEAVDRAMRGEGAPSPIWEGEDGV
IAWLLGGPEKLYEVPLPGPGEEKRAILDSYTKEHSAEYQSQAPIDLARRM
RERIGDLAQIATIVLHTSHHTHVVIGTGSNDPQKFDPDASRETLDHSVMY
IFAVALEDGTWHHERSYAPERAHRPETIELWNKISTIEDPEWTRRYHSTD
PDKKAFGCKAVVTLKNGEVIADELAIADAHPLGARPFARENYVNKFTALS
DGIIAPREQERFLSVAQGLADLKPGSLGALNPLVDTVVLDKAPSTPEGIF
K
169631690YP_001705339.1 transcriptional regulator protein [Mycobacterium abscessus ATCC 199MSRPFAGARLRRLREERGLTQAALARVLDLSTSYVNQLENDTRPVTVAVL
LRLTERFDLSPHYFSPDSDARLVADLGEIFTEAAVGEVSDLQLEELVARM
PSVGQTLVGMHRRLRDVTAELESYRATENAETIGDSVREPLRPMPFEEVR
DFFYDHKNYLGELDTAAEDLFEHYGLHVGGLDIQLATVLKQDLGIAVAVN
KAGEPSDSSKRRFDATAGVLRIAHWLTPGQRAFQMATQLALVTQTETMAA
ILAGADQLSPEAIGVARIGLANYFAGAFLLPYKQFHHAAESSRYDVDILA
RQFEVGHETVCHRLSTLQRPSMRGVPFILVRTDRAGNISKRQSATAFHFS
RVGGNCPLWVVHEAFSNPGQFVTQVAEMPDGRTYFWVARTSSTSTGGFLS
TPKSFAIGLGCDIAHAHRLVYSTGIAIDDPSTAVPIGPGCKVCVRESCAQ
RAFPYIGRSVHVDEDASSGLPYT
169631689YP_001705338.1 major facilitator transporter [Mycobacterium abscessus ATCC 19977]MPQRLSAWRFVTTFGVISMLADIVYEGARSITGPLLASLGASALVVGVVT
GIGEAAALALRLVSGPLTDRTRKFWAWTISGYALTVVTVPFLGVSSVLWI
AATLVIAERVGKAVRSPAKDTLLSHATAVTGRGKGFAVHEAMDQIGAITG
PLLVAGMLALTHVNYLPTFAILALPGGATLLLLFWLRRRVPHPERYEHDD
YIRGAADRPHKLSLPLSFWLYSGFTAITMIGFATFGVLSFHMVQRGVLPV
PAVPIVYAAAMAADAVAALLSGWAYDRVGPKSLAALPIVGATVPMLAFTD
SLPGIVLGALLWGAAVGIQESTLRAVVADLVPPPRRATAYGVYAAVLGTA
TAIGGALTGYLYGVSIPMLIAVVGVIQLVALITAAPTLLRHAGQV
169631688YP_001705337.1 alpha/beta hydrolase fold protein [Mycobacterium abscessus ATCC 199MTRWLLLRGLSREKRHREQFPQIREHTILAQTANNPDLDLDALARRWAQY
LQSQRPSSAGVVRQIAAAVTFRMPRHIDTPLLILTALRDRIVSSSASHAI
ATRYGGPIAVHPTAGHDIPLDDGARIAEQVKQWIG
169631687YP_001705336.1 UbiE/COQ5 methyltransferase-like protein [Mycobacterium abscessus AMTTADGLHSGDPSPVHRRAFNDQVTRFWGRAARAYDWAPLQQWVYRPAQD
EMLAQLRQHKSQRIVDIACGTGILATRIQDELEPEQVHGVDMSEGMLAQA
KARSSLVNWQFAPAEKLPFDDGALDAVVSTSAFHFFDQPAALTEFHRVLT
PGGFAAITTFTPDRTSAPILRRVFGDRIPASVPSKAEMRLMFETAGFEVT
VQRPVHHPFTLPFIEFDRLTVGIKR
169631686YP_001705335.1 hypothetical protein MAB_4612 [Mycobacterium abscessus ATCC 19977]MSIPDRPHLVPGPDHPIGISPSNTRVVVTAGDDTVADSTRALRLQEASYP
AVHYLPPDSVNWDVLQRTDTHTYCPYKGEASYYSVRTPEGTVEDAAWTYE
DPFPEVAPIARYLAFYPDRVTVTAE
169631685YP_001705334.1 putative transcriptional regulator [Mycobacterium abscessus ATCC 19MMDERKATGILNAAEQLFLQFGYRKVTIDEVARRAGVGKGTIYLYWPSKL
ELFGAVFTRDGVAMLTAAADALRADPREVLLSVSSRRTFIATMNNPLARA
IVTGDQALLGDLLTTTPATGEMGLGKLGTTDLVLRLLYRHGLLRDDPEQD
PMLAYRVAATTAGFYAVENTSAAGGFALESKADALADTVSSAFEPAEEPS
LAVLEAARAEALTFYERWCHELSAVLNPSAKETAK
169631684YP_001705333.1 O-methyltransferase-like [Mycobacterium abscessus ATCC 19977]MTAKVDFSDVEWRSVTWTMLVTLFLRAYESRSPRSILNDRAAAELVDRID
YDWPRIERTTAPRSNQYTVTLRARALDDWTGEFLTAHPDATVLHLGCGLD
SRAFRLNLPADVRWFDVDMPEVIAMRRRVIEERTGYRMIASSVTGAAWFD
DIPTDRPTLVVAEGLVMYLTEDEIRELLQRITDRFPSGQIVFDAMPPSIV
RAQKLFKSSIRSAAQVQGWNRRLRCVEETTPWRLYPLVPSRFLRGIYWAM
ASLPWLRSFERLYRFSF
169631683YP_001705332.1 putative acyl-CoA dehydrogenase FadE [Mycobacterium abscessus ATCC MATDAAPTNPDELFGIDALLSDEERAIRDSVRALVQARVVPNVQRWYEHG
DLPVRKLALELGKIGVLGMHLHGYGCSGTSSLAYGLACMELEAGDSGIRS
LVSVQGSLAMYAIYAYGSDAQKQKWLPRMATGEELGCFGLTEPDFGSNPG
GMRTHARRDGSDWVLNGTKMWITNGSIADVAVIWAQTDEGVRGFLVSTDS
AGFDAQTIHSKMSLRASVTAELNLVDVWVPEKNRLPLAVGLKAPLSCLNE
ARFGIIFGSMGAARECLRTALEYAQTREQFDRPIAGFQLTQEKLANMALE
YGKGVLLALHLGRRKDADTLATPQVSLGKLNNVREAIEIARTARTILGAN
GISGEYPVMRHANNLESVLTYEGTSEMHTLVIGQALTGIAAFR
169631682YP_001705331.1 3-oxoacyl-(acyl carrier protein) synthase II [Mycobacterium abscessMAKPSTANGGFPNIVVTGMAMTTSIAPDVEGTWKGLLNGESGIRVLDDDF
VAQYDLPVKIGGHLKVRDFDKDMTKIELRRLSYVQRLAAILGRQVWEDAG
APEDIDLERLTVSVGTGLGGGEKLVEAYDEMRARGTKAVSPLTVQMFMPN
GPAAVIGLERKARGGVITPVSACASGNEGIAHAWRQIAYGDADIAICGGI
EAAIEAAPIAAFANMRIVMSTDNDNPAGASRPFDKNRTGFVFGEGGALMV
IETEEHAKARGARIYARLLGAGITSDGFHVVAPHPDGIGAAKAMNRALET
AGLDAKDIDHVNAHATATSVGDVAEGRAIHKSGLQHAAVYAPKGALGHSV
GAVGAVEAVITVKSLQEGIIPPTLNYETPDPEIDLDIVSKEPRKGDYKYA
VNNSFGFGGHNVAIALGKY
169631681YP_001705330.1 hypothetical protein MAB_4607c [Mycobacterium abscessus ATCC 19977]MRVDGDTWDITSSVGATALGVAAARATETLRADALIRDPFAQILVDATGK
ATGWERLVAGDIDWPDPEAGRIYDRMVDYQATRTHFFDEYFLAAAAAGIR
QVVILASGLDSRAYRLDWPAGTTVYEIDQPQVLKFKDSALAAHQPTAQRR
GVAIDLREDWPAALRAAGFDSAQPTAWLAEGLLPYLPADAQDNLFRDIGV
LSAAGSRVAVEGYEGKLVLDESEEEAVRREQVRAAFKTAIDVDVTIENLI
YEDENRADPAEWLDAHGWSVTKTDAHDEMARLGRPVAEDVERGTFRGQLI
QGELR
169631680YP_001705329.1 hypothetical protein MAB_4606c [Mycobacterium abscessus ATCC 19977]MTGTTTARSDDDSWDIASSVGATAVMVAAARAAETRSASPLIQDPFAQLL
VERAGSGAWSVLASDGLRQQLAELDPDADRVMQYAVDYQAVRTRFFDGFF
ERAAHAGITQVVILAAGLDSRAYRLDWPAGTTVYEIDQPLVLQYKRHTLD
AHDVRSACLRREVPVDLRQDWPAALQREGFDVAEPTAWLAEGLLMYLPTE
AQDRLFELIVDQSAPGSRIAVEAVGPDNDKRQEFRSKMRAHFDRARKLAG
MDGESLDVGSLMYHDENRTDVPQWLAGRGWTVRAIPAEVEMAEAGRPGYI
EEDLRGNTLIEAELKG
169631679YP_001705328.1 aldehyde dehydrogenase [Mycobacterium abscessus ATCC 19977]MTTEISTPADQHAASEPSRIPGIVRGLRETFATGRTREYQWRKAQLVGLE
RLFKENEAAIAKALNDDLGRSSAEAWIADVVGTVVEITYARKHLKRWMRR
KRVRGLPMAQQPAKAYVQSEPYGTTLIIGAWNFPFYLTIGPLVGAVAAGN
TVALKPSELAPACSALMAKLLPQYLDPHAVVVVEGDGYVTQELLAQGFDK
AMFTGGTEIGKRILEGAAPHLTPVALELGGKSPVYVASDANIEVAARRIG
YMKGLNSGQVCLAPDYVIADASIRDELVEKIKESWEQFQADREDKGLRVL
NQRQFDRLVGYLAATEGQVAVGGASDAESLTIEPTIVVDPDADEPLMQEE
IFGPILPIVTAETLDAAIDFINSRPKPLAAYAFTESKYTANRYAAEVPAG
GMVINHLLYHAVIPKLPFGGVGASGMGAYHGKAGFDEFSHRKSTLYKSTA
LDLKLPYPPYTEKNLKLMQRLM
169631678YP_001705327.1 putative short-chain dehydrogenase/reductase [Mycobacterium abscessMPGVQDRVIVVTGAGGGLGREYALTLAGEGASVVVNDLGGARDGSGAGSA
MADGVVDEIKAAGGRAVANYDSVATEEGAANIVKTALDEFGAIHGVVSNA
GILRDGTFHKMTYDNWHAVQQVHLYGGYNITRAAWPHFREQGYGRIVVAT
STSGLFGNFGQANYGAAKLGLVGLINTLALEGAKYNIHSNAIAPIAATRM
TADIASEAVLEQLPPAFVSPVVGYLCTEESTDNGSVFVVGGGKVQRVALF
ENAGATFASPPTVDEVAARWGEIEDLATVTKAGPPSLA
169631677YP_001705326.1 oxidoreductase [Mycobacterium abscessus ATCC 19977]MKAIQAQSLSGPEGLVYTDVETPGAGPNVVVVDVKAAGVCFPDYLMTKGE
YQLKMEPPFVPGIETAGVVRSAPEGSGIKPGDRVMAFNFIGGYAERVAVA
PSNILPTPPQLDDAEAVALIANYHTMYFAYARRGQLRAGETVLVLGAAGG
IGTAAIQIAKGMGAKVIAVVNRTAATEFVKSVGADIVLPLEEGWAKAVRE
ATGGAGVDMVVDPIGGPAFDDAVRTLASEGRLLVVGFAAGGIPTIKVNRL
LLRNASLIGVAWGEFLRTHADYLYETQAGLEKLVAEGMRPPVSARIPLSE
GRQALQDFADGKVYGKMVLVP
169631676YP_001705325.1 MaoC-like dehydratase [Mycobacterium abscessus ATCC 19977]MDPERAADGPFGGTIAHGLLTLSLLPHFQFELIRVDNISMGINYGYNKVR
FINPVRVGSRLRARAEVTSVEQKPGAVDVTIVTTVEIDGADKPACVAESI
SRYIT
169631675YP_001705324.1 putative YrbE family protein [Mycobacterium abscessus ATCC 19977]MTTFEGTSPARPATPSRDAVSGALKEYVRKHPVQAVETAGSQIVLGVRAM
QYMFSDIVHRAFPWREFIHQGAFMAGSAVVPTLLVAIPIGVTLSIQFALL
AGQVGASSLAGAASGVAIVRQGASLVAAVLMASAVGSAITADLGSRTMRE
EIDAMEVMGVSVIRRLVVPRVAAAVLVGVGLTGTTCFVGFLASYLFNVYF
QHGAPGSFVATFASFTRVDDLVLALLKAILYGLIVAIVACDKGLTTKGGP
AGVANSVNAAVVESILVLMLINVLVSQVYVMVFPRHGI
169631674YP_001705323.1 putative YrbE family protein [Mycobacterium abscessus ATCC 19977]MTISTYRPKGVQPIIDAGQRIAQSIRRLGHMLAFFVEAIASIPNALRYYS
KEFFRLLADVTWGNGSLVTGGGTVGVAAVLGATIGALIGIEAYNLLNIIG
LGPATGFISSLVSTRELAPVMAALAFAMQAGCRFTAQLGAQRINEEIDAL
DALAIRPIPYLVTTRLLASTVAVVPLYLLCLVISYITCRLLVGISSGGSI
GGAYNHYFTMMLSGTDVVYSVIKAVVFVWIASTIQCYFGFNASGGPEGVG
VAAGHAMRAAITVVIIVNMLLTMALWGVDAGARFGG
169631673YP_001705322.1 putative Mce family protein [Mycobacterium abscessus ATCC 19977]MVDVSGGSFSASGRGWSDRALLLAGVAVLAILGLVTGLLLAKSKGYLEDT
VKVDAQLMNVGDGLPERADVKFRGMLVGAVTSVTPAEDGKPNIVHIDLKS
EHAGGIPSTVTARVVPSNVFAVSSVQLVDNGDGAGIRNGAIITEDTKLPT
VLFQTTTNKLRQVLAATERQRGDPPVGLIGVFGEATQGRGNKLLSSGARL
QAILTEFNAMVTASPNDPSTIAALEKVSDALSTTSPRLLDNLENALVPLR
TLAQKKDDVRGLLSAGLHTTGTTATAIDNHIDQMIGIGTHLTPVVGVLAQ
NADKFVPIATRVRALSDAAFANGWDPGRQVIGLNLILSFSPAWTYVRDDC
PRYGELAGPSCTTAPETRQWIDIPEVLQPGSYKPPPDIAPPPGTVFPPPA
ADIMLHGTGPNPQEVDRAANPVLPPFGPPPNPAPAPVAPASFGGNVGPVG
SAVEREQLGKALGGDASTSQQLLLGPVARGTTISVSRDESAADAAQPNSA
QLNSGQGGGR
169631672YP_001705321.1 putative Mce family protein [Mycobacterium abscessus ATCC 19977]MKNFRAAAIGLSLFVVFAIGVTTLVYGTLRRDTTGSTKNYTAIFTDVTGV
RVGDDVRIAGVRVGRVDSIELDGSLAKLKFRVKSNQNLYGNTIVAVTYQN
IIGQRYISLSRGIEGSPERLPEGSVIPVERTEPSFDVGALLNGFEPLFTL
LDPKQVDNLSNGLIDAFAGDRGALAHVVAQTTEITKSFAGRDQSLGGLID
NLNTVLDNVAKQNDNLDQLVIQGQSVVGELDNRRQNLVSSIGSATHVVSR
IQTIGDNVYPQMQELVYREPGTAAHILANKDQFAFLGSNLPLLLKGLART
TQDGAYGNSYACQLNINGFFPGLNDLVPEIVRRATHGNVAKYTPKCRGIE
169631671YP_001705320.1 putative Mce family protein [Mycobacterium abscessus ATCC 19977]MPRDRMSPRERKLEDRSKFWIGMIAVGVVAAIIASMLLYRQIGFGYTRYQ
AEFAQAAQLKKGDYVSVAGVDVGEVKSVVLDGTKVLVDLRVRDEVKLGAE
TQAAIKTTTLLGSRYIELRPRGAGTIPNKRIALSHTEVPYDLQALLADTA
ATYEQVDATKLAQSIDILAKQLEGLPEALPEAMRNLKDLSGIVSTRRTQI
GELLKSASTVTATLHRQQANLGHLVFQGRDLLGEFVSRKASFQRLMASIT
KVVDLLSKVVVKDRPAFEKLLQQLRDVTAMASDHDDYMRNLLQILPVPLR
NFTNATGSGYSMGINLTNGLIVDNWMCAISSRAQQWGLIEYFKDCA
169631670YP_001705319.1 putative Mce family protein [Mycobacterium abscessus ATCC 19977]MSINVTQQGSRARRVFMIGAVSVLVVLALVGGYFGLRKAGVVDDKITVTA
QFDEGSGLFVGNVVEVLGLPVGAIESVEAKGTYVEVKFNVDKDVKVPANV
IAAAFTSSVLTDRHVALSPPYTEGPVLKDGDLIPLDRTRTPVGFDRVLAT
VDKLASAMKGDGKGGGPAADLVNIGAQAAAGNGEQVKTALDELSKALKMT
TDGAETKDQLTTIIKSVSSLVNAMNENDKAIRQFGSAVHGTADVLAAERF
GTGNTGRKANEVLKSTAELIEKNRDVIKGLLGNSNVTLQSLSDNQRELKE
TLDLLPLLLDNVDRSIDPVNGSLRLHPMLDKLLFESQFTKEICNMMGLRQ
LGCSTGTMADYGPDFGLTYMLDGMARMGQ
169631669YP_001705318.1 putative Mce family protein [Mycobacterium abscessus ATCC 19977]MRGSKISKLRAAALAAVGALAVSACTPPGLDSLPLPAPNMGSQSYKLTAR
FANALNLPAKAKVRLGGADVGEVESMDAVDYVAVVQLRIREGVRLPVGTT
AQLRTATPLGDVFVAVTPPATPSGQLLKDGGTLDLDNTSSAATVEGVLAS
AAVLVNGGVIRNLTHVVNGLGKSSGGNGSNGIVFGDIVKQSDQLMGTLNG
RSAQIQNSLDKTSQLASTLSAREKTINDLLESGAPALKAIDPHQVTDLAD
TAGHISDQLAKFPSIQGTDSRSMITDFNTVARAFNDVTVSPDTSLVALNR
LLPILIKANAGSALAVDVNMAKLALGNWPDAGYKGDPTFHGPKQADWGYL
VGSFKYSLYRLQERVVGQGPNPPAPAPAPQPEPAPAPEPGPGR
169631668YP_001705317.1 putative Mce family protein [Mycobacterium abscessus ATCC 19977]MTAPVQSGGLLESVSRGLLAVGDVFRRSWKWLSVVGLVAILVICVGYVMF
GTLKVNPIESEYQVKVQLHESGGLLPNQEVTLRGVPIGRVESVNLDKGGV
VAIAAINGSVKLPVDSEVRVSGLSPAGEQYLDFRPTTNNGPFLGNNSVVA
LGKATTPITLAQVLADSDGLLAQLDTQKLSTLRKELGVSAQGPEKLANIL
DGGTFLITTLDGVLPETVTLLKSSKVTFSTLVDLNSGLDATGQQLGSTFA
GLKKMDGGFRTLLERAPQTLHGVDNLFTDNSDTMVQLLGNLATVAQLNYV
RVPALNALFPGPEVRGSMLESAASIFHDGAVWALADLLYPRPTCDYVTPR
KPVSDASFYEPALYSTYCANPDPAMLVRGARNAPRPADDDTAGPPPNADL
AKVSDPTPRGKWSVPTPYGGPQWPLPIPGDAPLPPEAPAPPPGFGNTPPT
GR
169631667YP_001705316.1 hypothetical protein MAB_4593c [Mycobacterium abscessus ATCC 19977]MADDAADKDAKNADESAVTSDAEKAESSAPSSAAVESTAEGTTEAATAEV
ADFDAEDSEKTKDSGAVEDSDDEDISLEPDEEENPKRIRGRHWALTAAAI
VAIAIVALAAIIGRLYEEQRIEEQSSREALAAAQEFANVMINVDSAKLDE
SSNKTLERSTGDFKQKYSESSTTLRQVMIENKAKATGVVVDSAVKSAAPD
KVEVLLFIDQAVSNVAIPDARMDRSRVQITMQKVDGRWLASDVELT
169631666YP_001705315.1 hypothetical protein MAB_4592c [Mycobacterium abscessus ATCC 19977]MSVGGLLLVALGIAIGMVGIVVPMVPGTGLVVLSIGAWALVESTTKAWVV
LGIVVGLAATTTVVKYVWPAARMREAGVPTLSLVLGGIAAIVGFFVIPVV
GLVVGFVLGIYLAEFIRRSSQRQAWGATVTAVKAVATSIGIEMVGAMVSA
GIWLGAVLV
169631665YP_001705314.1 putative phosphotyrosine protein phosphatase [Mycobacterium abscessMTISSAESKASPADNPVEGIWNFRDVGGADSPVTIRPGVLFRSSELSGLT
PAGAQTLRAFGVTDLYDLRSPTEIARTGSDRVDGGIRVHEVPFATPAAGE
ERAPHEIAYRQMMLESMTAGRGPDPASQVEFMLAEYRRFPELPGTLVALK
AVVDQLSSGATALVHCAAGKDRTGLLVGLLLSSVGVDYADIAADYLRSNA
AIGAMRAHISAQMNAAEPELAQTMAAMLSDEVLGVREEYLDTGFRQVANV
FGSPEAMLVAAGVDDDGLTALRAALT
169631664YP_001705313.1 xanthosine permease [Mycobacterium abscessus ATCC 19977]MNLTARLVVMNFLQFFVWGAWLLTLGAYWFNNKHWSGAHFGAAFSTMGIA
AIITPPIMGVIADKWINAEKLYGVMHLGGAAALFSLPLVASPTVFFWVLL
LNMLCYMPSLSLAITVAYNALKNAGRDTVTSFPPIRVWGTVGFIAALHTV
SLLGLETSTGQFYVAGTAALLLGLYAFTLPPCRPKLSSSASSGPGRTTVA
DRFGLTAFTLFQQRKLAVFFIFAMLLGGALQLTNAYGDTFLHDFADVAEY
RNLFAVEHPAIIMSISQISETLFILAIPFFLRRFGIKTVMLMSMVAWTLR
FGLFAYGDPGDGLWMIVLSCIVYGMAFDFFNVSGSLFVEDQCGPEIRASA
QGLFMLMTNGLGAMLGSLISGAVIEYFFTYPDDGKDWRGIWLSFAGYALV
ITIAFFVLFRPEPGGNTDEKAPATVGV
169631663YP_001705312.1 putative phosphotransferase [Mycobacterium abscessus ATCC 19977]MHKDVSSDSDGPTGDAASLDADAIPTSLSEYLNRELGEQVSVRRLSAGHS
NLTYVVTGSSGTQWILRRPPFGRLQAGAHDVMREYRVLDALSTAQVRVPR
VTLASTDAEIFGAPFYLMERQDGEVIRDVSPEWFVGSARRELVLDLAVAL
AEIHNADPTRLVEAKLGRESGYLARQLKTWGGQWESIKELPTGRDLQDHT
TITAWLTENYPGDRPAAVVHGDYKLDNVLVDPATARITAVLDWEMATVGD
PLADLGYLLYMTPEPGGEVAMSELTGSVTAQEGCPSHTEIAQAYREARSG
DQSYWTPEDLVYYQVLGGWKLATLLEVSYQRHLAGTTDDPFFAELDEGVP
RLLSVARSLIPAAG
169631662YP_001705311.1 enoyl-CoA hydratase/isomerase [Mycobacterium abscessus ATCC 19977]MADEVLIEQRDRVLLITINRPDARNAVNRAVSQGLAAAADQLDSSADLSV
AIITGAGGNFCAGMDLKAFVSGEAVLSERGLGFTNVPPRKPIIAAVEGFA
LAGGTELVLSCDLVVAGRSAKFGIPEVKRGLVAGAGGLLRLPNRIPYQVA
MELALTGESFTAEDAAKYGFINRLVDDGQALDTALELAAKITANGPLAVA
ATKRIIIESASWAPEEAFAKQGEILMPIFVSEDAKEGAKAFAEKRAPVWQ
GK
169631661YP_001705310.1 hypothetical protein MAB_4587c [Mycobacterium abscessus ATCC 19977]MARTEGDTWDIVTSVGATALVVSAMRAIEARKPEPLARDDYAQHFVAATK
AEAPLFSELLEDPEAAQAPDIQLFSSYLGARTKYFDEFFLTAGNAGVRQA
VILAAGLDVRGYRLPWAAGTTVYELDLPKVLEFKKQVLDEHNARATATVL
DLHVDLRDDWPTVLKAAGFDPAQPTAWLAEGLLPFLPGAAQDLLFERIAD
LSAPGSRVAVEDFGAPGNQADRMSNAMQNEEGALQRIFKSIVEEDAPPSS
LWFGDEREDPARWLTGHGWTVEATTAGELLKRYNRVPLAGEHELTDAMGQ
SRYFTAVLGA
169631660YP_001705309.1 hypothetical protein MAB_4586c [Mycobacterium abscessus ATCC 19977]MVRTEGDSWDIVTSVGYTALAVAAGRALDAKLDPPLAHDDHAAAFVAAAG
APQLAAAVATADMTSSAAFNAQWVGVRTRFFDNFFADAAGAGVRQHVILA
AGLDSRAYRLPWPAITTVFELDQPKVLQFKDEVLKRSGAQPSARRVTVAV
DLRDDWPAALREAGFDATQPTGWILEGLLPYLPGAAQDALFERLNDMSAP
GSRVAAELGPEPGELERLAASIKTVVGETSDGETQPNLRDLWFDDPRLDT
KTWLGERGWTVTEANLVDAAVAYGRPLRDLPPAFENFLSTKFFTAVQDHP
RG
169631659YP_001705308.1 hypothetical protein MAB_4585c [Mycobacterium abscessus ATCC 19977]MTSTDQGSWARSEGDSWDIVSSVGYTALGVSAQRAVESERPDALIDDPFA
KHFVLAAGEPHLIETITKRDAPQASPFEYLRGMGMRSRFFDEFFLEAAAS
GITQAVILAAGLDARAHRLAWPAGVTVYELDQPQVLAFKDGVYAQQGAEP
TCDRRTVAVDLRDDWPAALKEAGFDAGRPTAWSAEGLLPYLPAAAQELLF
ERMVELSAPGSRAAIEGPTGTLGMSQFAKVEQKYRSEKDTFGKIDITELF
YDEEKTPPVEWFSVRGWSTQGLDMFDLAERYGVRHPEVPEDIRELAGAMH
YLTCTLPA
169631658YP_001705307.1 hypothetical protein MAB_4584c [Mycobacterium abscessus ATCC 19977]MTNIEDKDWSRSEGDSWDIVSSVGFTALGVAAARAVENREADPLVRDPYA
EHFVRAAGEPHLIGLLDSSEPKPPNPGTAPRHIGLRSKFFDEFFINATNS
GCKQAVILAAGLDVRAHRLPWPAGTKVFELDQPQVLEFKDRVLAEHDATP
TSDRREIAVDLRDDWPAALLAAGFDPEVPTAWSAEGLIIYLPSAAQDLLF
ERVVALSAPGSQVAVEATRGRPDIAKWGEMQKKYADEGHPMSKVDITTLF
YDEERADVAEWLAARGWKVQGSHALELAAAYGVEIPELPEDVVEVVKQGN
YVTAVLPS
169631657YP_001705306.1 hypothetical protein MAB_4583c [Mycobacterium abscessus ATCC 19977]MKIDPVATEKCAAQLDATDTHVEFAKGKLRATEGKDLGDLTDAMNAARNR
VSGALGTVSAVQKEISQNIRTCTKALVEMDQRNAGNLSDAGIKFPVLS
169631656YP_001705305.1 hypothetical protein MAB_4582c [Mycobacterium abscessus ATCC 19977]MTLGDTQKQLEQVIADLRQVGEITVSTVWPIAKKVVGAVRKVISIATEPP
PPEPDTVRDVAARWREMAPAMGEWHANDVQQAQNTIPDTVWGRTPGDPYG
ETTGDKARTSIANFKTRSTTIGPAATGVASSLDTFAGSMEKARARWHNAF
ASLKDDVDWNNIPKNPFDAIPYVRKLVGDVLHGVEELAGAYGDADKAVNN
AKGELGKAMEGITLPDHTSVAAGAIGSVNNWSDVKNDPDGHKDGTGLRPG
VQERADANLAAMSPEDRAKAQAMLDNAKDEARRNWIISALARGGDIGSLQ
RFSEKLAQMDDQQVRELDPVEYAKNHPGVLVQPDGTTCGSSSLVVAKMIN
DPMYAMKMLTGYDANGSAAPQPGQSLTTAEVTSRFADEAKKMHDSTNNAI
VPGWGTTWPESLGTPPGGAADEMGKPGGPGVPGSAYQFEVANPLGPSGDY
QAISAAVQSGQSVPLFVGSGANGHIVLVTGIQGDSLEIYEPSSGQKMTIP
RDDFVNNRISFGGETRYRPWGEVIPK
169631655YP_001705304.1 hypothetical protein MAB_4581c [Mycobacterium abscessus ATCC 19977]MKGLRLAPALLLVFVLAASCPKHPETFEPNDVDAARSARLAADAWVAPAK
TYRSSYNGLNNISRESVVRTASVTHSDPLDVVTRETQKALQNGWVLTYAH
CGSVARPMSSASAPQTLSGVEVNLEKSPTDPENAAIAQLTAYRVAPDPDG
QGMVNMEINAFARYHSDRGWPDLPSVPLETTCLAIPGAATAGVNATSAFP
LGIVQGVKGGRPLDEKGEPDGSAR
169631654YP_001705303.1 hypothetical protein MAB_4580c [Mycobacterium abscessus ATCC 19977]MSQNPENTKYVEPGEFKRDTNYINTRITADGRDGYPVEPGRYRLVAARAC
PWANRTLIVRRLLGLEDVLSLGLCGPTHDKRSWTFDLDPGGVDPVLGIHF
LRDAYLKRYPDYPRGITVPAVVEESTGEVVTNDYAQMTLDFSTEWAEYHR
AGAPQLYPADLRPEIDEVNRRVYTEVNNGVYRCGFAGDQAAYDAAYDRLF
AALDWLSERLAGQRYLVGDTITEADVRLFTTLVRFDPVYHGHFKCNREKL
TEIPVLWAYARDLYQTPGFGDTVDFGQIKEHYYVVHADINPTRVVPKGPD
LSGWGTVHGREKLGGRPFGDGTPPGPPRESERVPDPGPCPG
169631653YP_001705302.1 NAD(P) transhydrogenase- alpha1 subunit PntAA [Mycobacterium abscesMTDQPVTIGVVRESGEDERRVALVPKAIAGLIGKGVNIVIESGAGERALL
PDELYTEAGATVGDAWSADVVVKVAPPTAAEVARLRQGQTLIGFLAPRNA
ENSIGALRSAGVQAFAVEAIPRISRAQVMDALSSQANVAGYKSVLVAASE
STRFFPMLTTAAGTVKPALVLVLGVGVAGLQALATAKRLGARTTGYDVRP
EVADQVRSVGAQWLDLGIDAAGEGGYARELTDEERQKQQQALEDAIKGFD
VVITTALVPGRPAPRLVTAAAVQGMKPGSVVVDLAGETGGNCELTEPGQT
VVKHGVTIASPLNLPATMPEHASELYAKNITSVLELLIKDGALAPDFDDE
IVAGSCVTREVS
169631652YP_001705301.1 NAD(P) transhydrogenase- alpha2 subunit PntAB [Mycobacterium abscesMYGQLLANIAILVLAGFVGFAVISKVPNTLHTPLMSGTNAIHGIVVLGAL
IVLGNLPADASWGTRVIAFVALIFGTLNVIGGFLVTDRMLGMFKSKKPAQ
SEQQKEAAK
169631651YP_001705300.1 NAD(P) transhydrogenase subunit beta PntB [Mycobacterium abscessus MSSESLNYIVDVLYIAAFALFIYGLSGLTGPKTAVRGNWIAAVGMGIAVL
ATLIKVSESATTLDWILIGAGLGIGVVLGIPPALKTKMTAMPQLVALFNG
VGGGTVALIAWSEFIETKGFSEFKPDQSPTVALVVGSLFAAIIGSVSFWG
SLVAFAKLQESIPKNVEKRLVASAKLFQASNIVLLLAAVGTAVYIGLHPG
LPVWWIVAVLVFAGVMGLFVVFPIGGADMPVVISLLNAMTGLSAAAAGLA
LNNTAMIVAGMIVGASGSILTNLMAVAMNRSIPAIVFGSFGGSDAGAAGG
AAEQGTVKATSASDAAIQMAYANQVIVVPGYGLAVAQAQHTVKEMADLLE
SKGVEVKYAIHPVAGRMPGHMNVLLAEADVEYDAMKEMDDINGEFNRTDV
TIVIGANDVTNPAARNDPSSPIHGMPILNVDESRSVIVLKRSMSSGYAGI
ENPLFFQPQTSMLFGDAKKSVSAVIEELKAL
169631650YP_001705299.1 hypothetical protein MAB_4576c [Mycobacterium abscessus ATCC 19977]MRGLLGAFVAGAALLTPVATAEPHDCASVDRARVQIRQLSQENGVAVRQT
AVTRNRATAALLRTAAVDTSDPAVRDRALEAAAAAERYANVLAAATSVDG
VLEPPGEEMSRAVNTMAALERVCPAPGG
169631649YP_001705298.1 low temperature requirement protein A [Mycobacterium abscessus ATCCMIGGLRAMVSRDPAEPHRASTPLELLFDLVFVVAVSRASGSLHHFWAEGH
FTQGLIGYAMGFFAIWWAWMNFTWFASAFDTDDWLYRLTTLVQMAGALTI
AAGVERAMTQADFGIVIGGYVLMRVAAGSQWLRAAVSDPAMRATCLRYAA
GIAAVQAAWVWWGVCAPEHVRFGLFIAIALADMSVPLFAERVAPTTWHPV
HIAERYGLFTLIVLGESILASANSIIGGAEEAEHSGTMISIAVSALTIVA
AVWWIYFDEEQECEDASLRASLLWGYSHYFIFASVAAISAGFEVAVDQGL
GKSHLSATTAALTITVPFAIYLVLAWLILLLRRRDAVLNIGLPAIALAAV
AISSMPHALYWLAGLAAVAAALVTWRRVEDTESASAGSLAHSEES
169631648YP_001705297.1 TetR family transcriptional regulator [Mycobacterium abscessus ATCCMQPVPEASKAGSSSQRRAGRREELVAVASKLFAARGYHGTRMDDIADVAG
LNKATVYHYFASKALILYEIYFKAAEETLACLQDDPRWSARESLYQCTSR
MLALIFSNREQGAVYFQENPFLSEWLSPEQVAEIRTREDMVQERVQNIIE
RGIASGEFVECDSHVMALGYIGMVLGSYRWLNPSGRRSAQEIAVEFSTTL
LRGLIRDEATRINDPLGVASATSLDGAR
169631647YP_001705296.1 epoxide hydrolase EphC [Mycobacterium abscessus ATCC 19977]MAADCYLTLDLPNVRLRALAWGPQDGPLVICGHGFPDSAHTWRLLGPRLG
AEGWRVVAPFTRGYAPSEIPADAEYGLGALMQDVLDIHTVLGGDERAIYI
GHDWGALVGNALARSGRSPFARIVTMAVPPFEVLGSNMASIGPGGWPAVL
ARQLFMSWYTLFHQLPLLPEWLLPWLLRLYWRRWSPGYDARADLLYTGEA
MLQKGNRRAVIGYYRANIRGALFPARKYWPTQRSLLDGARTPMLYLHGRN
DGCMTYRLIDSARPDLPDRSVEIINGGGHFVHLECPDVVYELVREFLGPP
TSKVE
169631646YP_001705295.1 hypothetical protein MAB_4572c [Mycobacterium abscessus ATCC 19977]MPVVSQTVEVAAPPQVIVSIVTNYEAYPEWNKEIASVDILQRLPDGRPHI
VRLKVETSGMSSTNVAEIAYLNAAQVATRLLESDIFEKQEQTFSIVPMGQ
TCLLTVDMDVETKLPIPKPMVKKLANQVLEHLAEGLKGRAEAIASGQLQP
APVQQPPTQA
169631645YP_001705294.1 GntR family transcriptional regulatory protein [Mycobacterium absceMNAPRARTREIRRPQLSEEVAGRLRAAIMTGDLRPGEYIRMDETAAQLGV
SVTPVREALLTLRGEGMVDAVPHRGYAVAALSRKDVEDIFALQSHLAVEL
AKAAAARITPEQADALAELNDALRNATSPDQVIWAEFEFHRLLNHVADRP
KLAWFLLQAVRYTPHQLFAEDASWIVPTTETHDKLIAALRAGDIAEVIAQ
TEVQFIDGARRLIEYLDRTGMWSQD
169631644YP_001705293.1 enoyl-CoA hydratase/isomerase [Mycobacterium abscessus ATCC 19977]MSLDESVGAPDVAVDGGIMRVTFTRPDRMNALNGPATSGLIEALESIPGR
DDVRVVVISGGAPGSAFSAGADVTELAAGSADLTPLQAAELTMDNAERLV
RAVLNCPVPTIAEVTGVAAGIGASVGLACDLIYAADTAFFLLAFANIGLM
PDGGSSALVSASIGRVKANAMALLAQPLSATDAFAAGLVNEALPGDQLRE
RVDKTARRLAHGSRRAMQLTKEAMNAVSLKLFDEAIARERDGQIELLISP
DAHEGFAAFLEGRRPNFS
169631643YP_001705292.1 fatty-acid-CoA ligase FadD [Mycobacterium abscessus ATCC 19977]MTDTIDATVQSAGLAQPYRARRQNWCNQLARHALMQPDATAIRYLGHSIS
WAELHQRVQALADALSRRGVGFGDRVLILMLNRPEYVESWLAINELGAIA
IPVNFRMTPPEVAFLVENSGAKVAITETVLAPVAAAVRQQAPALETVIVA
GSASENGVLGYEEVIAEPGEPHAEVDLPGDTPALIMYTSGTTGRPKGAVL
THLNLSGQAMTYLLSTTVDLNSDVGFIGVPMFHIAGVGNMITGLLLGLPT
VIHPLGAFDPGALLDVLESEGVTGIFLVPAQWQAVCAAQQANPRKVRLKT
LSWGAAPATDVLLRTMSETFPDARILAAFGQTEMSPVTCMLMGDDAIRKM
GSVGRVIPTVSARVVDDNMNDVPVGEVGEIVYRAPTLMQGYWNNPEATAD
AFAGGWFHSGDLVRQDEDGFVWVVDRKKDMIISGGENIYCAEVENALAEH
EQIAEVAVIGRPHEKWGEVPVAVAAIHGAALTLAELDGFLTARLARYKHP
KDLVIVDALPRNPSGKVLKTELRQRFGIAD
169631642YP_001705291.1 putative Mce family protein [Mycobacterium abscessus ATCC 19977]MANSFETDGRGPSDRQLLLCGLVMAVVAALVGTALVIKSTGRFNDYVRVV
AELTNVGDGLPAKSDVKYQGVLVGAVDDLTPSQRGRPNVVHINLKPALAH
TVPRSVTARVVPSNVFAVSSVELVDHGPGPAITDGAVIPEDTELPTVLFQ
TTISKLRDILLANGRGRDDDSVGIFAVIAAATEGRRATLLNAAGQLTRII
DQLNDIVATDTGPSTLSALLDATKGLQTTAPELVDALHQAIKPMQTLAEK
REQLQSLLNAGLHTTGTVRQSLDNQTDRMIDITTKLTPVVGVLAKNSVHF
LPMATRLKVFSDKFFSEVWDPEKDVVNIRGILSFTPSTMYTRADCPRYGE
LKGPSCFTAPELVVRPDLPETLLPQNFKPPPDLAPPPGTEVGPDGNLIVT
GPPLLNPHPNLQDPNPPLPWWQPNPSPRVPGSADPDDLEPPPGSPGMPIP
STAPASFGGAVGPVGSKTERDQLGLITGGEASSSTQLLLGPVARGTKPVV
VEQASAGGRR
169631641YP_001705290.1 putative Mce family protein [Mycobacterium abscessus ATCC 19977]MRFRGPLIGLSVFMVIALAMTWLVYATLRREVAGSTNDYSAMFTDATGLR
DGDDVRIAGVRVGRVESVAIDGDLARVDFRVETEQPLYGNTIATITYQNI
VGQRYLGLSMGKTGSTDRLKPGSVIPLEQTEPSFDIGMLLHGFEPLFSVL
DPTQVDNLTDGVVKSLQGDTGSIVGLVDQTSQLTETFAGRDKVLDDVITN
LNGLTQTLAGQNKNLDSVLTHTREMVAILDNRRGALVDSVGSTAFAVRRL
SNISDTVYPQLNEILHREPGFVSHLNTVEPQLAFAGANLPLLLKGVARTT
QEGAFINGYVCDLNITGFFPGLNDVVPIIVNAATPGNKAQYTPKCRNLAD
G
169631640YP_001705289.1 putative Mce family protein [Mycobacterium abscessus ATCC 19977]MAKNTAWQSLWRSISQRPVESYNKAWLGAIALAVIGALVGAMLLVKAIGL
GYSHYTGEFLQAASLQPGANVSYAGVPVGNVTSVELAGDRIEVGMRVRDD
ITLRKDARASIKITTILGNQYVELRNGGDGTLPNRRIDLAHTEVPYDLQA
TLQDATSTFEQVDADKIAESTAILAKQLEGLPAVLPQAMENIQTLSSVIS
HRRDQIGTLLSSTELVAGTLHRQQGDIGKLIVQGRDLLGEFVSRQASFHS
MMRAVTELVDVLNKIVVKDRGAVDKLIADVKTFSNLIGGHDDLFRSLLQV
TAVAARNFTNLTGYGNALELSAPGGLAVDSWMCAISGRAKQFNMIPYFKD
CQ
169631639YP_001705288.1 putative Mce family protein [Mycobacterium abscessus ATCC 19977]MSASLSTGTRRTLWIAGALAIVIAVVAGAFGWTYLRDRSHRLTITAQFES
VSGLYPDNKVSVLGMPIGKVTKITSRGTYMEVEFTIDSTVKVPADAKAVT
VSTSILTDRHIELTPVYRGGPTLKNGDIIGLDRTKTPVEFDRVLAMIDRL
SKAMKGDGKGAGPLADLINNSTNALSGNGELMTSSLDELSKALRLSADGG
AMTRDQLTKIVTRLSSLFEASARNDQNIREFSSTVRQLSQVLDQEQLGSG
TTGKQLNNILLQAGSLLEQNRDAIKQSVGNSSQIAQAVYDNRRELSEGFD
LLPLMADNVYNIIDPVNNVVRAHVPADRLLFDTQAAKEICNLMGLRQLGC
STGTLQDYGPDFGLTYVLDGLAAMGQK
169631638YP_001705287.1 putative Mce family protein [Mycobacterium abscessus ATCC 19977]MNRWQKLAGPAVVAAVLLTSGCSTNGLASLPLPAPGMTGGSYGLTAVFTN
ILNLPARAKVKLGGADIGEVDSMSTANYTAVVTMRIRSDVEIPKRTTVEL
RTATPLGDVFVALKPPRPAVPDAPLLRDGDTIGLDATTAAATVEAVLSSA
AIIVNGGAVRNLTGTVNGLGRATGTNGQAFGDLIGKSNRLLSTLNARSSQ
LDSALRDTAQLAAEMNTRHDTLSDLLVAAAPATDTLAANASHIADLADQV
GLVTKQLSKFPSIAGTDTSGRSVIADFNTLSASFNDITVSPDTSLAALNR
LMPPIIKIMAGSAFAARVSIDKLALGSIPDIGYQGDPGFHGPKRYDWAKL
VGSFKYTLWRLQERVVGKGPDAPAIPMRPSPTEPGVIEPVPGAAPVPQEP
PR
169631637YP_001705286.1 putative Mce family protein [Mycobacterium abscessus ATCC 19977]MINTLATTIVDAVKMGHRQRFWLSGMALLATLLVACAYLMVGALRARAFA
STYEVSIELPESGGLIPEQDVALRGMRVGRVDSVTPSPRGPIARIHIESG
VKIPVGTPVRVSGLSPAGEQYVDFAPVTTAGPYLSNGSVITRGQATVPVS
LSRLLADADGALAQADTKKLEIIKKELHLSRDAPRKMTDIIDGGVFLLST
LDSVLPETVSILKKSRVTLSSFAEMNNGLAVTTQGLNRSLNGVARMDNGF
RTLIDRVPGPLATTDAVIADNSDNMAQLLGNLTTVAQLSYVRVPALNALF
PTYRGSVIDAVANTFHDNGVWAIADIYPRYTCDYGYPRTAVSAADYPEPF
LYAGYCRDDDPAVLVRGAKNAPRPADDDTASPPSGADLGKVADPTPKGRF
TIPTPYGGPTLPIEPPR
169631636YP_001705285.1 putative lipoprotein LprO [Mycobacterium abscessus ATCC 19977]MGMSHFSRLRRTATGPRLITTALGLMLVAALPIPATHNTARAEAAHDAVL
AAIANTKGTFLVYNFGGSNPAPFRNAAGNEYTLDNGGHLMVIKSASSRLR
ANLLVDTHSGYQSRCERDPRARTSEGLWQASETYKPMAAWVAMGKPTFII
NANFFDVRGQKGGTWKSTGCTSPLGAYVDTANGSANYNKQVTGTRVYAGK
QALSGGDEVWTALATMVFSQGSAPEVIASAGPKDFGYATAPLEGLMDKGV
QFVAVSGLKLLLPGFTEQLNDPGPAAARTALGYKSATDELMVFQGGSYTP
DNLQDLYRGLGVDKAIALDGGSSSAIVLRRDAGGMWAGYGSPKGNCDTTY
TLCDAAGGVGRALPSWLGFS
169631635YP_001705284.1 hypothetical protein MAB_4561 [Mycobacterium abscessus ATCC 19977]MGIDIRHADDRARTRISWLDSRHSFSFGEHYDPHNTHHGLLLVNNDDIVL
PGAGFETHPHRDMEIITWVLHGSLVHQDSEGNAGVIYPGLAQRMSAGTGI
LHSEKNDSWRLSGERHTDPVRFIQMWVTPDDSGIDPGYQQREIGNELLSG
GLVTVASGMPQHRDQTAITIAQKNAALHAARIAAGDSVELPAAQFVHLFV
PRGAITVEAVGELTEGDALRLTDIGAVRVTAIRDAEILVWEMHTRLGG
169631634YP_001705283.1 alcohol dehydrogenase B [Mycobacterium abscessus ATCC 19977]MYLEGLAESMKTKGALIRELNKPIVVEEITFGDPAEGEVQVQLHAAGMCH
SDYHVLTGATPMELPVLPGHEGAGVVTKVGKGVTSVQEGDHVIFAFIPAC
GKCPPCMRGYRSLCDRGAILLGGKAIADGTNRIHAGNTPVSAMNLLGTFS
PYAVVHEDSVVKIDDDVPFESAALLGCAVPTGFGSSTNIAEVKPGEDVII
VGIGGIGMSALQGAVVSGARRVIAIDPVPWKREQALKFGATHAFPTMAEA
LLPVMDLTWGIMAQKTIITVGEMRGEMIEEAMLLTAKTGTCVVTGMGAMV
DVDVKFNLFLFTMLQKTLKGNIFGGGTTHTETPRLVGLYKQGLLKIDEMI
TSTYSLEQINEGYQDMLDGKNIRGVIKYTEADW
169631633YP_001705282.1 putative long-chain-fatty-acid CoA ligase [Mycobacterium abscessus MQFTQWLHRALQQYPDRLITIDQGREHTVEQFADRVARLSAGLRANGVRP
GDRVGMLSLNSDRYIEYLTAVPWLGAALNAVNIRWSLAEIGYSLRESGTR
VLLVDDTFKAAAAPLRAACACLETVIYCGAGPAPQDMIGYEDLLASHEPI
DDTRTGGDSLLGVFYTGGTTGNPKGVMLSHNNVLASAMGSLSTGNFLTRG
GRLLHSAPMFHMADFSAVLAGNLSGSTHVIVPSFSPQGVLDAIVAHDVQD
MLLVPTMIQMLVDHPGAAQLDLSGIRSITYGASVISEAVLQRATRVFPNA
RFTQAYGMTEVSPVATLLLPDDHDDPALLRSAGRAAPHCEVRIVDPDDNE
VPRGEIGEVIVKGDNVMLGYWELPEESAAAIRDGWMHTGDAGRMDDRGYV
YIVDRIKDMVVTGGENVYSAEVENALAKHPAVAACAVIGIPDEQWGERVH
AVVVKQAQSECCDGDLQEHCREHIANYKVPRSFEFVDELPLSGAGKILKR
VLRQKYWESRDAGVS
169631632YP_001705281.1 hypothetical protein MAB_4558c [Mycobacterium abscessus ATCC 19977]MSDGVLMWVGLALFALVFAGLWLILTKARKKRIAQLEAFAASQGWMYTAE
DQSLLALSHDEPFGQGHSRTVQDVFNGTTGGHEFVSFQYIYKVTTGSGDQ
RSTETYRYMVTCIVTPPSPYRLEIKPEGVFAGLARAVGFTDLEFESDAFN
KRFNVKAAPERFAYDVLNPRTMERMLADQRYSQPLRFENGRLLTWRRGKL
DENAIASEVQYLIDTLEPIPPYAWEQH
169631631YP_001705280.1 LemA family protein [Mycobacterium abscessus ATCC 19977]MTPVLIVTVIAVFVALIIGLWLLTTYNGFVRIRNLVQEAWKQIDVELQRR
HDLIPNLIETASAAAQFERDTLQQVTAARNVARDAAATHQGVAAQSQAEQ
QLSGALGRFFAVAESYPQLQSIQNFVALQRELANTEDRIAAGRRFYNGNV
RALNTKVQTVPSNLVARWFGFTEAEYFELDDPQARNVPTIRGAFDRLNPP
QQ
169631630YP_001705279.1 hypothetical protein MAB_4556c [Mycobacterium abscessus ATCC 19977]MAMSWAELGSYAGAAFAVIWPLLGFSVLIRTLFRKKNLASSPLAKHAADH
GWHFVAADDGALRQVGYPDTAFAVPFPGACNVVRGQYEGRQFLAFEAYSK
AERVAAEEEYEVKRTAVVAIAMPGPLPWLQVYPENLLTRALGDITFESDD
FNRRFRVLAQDTRFAYDVLNPQNMARMLMDPRYAEFPFRFDGEWLWTWQF
EDLGPALIEDRLRFLADTLAAVPTFVWSPR
169631629YP_001705278.1 glyoxalase/bleomycin resistance protein/ dioxygenase [MycobacteriumMSRMLFVNIPIANAAASRKFFDHLGFSFNDQFCDENTLCMAVNEQSWVMM
LEHDRFRGFIADDIADTSKSREVLLCVSADSRAGVDELVDAALAAGGVDW
MPAQELGFMYGRSFRDLDGHVWEVSWMDPAHLQ
169631628YP_001705277.1 putative metallopeptidase [Mycobacterium abscessus ATCC 19977]MTHRILAVPAAVAVLLLGGGALAAPAYATDVFTPGSPNGIDSYFPQDGNG
GYRVTQYDLTLRLDPETTDVNGTMVISATATQNLSRFNLDFSDLGTVTAS
VNGRDAATEFSGEHEMTVIPEKGIRAGSSFRTTVTYTFNEQQEAQKRGLG
ALPGWVRSTSGGYAKGGEPDGAENWYPSNNTPVNKAPFTLTATVPSSWVA
VGGGREGKSVESGGWTTKTWNEPNPVAMYLVPFAVDHFSVFRSTLPSGTP
VVSAFAPDAGSGNAEARLPEILTFLESKLGTYPHVAAGGIFADPIREDIA
FSALETQTRPYYTFSRDVEDDKRLAVVVHENTHEWYGDVVSVEQWRDICL
NECFASYLPWMWSEEKEGKSIDKHYRETVEKIWDDDKVWGNLLYDMCPGG
AECSADEVFNPLGVYGKGPLALHALRRTIGDKAFLEILRSWPSVHKWGNA
TWPQFEAYVQKVTGKDLSGFFTAWFHSVTRPEDRYLFPGSLAQR
169631627YP_001705276.1 RNA polymerase factor sigma-70 [Mycobacterium abscessus ATCC 19977]MTAHAIEDEFLSHTEQYRREILAHCYRMTGSIHDAEDLVQETYLRGWKAY
ARFEGKSSVRTWLYRIATNTCLTALEGKQRRPLPTGLGAPSADPLDELDE
RSEIPWLEPLPDDATDPASIVGARESVRLAFVAALQHLPAKQRAVLVLRE
VLQWKAQEVAEAIGSTTAAVNSLLQRARAQLHEVSPHEETLLEPEDPMLR
EQLRQYINAFERYDVEAIAKMFTTEAIWEMPPFTGWYQGGPSIAALIKEQ
CPAEHAGDMRLVETSANGQPAIGLYMREGDGVHRPFQMHVLDVTQDGVAH
VVCFFDISLFEKFGLPAELTD
169631626YP_001705275.1 hypothetical protein MAB_4552 [Mycobacterium abscessus ATCC 19977]MGFLKPTLPVVDVADWGKGTRAEKIRPMARHWAEVGFGTPVALHLFYVLK
IALYILGGWLFAMVTTEGIDRWTDFSLPIVFQKVVLYTMLFEVVGLGCGF
GPLNNRFFPPLGSILYWLRPNTIRLPPWPRIPLTKGSARTAVDIALYAAF
LGMVLVALLSQPTAAGLLPTWQTAAILGLLVITGLRDKVIFLAARGEVYG
ALTVAFLFTGADMIMAAKLIFMVIWIGAATSKLNRHFPFVISTMMSNNPL
IRARRLKRAFFEKFPDDLRPGRLSRVVAHVSTAVEGLVPFALFFSHGGWV
TTVAAGVMVCFHLGILTAIPMGVPLEWNVFMIFGVLALFVSHANVGLSDM
QHPAPVLLLLAVSAGVVATGNLLPRKVSFLPGMRYYAGNWDTTLWCIKPS
ASAKIEKGIVAIASMPQAQMERYYGSKDAAQIYMYIGYAFRAMNTHGRAM
FTLAHRAMAGQDESEYVITDGERICSTAIGWNFGDGHMHNEQLIAAMQER
CHFEPGEVRIVLLDAQPIHRQTQRYRLVDAATGEFESGYVRVADMVNRQP
WDDELPVQVNS
169631625YP_001705274.1 lysophospholipase [Mycobacterium abscessus ATCC 19977]MQRTFDGADDVRIVYDTWTPAGTPRAVVVLSHGFGEHARRYDHVARRFNE
AGYLVYALDHRGHGRSGGKRVYLRDISEYTDDFGTLVDIAAREHPDLKRI
VLGHSMGGGIVFAYGVDHQDRYDLMVLSGPAIAAQVGLPYVLTLVAPVVG
RLAPGLPVQKLDVNAISHDPAIIAAYHADPLVHHGRVPAGIGRALLGVGK
TMRQRAAGLKRPVLTMHGSDDRLTAPEGSRWLSESAPDATLKIWNGLYHE
IFNEFEKELVLDEVVGWIDARL
169631624YP_001705273.1 hypothetical protein MAB_4550c [Mycobacterium abscessus ATCC 19977]MTEDKQLSRIAALLRQAEGTDNTHEAEAFMAAAQRLATATSIDLAVARAH
SAKRDAQARPTQRTITIGEAGTRGLRTYVNLFALIAGANDVTCDVASNST
YVYAYGFAEDIDAVHALYASLVVQMVRASDAYISSGAHRPTPTITARLNF
QLAFGTRVGQRLTDARQEARAEAVKTEKRGTGTELVLRDKEIELRDFYKG
TSTARGRWRAVSAQAGYSSHARRAGDRAGRRARLGASPELAGARAALDKN
169631623YP_001705272.1 hypothetical protein MAB_4549c [Mycobacterium abscessus ATCC 19977]MRTIFERAAGHSRRDIDFFGARLTLPPEARFASVASVQRYVDDVLALVHG
RWPAGPVTVRARRGATAAHYERDGDRAAIAVPDDRSGSAWAMRELVILHE
LAHHLCPQDGPAHGHDFVVLYPELAGLAMGPEVEFVLRTVYAREGAR
169631622YP_001705271.1 O-methyltransferase [Mycobacterium abscessus ATCC 19977]MADADTRWIKIDDYLERTVATDAAELNPIRQAQEDGGLPDIAVSATQGKF
LYLLATIAKARRVLEIGTLGGYSTAWLAKAVGPEGAVVTLEFDPKHAAVA
QASLVEAGLGDRVRVLVGAALESLPAVEGPFDLVFIDADKSNNPGYLDWA
LRLTEPGAVIVVDNVIRWIGEEGPNAEGTRAALERLGSDPRLDATALQTV
GVKGWDGLAIAVVR
169631621YP_001705270.1 aldehyde dehydrogenase [Mycobacterium abscessus ATCC 19977]MTDVQIESPVDQALQDLADGEKTWAKTSLADRLRLLADTRQRVIDNAPQW
VQAAAFDIKKLDPQSPLVGEEWISGPYAVAGAVAALIASLEQLQAGHSPL
RDAKFGVTPGGRTTVSVLPLNIFDSLLLSGFSAELWLQPGVDQSEALRTA
GLAQRDPSHTHGVGAVLGAGNITSIAPLDTLYELFANNRVVALKLNPITD
PLLPVFTKVLQPFIEIGAVRILTGGADVGTYLVHHQLVDHVHMTGSSITH
DAIVFGTGEEGARRKAANQPVLDKAITSELGGVSPTIVVPGRWSSSDIEF
QTRHIATQRLHNNGYNCIASQVVVISKAWPQREEFLAALRKAVDEAPSRP
AYYPGSDDRVAGAQQSYPDAERHGQNGARVLIVDPQDRTALLRTEYFGPV
LGVIELDSDGAEFVREAARVANDEFVGTLGVNVLAHPDTIKALGSEFDTL
IEDLRYGTVAINAWTGVGYLTPAATWGAFPGHVINDVQSGIGVVHNGFLV
EKPERTVVRGPFRPFPRSVVHGEWALSPKPPWFVSNATAASTGELLVDFA
SKPSLRKVPRIFISALRG
169631620YP_001705269.1 TetR family transcriptional regulator [Mycobacterium abscessus ATCCMQPGVQECAAGRWSGQRERRRAEFVDAALAAIAEHGPQTSTEQIAVHLGV
TRTKLYRHFTDAADLQRAVAQRASDMLIADLAPLWEPDGSMAQIIEAGVG
AHARFLVGHRNLYRYLAHCSMAENSDGPDAITDIKLAVGTHLGQVFALYL
GAFGAGVESDILAMGIVGMVETATSHWLDNPGTTSQERLIADQVRWIWLL
LDDTLRAEGIYVNPNEPLPPPDEIARTADSYRDPSRLR
169631619YP_001705268.1 dihydroxy-acid dehydratase [Mycobacterium abscessus ATCC 19977]MSAPHKPDSLRASGSSQPDIKPRSRDVTDGLEKTAARGMLRAVGMGDDDW
VKPQIGVGSSWNEITPCNMSLQRLAHSVKDGVHEAGGYPLEFGTISVSDG
ISMGHEGMHFSLVSREVIADSVETVMQAERLDGSVLLAGCDKSIPGMLMA
AARLDLASVFLYNGSIMPGKAKLTDGTEKEVTIIDAFEAVGACARGLMSR
EDVDIIERAICPGEGACGGMYTANTMASAAEALGMSLPGSASPVAIDKRR
EEYARKSGEAVVEMLRRGITARDILTKEAFENAIAVVMAFGGSTNAVLHL
LAIAKEAEVELSLADFTRIGNKVPHLADVKPFGRHVMKDVDEIGGVPVVM
RALLDAGLLHGDCLTVTGKTMAENLAHIAPPDPDGKVLRAMNDPIHPTGG
ITILHGSLAPEGAVVKSAGFESDVFEGTARVFERERAALDALEDGTITHG
DVVVIRYEGPKGGPGMREMLAITGAIKGAGLGKDVLLMTDGRFSGGTTGL
CVGHIAPEAVDGGPIAFVRDGDRIRLDVANGKLDLLVDEAEIAERRKGFE
PLPPRYKTGVLAKYTKLVQSAAVGAVCG
169631618YP_001705267.1 hypothetical protein MAB_4544c [Mycobacterium abscessus ATCC 19977]MPFMPVSDSMFLIGETREHPFHVGGLQLFKPPVDAGPDYAEVFYEQLMST
TEVSSDFRKRPGQPLAVMGNLTWIVDDEVDWEYHVRRSALPRPARVRELL
TVTSRWHSSPLDRHRPLWEMHVVEGLSDGRLAVYTKMHHAVIDGVGALRM
MMRSLSDDPDARDCQAVWAPAKRRAKSSIVSTTNTSAIDLVKGAAGAVRQ
VVSIPPGLLKYGRHALSDPQLVKPLSAPHTMLNVSIGGARRFAAQTWSMA
RIKEAGKALGGTVNDVVLAMCGGALRTYLEEQNALPDKPLVAMCPVSIRA
EGDQNAGNSITALLANLATDKPDPLERFSAIRDSVQAAKSVLSEMTPLQR
MLVGALNGAPVLTGAVPGLVDRTAPAFNVIISNVPGPRTDMFWNGFEMDG
CYPASIPIDGVALNITCTSSGSSMHFGLTGCRTSVPHLQRILAHLEDALT
QLEESVA
169631617YP_001705266.1 hypothetical protein MAB_4543c [Mycobacterium abscessus ATCC 19977]MRNRTRTAILAGAAAAVLILSACSSDNKGDDAKSEHSGHSGMSGMTTTLD
TNAAAPVSDHNDADVTFAQQMIMHHQQAVEMSKLTEGRTANPAVLDLAKN
IETAQQPEIDTFTGWLKQWNQPLMPEGHDPAGHMPGMVDAPVLDRMKTLN
GEVFDQLWLQSMIAHHQGAIAMSNAELSGGQYPAAKQLAQQIIDNQQPEI
DTMQGLLKG
169631616YP_001705265.1 hypothetical protein MAB_4542c [Mycobacterium abscessus ATCC 19977]MSTKTSTGHGYSLKKDDYAKRLLRIEGQVRGIAKMIDEDKYCIDVLTQIS
AAQSALRSVALGLLDEHLGHCVTNAVASGGADADEKLAEASAAIARLVRS
169631615YP_001705264.1 TetR family transcriptional regulator [Mycobacterium abscessus ATCCMTNLIPESETPNKRERAKADRRDQLLRAAARLLAMRGYARVRLEDLGSAV
GISGPAIYRHFPNKEALLVDLLTDVSRRLLEGGMTVAAAASSPAEALDGL
IDFHLDFALNESDLIRVQDRDLDSLPENARRQVRQYQRRYVEAWVQVLCR
SQQGLDESDARIKAHAAFGLMNSTPYSAGRSAPSQTRTVLRQMVVAALRS
169631614YP_001705263.1 putative acetyl-CoA carboxylase subunit beta AccD [Mycobacterium abMTLVGEQNRAEHARLVAELRERLAHAALGGNEQSRQRHVDRGKLLPRDRV
DALLDPGSPFLELSPLAANGMYDDDAPGASMIAGIGRVAGRECVIAANDA
TVKGGTYYPMTVKKHLRAQEVALQNRLPCIYLVDSGGAFLPKQDEVFPDR
EHFGRIFYNQATMSAKGIPQIAAVLGSCTAGGAYVPAMSDEAVIVRKQGT
IFLGGPPLVKAATGEVVTAEELGGGDLHSRTSGVTDHLAADDKDALRIVR
RIVSTLAPRTESPWPVVEAIAPERDPGTLYDVVPTDPRIPYDVHEVIVRL
VDGGTFTEFKAEYGKSVVTGTARLHGHPVGIIANNGVLFAESAMKAAHFI
ELCDQRRIPLLFLQNISGFMVGRDYEAAGIAKHGAKMVTAVACARVPKLT
VVIGGSYGAGNYSMCGRAYSPRFLWMWPNARISVMGGEQAASVLATVRAD
QSAASGKKFTEAEQEAFKAPIREQYEQQGNPYYSTARLWDDGVIDPADTR
TVLGLALGICANAPLEPVSYGVFRM
169631613YP_001705262.1 putative acyl-CoA carboxylase subunit alpha AccA [Mycobacterium absMTLQSVLIANRGEIAVRIASTLRAMGIRSIAVYTDGDTDHLGSCDTAVRL
GADSSCYLDIDAIISAAKQTGAQAIHPGYGFVSENADFVRACQAAGIVFV
GPPAEAMDAMGDKIRAKGTVAAAGEPVVPGSVGALSDAELVFTAEKIGAP
LIIKPSAGGGGKGMRVVHDLGGISDALVASRREAAALFGDDTLLVERYLA
RPRHIEVQVFGDTHGNVVHLGERECSLQRRHQKVIEEAPSALLTPQLRAA
MGQTACQIARSVGYFGAGTVEFILDSDAPESYYFMEMNTRLQVEHPVTEM
VTGIDLVQWQILVAAGERLPLSQEQIVLTGHAVEARVYAEDPAREFLPTG
GTVALARFSGTARTDTALATGSVVGSRFDPMLAKVIVHAADRDTALAEVD
RALAETRILGVGTNIDFLRALVTNPVVMSGDIDTALLDKIAAEYHPPAAP
PWVWVAASALLDGQSGAGTLWDGKSGWRVGAHAPRAHRLRIGDSTELVRL
WGDPVTEVSIGEGGRTPSRVHCATAEVSVEFAGQLHRADAVRSDAAAWVA
TGDGTWHADIAPEPRLRHLDGDDEDGEIRSSMPGVVRVVSVSTGAAVERE
AAVVVVEAMKMEHTLRAPIAGTATVSVAVGDQVAVDQLLATIHPNTNPEE
GKP
169631612YP_001705261.1 putative acyl-CoA dehydrogenase FadE [Mycobacterium abscessus ATCC MTFSTAELPDEYESLRKTVEEFAHSVVAPAAAHHDATKTFPYAVVAQMGE
MGLFGLPFPEEYGGMGGDYFALCLTLEELARADQSVAITLEAAVSLGAMP
VYRYGSEEQKQRWLPELASGKSLAAFGLTEPGGGTDIPGSIRTRAVEDNG
SWVINGAKAFITNSGTDITAVVGVAAVTGRSADGSPEISVIHVPSGTPGF
TVEPGYDKVGWHASDTHPLSFDDVRVPYENLLGERGRGYAGFLRILDEGR
IAIAAVATGAAQGCVDESLRYARSRPAFGSAIIDYQSVSFKIARMQARAH
TARLAYYHAAALLLAGKPFKTEASIAKLIASEAAMDNARDATQIFGGAGF
MNESPVARQYRDSKILEIGEGTSEVQLMLIARALTG
169631611YP_001705260.1 hypothetical protein MAB_4537c [Mycobacterium abscessus ATCC 19977]MLVLTRWFRRALVSGVCVAGLLGAGVVPALADPGDPPDPGIEEPGPPPPP
PLPWELPPPPPPPAPDAPPPAEVPPVPAPVPTTPPPGAPPTGDVPPLPVG
LLKNSPNNGDVVGVAQPITIVFAAPVTDKKAAEAAVKITTSKPAPGYFYW
YTDQQLRWKPTQFWPANTDVNVNAGGTKWSFKVGDAFVSTVDDATYTMTV
TRNGVVERTMPISMGKHDKKHETKNGTYYVSEKFQKMVMDSSTYGVPVNS
AEGYKLDVYWATRLSNSGIFVHAAPWSVGAQGKSDTSHGCINVNTDNATW
FFNQSHPGDPVIVKNSPGGPYKDYDGYDDWQRF
169631610YP_001705259.1 zinc metalloprotease [Mycobacterium abscessus ATCC 19977]MTTESVLPKSGIDLSHRDESIRPQDDLFGHVNGRWLAEYAIPADRAVDGA
FRTLFDRAEEQVREIITEAADSNAAEGTESQKIGDLFASFMDTETVSGLG
LTPLQQELDLIASASDTTALAAVMGVLQRAGVGSGVGCYVDTDAKDSSRY
LLHVSQSGLGLPDESYYREEQHAATRDAYRTHIAAMFTLVYGDGDHADTA
GKIVALETKIAAAHWDVVKRRDAELSYNLLRFADLEQTAPGFDWSGWLSA
LGAGAGQVTELVVRQPDYLTTFGRLWATEPLSDWKLWASWRLICARAPYL
TDPLVNENFDFYGRTLSGTEQIRDRWKRGVAVVESLLGEAVGQLYVARHF
PPNAKARMEILVDNLREAYRVSITDLEWMTPQTRERALQKLDKFTPKIGY
PATWRDYSTITIRRDDLLGNVRRATAAECDRGLAKLAGPVDRDEWFMTPQ
TVNAYYNPGMNEIVFPAAILQPPFFDADADDAANYGGIGAVIGHEIGHGF
DDQGSKYDGDGNLVNWWTDTDRDEFGVRTKALIKQYDEFVPRELSDQHVN
GAFTVGENIGDLGGLSIALLAYEISLGGGAGPVIDGLTGVQRVFYGWAQV
WRTKAREAEAIRRLSVDPHSPPEFRCNGVVRNIDAFYEAFGLTTEDELFL
EADQRVRIWS
169631609YP_001705258.1 hypothetical protein MAB_4535c [Mycobacterium abscessus ATCC 19977]MSKDASASENGPVFSRYGVLSAVLGVITVVALVLSVLITTGHRSQVARDR
YDARVLDTAVTWVNTLINMKKSNLDSSVQTLQDGTAGQLSDHLGELIAGV
VKLARTVDADAAGEIDSVAIDRRGASIPGEDVGLPAVERIDRVMVVATSV
TRDVNAAPKVNQWHMRLAVSKVGDQLSITGLELLR
169631608YP_001705257.1 hypothetical protein MAB_4534c [Mycobacterium abscessus ATCC 19977]MSRNMLRVILFDLLAPVVTVLAIVELGVILRWPVWWVVVCTAVCVLIVEG
MAVNAYLARRDSVTVGTDDDGPALRTGIVALATASVLAVAVVGYARWTLP
DREGNADRAAVTDVAATVSEAVVNFAPDNPDTSVRQATEHMTATQGQSFT
RDFGRATAELKAKGISQQGEIVSVGIEALGPGDAVMATLVRRTSVAAKTR
PEQSVLALRLTLTKRDGRWLVDNIAPIDRIGAQVPKN
169631607YP_001705256.1 hypothetical protein MAB_4533 [Mycobacterium abscessus ATCC 19977]MWTAPDDATIAQILRDTKTIAIVGVSANPDRPSHGVYRYLAEHSPYRIFL
VNPTISELDGKTVYPSLDALPETPDVVDVFRRPEELAGIAQEAIDIGART
LWFQLDLVDLDAANKATEAGLQVVMDRCTEIEFARLGPH
169631606YP_001705255.1 hypothetical protein MAB_4532c [Mycobacterium abscessus ATCC 19977]MSELTLRTIADEDDYESYMASAYSVFLRDPQKDEIEVNRKFTELDRMIGF
HDGKKWVATTGAFSRHVVLPGGAVVPVAAVTAVTVSPTHRRRGLLTTMMR
HQLADIRSRGESLAMLFASEALIYGRFGYGVATESAELSGQVRELAFRPT
VDLGDGTLEEVSAETFLASAPAIYDAVIPGLPGQMSRTPEWWASWTLDSE
ELQKESGKVRFVLHYESDGTASGFAIYRPKPGWGDAGPNAELHVQEVLGT
NPRSYARTWRYLLDMDLVRKIKYHGASVQEELRYLVANHPSLECVVSDAI
QVRLVDIPRALAQRRYAADVDVVLEVTDDFLPENSGRYRLRGGLDHASCE
ITTDDADIALTVRDLGSVYMGGVSLQVLASAGLVTELRAGAVQRAATAFG
WPVAPSAPDDF
169631605YP_001705254.1 hypothetical protein MAB_4531 [Mycobacterium abscessus ATCC 19977]MSDETKSDEPTGAITTPTPPPPPAPASVTGPPKPPPTNVGWAVASVIFFW
PLAFSAFTNALNVTQFWLTGQYDRAQESSDRAKLLGKIALLTGLVLLFLF
ITLRIACAIWWHSHGGGWGHHGGWHRSWDDGGWDGPGPIGPMGRPGRDN
169631604YP_001705253.1 hypothetical protein MAB_4530 [Mycobacterium abscessus ATCC 19977]MTVTSDAPAVSPEVPDEPSGSGASGSTSAPPGRGDKPVTHWTTAEILGAL
QSGDLSDWQAIVHALKRDPFGRTARQVEEVVSADELYGISTALQEVLIRA
RDDLAAAERREAANEINLLFEASGLREAEFASRIGVSGSELSAYLAGSTI
PSVAMLVRMRRVARRFGRTRPRG
169631603YP_001705252.1 putative membrane protein MmpL [Mycobacterium abscessus ATCC 19977]MMRTSDYLRRYRWLTVAVWLILIVAAVGLVAGRGEKLTGGGFEVAGSQSL
KVHDAMETGFREQGASPLALVAAPRPDATVSDMAAAVDYLKQVAAQIPQV
SVEPIPPQLTPQPDRPFVVTLRIGFDNTGATDIAKSLRKKIGVHGGQPGQ
IAGGRVSLYVIGQGALGAAMTEQIAGDIKKAEKWNIPVILIVLIAAFGSL
AAASLPLLLGVCTVALSVAIVLALSNITTISVFALPTVTMIGLAVAVDYS
LFILMRYREELNSGKNRQEAIAGAMATSGLTVTFSGLTVIAALAGIYLIG
TPALASMASGAIIVVAIAVLTSTTLMPALLAIFGKAAANQSRFLRVSPLR
KHSIPFWRKWTQQVMRRPWLSALGASIFLLALAAPSLQMHVSNSMLRQFD
SSHEIRRGIDAAAVAMGPGALGPVQVLLTFKDSPAHAHAQALETAKETIA
QAPNIARVSDVSFSTDGHDALISAVLSVDPEANAARDTVSWLRANVPDAL
ENSGADINVGGPTALLFDYDTRVEHSLLGVFAFVCVLAFVMLLATLRSPV
LALKGVVMTVLSVAAAYGSLVIVFQWGWLEFLGFHKANIDSSIPPLALAL
TFGLTMDYEIFLLARVRERYLRTGDCGDAVSYGVRTSARTITSAALIMIA
VFIGFAFVGMPLVAQLGVACAVAIAVDATVVRLVLVPALMAMFDKRNWWL
PGWLDHVLPTVDFETPCVDELPGPHSESALRLQGSGFEEPRIDYHAIAVS
AARLKRLADGGTITAPDTQAVLADRWRDNLTVALEALQTSKNGTDTDIVE
MPGPLSRVTPVEITQVKLPTGQKCVVPTDAEALRMQGLLLMRRNAERDYT
EFARLASAMEPRMAAKVLAGIDQHYCVQSNQRWVSSQLVRRLADPKPGDG
AMECPTVRRQCLSVAVAMLEDAR
169631602YP_001705251.1 hypothetical protein MAB_4528c [Mycobacterium abscessus ATCC 19977]MSATTSRRAAYGLLSAGVLAGGLALSALAPIAAAEPVPPTPAPAPAAPAA
PAPVANAAAPAAATVTPATPTPDGCQASKMTKTVGNVVQNAASYLEQHPD
VDAAFTEIKAAPQDQIATKTQSYLVSRPDVAASLGGIAAPLNELRTKCGL
PLDLAQVVNGGGLNPAAMGVNPALLTALSQNPAAQQVAQNPAAQALVQNP
AVQAAIQNPAPAATFPQGPGPAPGPAQPVQPAAPAGPVGTGPAPGPRV
169631601YP_001705250.1 hypothetical protein MAB_4527 [Mycobacterium abscessus ATCC 19977]MPSPTASQKADRSRQDLVNTLGLARQYTQAGGMEGLAAVLVPLAGYAAVL
LSVRYLNRHDDVAPAAGREALPH
169631600YP_001705249.1 hypothetical protein MAB_4526 [Mycobacterium abscessus ATCC 19977]MPSAQPNSLTKKPATSVLLALVLDVVGIFVFCTIGRRSHAEGITLLGVWQ
TAWPFLSGGAIGWVLSRGWSRPTSITPTGIAVWVCTVLFGMVLRRLSNQG
VAVSFVVVASLVTALFLLGWRAVANRVSKS
169631599YP_001705248.1 hypothetical protein MAB_4525 [Mycobacterium abscessus ATCC 19977]MITTNPVLAAGTWTIDPVHSDITFSVRHLGVSKVRGSFTDFSGEITVAED
GTPSVSATIDVASVDTRNDQRDTHLRSADFFDTDNHPKATYRSTAVRPEG
DDYLVEGELTLHGVTRPVALSLSLEGVGAGVQGGSVAGFEASAEINRSDF
GITGGAGLVGEKVTLTFNIEAGHPEAPSN
169631598YP_001705247.1 hypothetical protein MAB_4524 [Mycobacterium abscessus ATCC 19977]MPPSDDRDPDRLEGGCTPPDPNGPDSCPDDPEADTAPQPVIKRRGKYWWI
RWAILIVLAIVLAVEIGFVSDQLDRAWRSLKTANPWWVLAAALAAMASMH
SFAQIQRTLLRSAGVKIRQWRSEAAFYAGNALSTTLPGGPVLSATFIYRQ
QRLWGATPVVASWQLVMSGVLQAVGLAILGLGGAFLLGAKTNPFSLVFSV
GGLLAILLLAQAVASRPEMLDGIGVRVLRWVNDLRGKPPMMGVARWREIL
KQMEAVTLTRRALGEAFGWSLFNWIADVACLAFAAYAVGSRPSLVGVMVA
YAAARAAGSVPLMPGGLLVVEAFLVPGLVSSGMTLPDAISAMLIYRAVSW
VFISAIGWVIFFFLFRDESQIDPDATPAAAKDPDATPGAPPANPPKNSSD
PPK
169631597YP_001705246.1 putative adenylate cyclase [Mycobacterium abscessus ATCC 19977]MMERLREWFRAMHVLGPRWSVFVASMVGINAATLLLLFYFLRHWMPFKRP
AGDWVFENGPPLFWLLFGIMIVTSVGWALHMEHRLARWYCRGGPPTALEL
RTALTAPLQQSLLHLGGWAIGATVFIAAGAMHDSKWTLATIIGCVQSATA
SFGITYLLGERILRPIAAKALSASEFHGRFAPSVFVRVRLSWWIGTLAPA
IGIIALCGMALWKPEDLTSTRDLALTVLLIVSTTLVGSYGLALLTAGQLA
DPVRQLRTAISDVAQGDFNARVEVYDGSELGVLQAGFNRMMQVGEERRQL
RELFGKHVGADVASQALQLGTNLGGENRYVAVFFVDMIGSTSMAADRDPE
EVLTILNDFFRIVVEVVDSRGGFVNKFVGDEALSVFGAPLHRPDATTACL
AAARELRDRLNEDFPHPFEFAIGVSAGLAVAGNVGATARYEYSVIGDPVN
EASRLTELAKHRPSRLLASTNALYFADPDEQKHWEHGDSVLLRGRTRATH
LAWPAGT
169631596YP_001705245.1 epoxide hydrolase EphF [Mycobacterium abscessus ATCC 19977]MTQRSMPVLDGVEHQYVQAGDVKIHVAVAGPQDGRAVVLLHGWPENWWMW
HKVIPALAAAGYRVHAMDLRGAGWSEVAPAGYEKEQFASDVLAAADALGL
ESFDLVGHDWGGWTAQLVALKAQSRIRRLVVLNIPPVWQQPGRVARYAHK
LAYQLVVGAPVVGPLSHLSPTLWWFIRRSGMPKESVDFFRSCFRDRDRRV
AGSKIYRSMVGKEFANLARGPYDDQKLTMPVRVLFGLDDVAVHPSLLDGF
KDHADDLNITEVPNCGHFIVDEQPELVVKWLSEVLAEPAP
169631595YP_001705244.1 hypothetical protein MAB_4521c [Mycobacterium abscessus ATCC 19977]MTHADAAESVHPYVRKGAAWAWRLLVLLAFGLTVLWLFWHLKTITIPLLL
ALMGSALLVPTVNFLQRHKIPRSLAVVVVLLTGTAAIVGILTFVVDQFIK
GLPDLSAQLTNSIESLKNWAIHSRFHISEDQIGKAGDALVNTIKDNQGRV
TSGALATATTVTEIITGAVLTLFTTIFFLYGGKEIWEFVTRIFPTAVRPR
VRRAGVLGFGSLIGYVRATVAVALVDAIGIGVGLAAFSVPLALPLASLVF
LGAFIPIIGAAISGFVAVFIALITKGAFTAAMILVIVIVVMQVEGHVLQP
LIMGHAVQIHALAVVLAIAAGGVLGGIIGALLAVPTVAVLNTAIRALIEP
FDADDPYLREGEEEAEVLDPEMVPDGGPSALGAKPGNGVPELGPAPPKD
169631594YP_001705243.1 putative two-component system sensor kinase [Mycobacterium abscessuMGSKNGTVPRWMSGSDPTASLWRAAQVFRLASFGYALLASQLASYTNYER
QGLSWALYAVMAMWTGFAAVALSRNWFRRWQLVLCDQAIVIALMLAGRLV
VDVQWYSGHQTLPTTLWVANAVVSMGLLRGQLAGVISGFVLAAVSIAARG
LPVSALWLDATMPALVVVGLAIGAASTTAKRTFHELRRAERAAAAAIERE
RLSRQVHDGVLQVLSYVKRRGTEIGGPTAELAAIAGEQEIALRELISGAT
QTTLADDELVDLRPLLRTQASTTVSVSAPGAPVLIGQHMASELAAVVRSA
LSNVALHAGPQAHAYVLIEDLVDSVVVTVRDDGSGIADGRLDQAEREGRM
GVSRSILGRVADLGGAVLLETGPGAGTEWEITVPKSQEVGA
169631593YP_001705242.1 two-component LuxR family response regulator [Mycobacterium abscessMTGNTDSEQISVMVVDDHPMWRDGVSRDLQAAGLRVVATADGVASSGRIA
ATVKPDVVLMDMQLTDGDGAQATAAVLSASPHSHILVLSASAEREDVLEA
VKAGATGYLVKSASAAELIDAVRATAKGQAVFTPGLAGLVLGEFRRMSSA
PAADADETPRLSDRETEVLRLVAKGLSAKQIATRLSLSHRTVENHVQSTL
RKLQLGNRVELTRYAIEHGLDE
169631592YP_001705241.1 putative YrbE family protein [Mycobacterium abscessus ATCC 19977]MTTPGGRVATEDGAAAIQDWATGYVKRHPLESLSTVGEQFMLGVRTLQWF
FVDLFTGQFQWQEFVRQGAFQAATAVMPVILVTLPIGVTLSIQFALLAGQ
VGATSLAGAASGIAIIRQAASLVAAVLMASAVGSAITADLGSRTMREETD
AMEVMGVSVIRRLVVPRFAAAIMIAVALTAVVCFVGFLGAYLFNVYWQGG
APGSFVSTFASFATPDDMVLAVLKAIIYGAIVAVVSCQKGLSTKGGPIGV
ANSVNAAVVESILLLMVVNVAISQLYIMMFPRTGL
169631591YP_001705240.1 putative YrbE family protein [Mycobacterium abscessus ATCC 19977]MTVSSYLSPGRRPFILAYNRIRRPLMRFGHMVAFFFRALSGIPVVLRQYS
KEFLRHLSDIAWGNGSLVVGGGTAGVALVLGVTAGALVAIESYNFLDLLG
LGPATGIISSLASTRELAPIMASLAFAMQAGCRFTAQLGSMRIAEEIDAM
DSVAIRPIPFLVTTRLMAAIIAVIPLYLACLAISYVSCQVMVGILSGGSV
GSYLHYFGIGVSGIDIVYSIIKTVVFVWIASTVQCYYGFYASGGPEGVGI
AAGHAMRAAITVVVMVNMLLTMALWSVDAGARLGG
169631590YP_001705239.1 putative Mce family protein [Mycobacterium abscessus ATCC 19977]MPNPFEVDGRGPSGNQLLTLAVVTLVAIVALTGAMLLKSAGRLNDYVRVV
ADLTNVGDGLPQKSDVKYHGVLVGEVDDVTPATGSEPNFVYINLKPEYAK
TIPSSATARVVPSNVFAVSSVQLVDRGPGAPIRDGAHIAEDHELPTVLFQ
TTVSKLRDLLNATGRGRDDNSVGILAAVGAATDSRRAKLLAGGAQLNRLI
NELNAIVATDTGPSTVSALLNATEGLKQSAPDLLDSLHQAVRPMQTLAEK
REQLTALVHAGLTTVGTNKQAFDNHTDQLIGITTGLTPPIGVFAKNADKF
VPIFRNINKLSRNWFEHMWMADRDVPNMPIAVTLAPSYTYTRADCPRYGD
VKGPSCFTAPEQVVRPDLPETLLPQNYKPPADLAPPAGTVIGPNGNLVAV
GPPRVVPPGGPNLIDPNPPLPPWQPYPMPRVPGTSDPDDLEPPPPPATPP
IPPAPVAPGGINGAGRPAVAPASYGGNVGPVGSRGERDQLRVIAGGSATP
ATQLLLGPVARGSAVSFVKEGPS
169631589YP_001705238.1 putative Mce family protein [Mycobacterium abscessus ATCC 19977]MRFRGPLIGLTVFMTVALTLGWLVYATLLREVSGSTTAYSAIFTDVYGLR
EGDDVRMAGVRVGRVQKIELVDNERARVDFVVQNDQKLYGNTIASVTYQN
IVGQRYVGLSPGKSGGPAGDTVLAAGATIPVERTDPSFDVTTLLNGYEPL
FSTLSPEQADNLTKGVIQSLQGDNASIVTLVSQTSTLTKAFAGRDQALGN
AITSLNTVTGNLAQQNASLDKVLTQTRQMVSDLDSRRPELVSSAGSLAQT
MRRLSKITNDVFPSLEEIITRQPGFTNHVVGIEPQYAFLGDNLPIVLKGL
SRFYSEGAFINVYMCDLNLTGFFPGLNDVIPIIVNAATPGNVAQYTPRCR
NMANG
169631588YP_001705237.1 putative Mce family protein [Mycobacterium abscessus ATCC 19977]MAERSRWQKIKNRPIETYNKTWLGFIAIAVIASLIGAMLLIKALGLGYTS
YTAEFVQAASLRPGQPITVAGIPVGNVTSMKLVGDHVEAGLKVRDDIRLG
KDTKASIRVTTILGSRYLDLRPRGSAALPGKTIDLAHTEVPYDLQAALAG
ATNTFEQVDFDKVAQSLTVLGTQLQGLPDVVPRAMENIQSLSSVIADRRD
QLGTLLKSTEKVTSTLRRQQSGIGVLINQGQDILEEIVTRRNTFHAMLQS
FTNLVEQLSKVVVQDRAQLNAMLKTAHELSDMLGKHDDLLRSLYPIAPVL
IRGIANSTGTGNAIDINLTNGLLVDSWMCAISGRAKQFGMIPYFKDCK
169631587YP_001705236.1 putative Mce family protein [Mycobacterium abscessus ATCC 19977]MSKSGHSRRRLIAAIGALALLVAAVVGAGAYWVRSATDHITLTAQFESAS
GLYESNVVAVLGMPVGKVTKITPMPGYVEVQFTVDKNVRVPVDAQAVTLS
TSILTDRQIELSPPFRGGPALKDGDTIGLDHTKTPVEFDRVLGMLDRLSL
SLKGDGKGQGPVADVINPVSGIADGNGEKIKAGLGELSKALRLSSEGGAT
TREQLTAIVKNVSSLFDAAAANDGKLREFASTVHQLSQILDEEALGTGST
GRRFNELVKQAGDIVEANRDHLKQTILNSNTALKAVVDNQREISEWIDVQ
PLAWDNMYNAVDHDNKRLRVRFMTDRLVFESQMDKEICNMMGLRQLGCST
GTLQDYGPDFGLTYVLDGLAAMGQK
169631586YP_001705235.1 putative Mce family protein [Mycobacterium abscessus ATCC 19977]MAARVARTVRAAVATLMTATVLSGCATNGLGDLPLPAPGIGSGGYRLTAL
FSNVLNLPDSAKVKLAGADVGQVDEMHVRNFTAVTTLRILDGVRLPKGST
AELRSATPLGDVFVSIRPPAGASADGPLLTDGDTIGLDSTTAAATVESVL
SSAALASNGGAVRNLTNVVNGFGKATGDQGQAFGDLINDSNRLLGALNSR
SVQISEALTQTSQLADQLDAKNQVVTDIVTAAGPATETLASNTAQLSELL
LMMGDTTRQLQKFPSIAGTDTSGRSIIADANTIAKAWNDVAVDPDTSLAA
FNRIFPTAIKATAGNSLSLHASLDQLVLGSIPDVGSYADVGLHGPKRYNW
AQLAGSVKYTLWRLQERVVGKGAFGQEAPVGPSPTEPGVIEPVPPAPGPG
R
169631585YP_001705234.1 putative Mce family protein [Mycobacterium abscessus ATCC 19977]MIDAVANAVVAAVRAGHRQKSMLSTLALVLTLVLAVTYLCVGALRANPFA
STYRVTVKLSESGGLLPRQDVALRGVKIGTVQSLRITPQGVEATAEILSK
YKIPAAAKVRVAGLSPAGEQYINFEGTPGQHGPYLSDGSVIAEGVQVPVT
LAKLLADADGVLAQVDPKKLELIKKELGLTKEGPRKLTEIIDGGTFLLST
LDSVLPETTSILKNSRVVLTLAADKNAGIKATADGLGRTLRGVEKMQNGY
RTLIDRTPKTLSAIDNLFSDNSDTMVQLLASLATTSQMLYVRTPAINAFF
PNYRGSTFGAIADTMRDNGIWVTADLYPRYACDYGTPRVPPSSADFPEPP
VYTYCADDDPAVLIRGAKNAPRPAGDDTAGPPPGADLGKKTDPTPKGRFT
IPTPPGGPTLPIEPPR
169631584YP_001705233.1 TetR family transcriptional regulator [Mycobacterium abscessus ATCCMDDENDTTARKRLPRGQGWQLRQQIIDTAMDLILSSGEARAPSARELTRA
LGITAPSLYRHFSSTDELADALCARYFEQLGEALQRATVNVSTALERLHA
LGLAYVRHAAEHPLWYRFATANPPRLGAESDEILSSSAFLHLRDIVQELV
DEERFPRGNTLGSALQLWATTHGVASLLVTRPYLPWGEQESFASRTLRAA
YLGQVMTAGPESADGDGK
169631583YP_001705232.1 hypothetical protein MAB_4509c [Mycobacterium abscessus ATCC 19977]MFTSHRTASTLRGMSDPQLQQMTATLDELDGRERALRAEVDALRGRMVEW
TQAEYLKAQRYWDDYRRAQGVAQAVAPAPVVMPPARMPVPARAPHPAPPQ
LEPWWMREGFASKAMALAGAVVTLAGVVMLLVLAAKSGYFGPVPRMVSGA
ALAGGLVALGIRVYSRPGGRVGGIATAATGFAAAFFDVLALTVIYDRIPV
VAGLVLGLGIAGVGLVLARHWNSQPFASGVVAAITVLAPFLTDGFTVELA
AFALILLIASLTAQVGRNWPVLHAFRTVGVSLTLLTAIHVSYTASLALLA
MSVMALLVTLVGSLWLLTGEHDDITSSVMIAVASSPVLYGALFFPVWPLG
VLVPVGVAVVMGAVLLLVGALPVHARITVAAVAGVALLQASVDGARDALL
AVVLLAIALSCCAIGYQLRDRVALVLGQVFGGLGAAVYLAYVRPELLTDS
ASAVLYAGPLLVIASVLMAATVGMVLATMARVGWASPQSAPTRAVLAGVS
MLYSGTAAVVLSGTALLGNNDGFLLGHGLATVSWMAVSVALLLAGLRRYR
GRSWVTRTGFVLAAMAVAKLFLFDLATLDGVARIGAFIVTGLLLLGGGTL
YAREYATRSEEPSAERPVT
169631582YP_001705231.1 putative membrane protein MmpL [Mycobacterium abscessus ATCC 19977]MFAWWGRMVYRYRFIVVAAFVTVCLGSGLFGITLGDHVTQSGFFADNSES
VKASVMADDALGRDRTTHVVAVIAAPEGKTVDDPAFQKKVIDHFDQLQKD
NPDEVYGWAGWLRAPTTTDPTVKRMVTEDRKHTFVSVSLKGDDDDTILNN
YKALSNPDKDDDPAKNKFLMDGVDIQLAGLQPVASELTGTIGKDQQRMEV
LSLPVMAVVLFFVFGGVIAAGLPLMVGGLTIAGALGIMRLVTLFAPVHFF
AQPVVTLIGLGIAIDYSLFIVSRFREEIAEGYDTETAVRRTVITSGRTVM
FSATLIAAALMPMLIVPQQFLRSLTYAGIASVLLAAILAVTVLPACLGVL
GRHVDALSIKRFSRTKSREELENGFWGRTVVYVMQRPLVFAVPIVIVMLL
LIIPLGNLKLGGFSEKYLPPTNSVRQAQENFDSLFPGFRTETITIVTKGA
TDSQLNQIRADAMKVPGFVEPGGDKTQMWQRRQAVKTDGDTSVKVIQNAL
VDRNTAGAKVKQLREIPVPKGVTMYVGGTPALEQDSIDTVFDKLPFVIVV
LISVTTILMFLAFGSLVLPIKAAVMSALGLGSTMGILTWIFVDGHFSKWL
NFTPTPLTAPVIVLIIVVIYGLSSDYEVFLMSRMIEARHQGLSTTEAVRV
GTANTGRIITAAALILIVVAGGFAFSDLVMMKYLAFGLIAALILDATVVR
MLLIPAVMKLLGDDCWWAPAWMKRIQVKLGLGEVTLPDERKRPTGREQAI
AAASSPVGSNARTTKLPIASERTRLPSTPTPRQHDPSAPARPTPPPPAPP
TAPVNLAGNDSGDASATTRMAVPGKNVAPTDAPTTRVPGGNPAGPDAPTT
RSSVAGTHRPDRRNADREIESWLGELRGPKQPGAAAGTEAGDATTAIPVS
KPQSTPRPAQPNRASGTPGEDATTAMPIAKPEVQRQGPPRAQRPQPEQQQ
PAKPSTDATEALPAPGQNRTPQQQEVDEATRRSRGGSVSAQDLLRREGRR
I
169631581YP_001705230.1 hypothetical protein MAB_4507 [Mycobacterium abscessus ATCC 19977]MSLAMEGAACSTSAVEESNRRRRVLRVLLVWDAPNLDMGLGAILGGRPSA
ENRPRFDALGRWLLERTAAYSADHADCLVEPEATVFTNIAPGSAEVVRPW
VEALRNVGFAVFAKPKIDEDSDVDVDMLAHIELRSTEGLAGVLVASADGQ
AFREPLEIIAGDGVPVGVLGFREHASWALTSDILEFVDLEDIPGVFPRAL
PRVGLDSLPDEGAWLQPFRPLSALLTSRT
169631580YP_001705229.1 tRNA (guanine-N(7)-)-methyltransferase [Mycobacterium abscessus ATCMRCDGQERGCAEAGSATDELPGTVGAASSGRTDSQNHHPRRVSSFRSRGS
SLSEGQQKAWDRSWPTYGRLAREADGSCPPLDPATWFGRTAPLILEIGCG
TGTSTAAMALQEPDFDVLAVEVYRKGLAQLLSAIDREGIENIRLIRGDAL
DVLEHLLPSGSLTAARVFFPDPWPKARHHKRRLLQPGTVALLSDRLRPGG
TLHVATDHANYAEHIAEVGDGEPTLRRLRLDDPRIPVSVNRPTTKFEGKA
HTVGSVINDFVWERL
169631579YP_001705228.1 hypothetical protein MAB_4505c [Mycobacterium abscessus ATCC 19977]MTRGFEVFRATLERFATRPEIRQIHGGQRIHDVVVRAGDPLRVAVRGRAG
VGVTSVIGALGLTLPADEGPGHALIEVPIAGADPEPLVADVDVVVFAEAL
KPEDRAVLEASIAPKVLILNKADLTDPGAARGPWTAAVSRCAEYRAETRV
PTLPLSAHVPLVSLDDGMVEALKLMVENPADTSSVDAFVTCTHDVPVAMR
QRILHELDLYPMGCAIGALRQVPSLAAPGLTSLLRDLSGIDAVVSAIREA
IAQGWYRRMRVVLAELRKIGVTGVLPMQIDSFVNSDDVVVAAMRCAVDAA
TAAGIPVDLSDHPEDHRYRAERWQRFAEGPVNSTYAALGTDIARGSLRLW
RRAGGRA
169631578YP_001705227.1 hypothetical protein MAB_4504c [Mycobacterium abscessus ATCC 19977]MSTPADKQVDQLVLAVDPALGPLGVEPQDAVMVTGSWLAGASTLATGLKS
RMPGTRIVEPEDLRHGQSPAAVVFVCSGTAPLTPSDCGLIQLAAANTDAL
IAVVSKIDVHQSWREVMERNREILAQHDSRFRDITWLGVSTRGAAPGLDE
LASAVRKIRGKPDLAERNRLRAWVTRLQGMLNVPPEAGEGARADELRNQR
QAAVRRTRSSKSERTLALRNRIAQARMTLLYFARKRVGSVGGELREDIAE
LKRRDVAGFGDRVRRRVADIVAEVEQGTEEHLAEISAEVTQHWVAPRPSA
NRPVPPEAGDPPVRSRRLETRMMALFGIFFGLGAALTVSRLVAYARPGLA
PVGLAVGLVAGAVIAVWLVAVRGLLHDRTVLDRWLGDTMGELRAYLEQWV
AARVLEVETRLNADLVEIDERENDKLAARVGQIDSELREAAMNTARATAL
RNRDLPSVHKALTKVTERLDAIAASDENMTS
169631577YP_001705226.1 hypothetical protein MAB_4503c [Mycobacterium abscessus ATCC 19977]MIEGFDQGFGGGLGGLEEGMPEPGHALSPDLHVDHHMYLPTDGGLVDLGT
DLIDTDHDGIGDTVTLHPSDGSTGLSVVSDIDEDGIADKVTTFGADGTYE
TWARGTGAHWELIEHGRVGGK
169631576YP_001705225.1 phosphoenolpyruvate carboxykinase [Mycobacterium abscessus ATCC 199MTAATIPGLDNAPTKHAGLLAWVREIAELTQPDRVVFADGSDEEFARVSQ
QLVDAGTFVRLNPDKHPNSFLALSDPSDVARVESRTYICSEREEDAGPTN
NWVDPTEMRATMTELYRGSMRGRTMWVVPFCMGPLGADDPKLGVEITDSE
YVVASMRVMTRMGAAALEKLGDDGFFVKALHSIGAPLEPGQEDVPWPCND
TKYITHFPETREIWSYGSGYGGNALLGKKCYSLRIASAMAHDEGWLAEHM
LILKLISPENKAYYVAAAFPSACGKTNLAMIQPTIPGWRAETLGDDIAWM
RFGKDGRLYAVNPEFGFFGVAPGTNWSSNPNAMKTIEAGNTVFTNVARTD
DNDVWWEGLEGEPEHLIDWKGQDWVLRETETKAAHPNSRYCTPMSQCPIL
APEWDDPQGVPISAILFGGRRKTTVPLVTEARDWQHGVFIGGTLGSEQTA
AAEGKVGTVRRDPMAMLPFMGYHVGDYLNHWINVGKQADESKLPKVFFVN
WFRRGDDGRFLWPGFGENSRVLKWIVDRIEHRANGVSTPIGTVPGVEDLD
LSGLDVEAADVAEALAVNNEEWQAELPLIEEWFQFIGDKLPTGVKDEFEA
LKQRLSS
169631575YP_001705224.1 hypothetical protein MAB_4501c [Mycobacterium abscessus ATCC 19977]MLRAFIFGAVGASLVIVPPAAANASPVAPTPGPGDHVGQLLGGGNAPSEA
QQPRDDAGGWVEHRGATGAQCMDRGVVCDTGIWYPDNLQRQGSQDEGGRS
EWVQMPDQTGAECENPGVICGSTAS
169631574YP_001705223.1 putative transmembrane efflux protein [Mycobacterium abscessus ATCCMLLSPPTAPAPPRAERGRWYALSVACLIEMLLVINSSIVAAALPATQAAL
RFTNSDRQWLITAYVLTLGGLLLLGGRVADMVGLRSAMIIGLSGFAIASF
VGGSATNFGELVASRISQGVFGALLAPAAMSLVANSFRGSTAERHAFGIF
GAVIGAASTAGLLVGGVLTQLLVWRWVMYISVLMTMTALAGTLAFVRKYP
VGQRSKLDLFGSLTVTLGLFAIVFGFSRAEVRGWTASIAILSFITGLTLI
GVFIRHQQRSKNPLLPLRVVCDRTRGAAFLAMFFASAGLFGVVLSLLYYL
QRCLHLAPLWAGVAFLPFSATVVFASTLGNSFILPRLDGRTVLIAGGVTS
AFGLLMLSHIDSHANYYTAILPGLVIGGFGKGLIFGASTHGAATGIRPEE
SGIASATVNVMHHVGGSLGAALLSSVVASTATFFLARHASSDQAAAAGYS
AAFWVSAASCLAAAAIALVIRPADGNSRTAPVLRGKCCTARD
169631573YP_001705222.1 putative two-component system sensor kinase [Mycobacterium abscessuMQQAAQASSPRPILMPDYISGWRTQLFGSTPPSARLGIVAAVVLLVAESM
LTIFLRTIAPTEHLAAVYLIGILVISVIWRLRLALAMSIASAIVFDCIRN
WPKANPLSTESHNLITHLSFLAVTLTASALAALARAGTIEAERRRREAAA
IAQQQAALRRTATLVASNVSPVELYAKVVEEAARCFASPTAVLVQLMPGD
EGTIVAGHGTEESRTPPAGKRFPLLDSNNVARELRLTPAVCAPIVVDAKH
WGTLIVGSHTPAQRDQDIRAGVRDFADLVATAIANAATREELAASRARIV
SASDTARRRLERDLHDGAQQRLAYLRLKLGMVRAAVPATDAELTQELNNL
DTDLTAVTRELQEFSRGLHPAILSKGLAPALRTLARRSLIPVRTELELDQ
KYGESIEIAAYYVVAEALANTAKHSQASEVVIRAHEADDQIHITISDDGI
GGAKPRKGTGLIGLTDRVTALGGRLDVHSASGRGTTMTAIIPLHQSD
169631572YP_001705221.1 two-component LuxR family response regulator [Mycobacterium abscessMSAIRVLVADDDTLLREGVASVLEKAGFEVVGRAGDATALLELVRTESPN
LVVVDIRMPPTHTTEGLEAAQKIRGEHPGIGVLVLSAHVEVEYAAELITS
GDGVGYLLKSRIGDVGEFADACTRVAGGGSIVDPELVRELLSARRKDDPL
SALSQRELEVLELMAQGLSNSGIAGRLWITESTVEKHVHSVMRRLDLGHA
DEYHRRVLAVLAFLTHR
169631571YP_001705220.1 hypothetical protein MAB_4497 [Mycobacterium abscessus ATCC 19977]MDDNSGTGSPALKVINAVPDWGVTGRTNMQRRYLVSGLLASGVVCALATA
SPAIANGGGQNCVTVPNANTVCSSPGNVQITSATPIYEGPPPSIYPPYYP
FGIGGYTVMHGHSGE
169631570YP_001705219.1 luciferase-like monooxygenase [Mycobacterium abscessus ATCC 19977]MRFAFKTSPQNTTWDDMLAIWKVADDIEVFESGWTFDHFYPIFSDPTGPC
LEGWVTLTALAQATQRLRVGVLVTGIHYRHPAVLANMASALDIVSGGRLE
LGIGAGWNEEESGAYGIELGSIKERFDRFEEACEVLTGLLSRETTNFDGK
FYQLKDARNEPKGPQKPHPPICIGGSGEKRTLRITARYAQHWNFVGGPPE
EFARKREVLAAHCADIGRDPKEITLSAHIRLGADRDYARVVDEAASLGAE
GLDLAIIYLPPPYDPAVLEPLAQALRG
169631569YP_001705218.1 hypothetical protein MAB_4495 [Mycobacterium abscessus ATCC 19977]MAISVNLEKALDKAYENKDLKDVLDAPPSALAGLTEKHDAALKEALNIST
VRELGTNKYIAVAAALAALESKTG
169631568YP_001705217.1 hypothetical protein MAB_4494c [Mycobacterium abscessus ATCC 19977]MNEDSSRGLTSIPDEPPSAWSLLEWNPPTIPVLPVIAVLLAGWYVLSVLR
LRRMGRSWPWWSTVCFLSGCAILGAVMGLSIERYGFRLFSAFMFQQLTLS
ILVPPLLVLGSPGRLLLRSTPHHGSGRWVLAAALAGLRSRAGALLLHPAV
TIPLFLFSYYGLYLSQLFDTIAATWLGHTTLEVFFLATGLLFVIPILSTD
PLPIRQTNLGRMFDIFVEMPLHVFIGVVLMMAPRPLIGIFANPPAQWSVD
PVRDQAVAGALAWSYGEPIALATTLIFAVRWRREEQAETEEREADNARQE
DELASYNRFLRQLHGDTTDLNP
169631567YP_001705216.1 IclR family transcriptional regulator [Mycobacterium abscessus ATCCMSVLTRAAQILDALAESNSGLSVRELAEATGLPKSSVHRIVQELTVSQYV
MAGGRGGSYQLGPGLLKLGLNNRRQFVAPMRKAIATVAREVNENIDLAML
SGGELVIIEQIATVRNLPTVTVVGRTFALHASSIGKALLSQLPPDQVRNM
LPADLEVFTTNTITDVTALLRELDDVRSTGVAFDHEEHDVGISSVAVPLP
HPAAIPQAMAIVAPTPRFAQRKTKYVAALDSLTKRANST
169631566YP_001705215.1 hypothetical protein MAB_4492c [Mycobacterium abscessus ATCC 19977]MGLQFYDLSHPWGLGTPCWPYFEDVKIERLHNMARSGVLTQKITTVMHSG
THIDAPAHVVPGTPFLEEVPLPNFFGTGVVVSIPKKKWEVITAEDLENAR
PQIREGDIVIVNTGWHRYYGDNRHYYAYAPGFYKDAGEWFVERKVKMVGS
DTQALDHPLGTAIGPHGTGAPNGLIPQVNLEYEQLTGRKVIEDFPYWEPC
HNAILSNGILGFENVGGDIDKVTGKRVTFAAFPWRWKKGDGCIVRLVAIT
DPTGEYRIETGTAG
169631565YP_001705214.1 hypothetical protein MAB_4491c [Mycobacterium abscessus ATCC 19977]MKVTKFEDAVLYEAPKHFDMHALRLQGSPSARARIGLSRFLPGGGAEMDV
SDSEKIYVVLSGSVRVSLSGGTEEVLRMFDSCLIEPGEMRAIANLSHEVA
TMLVITFATGSERESHHV
169631564YP_001705213.1 oxidoreductase [Mycobacterium abscessus ATCC 19977]MFDDPRALFDIAGKSAIVIGATGSLGQIASRALAGAGANVAICGSREDAL
SDLRDELAAAPGCIVPIARRPDSESASDAIVKETIEAFGGVDILVVASGV
NEVAPAVDMQPARFEAVLDANVTSTWLAVRSAGRAMIERGRGGKIILTSS
ARGKLGHPAGYTAYCASKAAVDGLVRSFGCEWGRYGITVNGLAPTVFRSP
LTSWMFTDEPAAQATRENFLSRIPLGRLGEPEDLAGPILFLSAPASDFLT
GHVVYPDGGYTAG
169631563YP_001705212.1 3-hydroxyacyl-CoA dehydrogenase family protein [Mycobacterium absceMTNDIRPVCVVGGGRMGAGISQVFALAGFTVFVYEVNEQVRTSVVDRVRE
SLACAELDVAVADRIIITDDLSAAVADACFVTEAVGEKLELKREVLAGIA
AAAPHDAILASNTSVIPISEIAAGSPAIDRIVGTHWWNPAPLIPLVEVVQ
ATGTSVETVSRTMKLLAAIGKKPMHVRKEVPGFVGNRLQHALWREAIALV
QEGVCDATTVDDVVKNSFGLRLAVLGPLENADLVGLDLTLDIHRVVVPAL
DCQGGPNPVLVDKVARGMLGCKTGEGFRRWSPADIAEMNNRLEGHLVRLL
HPRNTGPVG
169631562YP_001705211.1 carboxymuconolactone decarboxylase [Mycobacterium abscessus ATCC 19MARIPLADPATLSGLEQAVYQRFPANLVLGLLRATPEIADGYLDLGGALS
ASPLDRGIREMVILRVGTLSGSAYERMQHLGIARSVGLSDAEIAAVDSGR
FDELAPNERAILSFVDELVASPKATVTFDAALRALGEQGLATVILLVGHY
MLTARLLETLEIDLDAGPTSWDGI
169631561YP_001705210.1 hypothetical protein MAB_4487c [Mycobacterium abscessus ATCC 19977]MHPITYYPVDTQRLVRSNAERIRHKPYAHYFNPDVAVPEEVFAALKAPLE
PEQVLGTSSTELNRLLEPGYLEGETGYCGLPDGAGYTSSLVRFPGATPEM
FRWWFWWHSFEPERYSLWHPWCHADIWRTDPETETAPNLTDEQRYVGSTH
HINEYIGQDPLDIEITFIDPARWGFDADGFAAAGIGAHACGSVLMKGSHM
RLATMVHLARITDDGFELRSRYWIADRAEPRHDPVAGIAQLTTVPGFSGE
RQAYEQLVHDQTEFNHLATFLPDIYQEFGPR
169631560YP_001705209.1 3-hydroxyisobutyrate dehydrogenase [Mycobacterium abscessus ATCC 19MATYGWIGLGNMGGPMAANLVAAGHTVRGFDLSGDALAAAETTGVTVVEE
IAEVLAGAEVVFTMLPKGEHVRSVFEGPYGIWENASPSTLLVDSSTVDIE
TSRYCHAESARRGFRFVDAPVSGGISGARAATLCFMLGGELENVGAATDY
IKPMAGRVIHAGDGGAGVAAKICNNMMLFIDMMANSEGSQLAERLGLDPQ
VFWEICSVSSARSWAQQTWYPVPGIIESAAANRNFDATFTVDLAHKDARL
ALAAGEATGVNLPAATLVTEQFQQLIDEGLGGKDCSLIVKYATPDGSPRG
YTP
169631559YP_001705208.1 putative transporter [Mycobacterium abscessus ATCC 19977]MSTTAEADAAPSGLRKVVAASMAGTVVEWYEFFLYATAATLVFNKVFFPA
VQAGGNDLDNIIKAFLTYAVGFVARPIGGIVFGHFGDRYGRKHLLQIAIV
LVGVATFLMGCLPTFAQVGYAAPMLLVGLRFLQGFAVGGEWGGAVLLVAE
HSPDSQRGFWASWPQAAVPLGNLLATLVLLTLSWTLSDSAFMAWGWRVGF
WLSVIIVAIGYYIRTRISDAPIFHEARKEIERNKASSYGVIEVFRRYPRG
VFTAMGLRVAENILYYMVVTFSITYLKTQLHMDTRRILLLLLIAHVVQAI
ALPIVGRYTDIAGRRAPYALGALLSAGWGFIAFPMFNTRNEWVILTAIVI
GLLVHSLMFAGQPAIMAEMFPTRMRYSGVSVGYQVTSIFAGSLAPVIGTA
LLGRYHSWVPVAVYLAAVAPITLFAVWSLPETRGSSLHELDAADRART
169631558YP_001705207.1 aldehyde dehydrogenase [Mycobacterium abscessus ATCC 19977]MTNYDKLFIGGVWTEPATDQVIEVISPATGQKVGQCPLASPADVDAAVSA
ARRAFDNGPWPRLTPHERQAVLQKAVSLLESRKDEICKAIADETGAPPMV
IETLQWMGGFGAIQYYANAADAVKWKELRNGAYGQTLVTREPAGVVAAIA
AWNVPLFLALNKIGPAFLAGCAVVLKPAAETPLSSFILAEVFAEAGVPEG
VLSVVPGGAETGRALTNNPDVDVFSFTGSTAVGKEIAEIAAKNLKKVTLE
LGGKSAAIVLEDADLAAALPMLVFSGLMNAGQGCVNQTRVLAPRSRYDEV
VDGIVGMVSLMGVGLPDDPATQVGPLITEKQRTRVEGYIAKGIAEGARLA
YGGKRPEGLDGGYFVQPTIFADVDNSMTIAQEEIFGPVLSIIAYDSVDEA
VKIANDSNYGLAGSVWTTDVQKGLEVAAQIRTGTYGINWYAFDPSCPFGG
YKQSGIGRENGPEGIEEYCELKSVLLPMGYTLESI
169631557YP_001705206.1 hypothetical protein MAB_4483 [Mycobacterium abscessus ATCC 19977]MSLSPFDDYPIHQIADVVRHVGTSDRNFYDRYYFGCHGGRADLPYLITGL
GVYPNLGVTDAFASVRNGDDIVVFRASRALGDDRADLTVGPYRIEVVEGL
KKVRVILEPGWHDATYDISFDLTYTGEIPASLEPGHYQRQLGRVMFDTSR
FAQTGTWTGQLTIDGTTHELDGVNWSGNRDRSWGIRPVGEGEPAGRRATL
AGGFFWLYNVISFPQYSIVFINQEDEHGNKVVSGARRVWRDPSKGIEELG
PIAHDITLIPGTREARSAVVTLGDITITADIVLPHYFGFGTGYGLDPDWR
HGMWQGDLVVQGKRYKTAELDATLKLLCPVDNLATFRLIENGVETHGSGL
FEFGPIGPHKPSGFTGFVDTHQERDSDS
169631556YP_001705205.1 putative phosphotransferase [Mycobacterium abscessus ATCC 19977]MTEQTATHEDVARPAESQRDPETLRGALTDWISGQLPADAALSVDHAELP
SANGMSSETILADAQWTENGQRTAHRLVIRTAPQPDSSPVFPSYDMRRQF
DVMDTLGRHSSAVVPPVRWYCDDTAVLGGEFFVMDRVDGDVPPDRMPYTF
GSWVTEASEADRRKMQRLTVDQLARIHAAPVERFAFLNDAREGETGLDAH
VRRTHEFYEWVRGDGPTIPLIDRGFEWLRENWPEESLSGVGRPIDVVSWG
DSRPGNVIYRDFEPVALLDWEMASVGPRELDLGWIIFLHRFFQDLAEVAT
LPGLPDFCKREDIAAEYAALTGHHAADLDFYTAYAALQHAVIMARIQMRA
MAFGQAQMPDDPDDLILHRATLEKMLNGTYWAGVKA
169631555YP_001705204.1 hypothetical protein MAB_4481 [Mycobacterium abscessus ATCC 19977]MPDITDLFAQRATLRRSTSLLTAFRFEQSAPERFYGTLAQDTVHLITDLW
QQAEGVALRGRTVLDVGGGPGYFASAFADAGARYIGVEPDPREMHAAPQG
HRGIQDPRTTYLRASGMALPLADNSVDICLSSNVAEHVPQPWRLGEEMLR
VTRPGGLAILSYTVWLGPFGGHEMGLTHYFGGARAARWYTRKHGHPPKNN
YGSSLFPVSVRDGLRWARDTGTLTAAFPRYHPKWAWWITKIPALREVLVS
NLVLVLRPR
169631554YP_001705203.1 putative glycosyl transferase [Mycobacterium abscessus ATCC 19977]MFSELSDQQDLPREVLMLCWRDTAHPQGGGSETYLQRIGAELAASGVKVT
LRCAAHPGAPRREVVDGVHISRAGGRFTVYPRALLSLLASRLGLGALRDV
RPDVVIDTQNGIPFFASTVAPAPVVVLVHHCHREQWPVAGPLVGRLGWWL
ESRLSPRMHRRNQYLTVSQPSASDLVALGVEAGRIAVVRNGVDQTDPRIA
GDAMNVRSETPRAVVLSRLVPHKQIEHALTTLAVLRDHVPDVHLDVVGDG
WWMDPLVEYAARLGVSDAVTFHGYLDEESKHQVLQRAWVHLMPSRKEGWG
LAVTEAAQHGVPTVGYRSSGGLTDSVTDGITGLLCRDQDEFVRHTATLLA
DNKLRYRMGEAARARCADLSWRRSAAGVSAVLKAAMDGAPISGIIGAEPE
IAPQVEIPA
169631553YP_001705202.1 TetR family transcriptional regulator [Mycobacterium abscessus ATCCMAASPGLWGGRTAAQRRAERRERLVGAAQEIWIEQGWAAVTMRGVCARTS
LNDRYFYEDFADREDLLAAVWDGVRDELIAQISAIVAEDPDRPPLDTLRK
TITLVVERVSGDPGWADIIFVRHVGSAVLEQRRIDLLHQATAVLIAAAEP
YLVKNIDRTGFRMDTLVGIGGFSELVNAWRSGLLDVSADELIEHSTRIGA
TLASRYLAAG
169631552YP_001705201.1 putative short-chain dehydrogenase/reductase [Mycobacterium abscessMVSLLGFGRGERRTRKVDAVVTGAASGIGRAFAVELARRGGRVVCADVDL
PGAKETAALIGERAIEAACDVSVFDEVEALADTAEEWFGKPSDLVINNAG
IGAGGQVVGAAPLADWQKTLGVNLWGVIHGSHVFAPRLRALGRGGIINVA
SAASFAAAPRMGAYNVSKAGVLALSETLAAELSGTGVAVTVLCPTFVKTS
IVDSGIIEESAARLAATAMKWTGVSADSVARGCLDAHDRGQLYVLPQFDA
RFMWQAKRLAPDTYTKALGIAERFSRQRGN
169631551YP_001705200.1 hypothetical protein MAB_4477c [Mycobacterium abscessus ATCC 19977]MAIALDSILATIKDKQWALADIDWDAPGADQVTEEQRPTLKEFMSDLVWI
ENVGARGFAALAKKAPDEDLKQIYTYFHAEEQRHANAELALMRRWGMIEE
GEMPVPNKNIRLVIEWLDRYSDSLSLASLGTVIPSLETALDGALVKFLLD
EVNDPVCHEVFRHINSDESRHLAVGFQVLDMLGASSMRQLIIETVGTFVK
PSVMLGLLVYSPLLTRMVTNISAMGLSEEKLYNAIKRYENVGERSENTRR
LPAYHLIKYHARIAINQTQPFQFVSESMGKAIDLFPIKVLGKTPTWSQEL
TYEPVSR
169631550YP_001705199.1 putative monooxygenase [Mycobacterium abscessus ATCC 19977]MTEVLIVGAGFAGLGTAIRLLEKGIEDFVILERGDDVGGTWRDNSYPGAA
CDIPSLLYSYSFEQNPQWSRAYSGGSEILGYIQRMVDKHQLRRFIKFGVD
VTGLTFDDSTGMWTADTAAGEIFTGRCAVMAAGPLANVSWPDIRGLDSYT
GHKIHSARWDHDYEMSGKHVAVIGTGASGVQIIPELVKTAARVKVFQRTP
GWVLPRLDFQHPDWAQRVFGSSPAVQNLARQAWYWTHEAAAVGMVWDTPV
TTLIQWIAKANLRRQISDPWVRRQLTPDFRAGCKRMLMTSDYYAALEKDN
CKLITWPIATLSPNGIRTADGIEHDVDCIVFATGFDVCKAGTPFPIAGLD
GRKLADEWSGGAYAYKSVNVSGYPNLFFTFGPNSGPGHNSALVYMEAQID
YIVQAIGIVRAKDLLTLDVRKDRQDRFNEDIQRRLGKTTWNSGCQSWYLT
EDGKNTTMFPGFATQFARQLRTVELDDYSFTSGAAAASAAKPPVDASIG
169631549YP_001705198.1 hypothetical protein MAB_4475 [Mycobacterium abscessus ATCC 19977]MRRIGLIPPLYALALAAAVTAPLAAPGYLLIRDAVSTPRSYVTDTALGVG
EAAPRAVPQDFFIAVMTVLVDGGVLVKMLLALGLWLAGWGAARLAAQLVP
AAGIPGELVAATIAIWNPYVAERLLQGHWSLLVGYGCLPWIALTVIRLRT
ATNLGAWCPLAFWIAVAGLTPTGTVLALIVGLAAATDRRSRVGVLAISVL
AAMPWLVASGLGAAVPAGDAAGVHAFAARAEPGLGTLGSLASLGGMWNAS
AVPASRTTLFALVFSVVLLIVVAVGAAVLWRARKALGLLGIAVAAVIIPA
LLATGPGLTLTTWLITEVPGLGILRDGQKWVALAMPAYAVAGAAAVIAVR
ERSSQYLAAGLACAALIFTLPDLAWGVGGRMTAVKYPSGWNAVAAHINAD
PHPVAVLPPETMRQYPWGPSSIPVLDPFPRWIRADTVSSGDLRVDGHDVR
GDGTRGRQVEELLRAGAAPRELAAHGVGWVVVQADTPGQQAVSSKTLAQL
DTAYRDGDIALYRVPGPWNPIAAPPGRRAAVIAAHLVWIALLAAGGVAVF
RRQHTRQVGSGGTQDPKICTPDSDN
169631548YP_001705197.1 hypothetical protein MAB_4474 [Mycobacterium abscessus ATCC 19977]MNRGVMMRIAACGLLGLGSALIIAALLLSTYTSNRLAKIPLDWDATLVSE
GKGRALDPASLSGQKFIADPDRPLALQEQISTVSPADATKVGLQAGITLR
RTDKQGDAGLVLATVDTVTVDRHSAEAISSDDNPGGSVQKPRAIEDETPP
TTIALKHEGLSYRFPFDTEKKTYQYFDVVAQRAFDANYTGEEDVNGLTAY
HFTQNVGYDANGKLVEPVAYPSLYDKDEDSKVTARAQQWGVEAEHEDDEI
TMTRYYAAQREFWVDPVSGIIVKSKEHALHYYSRDALKPEVPMVDYTVQS
NDETVEKQVKAARDTRDSLAIWSNILPITFAALGVVALVGGGLLGSFSLR
AESALIDPGLDTVDHGFFGRRGPEKPPASEADTDKFPSPRNHL
169631547YP_001705196.1 acyltransferase [Mycobacterium abscessus ATCC 19977]MSAAPASAPAVHARGFVPALEGMRACAAMGVVVTHTAFQTGHTGGVDGRI
LGRFDLAVAVFFALSGFLLWRPHALAAGGGARPAPTGRYFASRFVRIVPA
YLAAVFIVLLLLPDAAGARGIVWLANLTLTQLYIPLTLTAGLTQMWSLAV
EVAFYIALPAIALLMRRAPVGWRAPLLTAAGAASLGWSFIPFHPPAGINP
LTWPPAFFSWFVAGMLLAEWSAAPPSWALRLARRRVLLAGVALSAFGVAA
SPLAGPEGLIQAPPHQYAVKIAMGATLAWALLMPLTLDASDTPHRILGSP
LMVTLGRWSYGLFIWHLAALNMVFTVIGRFPFSGHFPSVLILTLIFGFAM
AAVSYALVESPSREALRRFQQRRDGRRTAANATEATEISASS
169631546YP_001705195.1 hypothetical protein MAB_4472 [Mycobacterium abscessus ATCC 19977]MTYRLDSSALSRRWLAVAAAVSLLLTFSQSPGQISPDTKLDLAINPLRFA
ARALNLWSSDLPFGQAQNQAYGYLFPHGAFFSLGHLLGVPAWVTQRLWWA
LLIVAGFWGLIRVAEALGIGTRGSRIIAAVAFALSPRVLTTLGAISSETL
PMMLAPWVLLPLILTFQGRMSPRRAAALSAVAVALMGAVNAVATALACGV
AVIWWLAHRPNRTWWRFTAWWIPCLALASTWWIVALLIFGKISPKFLDFI
ESSGVTTQWTSLTEVLRGTDSWTPFVAPTATAGSSLVTQSAMVIATTMLA
AAGMAGLAMRGMPARGRLVAVLLIGLVLLTAGYTGALGSPIAQQIQFFLD
DGGTPLRNVHKLEPLIRLPLILGLAHALSRIPLPASVPVRQWLSALARPE
RNRAVAFAIVLLVALAASTSLAWTGRLVPRGGFDAIPGYWNDTAHWLADH
DTGGRALVVPGAPFAIQTWGLTRDEPLQALGQTPWGVRDSIPLTPPETIR
AIDSVQQLFAAGRPSDGLADTLREQGISYLVVRNDLDPDTSRSARPILVH
HTIEGSPGLTKVAQFGDPVGAGAVEGFVADSDLRPQYPAVEIYAVGANDH
DGEPYFTDIDTMPRVAGGPEALLRLNERRRQLNEPPLGPSLLATDAAQAG
LRPGPAVVTDTPLARETDYGRVDDHSSAIRAPGDKRRTFNRVPDYPATGV
PLVNGSWTGGTITASSSASDSTALPNVAPGTSTAAAIDRDNATSWVSSSL
EAALGQWIRIDLDRPITNAILTVTPSATALGAQVRRLEVETDNGTTSVRF
DEPGQPLNIALRPGETTWVKVTATGTDDGTSGVQFGVTELSLTQYDAAGF
AHTVDLRHSATVPPPPAGDNPLGWDLGSPLQGRSGCAPSPQRLRCAATLS
LAPEEPGTFIRTLTVPQPVSLTPRLWVRARPGPQLRDLIQQPGTTVATGD
SDVIDPQGSSYAATDGDPGTVWTAPQDSVQRLHLPSLVIKLPKPTAIGAI
RLRPSRTEVPAHPKQVAINLGDGPQLRSIDPKADVTELALHPSITDTITV
TVTDWTDIIDRTALGFDQLKPPGIAEVIALDADHRPIAPADNAANSKRKI
TIGCNRGPILALAGRFVPMSITATVRELLDGTVIQATPCDTSPIATGAGI
QDVTVNPSQQFIVDGVQLTAAATEPASATMTVAPKGAWGPDRREVTAEPS
AHERVLAVPESINPGWAARDAQGHLLTPVRVNGWQQGWVLPAGDGGKITL
TFGLNTWYRAGLFGGLALLPILACLALLPARGRTTLPPVAPWCAGPAAGV
AVLAALTAISGISGMAVGLAALAFKVWTRWPLRAVTAAGVYLAGGSLLLA
GAALSRHPWRSVGGYTGHSWWIQLLALISVASVALAAVRLPSRRCWKRRS
ASREGDSTSA
169631545YP_001705194.1 hypothetical protein MAB_4471 [Mycobacterium abscessus ATCC 19977]MTRFVVPAAASVLIGLLLGAAAVFGLTLSVEQDKKPVVTGIDPSTAILNR
PDYGNRS
169631544YP_001705193.1 hypothetical protein MAB_4470c [Mycobacterium abscessus ATCC 19977]MTGPYNYGPAPDYDAELAAAHNPALPQDQLLRLWHTRPDLRQALAQLPAC
PPSLAAQVQFSDPWRDPNARSHRGIIMAFAMLAGVLVIVGLGYVGYMAVH
GDGTTTQTHGMLPPNDPKTTSSSAATTTTAPPPVPSSPIKPVDVSTNCVQ
AEDGTDSNGVKYVYDPAKAFDNDPLTAWRCQWKEQDGQSITAKFDHPTLV
TSVGLIPGYAKTDIDGSDRFAQNRKITRVRWEFSDGSSVKQQVPVSRALA
SIKVNVVTDSVTMVIEATEPGVSIVNKSGQRQDAFNGLVSVSEVEIMGTQ
PPASEGPAPAPVVPPGPPVGAPPPMPTPGQAPLAPSPGASPAPVAPTARP
APARP
169631543YP_001705192.1 sulfatase family protein [Mycobacterium abscessus ATCC 19977]MAELNRRTVLTTGAIAAGAAAVGFGGYELLGTPRRNSSSGSDGNKPNILV
IVVDQMRAPQWFPDVQKLTNILPNLSRLHRDSVSFASHYTASNMCTPSRG
AMTTGLYSHQTGCLYTGEGPSESSLAPQFPTWGTMLRQQGYRTWWWGKWH
LGDWSDTNPEGLDAHGFSGGTFPSPNGMPNQGLQKDPGIVDQFAGWFDAE
AGKGPWCTTVSLVNPHDICWWPKNPLPEDVPHWFDGLPVNFQTPDELRQH
GKPRLQIDYANFMSPIMTGAVTYSGPDMARQWARCLDMYLWLQQQVDAQI
GRVLDKLASRPEIDGNTIVVFTSDHGEYAGSHGLRGKGATAYEEAIRVPL
YIRDPQGVLTPKPGETRTQLTSSVDLAPLLLTIGSGGNAWRSDPRFSYLA
ARADIAAIAKNNAAGRKWIAHVTDDMSVEEMATLLKDPRIRAVMGENAPT
EIPTSAASHIVAVRTAEAKLANYSYWKPGGMRIDTSRPSEHEFYDYSTPS
GKQESQNQAGDSTKQAQLQALIDNEVLPEVQAPLPAFLGQAQEQGLADMQ
KLMVLRGG
169631542YP_001705191.1 hypothetical protein MAB_4468 [Mycobacterium abscessus ATCC 19977]MAYDEDLVERIREVIATTKGVTEKRMFGGLAFLVHGHMTVAAKREGGLLA
RCDPRDTEALVAKPHVSRMVMGGREMDGWLSIDAEGVRTRRQLEPWVKRA
LAYAGSLPPK
169631541YP_001705190.1 hypothetical protein MAB_4467 [Mycobacterium abscessus ATCC 19977]MFAISSNPLCMTRMRRFERQHDAPWRDSPMTNEPDHLKEIAERVRAQVAE
LESQMSKVDAIEAEAESMDRMVRVRVNANGMVLSIQLHQATARMDRGRLG
ALIAETAQAATYRASDAAHQFFEGLIATRAELQQAAEAIHPQSREMFTAQ
PSAPQHRAPGLGPSAQPPSAYPAQQRPLLHPSLEDEDAHYERFNQNPFGR
Y
169631540YP_001705189.1 hypothetical protein MAB_4466 [Mycobacterium abscessus ATCC 19977]MPQGDGWMDNIPSQYVHGEHGFDERIMRDLAEVGVRAYTLDDLANGPATI
PEAIPVFVDWLSHLEERIPGPEPDHGHRSIIRSGLIRNLIDPAARGNQEV
IDLLISQVKHQPPLPSRQIDWALGGLKLICGPKEFSKIVALIPSLPTGAL
VIPIIQYLGKVKTQASHQLVVGYLDGPAREFAIKALVQAKAPNVRHLVEP
LVHDPDASVRKAARRAMERLPHD
169631539YP_001705188.1 hypothetical protein MAB_4465 [Mycobacterium abscessus ATCC 19977]MTKADPEWFYSVAGKLSEAATSFEARFTALDQKLNVSRSAGSYTTGGPRW
STSYDQSASDVFEVGSLGVMAATVLAKLVHEAGLNEAKAENESSPNGPQE
RTPTPPSGSKINHAMHPSKLSVGGDNSKPDHWSLIADYVKKEWADCDEER
IRAAGTAFSSFGTESQKQATELWNACTAVFTDERQRGYPEISEMVTEIAN
VCGALKGEVASDLGVACEAVGAKASEMKKLGQTSLTILHYIILSYEVDKV
LARRLPWGDRIRKGIDRLIEFNKKEYAKANDKLMKSIDQTVDQAAESNEG
INNTATTDAKFLSNLLDRIPRQTDPIRNRTKEENEAAGDEGERRAGINPR
GRKREVRVIVDTGSGPVAREVVPDRIDDVNRQVTEVKNTNEIRPDRVQIL
AEAEWARQNGYTMTLVVDHRTVINDPKIQEMVNNGQIQVVRKELDDAYF
169631538YP_001705187.1 hypothetical protein MAB_4464 [Mycobacterium abscessus ATCC 19977]MSERSYDLDAMQEHIEFLTKQMELLTEQTKNIERTADGILSQYEGQGAEK
FLEASTQWRDKFKQQIESLGALRDRIKITHGNYLDARTKNREMFPGV
169631537YP_001705186.1 hypothetical protein MAB_4463 [Mycobacterium abscessus ATCC 19977]MADQRLRVSTTALEQGARELRQHHRTIETAVTEIHRRAEALRSVWTGAAA
NDAATAWDDLRKALTSHLDALSEHAELLSKTATLHAHQEELTTQAIDSTN
S
169631536YP_001705185.1 hypothetical protein MAB_4462c [Mycobacterium abscessus ATCC 19977]MEWRSIASPQAQDDVDKLFGDAIKFVAVELAHADDFAPFMMVISLAGEIS
VRRSAIATTPRDEVGVVRGLELPGDGDQLRARAAVLDVTALVPVAGDAIK
IKIEHAEGIAIDMLVPYRIDSDGATINVQAANAARAELLLWTPEVPDED
169631535YP_001705184.1 hypothetical protein MAB_4461 [Mycobacterium abscessus ATCC 19977]MRYDLRREILGATISGTLILTACSQPGANAPNTAQPPTYSCQAQAATGEA
YTHAQTPAEPFTVSIPKLPDWKPAATARTDNKLSVVKTIGISRSLTMLMS
LDPTSTSQQATEQLKDLTKIVGPVKITRDETVEICGVRAARLIGTAGARQ
YDYLNLAYQVGGKYYPLQLRNQMSTSDVPLFSADVELMFQGFQISP
169631534YP_001705183.1 hypothetical protein MAB_4460 [Mycobacterium abscessus ATCC 19977]MEGGMWRYAVCASISGALTLAGCANHVPGEPISATYTRYTCQARSATGAT
YTQFRANGQPFSVSVPQLPGWRSSPTALRENQLALTKTIGDARSYVTMSV
LRPQTDRDKAFKQLGELAKFDSSVAIVEDETVDVCGLEASRLVGIAEDRG
LRFEYLNLAYSFDGNYYPLQLRGQMAICDFPLFGVEIETMFRHLQIGP
169631533YP_001705182.1 ECF subfamily RNA polymerase sigma factor [Mycobacterium abscessus MAHDEISRIFRAEYGRTVATLIRYFGSIDLAEDAVQEAFEVAIARWPEDG
IPPNPGAWITTTARNRGIDKLRRDRRRDELSREAGAFAEPQQEPEDVGPV
RDDRLRLIFTCCHPALSQEAQVALTLRLLGGLTTPEIAGAYLVSESTMAA
RITRAKKKIAAAGIPYRIPAAHDLPDRLSSVLSVLYLIYNEGYAASSGAR
LTRTDLSAEAIRLSRLLADLMPDEPEALGLLALVLLTEARRPARTGDDGA
LVLLADQDRTRWNRQMITEGHQLVRRCLRRNVPGPYQIQAAINAVHDDAP
SAAGTDWRQIVTLYDQLMRFTPTTVVALNRAVAVAERDGAQAGLDAMEPL
RADLDRYYPLHAARADLLTRLHRDSEAADAYRKALELTENEVFRRYLGDR
LARLEPGA
169631532YP_001705181.1 putative secreted hydrolase [Mycobacterium abscessus ATCC 19977]MRAGTVLTGLVVAALTACGGNASEPSKENTSSTKAQAPATAAPAADLACL
STRDRLAQLLMVGIKDADDARALVRDHHVGGIFVGSWTKKEMLTDGSLHD
VITAGPIPAAVSIDEEGGRVSRLKDLIGPAPSARELAATQTPEQVQALSQ
ERAQKMKDLGITIDFAPDADVTDGDPDGAIGDRSFSGDPQKVAEYAEASV
RGYQAGGVRAVVKHFPGHGHASGDSHTNGVVTPPLEQLKDNDLVPYRSLV
TSGAAVMIGHMQVPGLTGDDPASLSGAAVDLLRKGTGYGAPAYDGVIFTD
DLSSMAAITDRFPIEEAVLKSIKAGVDWALWVSTEKVGSVLDRLESAYNA
GELNADAINASVRRVLAYKGVPACG
169631531YP_001705180.1 putative cytochrome P450 [Mycobacterium abscessus ATCC 19977]MQHRIKQRTHWAVTHGIGRAYLKVLARRGEPVAQLGIDVGQAPDIYRIID
KIRERGRLSRAGDGWITADAQIVRTIFRDNRFVTFKPEHRSASPIIQRLA
AWSDPQLLNPAEPPSILITDPPDHGRLRRLVAAPFTPRAIEGLRDRIQEV
TNGHLDVLQQRQSPDLIADFTAKIPIAVIGEMIAVPPPDYSRLYTAMNRA
IQLIATTAPSWSEYQDGTAALREIDEYLEKHVARLRREGTESELATALLD
SDLSHFELKMFFAVFLGAGFVTTTHLMGKAIVTLLRHPEQLALLQADPSL
WPNAVEELMRYDTSNQWSARVATETVEIEGHTIEAGQSALLLLGGANRDP
AAFENPDVFDITRPNARENITLGTGIHVCLGQVLARAELHTALQTLFERF
PRLSLAGEPEYLNGMGIHGLRLLPVTLG
169631530YP_001705179.1 putative cytochrome P450 [Mycobacterium abscessus ATCC 19977]MRTRDQIKYWSRWATMHGISRAALLTQVRTLPLAALFLGPDRAEKHYRYI
EEIRASGSVTPSRAGGLIFTDLALTREILRDNRFITMAPTNIPSPILPLA
FSRWVFARTEPGLPNPVEPPAMLAVDPPEHTRFRKLVSKAFTPRAVSKLE
DRVREVTTELLDNLERHERADLLHDYASQLPVAIIAEMLGVPRADAPFLL
EWGNHGAALLDIGMTWSAYRDATQALIEIDRYFDAHLVRLRGELAEDPTV
DGILASIVRDGDLNDRELKATMALLLGAGFETTVNLIGNGIAALLRHPQQ
LAHLRENPDGWPNAVEEILRYDSPVQITGRVATQACEFEGHTLAAGSMAI
LLLGGANRDPAVFDQPDVFDVLRANAREHVAFGSGIHVCLGASLARMEGV
VALQSLFERFPELALAADPTPGKHVNLHGFGSLPVNLGRARVPASS
169631529YP_001705178.1 putative fatty-acid--CoA ligase [Mycobacterium abscessus ATCC 19977MNSLVSGLRLEEYLDETGAISLPDGYTVNHYLECAVDGPHDTFAYRYVDF
SSDPNGEPVDLNWPQLRARTRAVAARLQQVTQPGDRVAILAPQSLDYVVG
FFAAIEAGNIAVPLFAPELPGHTERLDAVLSDAQPTVVLTNQAAAESVNS
FIRRLPRDRRPRVLAVDSVPDSVGATYVRVTPDTDDIAYLQYTSGSTRAP
AGVEITHRAVMTNVLQMIISVGLDVDVRGASWLPLYHDMGLLMLMFPLCG
GRMTLMSPLSFVRRPGRWIRELAAASHAGRTFGAAPNFAFELAAERGLPK
EGESLDLSNVAGLINGSEPVSIASIRKFNAAFGPYGLPDNAIKPSYGMAE
ATLFVSSIAPDAEPSVIYVDREQLGAGYATRVDAAHENAMPQVSCGQVAR
SQWAVIVNPNAETELPDGQIGEIWLHGNNVGRGYWGRSQETEVCFRNKLQ
ARLDEGSHAAGTEPGAIWFRTGDLGVYIDGELYITGRVKDLVIVDGRNHY
PHDIEATVEDASPVVRRGFVAAFSVPADELPAGVDAGDGVGERLIIVAER
AAGAGRAEPGPIIEVLRAAVSRRHALPVADIRLVQAGAIPRTTSGKIARR
ACRQQYLDNRL
169631528YP_001705177.1 hypothetical protein MAB_4454c [Mycobacterium abscessus ATCC 19977]MKQYLLSVHSYAQDATQWSDEDVQRLYAQTGALNEKMKEAGVWVFANGLT
EPSDATVVHSVDGKVTTTDGPYLETKEHLGGFWIINAPDLDAALKWAAEG
SAACEEAVEVRPFQDEEA
169631527YP_001705176.1 hypothetical protein MAB_4453c [Mycobacterium abscessus ATCC 19977]MSRYMLSIVYAPGAVQPDEAALETIGADVQAVTRRMQDAGVWLFAAGLQP
ADTATMVTASAAGHTTTDGPYTETKEQLGGFSIIDVPTLADAQRWAAEVS
RAVWCPIEVRGLDRGCGELD
169631526YP_001705175.1 MerR family transcriptional regulator [Mycobacterium abscessus ATCCMDLTIDQLAQRVAMTARNIREWQTLGLVPPPEKRGRVGIYSDEHIAIINH
VKNLKSQGFPLDVIRRVIDSGSGSEDSVRKMVTEALSPFANGEPVVMPRA
ELIKRIGAGADSALADTDLVSEVDAATVSIRDSETLDAIELLVSSGMTLS
RIAETLREVDRLQHQIAQLLLGAYVADVWQPFVESGYTSEDWEKIAENAS
QAKQLTVTLASRLLARALDDTVDPILLQQANEAEAVLERDRPASSA
169631525YP_001705174.1 hypothetical protein MAB_4451c [Mycobacterium abscessus ATCC 19977]MTVAAQVSYPKTRRISFRFGESESEDRYFANNDIAFSHTVAFLSAVFPPG
EDIFVRSVRRYRDKIADPDLKKRVAGFIGQEMTHGLHHRDLNKQLAEMGY
PTAWFEYILNSTERMEKFLDEQYPDPDRCRRFRHLLLAFTVGAEHFTAVL
AENVLSRPELQHMMTDPEIKNLLNWHAIEELEHKSVAFDVYRAIGGSETL
RINMMRVLANIVIPVGVLSSWVSILTTDPVGRKQPWRVLRETVGVVRGPL
LRGFYREMKPFMRRGFHPDDIDTNALLNEWQDKLFGVNGELVDHLR
169631524YP_001705173.1 integral membrane protein TerC [Mycobacterium abscessus ATCC 19977]MDFTLSLTPDLVAVFLTLFVLEVVLGIDNVVFISILASKLPRGQQARARN
VGLTLAMVMRVGLVFLAGWIITLKEDILELFGQGFSVKDFILITGGLFLV
YKAVHEIHLKLEGAPEGSESSSGAATFKSVLVQILLLDLVFSLDSVITAV
GMTSNMLIIVTVVVLSFGIMLFASRFVFTFVNRHPTVKMLALSFLLLIGV
FLIADGFGIKIDKAMIYGPMAFAILVEGLNLLAAARKARQDNMTRTPVAL
RPSYPGIDESVAVAAATSAGPDAGSVGLSRKPVGGVGGDERAGLG
169631523YP_001705172.1 TetR family transcriptional regulator [Mycobacterium abscessus ATCCMAGGTKRLPRAVREQQMLDAAVQEFALNGFRDTSMDAIAAAAKISKPMLY
LYYGSKEDLFVACLRRELGRFVEAVRGDIDLTQSPRDVLSTTVVSFLNYV
DTHRASWIVIYGQATSTQLFAKQVREGRDRIIELVARLIKAASPEIDPET
DYDAMAVALVGGGEAVASRVATGDIKVESAKDTLLNLGWRGLRGRPRDEP
VAKRA
169631522YP_001705171.1 putative sulfate transporter [Mycobacterium abscessus ATCC 19977]MPSAPGLFESYDAIKARRDVIAGLTVAAISLPQAMAYALIAGVDPKYGVY
SAIVVTAIASIFGSSSHLINGPTSAISLLVFSSLAFLDPENRTGLFEALF
LLGVLVGTIQILIAVFKLGDLTRYISESVVIGFMASAALLLAIGQLANAI
GVRDKGDGHMQVLQRAWLTLFHGDAVNYRALFLSVTAVALAVLLRRLVQR
YELPQIDMLLVLIVTAVIAYAYGWTVPDGTGHTDVKISGKIPASLPEFHI
PEVQVSTLGELSHGALAIAFIGLIEALSIAKAIAHHTGQQIDYNRQILAE
GLANLAGGFFQSLPGSGSLSRSAINYQSGAATRFSGIVSAATVTIALLLF
APLLRYIPQAALAGLLLVTAVRLVDFHRLVYAIKASRYDAGLVIITALVG
VAVNLDTAVLVGVVLSILLFVPRAAKLKAAELVVTDEGVIRERTPQDRPT
GAGAPVIYDLEGELFFGAAPELDRYLESLHTRIRDEHLKVVILRLKRVRH
PDVVCIERLEHFIREQQQLGVTVLLAGVRPDSLALLENVGFTHWLPPEQV
FPEEEKEFSATLRAVRYAQSRLEEEPPNPAANPEKLYYLV
169631521YP_001705170.1 Sulfate ABC transporter- periplasmic protein [Mycobacterium abscessMPADEDHQDAPPIDWRALLRQLPLLNILGVVAVLVAATLVVVKNLPDHGA
DQLLNVSYDPTRELYNVVDGTFTKQYKDKTGKTIEIKRTNGGSARQARSV
LDGSQRADVVSLASVSDVDTLSLRGLIAPNWRQRLPNNSVPYTSTIVFVV
RKGNPRGIHDWPDLIKENVSVITPNPRTSGNGQLSVLAAWGSVVTRGGTD
TDARSFLTALFRNVAALDSGARGATNTFSVQRLGDVHLTWENEAINEVDA
NKGELEIVYPPVSIRAEPAVAWVDANLGDPKRAAIARAYLEYLFTDEAQE
VAAQHGYRPFKPDILARHSNTLPAIAQFPITAIASSWDDARQKFFSDNGI
YETIPRNTDRGTTTFASDRQGR
169631520YP_001705169.1 hypothetical protein MAB_4446 [Mycobacterium abscessus ATCC 19977]MTTALNPLETVANARAALHEVVSRLTEADNDKQTPNAKFTVAQLTDHLQN
SIKLLGGAAGVDIALTTEGSVADRLLPQSQAVVDAWQRRGIDGTVTLPIG
EYPAEVAVRILGSEFLVHAWDYAVATGQEFEPMDALTDGVLESVRMIIQP
ERRDGDFFADEVPVPDDSPNLVKLIAFTGRNPGWSPAS
169631519YP_001705168.1 hypothetical protein MAB_4444 [Mycobacterium abscessus ATCC 19977]MAQPSGLQNMVMAAVGALPFIPRPSTLPTRVVRTQGVKIDPANVAAYAQV
TGLTFSDKVPVTYPFTLQFPSVMSLVASLDFPFPAIGTVHLENHITQHRA
ISATDTVDIEVRAENLREHRKGLLVDVLTDITIGTDTVWQQTMTFLRQQR
TSLSGGPKPEPPKAVKLPPPNSTLRISGGQIRRYASVGGDHNPIHTSSIG
AKALGFPKAIAHGMFTAAAVLGNIQGDIPDAVRYDVKFGKPVLLPAAVGV
WIDRPGGPGTAWDIAVRNPRNGDPHVTGSVTPL
169631518YP_001705167.1 3-ketoacyl-(acyl-carrier-protein) reductase [Mycobacterium abscessuMSPKLTDDLYALLVNSGPGNLLAGRLGIPQPEKLRRYKKGQPALAGPVLI
GGEGRLAEPLRAALADDYEVVSNNLGGRWADKFGALVFDATGITTPVELK
ALHEFFTPLLRNVGKSGRLLVIGTTPDKAATTDERIAQRALEGFTRSLAK
EFSNGATVQLVYLHPDAKTGATGLESTVRFILSAKSTYVDGQVFYVGADD
STAPADWDKPLAGKVAIVTGAARGIGETIAEVFARDGAAVVAIDMPSEEL
NELASRVGGTALALDVTSEDAVDTITAHLKEHHGGKADILVNNAGITRDK
LLKNMDDARWDSVIAVNLLAPQRLTEGLIGNGTIGEGGRVIGLASIAGIA
GNRGQTNYGATKAGMIGITQALAPSLAEKGITINAVAPGFIETKMTAAIP
LANREVGRRINSLNQGGEPVDVAETIAYFASPASNAVTGNVVRVCGQSWL
GA
169631517YP_001705166.1 acetyl-CoA acetyltransferase [Mycobacterium abscessus ATCC 19977]MATSSARKSDASQGRRRVAVLGGNRIPFARSDGAYANASNQDMLTAAITG
ASDRFNLKGERLGAVIAGAVLKLSRDFNLTRESVLGSPLSPYTQAFDLQQ
ACGTGLQAAIVGADGIALGRYESVLAGGVDTTSDAPINFGDDLRHTLLAI
RRAKDNVTRLKLLGKLPAALGVDIPQNGEPRTGLSMGEHAAITAKQAGVK
RTEQDALAAASHQKMAAAYDRGFFDDLISPFLGLYRDDNLRPNSSVEKLA
TLKPVFGVKHGDATMTAGNSTPLTDGASVALLSSEEWAAERNIPVLAYFV
DGETAAVDYVNGPDGLLMAPTYAVPRLLARNGLTLQDFDFYEIHEAFASV
VLATLQAWESADYCKERLGLDKPLGAIDRSKLNVNGSSLAAGHPFAATGG
RIVAQLAKQLAEKKKENGGTGTYRGLISVCAAGGQGVTAILEA
169631516YP_001705165.1 putative oxidoreductase [Mycobacterium abscessus ATCC 19977]MEHAARRIIAGLIAAAAALAVGQLAAAAVAPDSAPFYAVGNTVVDHTPAA
VREWVIGIFGTSDKAVLFACLTVIIALLAALAGLVEGERRYGTVLIGLLG
VFGAVAAVTRPAGTFAWIWPSVIAAVAGALVLGTLVHRAQSQAVPDRRRF
FGTAAVFALGSAGLYWLGTRWSKGTVVAAERREATVPAPVAPAPPLPEGI
DVKGAVPYITSNTDFYRIDTALRVPQVSTAEWQLNIHGMVDRPRTLMWAD
LNAMAATQRAVTLTCVSNEIGGNLIGNAVWTGFPIKPILESVGVHPDADM
LLSKSVDGWTAGTPLQVLTDGRDAILAIAMNGTPLPVEHGYPVRQVVPGL
YGYVSATKWVVDWEITRFDKADAYWTIRGWSARGPIKTGCRIDTPRTGDR
LGTGTQIVAGTAWAQHRGIATVEVQIDDGPWLPARLAPEYSVDTWRQWWF
AWQATAGEHIITARATDGTGAVQTDQIASPVPDGATGYPKRLVTVAA
169631515YP_001705164.1 hypothetical protein MAB_4440c [Mycobacterium abscessus ATCC 19977]MARVLVTGMSGAGKTTLLRELARRGLCTVDTDYDGWTLADGRWDENRISA
LLEQHSDVVVSGTVDNQVNFYDRFCHLVLLSVPVDVAIARVSARTDNPYG
RTTAEQDEIVRNTEEIEPLLRESATLELDGRLSVPELADRVEALARQPR
169631514YP_001705163.1 hypothetical protein MAB_4439 [Mycobacterium abscessus ATCC 19977]MTEARRAVLVLSLVATSVLTFLLGVTDPAAPLFYPTRFLIWNLFLAWLPV
FAALAFSAVRQKIWLIPIGLVWLAFLPNAPYLVTDLVHLINGIAFWRHVL
QYGVAAWTGIILGIVSLRLVHRRIQRDFGAVTGWIVVVVSVGLCAVGVVI
GRFQRWNSWDLIHRPGAVAASTLEWVSSPFSFVAHTGVAVAVAAFFGLAY
LTIWSVSPPDTGPEVTAGPENLGKVPA
169631513YP_001705162.1 hypothetical protein MAB_4438 [Mycobacterium abscessus ATCC 19977]MPRYYRDQQAWKDLQMFLPERLRLDESTVPQEEFWDWHGNQVHLDRYANP
AASVKVVLLHGVGTNGRQMSLILGAPLARRGYETVAIDNLGYGLTEVAPG
TVPGYGDWVDLVVDFLEYERRRDVRPIVLYGLSAGGMLAYHVAAKAPRDT
VRGIIGMTFLDQRVREVADGTAHDLLTARVGVPFLRLAAKTPARRVRYPM
WLAAKMSTLANSRAAMKVFMKDRTSAASWVSVKFLAEYMSYAPAVEPADF
DVCPIILTQPDEDQWTPYELSRPVLDPITKVPVTVVPLERAGHYPLEDPG
LKQLEDAAVGFIRAVTG
169631512YP_001705161.1 acyl-CoA dehydrogenase FadE [Mycobacterium abscessus ATCC 19977]MTHMGHYKSNVRDLEFNLFELFKIQQVFGGEEFPELDEDTARTFLAEMRT
LAEGPLADSFAEGDRNPPVFDPETHSVAIPEAFKKSVKAITEAGWDRVGL
QEELGGTPVPRSLSWAIQEMILGANPAVWMYSGGAGFAQIFYNIATDEQK
KWAEFVAERGWGATMVLTEPDAGSDVGAGRTKAVKQDDGSWHIDGVKRFI
TSADSDDMFENIMHLVLARPEGAGPGTKGLSLFFVPKFIPNFETGEPGER
NGVFVTNVEHKMGLKVSATCELSFGQHGVPAKGWLVGEVHNGIAQMFDVI
EQARMMVGTKAIATLSTGYLNALEYAKTRVQGADMTQLTDKTAPRVTITH
HPDVRRSLMTQKVYAEGLRALYLYATTFQDAVAAKTINGVEAEDAVKLND
LLLPVIKGVGSERAYEKLTESLQTFGGSGFLQDYPIEQYIRDAKIDSLYE
GTTAIQAQDFFFRKIVKDQGKSLAFISGQIEEFVKSETGNGRLKAERALL
ATALEDVQGMAASMTGNLMAAQQEITQVYRVGTASVRFLMSVGDLLIGWL
LQRQAAVAIEALDAGATGADKSFYEGKIAAASFFAKNMLPLLTSTRAVLE
NVDNDIMELDEAAF
169631511YP_001705160.1 hypothetical protein MAB_4436c [Mycobacterium abscessus ATCC 19977]MPAMPPPVLTELDGLIEYIAQQQDAFRIVAFGLTDEQARLTPTAGTLSIG
GLIKHVTNMQAGWTDRIVSAPGPGTDHQRAEDEFILRADETLAGALAAFT
AQSAATLAAIKEKGLETPVPVPPAPWFPKDVDAWNVRWVALHLVEELARH
AGHADIIRESIDGATTYELLAAAEGWEPTDWLKPWTPKA
169631510YP_001705159.1 serine/threonine-protein kinase PknJ [Mycobacterium abscessus ATCC MTSSDRSSPGPGGQQPGDLPPGTVVSGYQIERVLGRGGMGTVYLAANPNL
QRSEALKILSAQSSRDPEFRARFMREASLAASLDHPNIVTVHNRGETPEG
DLWIAMQYVQGSDAHSESASGRMSLTRAVHIISEVAKALDYLHARGLVHR
DVKPANILLSAGDRRIMLGDFGLTRALDDSNSVTSAGNVTATIAYAAPEI
LSGTAVDGRADVYALGCTLFRMLTGQPPFGSGNSLPAIINAHLSAPPPRI
SQLAPVPESWDALIAKAMAKTPADRYQSAGELAMAAQQILTDPAQHRQTV
TQPVPATTPAPIAAPEPVHAMAPLAMADTGQSMLKHKRIAAIIGVMVLVV
ASSVVAVLIWPRADEGTDPRTKASPSAAQVAPGASLAGQPNTVLDTLLPG
QFDYPEGWEKNPSPTFRSGEFNPAVPPGSATNIGGTPVGCNTIDPAWALR
AKGRETSTLYLRDRKKPEREILIRVVPAADALSTDGASDALKRCDAVAYI
IPGSSTTWRCSFEFDEPNPVQNGQKELTTTESCYMFPSGANSIRQHVSFN
VVRGLLVYILASGASNRNDAAGSLSATALSFATTMKILRYGR
169631509YP_001705158.1 putative iron/ascorbate dependent oxidoreductase [Mycobacterium absMAVKTVAPKRLASNHGRVAELPVIDLSSDSNQLRAALREVAHEVGFFYLT
GHGVSPQLVHEVLSAARKLFALSEADKEAIAMVRSPHFRGFTRLGGELTG
GLTDWREQIDVGPERAASPTADGRDYMWLQGPNQWPAAVPELRPALESWD
IALAEVGRKLLREWAIALGSDGAVFSEAFGDKPATLIKVIRYPSDGTTSQ
GVGAHRDSGVLTLLLTEPEVGGLQVEVDGAWLEAPGREGAFIVNIGELLE
RASGGYLRATRHRVTLTGAPRISVAYFFNPRLDARIPVLELPPELRDRAR
GVSADPDDPIHATYGENAWKSRLRAHPDVAAVHGHLDS
169631508YP_001705157.1 hypothetical protein MAB_4433c [Mycobacterium abscessus ATCC 19977]MRTICSMAAGFGLAVSVFAAPIASALPGEGPVAVQCQVYADNNFGPPGFG
PGGMPGMGFGMKQWAGTVIGRGSNEGEARQDAQRQMWGPYGMSPELRDCV
PAA
169631507YP_001705156.1 hypothetical protein MAB_4432 [Mycobacterium abscessus ATCC 19977]MDKKGSAGQVLIGLALLFATASAFLAITLIWRAHAPAVGPAASAISAKQP
PDLSAYLPTPSEYPPGFTTPPENGIAMPRLAIPLASPDQPTIAPCDSARG
LPAQSPTGDPPAQLYLTNFTRAGGSILSIFIAEPGAWRDLSAVRTWTAQC
PQHGTADITCTDTAHLPIPAVSADDVAVVESRCRSSFDYRYRTYYALVRG
CLVYIMAHGDDPRPAESVLEVVVNKVRSGADTP
169631506YP_001705155.1 enoyl-CoA hydratase/isomerase family protein [Mycobacterium abscessMTSHVTLRVDGQVARVTLSRPEKLNGLTIDMLNGLTAAARHIASDNSIRV
VVLSGEGDTFSTGLDFAAAGKDPARVVANFIPLPWLGTNGFQEACWAWRR
LRIPVIALIHGRCYGGGLQLALAADFRFTTPDAEFSILEAKWGLIPDMSG
SVTLSQLIGIDTAKRLTMTGEMFDGFYAKEIGLVTQVSADPEADAQELID
QILSRSPDSVAATKTLFDKAWSMVPRRAFGLERRLQLRLMRGANFAIARK
AGIDKTEPQFKARSI
169631505YP_001705154.1 putative oxidoreductase [Mycobacterium abscessus ATCC 19977]MTSDTTLDAATLREAFGHFPTGVVAIAAEIDGTRTGLAASTFVPVSLDPP
LVAFCVQNSSTTWPNLRGAPRLGISVLGESHDEAARTLAAKTGDRFAGLD
TSTTETGAVFIGGTTAWIETSVESEVPAGDHAIVILNIHGLTVHSSVAPI
VFHRSKFRKLLG
169631504YP_001705153.1 hypothetical protein MAB_4429 [Mycobacterium abscessus ATCC 19977]MPLWTIYHTPNIFTDKEKTELANSITEVYTAVGLPRFYVITVFKQIEPAD
LYVGGEQTDSAVRIVVDHIARTLPDKAARERTTRRLGAALAPYLNRPGLH
WEFHVDETSQELWMINGLVPPPMNSAAEREWARTNTISPYAAPV
169631503YP_001705152.1 short chain dehydrogenase [Mycobacterium abscessus ATCC 19977]MIKDTVVLVTGGRRGLGAAIVDEVLNRGARKVYSTARAPFEDPRAQVVTK
QLEVTSAESVDALARDLTDVEIVVNNAGVLHPDPLLTGDFDRIDATFQTN
VFGPLRIARAFAPILKANGGGAIVNIHSVLSWLGGAGAYGASKAAIWSVS
NTLRLELEAQHTHVLGVHAAFIDTDMVSALPVPKTPPSAIAARIIDALDK
GDNEVLTDDLTVQIKSQLAGPVEKLAYRPGH
169631502YP_001705151.1 putative transcriptional regulator [Mycobacterium abscessus ATCC 19MGFERPLRDRSRWNTDACSIGKALDLLSTKTAFLIVRECFYGSTRFDEFA
ERIGVSAPAVSRALKQLEAAGVIEKVPYREPGQRERDGYVLTRMGEDLLP
VLLSLLKWGDDYLQNGHKPLTLIDKKTGGEIGVQVTSRPGQAVSADGIEV
RVARR
169631501YP_001705150.1 ArsR family transcriptional regulator [Mycobacterium abscessus ATCCMDAFEAIAEPSRRVLLDALAGGEWTAGDLVATLPGLTQPTVSRHLRVLRD
IGLVDVRPDAQRRVYALRPHGLREIDQWIDPYRHFWNE
169631500YP_001705149.1 hypothetical protein MAB_4425 [Mycobacterium abscessus ATCC 19977]MGDTVSVADIRTAIKELSIRADLAEREGRDEDARELRERVRGYQEELTRR
P
169631499YP_001705148.1 hypothetical protein MAB_4424 [Mycobacterium abscessus ATCC 19977]METWLIIVIAVACLAAVGAVLGVILLVIFAAGGISAARFSLTPVGADELR
GYLDSEASFAITVQRDFFHPPDQVFKALLDERFMSWAPFTKGVDYAGTAL
RDIGTKRALVNTFIVLAEQIVVNEPGRVLGVTATACSVPLVLDSAAEVFD
VVDNGTGGTRLTWHVGGTPRGVGWLPLRMAAPFVRPVAAWQLGKLRPIIG
RR
169631498YP_001705147.1 fumarate reductase iron-sulfur subunit [Mycobacterium abscessus ATCMSYDAHLRVWRGDDDGGELIDFTVPVSEGEVVLDIIHRIQATQASDLAVR
WNCKAGKCGSCSAEINGRPRLMCMTRMSTFDESETITVTPLRAFPVIRDL
VTDVSFNYQKAREVQSFTPPKGLKPGDYRMQQEDVERSQEFRKCIECFLC
QNTCHAVRDHEENKKAFAGPRYLMRVAELEMHPLDVADRREVAQEELGLG
YCNITKCCTEVCPEGIHITDNALIPMKERVADRKYDPIVWLGNKLFRR
169631497YP_001705146.1 succinate dehydrogenase flavoprotein subunit [Mycobacterium abscessMAELERHQYDVVVIGAGGAGLRAVIEAREQGFKVAVVCKSLFGKAHTVMA
EGGCAASMGNANDKDSWQIHFGDTMRGGKFLNNWRMAELHAKEAPDRVWE
LETYGALFDRTKDGRISQRNFGGHTYPRLAHVGDRTGLEIIRTMQQKIVS
LQQEDFAETGDYEARIKIFAECTITDLLLDSTDGVSRISGAFGYWRESGR
FILFEAPAVVLATGGIGKSFKVSSNSWEYTGDGHALALRAGGTLINMEFI
QFHPTGMVWPPSVKGILVTEGVRGDGGVLKNSEGKRFMFDYIPSVFKGQY
AETEEEADQWLKDNDSARRTPDLLPRDEVARAINAEVKAGRGTPHGGVYL
DIASRIPTEEIKKRLPSMYHQFKELAEVDITKDDMEVGPTCHYVMGGIEV
DPDSGAATVPGLFAAGECSGGMHGSNRLGGNSLSDLLVFGRRAGLGAADY
VKSLTSRPQITEADVDKAAALALAPFGDPAAAGAENPYTLHTDLQQAMND
LVGIIRKEEEVEQALVKLNELKERFKHVAVEGHRQFNPGWHLAIDMRNML
LVSECVAKAALLRTESRGGHTRDDHPNMDATWRKTLLVCSTTGGDPAVPD
VLVTPEPQLPLRPDLLALFEIGELEKYFTPEELAEHPGRKS
169631496YP_001705145.1 putative succinate dehydrogenase [Mycobacterium abscessus ATCC 1997MSQATGVFSPSRARIPERTLRTDRWWLAPLLTNLGLATFVIYATVRAFWG
SAYWVPQYHYLTPFYSPCVSTACAPGASHFGHWVGELPWFIPMAFISLPF
LLAFRLTCYYYRKAYYRSVWQSPTACAVAEPHARYSGETRLPLIMQNIHR
YFFYAAAIISVVNTYDAIVAFHSEKTGGFGFGMGNVILVTNVVLLWVYTL
SCHSCRHVTGGRLKHFSKHPVRYWIWTQVSKLNTRHMLFAWITLGTLILT
DLYIMLVASGTISDMRFVG
169631495YP_001705144.1 hypothetical protein MAB_4420 [Mycobacterium abscessus ATCC 19977]MSTKTELTELNQALGSLRRCVHSLQSRYGDLPAVRRIVNDVERLDIDAAD
LDLAPHEHRLAGNEKIQIPDTEYDREFWGDIDDEGVGGYR
169631494YP_001705143.1 tartrate dehydrogenase [Mycobacterium abscessus ATCC 19977]MSDRMRVATIPGDGIGVDVTREAVKVMDSATGGRIEWTEFDYSCERYAKT
GAMMPPDAPTTLAGFDAILLGAVGYPGVPDDVSLWGLLIPLRRAFNQYVN
LRPVRLLPGIASPLAGVSDEALSMVIVRENTEGEYSPIGGVHNRGNQNEF
ALQESVFTRIGCERIIRYAFELAASAGFRVCSATKSNGIIHSMPYWDSIF
NEIAAEYPQTPSVSMHVDALAARMVSDPASLDVIVASNLFGDILSDLAAA
ITGGLGLAASGNINPERTAISMFESVHGSAPDIAGQGIANPVAQILAGAM
LLDHLNEPATANKIRLAVDQVLSDGRVRTPDLGGTATTEQLGTAIAEAAR
169631493YP_001705142.1 succinate-semialdehyde dehydrogenase [Mycobacterium abscessus ATCC MHPGTVSTPLSSSSSVVDSALTHQDRHETTFPVVNPATEEVLADVADLDG
AAAVAALDNAVAAQRSWAATTPQQRSDVLMRAYTLMIQRTEDLALLMTLE
MGKPLPESRGEVAYAAEFFRWFAGEAVRLDGSVMLAPDGQSRLIVTHRPV
GPCLLITPWNFPLAMGTRKIGPALAAGCTCLVKPAEQTPLSMLALLGILR
EAGVPDGVVSVITTADPGATMAPLLADPRVRKLSFTGSTEVGRYLLAQCA
PTVKRTSMELGGNAPFIVFDDADPEEAAAGALIAKMRNIGQACTAANRIY
VQRGIADAFTEALTTKLTALRMGPGVEPGVDVGPLIDPDAVAKADRLVTD
ARKRGATVRLGGEVPDGTGYFYPPSVLTDVPDESDMMRTEIFAPVAAIAT
FETEQEVITRANDSEFGLVAYLYTNDTRRGWRVSEQLETGMVGLNRPVVS
TPAAPFGGVKQSGIGREGGFAGIEEFMETKYIGAAV
169631492YP_001705141.1 aminotransferase [Mycobacterium abscessus ATCC 19977]MVAARGQGCYLYDETDREYLDFTAGIGVVSTGHCHPRVVEAAQRQVATLI
HGQYTTVMHRPLQNLVRRLGEVLPPSLNSLFFANSGSEAVEAAVRLARQA
TGRPNIIVFQGGFHGRTLAAATMTTSGPRFSSGIGPLMAGVYSAPFPTAY
RYGWSEAEATRFALQELDYLFATATAPGQVAAMVIEPVLGEGGYIPANTE
FLTGIAERAREHGILLVLDEVQTGFGRTGQYFGHQHFGVTPDVLVMAKGI
ASGFPISGIAASAELMGRAWPGSQGGTYGANAVACAAALATLDVIDEEGL
VDNARARGQELLDGARKIAADRGIDGDVRGLGLMVGVEFSQDGRPAPQRA
ARAQAAAAENGLLLLMCGPHMNVVRMIPPLVVTADQISDALGIWSSVVAG
L
169631491YP_001705140.1 hypothetical protein MAB_4416c [Mycobacterium abscessus ATCC 19977]MDRHISITLTKRNVTCRARLLDAEAPRTCDTVWNSLPVLGQAYHAKYARN
EVYTLLPPLLPAPGRENPTVTPIPGDVCFFGFEPWEIGNPAYGYEPGSEA
HSAQGATDLAIFYGRNNLLINGDAGWVPGNVFATIEEGLSDIAAACQDLW
LTGVQGEQLAFARA
169631490YP_001705139.1 putative amidase [Mycobacterium abscessus ATCC 19977]MHKPTDPTEMTALELVAAYTSGELSPVEATAAVLSRIAQHDSAINAYCLV
DEEAALAAATESEERWRGHYTRGLLDGVPISIKDVFLTRNWPTLRGSGLI
DPDGPWDVDSPAVQRIRADGMVMVGKTTTPEFAWKGVTDSRQRGITHNPA
DPSRTAGGSSGGSAAAVAAGMAPMSIGTDGGGSVRIPASFCGVVGFKPTH
GRIPMYPISPFGPLAHGGPITRTVEDAALLMDIISLPDYRDPTSLSPTLT
TYRSQVYRDMTGLDIAYSPTLGYVDVDPEVADLVENAVNALNDAGLPVTH
ADPGFSDPIDSFETLWAAGAAASLNNYGALDDVGTDIDPGLAQMWDTGAG
ASATEYLAARNTCVQLGVTMGAFHELHNVLITPTVPIPAFPLGADVPPNS
GMRWWAQWTPFTYPFNMTQQPALSIPVGNTAQGLPVGMQIVGPRHSDDLV
LAVGHFAERVLAG
169631489YP_001705138.1 putative D-isomer specific 2-hydroxyacid dehydrogenase [MycobacteriMNEQLVRRPVIAVQHSPDSVPERLAPVTAAAEVRLVESDRLATALPGAEV
LFVYDFRSSALRETWSAADSLRWVQIASTGVDPVLFDEFVASDVVLTNSR
GIFERPIAEYVLAQILAFAKDIRRSTRAQAALSWRHFESESIEGTPVGVL
GTGPIGQAISTLLGAVGMRVTVLGRAESADLSSHVGEFEYLVLAAPLTPQ
TRGIVNARVLSAMRPTARLINVGRGELVGTWDLVSALNRGGIAGAALDVT
DPEPLPVGHPLWRTPNTHITPHNSGDVRGWSDRLQDQFVVNFERYLRGEE
LLNIVDKNRMHRHA
169631488YP_001705137.1 putative decarboxylase [Mycobacterium abscessus ATCC 19977]MDFSSLPDFAESADQRGIGIIAPFDLALERELWRWVPAEVSLHLARTPYE
PVPVSRAMAELVSNTSHLQAATRDVLHVEPEVVAYLCTSGSFIRGVQHER
ELVDAIMAAGAKSAVTTSGALAEAVTALNINRISVITPYDAELTELLAKF
LGELGVTVVRTDHLGLGGGIWKVNYRTVAERILAADTADAEAIFVSCTNL
RTYDVIDPLEQLLGKPVLTANQLTIWACLDRMSLPMMGPGRWLRDVFGGG
GSSD
169631487YP_001705136.1 putative decarboxylase [Mycobacterium abscessus ATCC 19977]MTNIRPTVGFIYPDHAAESDYPLVARQLDMNFPVVHIYGTDLHAVPELLD
LGSPERLAEGARLLRPHEPGAVVWACTSGSFVYGPQGAAEQVAGLSEQSG
TPASSTSFAFVNAAVALGVSKVAVAASYPRDIAELFVAFLAAHDIEVVSM
GEAGIDTAAEVGRLTAHQVDELAGANDHPEAQALLIPDTAMHTIAHVERL
ESRLDKVVLTANQVTVWEGLRLIDEVPDVSGLGRLFRRQHDDTGT
169631486YP_001705135.1 GntR family transcriptional regulator [Mycobacterium abscessus ATCCMTTLVPEEFAPLERQSTAELIAERLRIAIMRGVLAPGAQLGEASLAAQFA
VSRGPLREAMQRLVSEGLLRSERNRGIFVIELTDDDVLDVYRSRSAIERA
ALECIMTGDTVTAYRRLLVPVAVMTEAAARGDVVAVTDADQDFHEVLVDC
SGSPRLRRAMRTLLLETRMLLGELQGAYPDLSEQVREHEVLCAAIGAGDA
PAAYRLIDEHMHDAVTRLMARRDPGSVE
169631485YP_001705134.1 PEP phosphonomutase-like protein [Mycobacterium abscessus ATCC 1997MSTDLAAKASLLKSLHVPGDPVFLPTVWDAWSAKLAADAGFAALTVGSHP
LADSVGKADAEGMSFDDVVARVSQITAAVDLPVSVDIESGYAQTAQRLIE
GLIEAGAVGLNIEDTVHSEGGRLREPQEHADLVGALRVAADQSGVPVVIN
ARTDVLLRQIGEESDRVDRAIARLKLAAEAGADSLYPVGRHDPDVQRRLT
SELPLPVNAIAVPDVDDPASFGPLGVGRISFGPFFQRALSARAEEILGRW
R
169631484YP_001705133.1 hydrogen peroxide-inducible genes activator [Mycobacterium abscessuMSDRSYQPTVVGLRAFVAIARKRHFGSAAGELGVSQPSLSQALSMLEEGL
GVRLVERNTRKVLLTPEGDALLEKAISALNAVDEFTSAASGVRDPFAQTL
RLGLIPTVAPYVLPMVLSGLSREFPEMSLRVTEDQTHRLLRSLSDGTLDV
AVMALPVQTQGMAEIPMYREDFVLALPSGHPLAGSKNVEPADLADMPLLL
LDEGHCLRDQALEVCQLAGVRPDLGHTRAASLATAVQCVEGGLGVTLIPG
TAVTAETASGGLATATFAAPVPGRRIGLVYRAISAREDAYRRLAELLTRL
VSAVHPVTADAA
169631483YP_001705132.1 putative alkylhydroperoxidase C [Mycobacterium abscessus ATCC 19977MTLRTIGDEFPAYNLTAVIGGDLSKVNAQQPDDYFTTVTSDDHPGKWRVI
FFWPKDFTFVCPTEIAAFGRLNDEFADRDTQVLGASVDNEFVHFQWRAQH
EDLKTLPFPMLSDLKRELAEAAGVLNADGVADRATFIVDPDNIIQFVSVT
AGSVGRNVDEVLRVLDALQSDELCACNWRKGDPTINAGELMSAGV
169631482YP_001705131.1 putative alkylhydroperoxidase AhpD [Mycobacterium abscessus ATCC 19MSIENLKEALPEYAKDLKLNLGTVARGTVLSQSQLWGTLVATAAATRNEQ
VFKEIREEAAGILTPEALDAALGAASIMAMTNVFYRGRGFLDGAYDDLRP
GLRMNIIGNPGVDKSEFELWSFAVSTINGCHYCVGSHEKVLREAGLTREQ
VLEALKIAAIVAGVAQALATVPALV
169631481YP_001705130.1 isochorismatase/phenazine biosynthesis protein PhzD [Mycobacterium MTKEGRMRRRTFLRSSSVALPAAALGLTTAGSAHADVRPTGSIAYPFSTI
QVPTSSAPWTLEVHRAALLVHDMQHYFVKAYAPQDDPIGTVLKNIKSLLD
TAHTHQMPVYYSAQPGGMTKEQRGLFGQLYGPGMPDDDTERAIVDPLAPT
AADTVLTKWKYSEFFRSDLLEILHDANRDQLILAGVYAFSGITATSTDAV
QNDIQAFIVADAVADYTSTGHNQALAWCAERTARILTTRSALGALNNS
169631480YP_001705129.1 serine esterase cutinase family [Mycobacterium abscessus ATCC 19977MSISTYGVDYPASIDFIQAGKGSDDLSKHIQKTAADCPKMKFVVGGYAQG
AAVVDVLLGNTPPGTYTFTNPLPAGLEDRIVAIVLFGDPKNIRPPGVDAN
LAIRDELLHKVIDVCNPGDFFCDPQGGDIISHTTYAKDKLTDGAADTVVQ
RLVALLGHRCKGADGQSTDSATTCSPTA
169631479YP_001705128.1 hypothetical protein MAB_4404 [Mycobacterium abscessus ATCC 19977]MRIAMRYPACAVTAFATLFGGYGMQSPPAAQAASCTDIDLAFARGTNEPA
GLGDVGSPSPTRSRNSSRAPRG
169631478YP_001705127.1 acyl-[acyl-carrier protein] desaturase [Mycobacterium abscessus ATCMPRELTDIEMLSELEPIAETNLNRHLAVATEWHPHDYVPWDRGRNFAQMG
GDDWDPEQSQLSEVARAAMITNLLTEDNLPSYHRQAAKYFGLDGAWGTWV
GRWTAEENRHGIVIRDYLVVTRGVDPVALERARMEHMTAGFDATDEEESV
HQTDFLLSVAYTTLQELATRVSHRNTGKVCDDPVADRMLQRVAADENLHM
IFYRNMCSAALDLVPDQALDAIGAVIENFRMPGQGMPNFRRNGVLMAKHG
IYDPRQHLDEVVTPNLRKWRIFERNDFSAKGEARRDQLAAYVEDLKGQVV
KFEEQRDRMLAREARKREARAG
169631477YP_001705126.1 heat shock protein Hsp20 [Mycobacterium abscessus ATCC 19977]MSNLVWTRRSPFAEFDALVRQSFGPATSWPTPGFVPSADVVKDGDDALVR
LDLPGVDVGKDVTVEVERGTLVVSGERRDERAEQTEGRTLREVRYGTFRR
TFTLPTHVTGDAISASYDAGILTVKVAGAYANAAAQKIEITT
169631476YP_001705125.1 putative surface layer protein [Mycobacterium abscessus ATCC 19977]MTSPSAREGRAGDTLAVVSQTGPTVSFFDAASDEMLGAIDVLAEPHELCF
DPTQRLLWCTNTYHTGYYHANAGRRTQLTVIDPDTRRVVDVVDLAPEHAP
HGLALDTGRGLLYVSVEGSNERDGGVVVIDTTTRKMLGRIDTGAPGPHWF
VIDPTGEKGYASNKEAPFVSFVDLGSGTLTTVEVPGSEGLAISADGSELY
VAAPYGSFKVGETDPTQQAGIRVIDTRQAQVTAVLKTENVVFPVCLTSTG
TLLAGELRMSPDPSCTLGRHEPGLLRAFSTTTRELVASVELKGKFPLTMT
ASPDGRLGYVAGITSSEVDIVDLETWTVLNTLDIAKRGEAGAHGLAYIPR
ST
169631475YP_001705124.1 LysR family transcriptional regulator [Mycobacterium abscessus ATCCMDLNLLRVLDALLQENSVTAAAERLATSPPAVSRSLGRLRRITGDALLVR
AGQGLVPTPRAVQIRDELGGLLRRADQILRPGAEFDPGKLQRTFIVQAAE
LFLTALAVPLLERLRHDAPGVNVVFAPEAREDTGALRRGDIDIELGSLDH
LDPETRHTPVAMLPMVGVAAQDHPLFEGPIDAGTFATYGHISVSRRGKLY
GPIDEALARHGLRRRVPVVVPSHTSAMLLARSSRLIALTVAGSVDTAGLG
IRMFDIPLELPAVAVGVAWHPRNNDDAAHTWLRGLLIESFARLPV
169631474YP_001705123.1 hypothetical protein MAB_4399c [Mycobacterium abscessus ATCC 19977]MPGQPAENQKASARVVLRHALISAGPSLGTYYLLRSLGQPEIHALIAATV
VSGIQVLVKVVQNRKFDVLSGFLMFNFGLSLIIALVTSDARMAQVSNTIP
GILLSLFLIGSALVGKPLTELMIAKARPGRIDEIAAEHRWTGEDFTSYHR
MHVRVTLWCGVISLLLSAISIVIIYSFSVDIAQAVNQIFSLVTTIGLIIG
MIMFIRRYLQRVTYDSPAA
169631473YP_001705122.1 hypothetical protein MAB_4398c [Mycobacterium abscessus ATCC 19977]MSLTTERPETENGISPRQLLIEGLLNVGPALCAYFGLRLIGFSELHALMA
ATAVSATQGLVKMAWKRALDPVSLLVVPIFGVSLVIAWLTRDPRLSQVTN
EVPGMLLGTYFLVSALIGKPLTELLVAKLWPGGVEKLADEQGWTEADQGS
YHRLHVHVSFWCGIFSLLFSGLMVVIIYSFSVDVVQAVNPVVSMFTTGGL
IVGVVVAIRMYLRRKERVLSAR
169631472YP_001705121.1 hypothetical protein MAB_4396c [Mycobacterium abscessus ATCC 19977]MGKGAGKFTLGHALVSAALGLGTYYGMRLLGASELHALMAAAVVSALRVV
YTALRDKRFDIVAGFIMLMHGVTLVVALLTSSPQLAQLTHVVPVVLFGVF
YIGSCLTRRPLTELVVDVIRPGWVARHHWSDADLRAYHRMHVRLCIIVGS
LELVQAAAMAVIILRYPVDIAQAVNGLMAAVGSAARLAFVIAVIWVFLRR
RGHHQPSPARQSQVNEPEGSTPELIGSTCTPSSVAGTMPSAVITGVDPSQ
GTQPRAR
169631471YP_001705120.1 aminoglycoside 2'-N-acetyltransferase [Mycobacterium abscessus ATCCMSAVSNMPTVPVIRTHTARLIHTADLDSETRCAARELLIEAFEGDFTEED
WEHCLGGMHALIWYHGILIAHAAVVQRRLLYQDRVLRTGYVEGVAVDSDW
RGNGLGTAIMDAAEQVLRGAYELGALSAGDDVAPFYRARGWVPWLGSTPV
MTADGIVPATDEGVHVLPMSSGVDPSGSLTCDWRAGDGW
169631470YP_001705119.1 hypothetical protein MAB_4394 [Mycobacterium abscessus ATCC 19977]MRPTLEVMRTGPLALVQDLGRVGKAAMGVGRSGAADRSSHSLANRLVANP
DNLATIEVTLGGMSFRVIGGDVVVAVTGADTDPSINGIPFGTNSIAQVQD
GDVVSLGAPRSGLRSYVAVRGGVSVAPVMGSRSFDIMSGIGPKPLRAGDR
LPIGPRSPSFPEVEQAPVATISDDVVELKVVPGPRDDWFTDPDALIHGNW
IVSDRSDRVGTRLIGKPLELRDPARQLPSEGVVRGAIQVPPGGQPVILGP
DHPVTGGYPVIGVITDHDVDLAAQVRPGQTVRFSWSRPRMN
169631469YP_001705118.1 hypothetical protein MAB_4393 [Mycobacterium abscessus ATCC 19977]MSTATDLKVRDHGDRALLLECTSVHEVLAWTSALNADPIEGVTDIVPASR
TVLLKLNGPSDQPMVRHRLTQRTAPPGSLDDTTSPPVTIPVRYDGLDLEE
VAEHTGLGVDGVITAHTGTVWTVGFCGFAPGFAYLVGGDPRLAIPRRADP
RTKVPAGSVALAGEFSGIYPRESPGGWQLIGTTDTVIWDLDRNPPALLTP
GTRVQFREVTA
169631468YP_001705117.1 hypothetical protein MAB_4392 [Mycobacterium abscessus ATCC 19977]MATSEIEKSPQDEVVFAQVGRSYYPLLSAVFVGVVLISNVAATKAIGFGP
VVGDWSLITDGAFVLFPLSYVIGDVLSEVYGYRATNRVILLGFAMEALAC
LVLWTAKVLPPAEFYPNQEAFATIVESITTLMVAGLAGYLVGQTLNALVV
VRMKKRSKERHLWARLVGSTVIGEFADSLVFCSIAATALGIHTFGQLATY
TALGWVFKSVVEIVMLPVTYRVIAYIKKNEPTYTQAK
169631467YP_001705116.1 hypothetical protein MAB_4391 [Mycobacterium abscessus ATCC 19977]MVYPPARPEQPYWVDIAIRVAGGLVGALGLGIFGLAAFAVLSSRFSSNPF
ADPHGYGLVFGMLLAVPFGLLAAGTLPLAFTRGRRLRALTIGFLVYLAAV
AVLVYSAASMPVRVRPCATNPPAPQCKHAP
169631466YP_001705115.1 ABC transporter periplasmic substrate-binding protein [MycobacteriuMPPGMITRRGLLAAGAALAASTALASCAKESAPTSERDGTAFIKHAFGTT
EVKAPPKRIISAGYTGHDYLLALGIVPVAVTEWYGGFPFATWPWATERLG
GATPEVLTLTDGLMIDKIASLKPDLIVAADAGLDQDTYTKLSGIAPTIAQ
AGKYAFFEPWKDQAKAIGQAVFKPAEMDAVVKAVDNKFSSAASAHTGFKD
KKAIYLQGELLDGQAIAFRSGPRTGFLSGLGLITPPDLETYAKGDQLAYL
AADRLSTVLAEADVLLWGTESDEQIAALKADPAITTLGPSLLDRSIFTSK
ELGGAINFSSPLSLTYVVDNLVPQLARILG
169631465YP_001705114.1 TetR family transcriptional regulator [Mycobacterium abscessus ATCCMSAMRAAGQATHDRIMAAAKAEFTEHGLAGARLNRIAINANASKERLYSY
FESKERLFEAVVAQWINDAPYQVPLSAEDVPGYVAGLFDNIIADPQGARL
QRWIELEAPDGMFDNHLLRRIFQAKLDEVRRGQQCGLIDPAWDPKSLLML
LIDIAYSMAASGFSIDRIVGEPLSERTLADRRNAAAEAARRLVGIS
169631464YP_001705113.1 zinc-containing alcohol dehydrogenase [Mycobacterium abscessus ATCCMKVTAALSASPAAPFTLQELELDEPRSDEVLVKIHATGLCHTDLTFKSQV
PIPAVLGHEGAGIVTAVGEAVSGISPGDHVVLSYRSCGGCRSCAAGERAY
CSRSMRLNSAGVRADGSPTLSDNGTPVYGSFFGQSSFAQYALTGADNTVV
VDPSIDLAVAAPLGCGFQTGAGAVLNVLSPEPDSRLVVFGAGGVGLAAVM
AAKAQGVETIIAVDPVASRRAKATELGATQTVDPAMEDVAAMARGATHAL
DTTANAGVIATALGLLRQRGVLVLVGLGAQPGPIDLNDLMLGGKVIRGCI
EGDANPQEFIPELLQMHARGHFPIESLITTYPAADIEQAVADARSGAAIK
PVLLW
169631463YP_001705112.1 hypothetical protein MAB_4387 [Mycobacterium abscessus ATCC 19977]MDAHKARTRFTELRRQRDINPTELDEIWAALDTVRIEDILGSWKGDEFHT
GHRMNGQLAAARWYGKVFKSINDVEPIVCYDNDGKLFSNNELSLGGATLW
EVEFRGEVTATMVYDGQPVFDHFKRVDGSTLFGIMNGKRQRQSGSYLYFL
LERDQ
169631462YP_001705111.1 putative transporter [Mycobacterium abscessus ATCC 19977]MTVLFLGFLTGMSLIAAIGAQNAFVLRQGIRSEHVLPVIAVCITGDFLLI
AAGIGGLGGLITATPSLLTVAKVGGAAFLIGYGLMAARRALRPGTLVPAE
SNPARLGAVLLTALAITFLNPHVYLDTVVLLGSLANAHRDARWLFGAGAL
TASVTWFVGLGYGARYLAGVFERPGTWRMLDAGIAVVMLALGVSLLVS
169631461YP_001705110.1 putative oxidoreductase [Mycobacterium abscessus ATCC 19977]MTDMTQRAFVTGANGFVGRSLSLRLRTLGWQVSGVDLVADPAHNIQGGDI
NTAGPWMTEAAAADAIFHTAAVVSNIADSDTAWRVNVLGTKKVIDATAPG
AVFVHLSSVRAFSDLDFPDMVTEEHPVRTDGNAYVDTKVASEQVVLQAHG
AGRIDARIARPGDIYGPGSRPWTILPVEMIRSRQFVLPAMGRGVFSPIYI
DDLVEGVVALGSGGAASGQVFTISGGVGVTCAQFFGHYHRMLDRRGPLVL
PTAAAVGLATVKARVLALSGKATEANAISVRYLARTGSYSIAKAQRILGF
EPRFSLDAGMRATEIWLRDQGYLD
169631460YP_001705109.1 TetR family transcriptional regulator [Mycobacterium abscessus ATCCMNGREVAHRPLRKDAERNRKRVIAAARELFAVHGLESTLNEVAHHAGLGV
GTVYRRFPTKEALFEAIYVDGMDQLSGLAEAALRHENSWEGFEWFVHQMC
EITATNRGLREIAFSKAHGGDHVEAGRARLLPLLSKVVERAQEDGYLRPE
ASATDMPFFGVLTGAVSEFAGEVNADLWRRYMAILIEGMRRRDDQERLEV
DALDEAQIDAAMTTWQPAGSG
169631459YP_001705108.1 putative membrane protein MmpS [Mycobacterium abscessus ATCC 19977]MIRVAKRVWLPMLVVAAVAIGSITVMHLRTNFGATPFVVTPRNSDTAERF
NPKVVTYEVFGSAATAVINYRDLNAIPQRVSEVPLPWSLTLSTTLPSVMP
TLFAQGDGQDIGCRITVDNDVKDERVVTGVNAETYCLVKAA
169631458YP_001705107.1 putative membrane protein MmpL [Mycobacterium abscessus ATCC 19977]MSKPMNDPTTDAFPAARHAARPWLPRMIRVLAVPIVLGWIAVTIALNTVV
PQLEEVGHMRAVSMSPNDAPAMIATKRVGEVFEEFKTSSSVMIVLEGEQS
LGADAHRFYDQMVRDLRADTTHVQHVQDFWADALTAAAAQSSDGKAAYVQ
VYIAGDQGEALANESVEAVRHITAAVPPSPGVRVYVTGPATTSADQEIVA
NDSMELIELVTFGVIMVMLLLVYRSVITMVIVVAMVMLELASARGLVALL
SYHNAFGLTSFATSLVVTLAIAAATDYAIFLIGRYQEARRAGEDRESAYY
TMFHGTAHVVLASGLTIAGATFCLHFTRLPYFKTTGIPLSIGMAIVVAMA
LTLGPALISVASRFGNVLEPKGAGKARGWRRVGAATVRWPGAILVAAVTM
ALVGLLTLPGYHTTYNDRIYLPGQVPANVGYAAADRHFSKAKMNPDLLLV
ESDHDLRNPADFLVIDKIAKALARVRGIAQVQTITRPDGKPIKHTSIPFN
MSTANTAQTLTNDYSQANFANLLKQADAMQVTIDSMEKMQAITQQMAEVT
ASMSANMKNTAQDINQLRDNMSNFDDQFRPIRNYFYWEKHCFDIPMCWAL
RSVFDALDGISLMSDDFDTLVPDIQRMAGLMPQMVVLMPPMIASMKEQKQ
IMLSQYQVQKAQQDQTMAMQANASAMGQAFDDAKNDDSFYLPPEAFETAD
FKSGIKLFVSPNGHAVRFTIFHQSDPLTEEGTSRVEPLKTAAEDAIKGTP
LEGSSIYVGGSAALYKDMQEGADYDLLIAAVAALILIFLIMVLLTRAVVA
AAVIVGTVVLSLGASFGLSVLLWQHIIGTPLHWMVLPMAVIILLAVGADY
NLLLVSRMKEELHAGLHTGTIRSMAGTGSVVTSAGLVFAFTMMGMMVSSF
TVIGQIGTTIGLGLLFDTLVVRSFMTPSIASLLGRWFWWPMVVRPRPRPQ
PWPQPLHAGAAEAVRA
169631457YP_001705106.1 chromosome replication initiation inhibitor protein [Mycobacterium MSLDSQQLVAFAAVVDEGSFDAAARRLMITPSAVSQRVKALERSVGQVLV
RREKPCVATDAGTSLMRLAAQIGTLEREALQEMGGGVPIRVAIAVNADSF
GTWMGSVVSQIPDGVLIDIRIEDQDHSAELLRAGVVMAAVTTEPRPIAGC
RSESLGAMRYFGMASPEYVERHLPDGLLDSGIDKVRQAPLIRWDRRDALQ
DQFLRKLFRRDVVVAGHCVPTTVGFTAALRAGLGWGMMPEQLGREGLVEL
APGRYLDVPLYWQHWKFESSTLSAITSAVREAATVLRRSR
169631456YP_001705105.1 IclR family regulatory protein [Mycobacterium abscessus ATCC 19977]MDAYGDLVTEAPSVVNRTAALLRAVSSDTGTGVSTTELARRTGIPRATAH
RLLESLATEGLVERDARSGQWFLGPEIYVLGAASAPRYNITEKAAADVAA
LARDTGESAFFSLRRGDHTVVLLAEDGDFPIRSHVLYEGARFPLGVVSSG
MAVLAYLPDAAIHAYLERADLQSEWGNGFRIDAVWERVALTRKTGWAVNP
GQVVEGSWGMAAAVFDANQNPIGALTLTGIEARFNADRQPVLGQLLLRHA
HRLSRTVRR
169631455YP_001705104.1 MaoC-like dehydratase [Mycobacterium abscessus ATCC 19977]MHRQVDAQLGMEVVVSERRTVEQRGLWFEEFETDVLYLHRPGRTITEADN
VLFTTLTMNTQALHLDAAFSDALPPFNQRLVNSMFTLSTVVGLSVAQLTQ
GTIVGNLGFSEIAFPAPLFHGDTLYAESEVIDKRESKSRPGEGIVTFAHT
GRNQRGDVVATATRKTMVRRRPAEQPS
169631454YP_001705103.1 putative citrate lyase subunit beta [Mycobacterium abscessus ATCC 1MTVATAGPGWLFCPADRPERFEKAAVAADVVILDLEDGVAAADRPAARDA
LISTPLDPGRTVVRLNPAATADHALDLEALAQTEYTTVILAKSEHADQVL
GLAPLNVVVLVETPMGALNVAELVRPGNVVAAMWGAEDLFAATWGTNNRW
PDGSYRDVAQHVRSQTLLAAKAFGRIALDAVYLDIKALDGLRAEADDAVA
VGFDAKVAIHPTQVNVIRAAYEPTAKQVYWARGVLELAGRERGVFQFEGV
MVDAPVLRRAERIIQLSALTGGLCE
169631453YP_001705102.1 AMP-binding domain-containing protein [Mycobacterium abscessus ATCCMKAYDAGATLSPIIEETIGENFERIARAHPDVGALVDVSGDRRWTYRELD
AEINRVARGLMSLGVAAGDRVGIWAPNCAEWVLVQYATAKIGAILVNINP
AYRTHELAYALNQSGVRTLICAKAFKSSDYVAMASQVMPDAPGLRDVVFI
GTSDWTELVAGAERVTETALRARMSQLSNTDPINIQYTSGTTGYPKGATL
SHRNVLNNGFFVAESIQLQAGDRLCIPVPFYHCFGMVMGNLGCTTHGATI
VMPAPGFDPGRTLEAIERERCVGVYGVPTMFIAMLADPGFAHRDLSTLRT
GIMAGSVCPVEVMKRCIDEMHMAGVAIAYGMTETSPVSCQTLFDDDLDRR
TATVGRAHPHIEIKIVDPNSGETVQRGQSGELCTRGYSVMLGYWNDEAHT
REVLDTDGWMHTGDLAVMRDDGYCTIIGRLKDMVIRGGENIYPREIEEFL
LTHPDIEDVHVVGVPDEKYGEELCAWVRMRPDRVVIDAVAIRAFASGRLA
HYKIPRYVHVVESFPMTVTGKVRKIEMRQQTIQIFGLPEPGRTDEQ
169631452YP_001705101.1 putative acetoacetyl-CoA synthetase [Mycobacterium abscessus ATCC 1MSSSAYDRFVDHVSRRYAVPCNDYEDMWRWSVESVPQFWRALWEFFEVPG
RGLRDGDAGVLANSAMPAAQWFPGVELNYVAQMLRHVHRDGAAIVGVDEA
GERSEISWRELPGRIGAVAAELRRLGVGRGDCVAAYLPDVPDAMVAFLAT
ASVGAVWAGCGQDYAPEGAAARLAQLTPKVLISGRGYRYNGRWVSKQADT
EVLHRLLPGEPALIIELPTGSEDPVVEMVPFDHPIWVLFSSGTTGKPKGI
VHGHGGMLLEHLKGAGLHCDLGPGDVFFWQTALSWMMWNFRLAGLLVGAT
VVCYSGHPLYPNADRLWELLEAERVTYFGTSPGHLHASKKAGLEPSSEHD
LAVLKTLGSSGSPLSADLFQWAGAHTGATVSSLSGGTDVCTAFAGGTPEV
PTHPGELPARYLGVDLHSWSPDRRSLIGEVGEMVILQPMPCMPIRFWDDP
DGSRYKAAYFEHEWADGQAPGVWRHGDWVTVTERGSLVIHGRSDATLNRN
GIRMGSADIYEVVESMDQIAEGFVLGVDGPNGAYWMPLFITMAPGHTFDD
ALGDQVAREIRDRLSPRHVPDEVIEAPGIPHTRTGKKLEVPICGVLAGRV
DVSLDPRSIDNPDLVDWYRERGRDHRW
169631451YP_001705100.1 4-hydroxy-2-ketovalerate aldolase [Mycobacterium abscessus ATCC 199MTQLYIQDVTLRDGMHAIRHQISPTAVARIASALEAAGVNAIEVAHGDGL
AGGSVNYGPGSNTDWEWIEAAADAVTTAKLTTLLLPGIGTVAELKRAYSL
GVRSIRVAAHCTEADITAQHITMARELGMDVSGFLMLSHMASAETLAEQA
KLMETFGAHCVYVTDSGGRLTMPMVRDRVRAYRDVLDSHTEIGIHAHENL
SLSVANSVVAVEEGATRIDASLAGHGAGAGNCPLEAFVAVADLHGWGHSC
DLFALQDAADDLVRPLHDRPVRVDRETLTLGYAGVYSSFLRHAEAAAQRY
DVDVRSILIEAGRRRLVGGQEDMLVDIALSLST
169631450YP_001705099.1 acetaldehyde dehydrogenase [Mycobacterium abscessus ATCC 19977]MAIIGSGNIGTDLMIKVIRRSRILSMGAMVGIDPTSDGLARAARLGVATT
ADGVEGLIHMEQFAEVAIIFDATSAATHRENAARLAPYDKRLIDLTPAAV
GPYVVPPVNLGAHIASGATNLNMVTCGGQATIPIVHAVSRVAPVVYAEIV
ASISSRSAGPGTRANIDEFTETTARAIEQVGGAARGKAIIVLNPADPPPL
MRDTVFCLVGDADHGTIRRSVKEMIAEVSTYVPGYRLKQDVQFDRVDEPM
RALLRDTTGTVTTKVSVFLEVEGAGHYLPSYAGNLDIMTSAALHTAESMV
RGGDSSQEFGI
169631449YP_001705098.1 putative hydratase/decarboxylase [Mycobacterium abscessus ATCC 1997MIAGADIRTAAERLEFAAVTGIPCAPVRDIIGADDIDTAYLVQRSVIDRR
VTRGASVAGHKIGLTSEAVQRQLGVHQPDFGVLLSDMDVSALQHVPSDRL
LQPKIEAEIAFRLGEDLDNGDLGPSQVRAAVDAICAALEIVDSRIANWDI
TIADTVADNGSSGLYVLNGHWTGLDACEPREVTMRMYTGDLRVCEGTGTA
CLGDPLIALAWLARTTRKLGRPLRAGQIVLSGALGPMITPLPNTTIRAEL
SGLGTVTARFPPQSQGNDDDASV
169631448YP_001705097.1 3-(2-3-dihydroxyphenyl)propionate dioxygenase [Mycobacterium abscesMLMTCALVGLSHSPLVGKNDPASDTLARINSAIEHARSFVHEFRPELVVL
YAPDHYNGFFYKEMPPFCLATEAHAVGDFGSPAGQLSVDSDAAQLLARGV
LSRNVDLTVSARMTVDHGFTQPLEMLFGGIDRVPMVPIFINGVAGPFGPL
NRIRALGTALGHEAAALGRRVLFLASGGLSHDPPVPVLQGAPPRVADALI
EGHPPSPEQRARGEERVLAAGREYAAGSSSRIPINPIWDNEVLDTFESGD
LEAIDSWTPEWMGSEGGGSAHEVRTWVAAYSSLAASGPYQMLTRFYAAVP
EWIAGFAVSTAMRQVGP
169631447YP_001705096.1 putative alcohol dehydrogenase [Mycobacterium abscessus ATCC 19977]MLAAVAESQSAADPLAGLVLKDLPIPTPPSGWSVVRVVSSSLNMHDLWTL
RGVGHPADRLPIVLGCDAAGFDQDGNEVIVYPVIANPDAGMGDETLDPDR
ALLSERHDGAFAEYLTVPTRNLVPKPAWLSFDEAACLPVAWTTAYRMLFT
HAKITAGARVLVQGVGGGVASAAIRLASAAGAVVYATSRSEAKRQTAISW
GARDAYATGERLPERVDVVIETVGEATWSHSLKSLRPGGCIVIAGATTGM
NPPADLGRVFYLQQRILGSTGCTRSELIAMLRMLDATGIRPVIDRTMPLA
EIHKAFQLMIDGGLTGKLVIHPDPN
169631446YP_001705095.1 putative large terminal subunit of phenylpropionate dioxygenase [MyMASLPRPVAVAQGALCRPQALVRDIDVSGLVDSHGGLLDRVIFTDGELYR
QELRRVFAPSWLFLAHADQFHRPGDFFTTYMGEDPVIVSMDKNRRIRAFL
NSCRHRGARVCRADYGVTRGFTCTYHGWAYDLEGKLISVPNEEGYPDSFS
TDDWGLVEVPHVDSYHGLIFGTWNPAPVGLRESLGDMAWYMDAMLDHDSE
GTVVVGGVHKWVLDGNWKLAAEQFATDWYHVNMSHASALMVMAPQGKAPK
DEIVHRTGRQYVDPNGHGAGFPVHPKNRFDARVVHQWTDYGALRERLGEA
RVQGPLTNGHATVFPNLSYLPVNGSVRIWHPKGPDKMEVWAWTIVDRSMP
EEVRDAQRLYNLRTFGPTGIFEQDDGENWSEVQSISRGFVTNSVALNYQM
GLDSEREDGRHPGLTSELYSDAAGRSFYARWRDLMNTKAWHEEHV
169631445YP_001705094.1 putative ferredoxin subunit of phenylpropionate dioxygenase [MycobaMSSGIRVAALEDIPEGEGIVVAKAIAGTADNVALLRDADGSVWALDDTCT
HADASLAEGWVEDGYVECPLHSSKFCLKTGAVDGLPATKDTCPHRIEVRD
GDIFLFPGEKPRPL
169631444YP_001705093.1 putative rubredoxin/ferredoxin reductase [Mycobacterium abscessus AMKRIVVVGGGIAGVSTVGGLRANGYDGDITMIDAGGSPYDRPPLSKDYLS
GKVKLADIELRPEQWYRDQQVRLISESTVAVLRPALGAVETADGTLLAAD
RVVLATGGGAARPPIPGSENAAIHVLRDVADAQRLRDGLRSGVRVLIVGA
GLVGAEIASTAVDLGCSVVLVDPVRPPLVAAVGADMADWLHHKHRERGVV
TLQAGVEAFHQRIGEIEVSLQGEYRPQVADVVVLAVGMVPRTSLATAAGL
EVDGAVVVDVRQLTSNPAILAVGDVARIRKDGRLLARSEHWDGAGASGGR
AAATLMGADPPPASAPWFWTDRHGDHVEAVGQMSGADHTVLRGDVGDPGF
AVFGLRDGALVGAASVNQPNIVRAARRLIDRGVQLTAEVLGDPHSDLREL
LKQQRSVRISGRGED
169631443YP_001705092.1 biphenyl dioxygenase subunit beta [Mycobacterium abscessus ATCC 199MDAKIIPGALADRDTHFDVAQFYYSEAELLDEGRYVDWLELLADDVDYWM
PLRTNRLRRQQALSVAARGEAAYYDETKESLAWRIRRFDSGMAWAEDPPS
RTRHLITNISVRYAEPDKGAEACDLVARSAFLVYRNRLEREENIFAGART
DSLRRVDDHRFLIARRFILLDQNILQAKNICTFF
169631442YP_001705091.1 alpha/beta fold hydrolase [Mycobacterium abscessus ATCC 19977]MTIHTHLQSISTTLGEIAVHDVPAAGGADAPTLVMLHGGGPGASGLSNYE
QNIPALSRTFRILLPDQPGFGGSYRPTGADLDERSITEITVDALFQVLDD
LAVGSFHLLGNSLGGAAAIRMAQLRPERVTRLVLMAPGGGWLPFGPTPTE
GQKEMFRYFNGEGPTEKKMAAFIRAMVFDHKQFGRDVVSRRYQASLDEGH
IEFYHHYNAAFAKRNGMDPLWRDLHTITAPTLLLWGRDDRTITLEGAQMM
LKHISDVQLHVFGRCGHWVQLERQAEFDRLVADFLGEPA
169631441YP_001705090.1 putative dihydrodiol dehydrogenase [Mycobacterium abscessus ATCC 19MSGGWLGGYVALITGGGSGIGRAVTERYLAEGASVTIVGHRPEQLDRVHA
ESSAPDRLHTVVADTRESDQLHDAVVQTVSRFGQLDTLVANAGVWDYQRP
LTRLTASELTASFHEVFSVNVKGYLLAAEAAWRELVKTRGSIIMTLSNAS
FYVNGGGPIYTASKHACLGLMRELAFELAPKVRVNGVACGGMNTDLRGPE
ALSLADRSISTSFAKRGHDASAPLIPLHDSSTDPADFTGPYVLLASREQS
GPITGEAIAIDGGIGVRGFVKPAGGEHL
169631440YP_001705089.1 hypothetical protein MAB_4364c [Mycobacterium abscessus ATCC 19977]MASESEPPRIGPGFRRQLCLTGQLRNAYPVGSHDVQIVIDADAATVEGLC
DAASSIFEGDPACRRVVFAPDTDDVDSIEVAERAGFRMVVEVDLPGATVK
ILVCEPQWVTDGYVDLNSVPC
169631439YP_001705088.1 putative DNA-binding protein [Mycobacterium abscessus ATCC 19977]MTDHNTLVARNVRRYRQERALSLGDLARRSGLSKQTVSKIEQGVGNPTVE
TLALLGEALQVPPQRLLTEWGTPVFVQRASEDGWVDKGARSERLLDEIYG
SGYVRNLVVRLERTAQAGEEIGAHAPGTLHHVYVIEGILRTGPLNDPVEL
RTGDFARFPGDVPHRHESISPRVVAHLVTTLPQIRQFDPIR
169631438YP_001705087.1 putative long-chain-fatty-acid--CoA ligase [Mycobacterium abscessusMSTRAAALSELDLPATIYDLLARSAAQHANKPALRLLKGGREWLSPTTWT
YNELLGRVTQAANMYHALGLGGGGVVGLLLPNTPASYPALLGAQAVGIAN
PVNPMLTTAHIIDILGLTGAQILIAPAPALDPDGWQKARDVLDALPEIAT
LITVGGDVPHPPDRWAGDFDDLLSTHITTHLDAKTQRTSSDIAAYFHTGG
TTGTPKVAPHTHANEIYVAWALSQHNAFGGDLAVLSGLPLFHVNAVLVST
LTPLLAGGTTVALGPLGFRDRDAVADFWRIIEHYRITTFSTVPTVYASLP
PLPEDVDISSLRAGIVGAATLPTAVRTNFERVTGVPMIEGYGLTEGTCAS
TFMPLGDTRYGSVGPPLPYQRVKALRLDTEGRPTGDCAAGETGMLAISGP
AVFPGYLRPGPDGPAPDPAGVIQDGWLLTGDLGRLDTDGFVYMTGRAKDL
IIRGGHNIDPRPIEEAMLSHSDVVAAAAVPRPDVHSGEVPVVYLVLREGA
NPPETELQQWAADHCAEPASIPKFFHVVDSIPVTAVGKVHKVPLIHDSVR
RAVLHQLGTAGLTAEVSVSDTDGRPVAQIHLTNGAGSEGRHEAQKLLSRF
GISFHISESDRTDVSAAR
169631437YP_001705086.1 fumarylacetoacetate hydrolase family protein [Mycobacterium abscessMRLYTTDRGIGREDRHGILALLDLPHRDLGELLSDTGLDPARDATVTDEV
ALTDVAVLAPVIRPGKILIIGLNYPSHAKEALAAFAAMGRDDIVMPTEPN
MQLIAGSATTGTDHTIKLPAIAPDEVDYEGELAVVIGRSTHAVSVEEAWK
HVAGLTIANDVGARDIQRRAMTGDAAASIGVAKSFDTFKPLGPCLVTADE
FSDGVDLTLQTYVNGELRQDDRTGSFIYPIPELIAHLSRYQTLQPGDVIC
TGTPCGAGAFTGRFLRSGDTVEVAIERIGLLRNRVSAA
169631436YP_001705085.1 transcriptional regulator TetR [Mycobacterium abscessus ATCC 19977]MPRNRQQIPRAERESAILEQAVELFAANGYRGTSVAAVGRAAGVAPAAVH
WYYPTKDDLFAAAVTSIFDSVRERVEADPSINGEPYGELVALLSESQSYR
NLHREAYERMEGSEAVRAAYEHVQSWLDERLLAAIAQRNRGGVNSELVAD
AAHVLFEGILISSRRLDRSAGELIGLVVDALVAVAVTKRGS
169631435YP_001705084.1 putative biphenyl-2-3-diol 1-2-dioxygenase III [Mycobacterium absceMVLRTGRVQEMTDWYLQLLDGKVAFANPMIAFITYDEEHHRLAFLATGAS
EPPEDRHTGLHHVAFTYSSLRGLLDNYLRLKDQGLLPFWCVNHGPTLSMY
YRDPDGNQIELQIDSMTNEETQDFITSEAFAANPVGITFEPEALIERFDA
GESFAELVRWPSA
169631434YP_001705083.1 putative monooxygenase [Mycobacterium abscessus ATCC 19977]MSTVITPVVIVGAGPTGLATAYVLGRLGVRSIVCDQYDGVNPHPRAHVVN
TRSMELLRNWGIYDEIIADAIDFNRGINVLWKHTVAGEEFGRLDLADVPE
AHLARRLNASPVTIGSCAQDRVQGRLLEAVRSSGMTEVRYRTKVSAVGAH
EDHVDVYLEKDGHAETLRAEYVVDAEGAAARLRQSIGIDVEGIPEFGHQI
NMYFHADLSEWTDQESELLFWVLNTGCPGVFIRLGGNRWTFHTGFDPARE
AVSDYTPERCRELIRLAVGAPELEIDMRSVGTWVLGASTARQYRKGRVFL
VGDAAHQFPPTGGLGMNTGLVDADNLGWKLAAVLQGWAHTQLLDTYESER
RPVALANAESSIANVMKMADAGIGPNTMAVAAKLESDIPAVAAAERSRMA
AAVPEQRPHFDYLELELGYVYGGHNDAVDPITTAVMGGRMPHHWVNLGDR
RISTLDLVGVGFVLIAGPEGAEWIDAPKIREMRIPLQVYLVGRDLEPIGG
AIPGAEGNGAVLVRPDGHIAWIGTGLAVDPVEEISLAVETLCGKPLSEIA
T
169631433YP_001705082.1 indolepyruvate ferredoxin oxidoreductase [Mycobacterium abscessus AMRQPLVTPSERYTAVRGTVHLSGIQALVRLVLDQRRDDRRDGRSTAGFIS
GYEGSPLAGYDTELIRNSALLDEHEIVFVPGVNEELAATAVQGTQMAVTQ
PDRRVDGVAAIWYGKSPGLDRAADAIRHANLMGTHPQGGVLALVGDDPAA
KSSSVPGASELLLADLGLPILYPSDPQQALDFGRHGIAMSRCSGLWVAMK
VVTNVADGSGTVELNPDRVRPAFPETKIDGEDYRHTVTAHMLQPTLGALE
RSRDGIRLEIARKYAALNGLNQITKQAPGDRVGIVAAGKTYLDLVQALRT
LGVDNGVRVLRLGMIHPLEPGVIAQFAENLDYIIVVEEKRPLIELGLKDV
LYGTAGAPMIYGKRNPDGNNMFPADGELDTEAIADQLRPVLERFGALPAS
EPRIQRGRRGPVSLPLLTRTPYFCSGCPHNTSTKIPEGSMVGAGIGCHAL
VTMMDERQVGEVAGMTQMGGEGTQWIGMAPFLRRDHLIQNLGDGTFHHSG
SLAIRAAIAAGAHITYKLLYNSAVAMTGGQQAVGAMSVGQICMAMLAEGV
SRIIITTDNAKAYRKAKLPKGVMVWDRSRLIEAQRVLADTVGVTLLIHDQ
ECATELRRKRKRGLVSEPAERVLINERVCEGCGDCGQKSNCLSVQPVSTE
FGRKTRIDQSSCNKDLSCLEGDCPSFITVIPDPNAKRLKHIPDDSLADLP
DPPQLLAAAHAHTTRIAGVGGTGVVTLAQVLSVAATSSGWQVRTLDQTGL
AQKGGAVVSDIKMSKAEIAEPSKAASAECDLYLGCDLLVAADEKYLNAAD
SSRTTAVISTSEVPTGQMVIDPGVSFPEPGPLKALLREAVRDTVFIDARA
VSVQLLGSDQYANLLLAGAAVQLGSLPLSPAAIEKAIALNGAGVQSNIAA
FRYGRLAVAEPETFRRITEPPAPSSTRRSAAVEKLVQQVGALPGGELERL
LRIRVPDLVDYQSLGYAREYVRYVADVVHMERERCAGSEALSATVARQLY
KLMAYKDEYEVARLSLSPAVVAAVTAEFGEGARIAYRLHPPVLRALGLKR
KLVLGPWFRPVYRILVAARRLRGTRADLFGLAKVRRCERRLVVEYKETID
TVLSELSNANLSAAVEIADLPDMVRGYESIKLASVDRYRAATARAIGRFL
SIGEPVPN
169631432YP_001705081.1 fumarylacetoacetate (FAA) hydrolase family protein [Mycobacterium aMRLYTTDRGIARQGADGHFSLLDLPFDDIGALLRYSDTDTAARALASRVV
DSDHVSLAPVILRPGKILAVGLNYLSHAEEALEKFASIGRRDVQLPAEPN
IQIVAGSAVQADGRPLMLPVATPHHVDYEGELAVVIGRAGFAIRTDQAWG
HVAGLSIINDVSARDIQQRAYTGDPAASIGIAKSFDTFKPLGPCLVTADE
FTEKVDLRLQTRVNGDLRQDDRTGNLIHSIPELIAYISRYHTLEPGDVIA
TGSPRGAGQFTDRYLRPGDVVEISIEHLGTLTNSVQARQSTGTGQSPLR
169631431YP_001705080.1 hypothetical protein MAB_4354 [Mycobacterium abscessus ATCC 19977]MTDSNGHIAVASLPVLDEAGRATLFTHARTANSFADTPIAREKLLEAWEL
ARWAPTSVNTQPLRILFVDKGEARDRLIPHMFDPNKAKTSTAPAVAILAT
DTRFHDQIPTVFPLMPEMAELFEANSELRSSTGIFNAALQSAYFIMAIRA
VGLAAGPMGGFDADGVDREFFPDNDWSTVLVVNIGHPGENPWFGRLPRLD
PADVVRWA
169631430YP_001705079.1 hypothetical protein MAB_4353 [Mycobacterium abscessus ATCC 19977]MTFTLHVTNEQTPQAAKNGTDLMSLFLPVSPFVELLDIRAEKLTDDEAVL
RMPWRPELATTADMVHGGAIAALADITAMVSAWCGRELPEQLRGVTTSLA
LEFLEPARAEDLLGTGRALRRGKTLTACEVDIVTVAGTRVAKALASYKVG
169631429YP_001705078.1 TetR family transcriptional regulator [Mycobacterium abscessus ATCCMVPLRQAQALATRQRLVDVATELFALHGFTSVTTTSLSEASGMTRGALYH
HFANMTEVMEAVFERAEGFLVAEVNHSLTSIESPAERFLAIGSAVLDVLA
REPIVQRIVFVEAPMALGWSRWRALDGGRSLGLIQDILEELYRRGELVEA
VDPQMAAQLILGAINESGMYAAAAPSERSSRAAEQLTLLCRGLLSPRSG
169631428YP_001705077.1 secretory lipase family protein [Mycobacterium abscessus ATCC 19977MASPAMRLWRLTAALAITIVSLWQLMPTARADDRHYEEFYTPPNPLPAGQ
AGDLIRTEPQRLVLEPSGQLGAYMGTGTRIMYRSNDARGNPVAVTGTYIE
PSVPWTGRGPRPLLAYATLPYGMGEQCAPSRLFDQGIHFSQGMDLMFNIE
EGFVATLLARGFAIVVTDGIGMGVHGPQSPQFLNRVAAGTALIDAARAAM
KLVDTSLDPHGPVAFWGFASGAHASLSAAEQVGSYAPELNVVGTYAYSPM
TDLAAELPGIDGSFMAGTTGYILRGLFASYPELEQPIRESLTPRGLQMLD
WSGHTCIMQTGIDYAFRHLQFWFNDDITHLAQLEPFKTLLAAQRVGNTKP
TGPVYIAINRFDPLNDYNAARQSGLDYCAMNADVTFWTNEQPPLFNKLAI
NTFLPVFVDGERSMAWVTDRFNGVTTSPNCGHF
169631427YP_001705076.1 putative amino acid permease [Mycobacterium abscessus ATCC 19977]MTASKRACQGHGSAAESDRPQKLDGQLGVIGIVLMVIAAAAPLTVIGGDG
LLAIASGPGPGAPLGFLIAGLLLMAFAVGFVTMTPFVSEAGAFFSYITKG
LGERWGLGAAFVALVTYTAIQVGMYGYMGWALNDLVTSYGGPELPWWLWA
IVTLGLVAYLGYRNIELSSKVLGIALVLEIAVVLVTDAAIVFQGGRDGIS
AYSFTPEAAASGPLGIAILFAFAGFMGFEATAVFRDEARQPERTIPRATY
LSVAIIGVFYAVSCWAVVEAWGPANVKDVVQKSLDSGGNALLDTAEAYVG
AVFRDIMQILLVTSLFACVLSFHNVIARYQFALANKGVLPAPVGRVHPTE
RSPHISSALQSITAVAFVVLVAAVGLDPMVQVFSSMAGISTVGMLMLLIL
TSVAVPLFFSRDDSARAGRVLTTYVAPIVATIGLSASVYLVLKNFTLVTD
QSTVISTVLAALPIAALIYGLVQKKGVHRR
169631426YP_001705075.1 hypothetical protein MAB_4349c [Mycobacterium abscessus ATCC 19977]MTVVEVPGGYGSAMTVDAGSLIKIVNPAGTQVVDFWAHQRADLSEHLGLG
QCREVLERIYFRTGDTLISNRYNAMLTVMADDTGILHDTLIAPCSRAMYG
FLGLDPDHRSCTSNYHEALPERAAADPPQPWNLFMTAQVRTDGAIQYARP
PMQPGMSVTLKALTDLVIVVSACPDDHYPTNGGDGSPRPVTVEISGDA
169631425YP_001705074.1 putative hydrolase [Mycobacterium abscessus ATCC 19977]MTLSTGRLKVAGLQTSGTPGDIAANLDELASAACAAAGEGAQLLITPELF
VTGYDIGDVIYELAAQDLLSPLKRIAEEHGIALVVGIPEAVGEKLYNSAV
FVDQQGQVRATHRKTHLFGPLDRQYFTAGSDAVTVVDYLGLKVGMMICYD
VEFPENPRMAALEGVDLLAVPTAQMKPFEFVADSVIRTRAWENQMYVAYI
NHAGRERQTAYVGRSSIVAPDATVLGRILSATGIIYGIVDGHAVRSARKR
NPYLSDTRPELNQRLIRRHEPGD
169631424YP_001705073.1 putative regulatory protein [Mycobacterium abscessus ATCC 19977]MTVAEILALPVVLAGDPQVVGGGSLDRPVRWVHVSDVADLSGLLQGGELV
LTTGGPLADPDACTRYLGGLFAAGAAGVVVELGTSLQAIPSGVAREADKL
QLPVIALHRKIRFVDVTEQVHRSIVAEQYDEVAFARHVHEVFTELTMRRA
TLGEIVDACGQIAESAIVLEDLNRQVVAFTTHGDSPTGVIHDWERRSRLT
PVLPETGETGPESWLTTPVGPGRQEWGRLIAPSGGSSLRGRMALERAAQA
LALHRMIEQHQTTLEQQAQSGLVEELRRGRIKDEAEASARARALGVKPAL
SYIPLTVRVREEPCADQVLLQRRQIRLLDAVRHAVRTARLSALTANPRPG
QIDVLLSQTHASSAEEILTNVSSVIRASLQRLDDISRCVVGVGPASTRLI
DAAVSLDDSAHVAEVALSLPDDAKAFHRASDTRLRGLLALIRSDPRVQAF
AEVELRGVLENRARHGDDLFQLLREFLNTGGNKTELAKRLHLSRPTLYTK
LAIVQRLLGVDLDDAESRTSLHTAMLVLDHVNP
169631423YP_001705072.1 methylmalonic acid semialdehyde dehydrogenase MmsA [Mycobacterium aMTQSITHWMNGKTYPGVGGRLAPVTNPATGAVTGEVVLGSVADARAVIDS
ATVAFPAWRDMSLARRSAILFNFRELLNARKEELAAIITSEHGKVLSDAL
GEVGRGQEVVEFACGIPHLLKGGFTENASTNVDVYSVRQPVGPVAIISPF
NFPAMVPLWFIPVALAAGNTVVLKPSEKDPSASLWLARLLAEAGVPAGVF
NVLQGDKTVVDELLTHPAVKAVSFVGSTPIAQYVYATASAAGKRVQALGG
AKNHAVVLPDADLDLAADALVNAGFGSAGERCMAISVAVAVGSIGDELVA
RIAQRARGIKTGDGTGDADMGPLVTKAHRDRVASYIEAGRAAGAAIVVDG
REVEANGASDGFWLGPTLIDHVGPDMSVYTDEIFGPILSVVRVDTYDEAL
ELVNNSPYGNGTAIFTNDGGAARRFQNEVEVGMVGINVPIPVPMAYYSFG
GWKSSLFGDTHAHGMEGVNFYTRGKAITSRWLDPSHGGINLGFPENK
169631422YP_001705071.1 hypothetical protein MAB_4345c [Mycobacterium abscessus ATCC 19977]MKDETMTLTQETETLPNGLSAADAFQEASRAYTLDRAHVFHSWSAQSQIK
PMTIVASAGSYVWDGGGRRLLDFSSQLVNTNIGHQHPKVVAAIQRQAAKL
CTVAPQYANDARSEAARLIAERTPGDLDKIFFTNGGADANEHAVRMARLH
TGRYKVLARYRSYHGGTDTAINLTGDPRRWPNDYGNSGVVHFHGPFLYRS
VFNSANEEQETERALAHLEQTIRLEGPSTIAAIVLESIPGTAGVMVPPPG
YMAGVRELCDQFGIVFIADEVMAGFGRTGEWFAINHFNVVPDLLTFAKGV
NSGYVPLGGVAINGAIAETFSERAYPGGLTYSGHPLATAAAVATIEAMDE
EGMIGNARRIGRDVLGPQLQRLKERHRSIGEIRGLGVFWAIELVANPESR
EPLSPYGTSNAAINSVVAECKATGLLPFANFNRIHAVPPCSVTDLEVQEG
IKSLDTALAIADEYVVP
169631421YP_001705070.1 putative NAD-dependent glutamate dehydrogenase [Mycobacterium absceMITTSSCGVVLPAGYIGEAERYPEVDTATLDLLAADGFEFRIRRGDNGQL
RVTLYTAEGTVSLERVLSLLASCDLDVVSQVAMTIRRPDALLCTVHEFEA
EPKHEPAVNLWNDDSTYRPMTAAMSAMWAGWVEVDRLAVLTVSAGLSWQD
TALLRAYGRFLRHTVVPLSQNRIHAVLLSHPEVSAALVELFHRQFDPALC
SSDDVRAKRVDQQLARVKEQLEQVSGLDAHRTLNAYLTLISATSRTNYYL
SGGLGPDRNHISLKFRSEEIEELPRPRPPREIFVYSPEVEGVHIRFGQIA
RGGVRWSDRLDDYRTEVLGLAKAQSVKNAVIVPAGAKGGFVVRRPPSPTG
NLQADHRAHEQAGRRCYRQFITGLLEITDNLSADGEPSHPGDVVCRDGFD
PYLVVAADKGTATFADVANEIAAEHEYWLGDAFASGGSVGYDHKKMGITA
KGAWVSVRRHLSEMEIDVDRDSFAVAGIGDMSGDVFGNAMLLSRSLALVA
AFDHRHVFIDPAPDVERSWHERRRLFELPGSSWADYAPHAISAGGGVWPR
DIKSIPVSDQMRAVLGLGPEVSVLTPPAMIQAILSAPVDLLFNGGIGTYV
KSSGESHLAAGDKANDIVRVDANALRCRVIAEGGNLGLTSLARIEYARSG
GRINTDALDNSAGVDCSDREVNIKILLGGAIQDGPGASSDRSQFLASLTD
EVSRLVLRDNAGQNRLLGEARSHAHLQIDVHGRMINDLVARRGLDRELEA
LPGPEELGVLAAEGKGLTSPELATLLAHAKLDLKAGLTQCGAFAGPVFSD
LMAGYFPVRLADVVAVDVHPLRNEILATELVNDIFEMGGITYAHRLWEET
GATPEDILRAFVVVTEVFDIRQLWDDIVAEQARPAVEYSMIAEVRRLLDR
ASRWFLANRQQPLAVDAEIARFRDHIRKHSGLVSDLLCGNELAAMRLIRE
EFVTKGIGDSTAKRLADGLYRYSLLDIIEVASETGLTVEMVASTYFTLSD
RLDIDRWLIAVSALPRRDRWHTLARLTLREDLYRSVRLLTRDVVTEAAVG
GNADRLIAEWERDNWAHVQRAGARLEELAGKASHDVASLSVAARYVRSMA
NLS
169631420YP_001705069.1 WhiB family transcriptional regulator [Mycobacterium abscessus ATCCMDRFDSEIIAFVTKWIPYGGPPPGESLAEFGLLNDQLVARVRDIHGRLCP
DSLDWDGRHGQAAEALAFLDGASPCGTDVASARSLEDTAVAALVHPTTAS
ASQSGWRHDALCRGMPWDFFYSPDDERGARRRERERRALIICRGCRVVAE
CRGYALERREAFGVWGATTAEQREQILGSAPDQPAVVVVADR
169631419YP_001705068.1 putative MutT/nudix family protein [Mycobacterium abscessus ATCC 19MTTDCPRPHPGIGCFVVRNGRFLMGRRHGAHGAGTWSVPGGWIEWGESPE
AAAIREVREETGMLVVDARVAGATTTSHPEGMCSVTLWVVARWVSGEPVV
MEPDKYAEHRWYGLDEALPAPLFEVWEDLLGSPAYGELRAMLSEA
169631418YP_001705067.1 hypothetical protein MAB_4341 [Mycobacterium abscessus ATCC 19977]MADGLRASGSSKADLVLQVAGRDVTITHPDKVIFPDSGITKGNLVHYYLD
VAEGALRGVRDRPMILKRFVKGIAQEAVFQKRVPEKRPDWIASAELHYAR
GTSAREAVVTDAASLAWVVNLGCVDLNPHPVRADDLDHPDELRIDLDPVP
GVPWSQILDVAFVVRGVLEDHGLTAWPKTSGSRGFHIYAPVARRWTYREL
RLAAETVAREVERRAPELATSRWWKEERHGVFVDFNQNAKDRTVASAYSV
RATPDARVSTPLRWDEVAGCRPESFTLHTVRERFADIDDPWRGMDDATGT
LDQLLELAAELGPAEKAPKGASRDGRRRPTMPLIEIARTKTKPEAQAALD
VWRDTYPRVAGLLEPQDILIDGMRGPSSVWYRVRINLVHVPEGQRPAQEE
LIADYSPWS
169631417YP_001705066.1 acyl-CoA synthetase [Mycobacterium abscessus ATCC 19977]MSITAERPLFSKLQTLAKRGGAELHYLRKVIEAGMLKLDPPNVLAGLVRD
FYRFGEIGAVPAFGAHRSPSRTAIIDDEGSITYAELNDAVNALAHGLNRL
GIKGGDGVAILARNHRWFIIANYAAHRAGARVILLNTDFSGPQTKEVAER
EGARVLIYDAEYAEFLDGYSPELGRIMALPTNPDNPDQPASTDETIASVI
KRNSTSPAPRPSKYSSLVILTSGTTGTPKGAPRKLALTLAPVGGMFSHVP
FRSGEVTSVPAPMFHALGYLHQSLALTLGCTLILRRKFKPENVLADVEKF
KVTAIVVVPVMLNRLLNALDELSVKPDLSSLRIVFVSGSQLGGELASRAM
DTLGPVIYNLYGSTEVAFATIARPQDLAINPSTVGPVVKGATVKILDDEG
KPVSQGTVGRIFVSNAIPFDGYTGGGHKQIIDGLMSSGDVGYFDEHGLLY
VSGRDDEMIVSGGENVFPAEVEDLISGHPEVIEATALGVDDPEWGARLRA
FVVRHPDSTVDADGIRAYVRDNLARYKVPRDVVFLDVLPRNPSGKILKRE
LRELEV
169631416YP_001705065.1 hypothetical protein MAB_4339c [Mycobacterium abscessus ATCC 19977]MSREHDIVLYGATGYVGKLTALYLAGRVEATGARIALAGRSTEKLAAVRD
ACGPAARDWPLIEADTTRPATLAAMAASTQVVLTTVGPYTKYGLPLVAAC
AEAGTDYADLTGEVNFVRESIDVYGKQAADTGARIVHCCGFDSIPSDLSV
YALYRRAQEDGTGELLDTTYVLSKFRGGVSGGTAASMVEVMEASAEDPEV
RRNAQDPYSLSPDRPAEPEVGRQREFQTLRGESVAPELTGKWLGAFFMGP
VNTRIVRRSNALLDWAYGTRMRYREAMSLGSSVVAPVAAAAVTGALTVGF
GLGTRVPLPKFIAQRVLPKPGTGPSERTRERGHYRVETYTTTTEGVRYRA
IIAQEGDPGYKATAVLLGESGLTLALDRTELPDRLGVLTPAAAMGDPLLE
RLRAARGVTVEVERL
169631415YP_001705064.1 hypothetical protein MAB_4338c [Mycobacterium abscessus ATCC 19977]MSVSVVDPGPQQISRSVEVSAPATELFAIAADPRRHHELDGSGTVGQNIR
TPDHLQVGSRFSTGMRMFGLPYRITSTVTELDPDKVVEWRHPLGHRWRWE
FVALSPTSTRVTETFDFRNAGPIQSLLNYKLPGFVKANAKGIEATLRRLQ
ARYS
169631414YP_001705063.1 alpha/beta fold hydrolase [Mycobacterium abscessus ATCC 19977]MTRNTATETAWRQHEGFFTAGDGTRIGFSDTGNRKAPTTVLFLHGWTQNR
EAWDDVAGPLHERDPELRIIALDHRGHGKSDAAPEGTVNVRQLATDAADF
INAQIPAGQIVIVGHSMGGMTMMGLGEYHPDLVAQRISGAVFVATSAGRL
LHRLRVVPPVFQVVKAVILGVVAQGWFLQQGYLMRPIISTLVFGRDPRPY
DVGRVWDQIRSGTPRSYKDAAESMVLHEDLTEGLSAYRGMPTAVLAGDRD
FLTPAGDSRIIAAALQTNELRTYPGSGHMLPNERSSEVVNEIVTVLEALG
QPAAPVTRESAG
169631413YP_001705062.1 acyl-CoA dehydrogenase FadE [Mycobacterium abscessus ATCC 19977]MPIAINSEHVALADSAHAFVERVVPTELLHETLETPLPWPPPFWKSAADQ
GLTSVHLAESVGGQGFGALELAIVVAEFGRGAVPGPFVPSVIASALISAH
DPDHPLLSDLASGASIATFSSTSSFTATPAGDGLSVDGQARSVLSATSAT
YVVAPVAIDSDRRWVVLSADDVTLDSQQSVDPLRPVAHVTATAVQVPADR
VLSNLTDARATSIISTIVSAEAVGVARWATDTASEYAKVREQFGRPIGQF
QGIKHKCATMAAVTERATAAVWDAARALDDADENPGVVEFAASVAATLAP
AAAQQCAQDCIQVHGGIGYTWEHDAHIYYRRALGLTAALGRSGGAPATVV
RTAVEHGLRKVDIDLAPETEALRAEIRAEVAALKEIPSGKRNTAIAEGGW
VLPYLPTPWGRAASPVEQVIISQEFLTGKVRRPQLGIATWLVPSIVAYGT
EEQKQRFLPPTFRGEMMWCQLFSEPGAGSDLAGLSTKAVKVEGGWRLTGQ
KIWTSVAQFADWGACLARTDPSAPKHNGITYFLVDMKSEGVTVRPLREMT
GGALFNEVFIDDVFVPDELVVGEVNRGWEVSRNTLTAERVSIGSSDLPFL
ASLDDLVAFVGTHDLGEVARDRAGQLIAEGHGVKLLNLRSTLLTLAGGDP
MPSAAVSKLLGMRTGQGYAEFVVNHFGQDGAIGDSEQEQGRWADYLLASR
ATTIYGGTSEVQLNIIAERLLGLPRDP
169631412YP_001705061.1 putative short-chain dehydrogenase/reductase [Mycobacterium abscessMGTAVQLAGKVVAVTGGARGIGRAIATAFAAEGAKVAIGDIDKKLCENTA
AEIGNSAIGLPLDVTDHGSFEAFFDTIAATVGPVDVIVNNAGIMPITPFD
DESLESIQRQLDINVRGVMWGSQLAIKRMKPRGGGVIVNIASAAGKAGFP
GLATYCATKHAVVGLSESLSLEYEPAGISVVCVMPGMVNTELISGLDTHW
LLKTVEPEDIANAVVKAVRRGVFPVFVPKMFGGMYRTMSVLPRSTGKFLT
RKLGIQDFMLNAHGSDARKAYEDRASHSGPSTE
169631411YP_001705060.1 2-hydroxyacid dehydrogenase [Mycobacterium abscessus ATCC 19977]MSLSGENHRVRVLAHFPSGPRVLEQLAPHADWLDVRFCAEDDDNTFYAEL
PGADVLWHVLRPLSADDVAKGERLRLIHKFGAGVNTIALDAAVEHGVAVA
NMPGANAPSVAEGALLLMLAALRQLPRLDRDIRSGNGWPTDQSLGESVRD
IGSCTIGLVGYGNIAKSLEKILLAMGATVLHTSTRDDGTAGWRGLNDLLT
SSDIVSLHLPLTEASTGMLDSAALNRMKPGSVLVNTSRGAVVDEAALVNA
LQQGPLGAAGLDVFAQEPVSPENPLLALPNVVLTPHVTWFTADTMTRYLH
HAIDNCRRIHEGMPLADRVR
169631410YP_001705059.1 hypothetical protein MAB_4333 [Mycobacterium abscessus ATCC 19977]MPTQVTVEREFIGLPSPTAGRGGAGGHPCQGLYHRAAGTKPKVAFIATHY
QIDFSEHYIAEYLARHGYGFLGWNTRFRGFESQFLLDHALVDIGVGVRWL
QEQAGVETVLLLGNSGGGSLMAAYQSQATAPKVKPLEGMRPAEGLDGLLP
AAGYVATAAHLGRPDVLTDWMDASVIDESDPASTDPALDLFNQANGPAYA
PEFVVKYREGQAARNHRITAWALEELARVRAAGFSDRAFTVHRTWADPRM
VDPTLEPTKRPANLCYAGVPVKANRSTFGIGGATTLKNWLGMWSLSHAQT
RAEPHLADVTVPALVINADGDTGVFPSDARRIYGALGATDKSQATIDADH
YFQNPGARQEQADTIAEWASKRW
169631409YP_001705058.1 transcriptional regulator TetR [Mycobacterium abscessus ATCC 19977]MVQPTVRGRQTQAAIDEAARTVIARKGILSTTVADIAAEAGRSTASFYNY
YDSKEAMVAQWAMRFRTEAQERVSAAIRHGRSNKQRARDIATAHWLTWRH
QLAEMISVSQLAMINTEFAEFWNQMCSEPIDFLTTTIKRAQRDGYSPGND
PHLMASAIVSMMNQFAYNQLSQGNSATVDDDACIDTLAGICYRAIYSKEV
C
169631408YP_001705057.1 putative glyoxalase/bleomycin resistance protein [Mycobacterium absMTMIKPNNPNSEFEFGGFNHVALVCSDMERTVDFYSNVLGMPLIKSLDLP
MGQGQHFFFDAGGGDSLAFFWFKDAPDGVPGISAPAAIPGIGDIVSAVSS
MNHISLHVPAEKFDEYRVKLKAKGVRVGPILNHDESEFQVSRELHPGVYV
RSFYFLDPDGITLEFACWTKEFTAADVAVAPKTAAERTPREVATA
169631407YP_001705056.1 TetR family transcriptional regulator [Mycobacterium abscessus ATCCMSSSRVYGGVEAPDRQAERRNRLLDAGLDLLTSGPAPNLTVRGVCKHAGV
VARYFYENFTDLDQLSAEVFDRAIGHVATTTQQAVDAAPLPEKTSAGIAN
LVRVIEGDPRIGTLMFGNNPANSVIAERRQAAWDMFAALSGQHMNKTYQA
TNDETLRAVSYYTVGGVGHTLAAWVSGQLKLPGTELVRVLTELLQPVRR
169631406YP_001705055.1 hypothetical protein MAB_4329c [Mycobacterium abscessus ATCC 19977]MVTIEQVSEAEAQLAGDGGPGTRSRRNEPVPPAAPLSPWWSWRRRPTVAD
NFMGLALLGGPANIIMQLARPGVGYGVVDSKVESGRADLHPIKRARTTFT
FLAVATLGTPEQKAAFRKATNRAHAQVHSQPGDKVQYNAFDPELQKWVAV
CLYKGFVDVYEAFVGPLTGETAERCLQEGAVMGTTLQMPLAMWPKSCAEF
DEYWAQSMDLVHIDDHVRPYLYRIASASIAVPPFMRGPVGAFSRFITTGF
LPQRFRDEMGFAWDPSRERMFRWLLAVLGLAARLLPNGLRRFPFNALMLD
LDWRIRTGRPLV
169631405YP_001705054.1 hypothetical protein MAB_4328c [Mycobacterium abscessus ATCC 19977]MRTDRDNWDINTSVGSTALFVAASRALEATKPAPLAADQYAEVFCRAAGG
EWAELVAGGVPEHPLRSEDFGQYFVSFQGARTRYFDTYFGKAIEAGVKQV
VILASGLDSRAYRLDWAPGTTVFELDQPLVHQFKREALDQHGAEPKAVRA
EISVDLREDWGKALQDKGFDPSEPSAWLVEGLLIYLPADAQERLFESIDQ
LAAPGSFVGIEQMTTYADVVFAMLVAGANESGDQANSDFFSLIYNEQRSE
AATWFRCHGWDSERTELLDYLNFSGRTLPEPSQPAWYMFNSISLVSAVKG
169631404YP_001705053.1 hypothetical protein MAB_4327 [Mycobacterium abscessus ATCC 19977]MTAELSEHIEQPRITPRPAPTARPQLPRPGDLTLRERAMVETSALTDIAL
RTVGALSVMGVVAPSLVIDREFVARERDNLAFYGELAAMGDADLSFPEPE
ITPVVFSRPAGRVAQALAKATVENLDFESPYQTRNPALRDYWKRFPHNSV
ARAQHWRHDDGPRPTLCVIHGFFGSPYLLNGAFFALPWFFRNGYDVLLYT
LPFHGRRAEKYSPFSGAGYFSHGFTGFSESMCQAVHDFRIFVNYLRGTGV
EKIGLTGLSLGGYTTGLISTVERRIDVTIPNVPVVDVKSLLHSWIPAEPT
IKLAARLGHLDQGRLDGALSYSSPLTYQPVVPREQRLIITGLGDRLAPPE
QSEMLWEHWDRCALHWFPGNHILHVNQGDYLRRMTEFLDRHLNV
169631403YP_001705052.1 hypothetical protein MAB_4326c [Mycobacterium abscessus ATCC 19977]MSEAWIEGCPVQRIMFRDGLVISLGDYNEVVIAVPMWLTLPPAGKWPREI
VCVDPKAILDEERPLFSISGSTCTEARWNDAGDLHMEFSDDHVIDVPHHD
FDTAWEIYGKYHGYVASLPRGKVRVVRHDVAEEAGA
169631402YP_001705051.1 hypothetical protein MAB_4325c [Mycobacterium abscessus ATCC 19977]MACASAILTAGAGVSAPPGTAERSAVFDVGLTASVQPAPGALLTQFLANQ
VQNCSLICPFVVQGAVQIPASVLAAPATLVTRLRAGQPVVQALGLTGATV
SGTANEIWTGLIRTDLDQVVPRTQFGTEVIAVGLVRIGEAAITQPGGLPG
ALGQVRSDLFGALNNPPGPEPLPAVHTPLEAAAVRGTEVFWAVAFHGPEQ
LTLIVTRVPNAFLTTLGSTGNVGKAVQAAGEAVATTISESVAPVRDALTK
PIPITPATAAKDEGKAPDVTAAHPRAPAASVELVKTMAPQAKTPVVRLDP
KSNRQASLPRPPALSSRPDPGSAAKIKQPNPMSGLGGAIKKAFGDVGAKK
PAAPGKPAKTDRP
169631401YP_001705050.1 putative acetyltransferase [Mycobacterium abscessus ATCC 19977]MTSHTVPTAQASLSERVDAPDVVEIPSAGADLTWRAATKEDIPALFELWR
AAGAVDHPTSLVMLDELEEEFDDDDFDPALDSVIAVDSLGRVVAFGSATV
KSAHETVVWVALDGTVHPERRGEGIGSSVLRWQEQRGLQHLAESDECLPG
WLASSAEEHAVWTIELFHRNGYESVRWWHELERDLAQPIPDVTLPEGIRI
ETYGPEWSEPTRDAHNEAFRDHWGSQPEAREDWEAAHRLSAFRADLSFVA
VARDAAGQDIVVAYLLSDVNEEEWEANGYSFGFVDLLGVRRDWRGRKLAQ
ALLTHAMRAYRHEGLQRAVLDVDADSPTGAVALYEGLGFSLVNRSISLIK
QF
169631400YP_001705049.1 putative amino acid transporter [Mycobacterium abscessus ATCC 19977MSQRSDALSVGGKGLAGGQIGTFSGAVLGISSVAPGYTLSASLGLLVAAV
GLKMPAILIAGFLPMFLTAYAYRELNAKNPDAGASFTWSSRAFGPYVGWM
AGWGQVVACIIVLSNLAAVAVQFFYLFIAQVSHHLAIADLASNKPVNIAT
TLAIMLVATYVACRGITTGERVQYALVGFQMLMLFGFAGAALWKVGTGAA
PGHLSFDADWFNPFSGLTIGAFVVGVTGSVFAFWGWDTCLTLGEESKDPD
RVPGRAGLLSVTSILLTYLLVAVALTMYAGVGTTGLGLGNPANEENIFGA
LADPVLGPFFGPFLSLAVLASAVAGLQTTFLPLARVMLAMGVYGAVPRRF
AEISPRFLVPRFSTIVSSAVTAVFYTVVTVLSEHTLTDTIAALGIMICWY
YGITAFACIWEFRHTLFRGVRNVVFRFLCPLLGGAMLLVIFAISIRESMD
PANGSGSSIGGIGLVFFLGFGILALGVVLMLVQRAVAPRFFTENTWHTGS
EKVIAETLVPECPEPAKDLRTV
169631399YP_001705048.1 aldehyde dehydrogenase family protein [Mycobacterium abscessus ATCCMTEYAVTDPATGDVVATYPTATDAELDAALTAAAENSRTWPTDTTVADRA
AQMRRVAQLHTEKREMLADIIVREMGKPRDEALGEIDFCAAIYEYYADNA
EKFLADERIELLAGEGTAVIKRFPIGVLLGIMPWNFPYYQVARFACPNLL
VGNTIVLKHAPQCPESAEALALLFAEAGLPAGAYLNIRAANEQVAGLIAD
PRVAGVSFTGSERAGAAVAEIAGRNLKKCVLELGGSDPFLVLSSDDLDAT
VEAAAAARLDNTGQACNAAKRFIVVDELYDAFVEKFTATLLAAADGIAPL
SSVRAAQTLEAQVAAAKAGGATVISAGERRGAFHPPAVITGLTADNPAYG
QELFGPVASVYRASSEDQAVAIANDTPFGLGSYVFTTDPEQAQRVANRIE
AGMVFVNGVGADGAELPFGGIKRSGFGRELGRFGMEEFVNKKLIRTL
169631398YP_001705047.1 putrescine oxidase [Mycobacterium abscessus ATCC 19977]MTEFAVPTTTHSGPAVERDVVVIGAGISGLMTARRLVQAGHSVAVLEARD
RVGGRTWSQIMDGEFFEIGGQWISSDQDALKDLLAELGKKTFRRYREGNS
VYIGQDGERREFTGDFPVPEATLQQVNQLIHALDSLAAEIDAATPWQHPR
AAELDAIPFATWLASNSDDKEARRIVGHYIAAGMFTKPSHSFSVLQAMLM
IASAGKFEHLIDEGILLDERVVGGMQSVSQQIADELGPDVVHLSTRVRHL
AWSDAGDGLPSIVSAVSDRVTVRARFAVLAIPPNLYSTIDYQPPLPRIQQ
VSHQHQSMGLVIKAQAVYETPFWRAHGLSGTGFASRERICEVYDNTVADH
PHGTLVGFVAGEQAEETWALPDDQRRGAILESFAAYFGDEAKRPLAVYLS
DWGTEEFTRGAYGASWSIGGLSRWGHLQNRPVGPIFFASSDIQGIGYMHV
DGGVRIGTDTANRINSALLAPVNS
169631397YP_001705046.1 TetR family transcriptional regulator [Mycobacterium abscessus ATCCMQRDRESDDTARRGRGRPSVGVLNRDRIVDAALAELRASGLRKLTMRAVA
VRLGVTVAALYNHVPSRAGLLVAVQERFTAGLDVSGFGVVPLREALSRWA
WSYLDQLRRRPELVPLIVEVPLAQAPLTSGMYQRVTAGFAAAGWPEESII
ASMSILETFIFGAAVDSPGPTDVYAPYDPANAPQMGRVYEAFARSVRERQ
TRAHDLVFTMGLDAALIGLHHIWGTGRGWAGVRLPVQRQ
169631396YP_001705045.1 hypothetical protein MAB_4319 [Mycobacterium abscessus ATCC 19977]MKFEDVYFSKEDRYSMGTETDSGRHYVSMPVSNGLVDYEEYYEIDAEQYK
LFLANTSAAVSFIEACRKHEHDDRLIQKPGTNRGTPA
169631395YP_001705044.1 hypothetical protein MAB_4318 [Mycobacterium abscessus ATCC 19977]MDADLINEAIVTSIQDSAIPRVDLQKLTDQYGQDEGNQLGEQVVKIVREA
VAMPIDWGTMTLAEGVNDIMGRFSQKHPELSPQALEEIGRCVGWQLR
169631394YP_001705043.1 hypothetical protein MAB_4317 [Mycobacterium abscessus ATCC 19977]MSLPLADIKRAKVQSFRDVADALDGMAGANRDMKRGVERLPIMGDGWKGV
SGEAAHHDLDAHGKYLDGHAQAQQSAAAKIRAAADEFEGVQQLLKKIEND
AAQGKFTINYDTGEVTPPSGKYDKNELDYLTNTLRQISAAGGVANADLEA
AVKAAQTLPDPSGAVAQGLPAMPGSAIKPGGVAAGLEHLAAPDPNGDPGA
TKAAAAGADTQANYKEWYPRTPGSGDKLTIDPSKAGSFTGTVGALEKLPG
APKPADGFGSGVARQFGQGVNSRVDGIIDEAKNLTGQGGPGSPGVAESWA
KFALGTADQMANPLGSLPGEVKDAVNDPAGFAGKKLFDVSSIAATGPLGG
EAAAGARGLLGDLTGAETRALTHDIPDTHHGPAPLDHPSPHVDHPPTDSD
HHAPAVSDHNGGSGGDHSTPGDSPPHFAPLPDTGPYQLPERAQLATPSDG
AFFWSGRNVDGTGIGPISAGGNGAADLIADGSRATTLEGLLDSQGIKPPK
WSPTDDYAQKWWDGTSQMYAESASGEVRAVIGSNLRPGNVWQTVELPRLM
DNPHVNRIVVIDPDTGIETTVFQR
169631393YP_001705042.1 hypothetical protein MAB_4316 [Mycobacterium abscessus ATCC 19977]MGALQVSPELLHRSANEMDRLLAAHRAAHAKAHAAISTAMSGWVGGAASA
LDSESTQWQGHSKHVENEATHYRDAFDRIGYAFAGIEEQSAVNILGSRPQ
AKA
169631392YP_001705041.1 hypothetical protein MAB_4315c [Mycobacterium abscessus ATCC 19977]MEPSGFVSTVKEGLALKLETPYMVAASAIGLLSAWCALPGDEGFRTPFEG
LSKFFTWTGWASPAAWLNTAHQWMSDPSRIGVTHFAFVTLAFLGTLFASY
SRASFASLVGIGGLVETGFATVAWVLPVSFSIAMTLAGWVMRRWNDDLWE
RAWLTWFWMGMALGYCVLALIAFVFGEQKGRARSQPVEVALSWETQRYID
KRLRVFGMPSLIPPVSIPTIAPAVVTSRQLAKDYRKKKIRDTEEIGHVRR
VSDSGKEHSW
169631391YP_001705040.1 hypothetical protein MAB_4314 [Mycobacterium abscessus ATCC 19977]MTGAQRPPDEDVPIRHLFTVVKRNEIPRLENVWILVVAAQNCHFDRPSPK
RGSVYGNGIGILEPRQNDHIQIIHPTVIAVVADRLDHQLEKRFWA
169631390YP_001705039.1 hypothetical protein MAB_4313 [Mycobacterium abscessus ATCC 19977]MAHVTEVLDDRMIGKVAVPQLMDGIEVDDEEVELRRAIGCLLFCLESRTA
CIVARATDNLGIAG
169631389YP_001705038.1 TetR family transcriptional regulator [Mycobacterium abscessus ATCCMNFRRARSEEQREIRRQAILETASSMLSDMPVSQISLNELSRRTGLAKSA
MIRYFESREAVLLELLDGALRDWVTEIVTELSRDTYDGSAQQRADHLAAL
LSRSLREHAVLCDLMTAQPGVLEYNVSPETLLCFRRSAHTTIARYTDAIR
SFIPELGDDSQSVSLSTVVTSAALWMYAQPSASAIAAAEAEPALADISLN
FDTDLETMLSRLIIGALVKRSS
169631388YP_001705037.1 MmpS family protein [Mycobacterium abscessus ATCC 19977]MYRLLKRFWIPLLLVVVVGIGGYAIAQIRGSAAPRPAKLGEGSGITANFN
PKHITYEVVGSGGTANLNYLDENGQPHLIENAPLPWSFTIVTTLPSMSAN
IVAQGDRSVTDLGCRVTVDGQVRDDRSSADKVKPFIYCLVKSV
169631387YP_001705036.1 MmpL family protein [Mycobacterium abscessus ATCC 19977]MSNLHAKPHRPFLGHLIRVLSLPIILFWVALAVILGTVTPSLTDVAASRS
VPLSPQNSESYQGMLNIGKVFQQYDSDSSAMVVLEGDDKLGDSAHQYYDD
IVAKLKADHEHVQNVQDFWSDPLTAAGSQSVDGKAAYVQIFLNGSQGTSA
SHESVAAVRHIVDSVPAPPGIKAHVAGTTVLNADTQVAGHQSMATMELVS
VGVIIVMILFIYRSIVTMLISMVIIGLELFAAQGVTATAGYLNVIGLTPY
AVSMVTMLALAAGTDYVIFLFGRYHEERSKGLSREDAYYVAYHGVSHVIL
GSGLTIVGACLCLTMTTLPYFQSMALPCAISVLVIVAAALTLAPAVLTVA
SKFGLLEPRGKLSTTGWRKVGTSVVRWPIPIIVLTSLIAIIGFVSLMTYV
PQYNDQKFTPADMPANLAMEVADRHFSQARMNPELLMLEADHDLRTPADM
LVIDRVAKGIVHMRGIERVQTITRPLGAPIEHSSIPFLMGAQNAGTLQTA
KFNNENSAQMLEQADELSRTVASMERMYSLMQELTGTMHSMVGRTHEMEA
TIQEMRDNLANFDDFFRPLRNYFYWEKHCFDIPICQSLRSIFDVLDSVDV
LADQMHGLIADMDHMDQLMPQMLPVLRTTIDSMGRMRDFMIATHSTMAGT
QAQQQELAKGATEIGLYFDQAKNDDFFYLPPDVFTNPDFKRGLKMFVSPD
GKAVRFIITHQGDPASVEGIDHVRDLKGVVADAVKGTPLSNAKVSIAGTA
SMYADMQDGVSIDLMIAVIASMILIFAIMVLITRSVVAALVIVGTVAASL
GTACGLSVLLWQDILGLGVQWIVIPLSMVILLAVGSDYNLLVVSRLKEEI
HAGLNTGMIRGMGATGRVVTAAGLVFAFTMMSMIVSDLRVVGQLGMTIGI
GLIVDTLIVRAFMTPSIAAALGRWFWWPINVFEIVRRGRETQAPEPVTAP
LPVVDAGPQPPTAPSTS
169631386YP_001705035.1 putative serine protease [Mycobacterium abscessus ATCC 19977]MIDRSGRPPYTEDFPTTPHGYRLVHGPSAATRTRYAYGETFPDRDALAPN
RLPRKRLRVAGMTFGAVAVAVVASATTAFAVVNHSGPAAPAGQVAAPVAG
KPSPATGSTLGRPAATGAAGSVEEVSAKVLPSVVQLQIQSGRQQESGSGI
VLSADGLILTNNHVVASAAPGAQPSAPVTEPDSPFGGQFGSLPPGIFPGE
QQPGGYRDGRDGRDSDDYDGRGVRPSARTGDGVKATVTLSDGRTVPFTVV
GADPDDDIAVVRAQGVNDLTPISIGSSKDLKVGQNVVAVGSPLGLQGTVT
TGIISALNRPVATGDDQSGQRSVMSAIQTDAAINPGNSGGALVDMSGNLI
GVNSAIASLSGGQDSQGGGQAGSIGLGFAIPVDQAKRIADELVSTGTVRH
ASLGVQLASSKDAPGAVVAGIVRGSAAATAGLPKGAVITKVDNQVIDGPD
ALVAAVRAKAPGDTMALTYQDPSGDARTVQVTLGQSEA
169631385YP_001705034.1 hypothetical protein MAB_4308c [Mycobacterium abscessus ATCC 19977]MSTVHGVIVTDRPERYAKQLAQHWAAKSTVTELENDAVQIEMGPGAVTVL
RPKPGELHVEASSPEFGDVVKRHLERFGTRDELTLTWIGD
169631384YP_001705033.1 arylsulfatase AtsA [Mycobacterium abscessus ATCC 19977]MHIPGDDAPEPEQNAERGRLTRRSMLGGIAAAGMGVAAASALVAGCDDDS
SSRTDRSSAAEEANAGFNGKIELDVRDSKPDWTPYELKHAPDGAPNVLVV
LFDDTGMATWSPYGGRVNMPTLQRLADNGLTYSQWHTTALCSPTRSCLLT
GRNHHVNRFASITEGSDGYPGAAGRLPAQCATIGQVLQDNGYSTFWVGKN
HNVPQEDVSCGGSKSEWPLQKGFDRYYGFLGGETNNWYPDLVEDNRFIEQ
PTSPEQGYHLSKDLADQALRMLRDQRNTNPSKPWYMWFCPGANHAPHHSP
AEYADKYRGKFDDGYEAYREWVLARMIDKGIMPRETKLTPINPLPNDVAV
EADSVRPWNTLNPDEKRLFSRMAEVFAGFSEYTDAQVGRVIDYLEQTGQL
DNTVVFYCADNGASGEGSPNGSVNENKFFNGYPDDLAENMKYIDRLGTPD
TYNHYPTGWAVAFSTPFQMFKRYSQFSGGTCDPLVIHWPKGIKAKGEVRH
QYHHVTDIVPTILDVAGLTMPETYRGVDQFPVNGVSMRYTFDDKDAATTK
KRQYYAMLGTRGIWEDGWKASALHAPISGKGHFDQDKWELFHVDEDRSES
TDLADQHPDKLKALIDAWFEEADNNFVLPLDDRLPTELLTIERPQFEPRR
NRYLYYPDASPVPEGVAVNIRGKSYKIVANTDISAQAQGVIFAHGSRFGG
HVLFIKDGRLHYVYNFLGIKPEQEFISAPLTPGNRTLGVEFVRRDKGQYG
ESLGTTNLYVDGKLAATGPMRTQVGTFTLAGDGLCVGYDSGDNVSPQYTN
PGRFTGGTIKVVAVDVSDESFIDLEKEAQAAFARD
169631383YP_001705032.1 putative transglutaminase-like protein [Mycobacterium abscessus ATCMKRDIRAQLDVDILEPSTLEFQVAVSPLTGAEVSEELSLELNGRRVEAQE
VAGEHGNRIHRLPAERGNLKVSYTATILGQADEVPVEAADLSTYLRPSRY
AEADKFFGFAAAEFGEHTDPAVLLEKVSSWVGARLTYSPGSSDPIDGAVD
TLLSGAGVCRDYAHLVVALLRAVKVPARLVAVYAPGCDPMDFHAVAEAVV
DNRWRVVDATCLAPRQTMVRITTGRDAADTAFLDNHGGQIVLNESIVAAV
VDGELPEDHIDHLVSMR
169631382YP_001705031.1 hypothetical protein MAB_4305 [Mycobacterium abscessus ATCC 19977]MEYSPRNRKLREMETAAVTLTELVELPGGSFPMGCNVFYPEEMPERVSSV
EPFAIERHPVTNAQFAEFVTQTGYVTVAERAPDPDMYPGASPDDLVPGAM
TFRTTAGPVDLHDWQQWWDWVPGAYWRHPFGPGSDIDGAAEHPVVQVAYT
DAAAYARWAGRRLPTEAEWEYAARGGSGTVYAWGDEVAPEGRLMANTWQG
RFPYRNDGALGWHGTSPVGTFPANDFGLLDMIGNVWEWTSTRFQHGAGAP
KSCCSPSDNPDPSVIQVLKGGSHLCAPEYCHRYRPAARSPQSQDSATTHI
GFRCVENLG
169631381YP_001705030.1 alpha galactosidase [Mycobacterium abscessus ATCC 19977]MSRGRRALILIMLAVIGIVATVSSVHIFRRQPQPGPAIAGLASTPPLGWN
SWNVFGCNIDEQRIERTAQAMVSSGMRDAGYRYVVVDDCWFDPRRNASGE
LRANPARFPHGMKAVADFVHARGLLFGIYASPGEATCAQNGGSYPGRTGS
RGHEIQDAQTFARWGVDYVKYDWCGPPADVDELVDSFTIMRDALRATGRP
ILYSINPNSGTVIPPSRYDSFTGVATMTRVSQDLVPAWGAIDAYDTSLGV
VDALANAAGPGFRCTPQPGFFCDYDMLVAGAPQVAGIDLPPLNTAESRAQ
LALWAEWGSPLIAGNDLTHMPEDIRALLINRDLLAIDQDSLRASATALAG
SGGTIWTRPLGDGSTAIVIVNRDDVAQPFRAAFSALGLPKARRFDVLDVF
SGQRSVQQLTYRTSLAAHDARLLRVRAIGDQ
169631380YP_001705029.1 hypothetical protein MAB_4302 [Mycobacterium abscessus ATCC 19977]MPEATSARTLEQTPTHPEYGVMSSQGDTGPRDPVGDDSTGPGWGAAALIG
FRFGTCYFGAFGLVVAVGLIPVVLKGAGVDGPWSVIREIFHAARGPIAWI
GEHLLGLRVQSAQVGSDSAFQWTALFCIACLALVATAIWTVLDRDRRRYD
RLQPWVWAVLRLVLAAAMFYFGMAKVIPTQMPFVLNRLVEPYGNFSPTGV
LWAQVGISPAYQMVLGLAEVFGGLLLLLPRTTAAGALVCVVDLTQVFLLN
MTYDIRLKTVSSQLLLLSLFLLAPYARRLLTAFFTDRAVPAAATTQLFTR
PRANRIALIAQVCLGVALLAAFGAQGWQQFTRPTPNLYGIWQVETFSAEG
YSRDPLLTDKIRWRRVIFDRPFHVSAPVMVTVQRMDDSFEVYGGTIDPRR
HFIDLSHRIELGTYKETPTRIRLTYWWPGQPDQMIVDGDDYAGHKIHLRV
TRMDPASFPLVERGFNWVQEMPYNR
169631379YP_001705028.1 hypothetical protein MAB_4301c [Mycobacterium abscessus ATCC 19977]MACACALSFPAAAHADDKTVTYEVVSTTVSTANVQYWDGTEMQPADGVTL
PWKVDATVGDISRGAKTPNHAEVKANWSASADPDSAVTVRIYLNDKVVCQ
SVTGTGETDCNYATFSTYLDTAPPKA
169631378YP_001705027.1 alpha/beta fold hydrolase [Mycobacterium abscessus ATCC 19977]MDAELEEWKAAGHYFDYLGFDIFYRVEGSGPPLLLIHGYPFNSWDWALIW
PTLVERFTVIAPDMIGMGFSDKPVQYGYSVLDHADMHEALLSYLGIERFH
LLTHDLGNSVGQEMLARFEFEQQSRGRVPIDSVTWLNGGLFIEAYRPRIA
QTLMSRTPLGDLVSRFQGTPVTRRIMDAAVSEMFGPDTKPSPRLLSLFQQ
VLEYNDGARVTHQVGRFINDRYDNRSRWVRAMRETAVPMRMIDGPIDPNS
GLHMAERYLEVIHDPDVVLLDDNIGHWPQIEAPEAVLTHFLEHIDRITP
169631377YP_001705026.1 hypothetical protein MAB_4299c [Mycobacterium abscessus ATCC 19977]MFRLLTLPCAALLALATVLLAAPAGAEPFVPWFAQSVGNATQVIAVNGAG
GSNAKIDVFQRNGSQWQTVSTGIPAHVGSAGFIDKAKEGASATPNGVYSL
DWAFGTAPPPPSGLRYLQVGPNDWWDGDSNSPTYNTHQQCAKAECPFNTA
QSENLPIPQYKHAIVMGVNKDRVPGGGSAFFVHSTDGGPTAGCVSLDDAT
LVKLIGWLRPGAVIAIKG
169631376YP_001705025.1 hypothetical protein MAB_4298c [Mycobacterium abscessus ATCC 19977]MRPIRLLPLSLVLLAGACGATPVQPVAAVLPAPPPPWFADSVGAARQVVE
VQGRGGTKAVIGTWQRKGDAWEPVERDLPSDVGSAGFTDVSSDDNPATPT
GVFSLDYAFGTEPSVAHGLDYLQVDADDWWDGDPASPHYNTHQRCAESAC
TFDTSLSEELDGYPRAIVMGVNKSRVPGAGSAFFVHATDGGPSAGCVTLD
DAALVRLIGWLRPGAVIAIRR
169631375YP_001705024.1 deoxycytidine triphosphate deaminase [Mycobacterium abscessus ATCC MLLSDRDIRAELDAGRLGIEPLDAALIQPSSIDVRLDSLFRVFNNTRYTH
IDPKERQDELTSLVEPAEGEPFVLHPGEFVLGSTLEVCSLPDDLAGRLEG
KSSLGRLGLLTHSTAGFIDPGFSGHITLELSNVANLPITLWPGMKIGQLC
LLRLTSPAEHPYGSAGVGSKYQGQRGPTPSRSYQNFINP
169631374YP_001705023.1 hypothetical protein MAB_4296c [Mycobacterium abscessus ATCC 19977]MDVVLGVSMTPTTARLVLVEGAGADGRIVDTDTIVVSEGEGTTSEQVLSA
IVGTRDGMLDGGHNLVSTGVVWSDHAEAAELRDSLASRGIDGVEFFSALH
AGGALAKAASSVTGYDKSALLVIEPQTATLAVVDSADGSIVGLASEPLIT
GVTSGVLANLVNPLKGKENAPDGVFLLGLGTDVSDLAESLGDAIALPVNS
PDQPELALARGAALASAQEPDFEASTALLGQAYSLEGPTGTGFAHPDAVT
ESAGEANTELREFEDFDDQPAERKPFLLVGAPLLLVFGICSIALAVSLTV
TVRSTVDQGPSSPDRGVVQNPLPAEAPKQAAPPPSPVEAPAPAVSPAPVQ
QVVAPAPQHNPAPAPKQVAPAPVQAAPQAPAPAPEAPAPAAPAPVPEEQP
APVAPPPAVVPVPIPLFPPVWEPPRRQENPWWPDRDRPRYTPPAQTQQPP
IISIPGLPPIGGGDSDRGSHGGSRGGSGRGGWGDDGDSRGGSDSGSRGGW
GDNGGSRGGWGDSGSSRGGSDSGSRGGWGGNSGSHGGGSGGGSNSGFPWP
FGGR
169631373YP_001705022.1 UDP-glucose 6-dehydrogenase UdgA [Mycobacterium abscessus ATCC 1997MRCTVFGTGYLGATHAACMAELGHEVLGVDIDPGKVAKLSSGDIPFYEPG
LRKILQSNIASGRLRFTTSYAEAAEFADVHFLGVGTPQKKGEYGADLRHV
HSVIDTLVPLLSRSAVIIGKSTVPVGTARELGQRAAGFAAAGVDVEVAWN
PEFLREGYAVKDTLHPDRIVLGVQRDSDRAEKLVRELYGPILDEEVPFLV
TDLETAELVKVSANAFLATKISFINAISEVCEAVGADVTTLADALGYDPR
IGRRFLNAGLGFGGGCLPKDIRAFMARAGELGASHALTFLREVDSINMRR
RTRMVELATKACGGSLLGANVAVLGAAFKPESDDVRDSPALNVAGLLQLN
GAAVNVYDPKALENSRRLFPTLNYATSVLEAADRADAVLLLTEWQEFVDF
DPDALAKVVRTKVIVDGRNCLDAAKWVNAGWRVFCLGKRVEELAHT
169631372YP_001705021.1 aminotransferase AlaT [Mycobacterium abscessus ATCC 19977]MSTDNLPIDVPPRVPGLSPRQHQRVFAQSTKLQDVLYEIRGPVHAHAARL
EAEGHRILKLNIGNPAPFGFEAPDVIMRDIIQALPYAQGYSDSKGILPAR
RAVVTRYELVDGFPYLDVDDVFLGNGVSELITMTTQALLDNGDQVLIPAP
DYPLWTAATSLAGGTAVHYLCDETNGWMPDIEDLESKITERTKALVIINP
NNPTGAVYSREILTKMVELARKHQLLLLADEIYDKILYDDAEHISVASLA
PDLLCFTFNGLSKAYRVAGYRSAWLAITGPKDHAASLLEGVNLLANMRLC
PNVPAQHAIQVALGGHQSIEDLVLPGGRLLEQRDVAWTKLNEIPGVSCVK
PQGALYAFPRLDPEVHHIHDDDQLVLDLLLNEKILLTQGTGFNWPEPDHL
RIVTLPWARDLAVAIERLGNFLASYRQ
169631371YP_001705020.1 putative Fe-S oxidoreductase [Mycobacterium abscessus ATCC 19977]MSTATITLGIIGVIFSLVAWGSFFGGVVKMVRVILSGQPDRTRFRPFLPR
LKQLIVEVVAHTRMNKFRTVGWAHWLVMVGFLGGFPLYFESYGQTFNPEF
HWPIIGDTFLWHLWDELLGIGTVIGIVTLIIIRQLNHPRKPERLSRFGGS
NFFAAYTIEMIVLVEGLGMVLVKSGKIATFHNSHPSSDFFTMNVAQLLPE
SPIMVSVFAFIKMMSGGLFLLLVGRKLVWGVAWHRFAAFFNIYFKRNADG
SVALGAAKPMMSGGKVLEMESADPDVDAFGAGKVEDFSWKDLLDVTTCTE
CGRCQSQCPAWNTGKPLSPKLLITSLRDHTYAKAPYLLAGEDKSKLSEAE
IAEGERQLVGGEGAVIDHEVLWSCTTCGACVEQCPVDIEHVDHIIDMRRY
QVLIESEFPGELAGLFKNLENKGNPWGQNAKDRLNWIEEVDFDVPVFGQD
VDSFADFEYLFWVGCAGAYEDRAKKTTKAVAELLALAGTKFLVLGADETC
TGDSARRAGNEFLFQQLAMQNIELLNSVFEGVEQKQRKIVVTCAHCFNAL
GNEYPQVGGDYQVVHHTQLLNRLVRDKKLVPVAPVSQDVTYHDPCYLGRH
NKVYTAPRELIGASGAAITEMPRHGERSMCCGAGGARMWMEEQLGKRINI
DRVDEALSTPASKIATGCPFCRVMLTDGVTARDDSAAVEVVDVAQLLLES
VGRTEDIRKALPAKGTAAAAAAERAATKTAEPEPVVAEEEAPATTKAEAA
APAAEAKPVSGLGMATGAKRPGAKKTAAENSTAEASTATPTAEAAPAAPV
KGLGMAAGAKRPGAKKATAETSAATPPAASASPPASQAPAAAAAPAPPVK
GLGMAAGAKRPGAKKTAPAAPAAPAPEAAAVPSESEAPTATETSAVAEPP
VKGLGIAAGARRPGAKKAAPATESAPEPAQPATAPEPTEPATSAPKDEAP
ETSSTPEPPVKGLGIAPGARRPGRRN
169631370YP_001705019.1 LuxR family transcriptional regulator [Mycobacterium abscessus ATCCMSGTFDGIASAITAITGPLSAGHAVKVLVNGTAGSGKTFVLSRIREALGS
AGTPAVNHVPEAAPGPNTGPFVIDDADSLTDRQLETLRAVVENDPAAIIV
VAAAPRRNPALRSLFQALERESPAITLGPVNATDIGRMSPLAAPFAEQIA
AASGGVLALTAAAVERLGDPDPLQSALRAIDTRVDELLRRLSPMAQAAVL
LMSLNPGIGASDVAAALALPDAADLVDEALASGLIAGPGHVAFAARVHGC
AARLLGAARHLDLERSLLRTQLEMGSVSADLALALVGHGLRDLEVARLLS
NWATTESDPLSAADLYRAALTAGAEPDPIRVPLAESLARAGDLAAAAAQA
DEVLASTDPAQRTAGVRVAAAIACHNGDSGQAAALYSWLGADMDGLTALS
ASPVFVGTGQLAKGRKSLEDNVGAPPTTSATAQRNAALGVIASVEGRGQE
ALSLLGQAVTQQPSTSSFIPDSTVALAALTMLHSGDTARARSILTGAIRA
DRRHDVFGVRHRLLAAWIAMLSGDLSGAVQWLPGAQVELSRRDRLFAESL
RTGIARRHGDTGPLRQHWQASMDALSAYSIDLYTLLPVGELWVAAARLRT
LDVMTHHLDRAFAVLAHLGDPIAWSAPLRWAGVHAAILTNSPETLAPHGQ
ALAAGAGSSTYARILATAGRTWLRVLANHVDGEEVDSAARMLADTGLGWD
ATRLASQAALHANDPKVAASMLALARDLRSPSAAADGESTPSSAVHSPTS
TRLSEREREVAELLLRGLPYRDIGAQLFISAKTVEHHVARIRRRLGAESR
SDMFSMLRAILTP
169631369YP_001705018.1 hypothetical protein MAB_4291 [Mycobacterium abscessus ATCC 19977]MANALGLSIGATQLVATPDDPQSQPVVRSSILTLHEDGPPEVGVPSQPGL
TLTGFVGRVGDPVGIVAADGSVHRAEWALTEAMRVLIADAVSSANFTAPP
VLSASIPAHWSPQTVSTLRDAIDRVPAFAPGGRQLKLIPDARAALEALAA
GPGTPDRGVVVVCDLGGSGSSITLADAARGFQQIGQTIRFADFSGQQIDQ
MLLTQVLTDLNQDPEGTTSVGALTRLRDQCRLAKERLSGDTATSVPVQLP
GITTDVRLTRAELEGHLRGPLSNLINAIQDTVERNGIHPANITAVASVGG
GASIPLVTQQLSERMRVPVITAPQPQLAAARGVALLATRPDLPPQDATAM
RPVEQPPGDATMMRPVPTGTGTFAAPVAAAANEEPELAWSQDDSAPDLAP
LQETGYQSGYTVDLDDEYQGPTEATTARPELRFSHGPYADEDDYDDYPPL
PWYRRPLVWFIAAAAVAGIAFTGMMVSLTSSESPAPATTTPSVNVVPSTG
DAPAEPPPSPEPPPPPQTHTVTQSVQPPPPSPEPPPPPPPTTTTTTTPPT
TTTTTTTTTTTTTTTTTTPTTTTTQPTTTTTQPTSTSRPAITIPGLPPIP
IGPRN
169631368YP_001705017.1 hypothetical protein MAB_4290c [Mycobacterium abscessus ATCC 19977]MGNNLLDFVMALVRDQDMAAQYAANPERVIADAHLDGVQPSDVSALIPVV
SESMPSISQLAAHPVASGLAHATIPADNIWASGAAVSAFDSPFTAPTHDP
SLDAGLHAATDAVSDLSPRQDAITVPDQSTAPTDSAVAAIDQFQAPPQST
DGGFEPQQFGADAGVTGSADPGLHDPFFDQGDLGHHPGIGHDPGIDHF
169631367YP_001705016.1 hypothetical protein MAB_4289 [Mycobacterium abscessus ATCC 19977]MRPRHGTCSQTNEGALINPQHAARLLGWMIPTGARLVFGVIFLLEGTQKV
FGWWSGSPTGSGHPEPFLNWPYWWAGVFELVLGSLLTVGLRTRLAAVLAA
GMMAYAYFFEHLQVHWEPMQNGGAFAATFCWGLLLLAVTANDTRLSLDRV
LARRA
169631366YP_001705015.1 hypothetical protein MAB_4288 [Mycobacterium abscessus ATCC 19977]MTVALVLMAGAALIGVAGPACLGPTVRPSLLPAAALATWLGALLAFLVLT
TLSATLLLFPHVLDTSGVRTLVGGCLSGTVPHSSFGTLVQLGISLLPLTI
LARVAVVAIRSLRSARRRRARHFWMLRAASCRSGEVHWIDDPRPIAYSLG
GARGAVVATHGVRHLGERQCAAVIEHEMAHIRGRHHAAVLCADIAAAALP
MLPLMRRAPAMVRLMVELAADDAAARVHGPPTVHAALLAMSQSAVAVPGV
LHMSSESVAVRLLWLRTQGATGRTPMGRTRLMLGFALLPTTLAGSAVVAL
FRAYCTL
169631365YP_001705014.1 putative penicillinase repressor [Mycobacterium abscessus ATCC 1997MRDMFGLGEREATIMELLWSAAEPVTVRDVLDRLERPLAYTTVMTVLDNL
HNKGHVTREKVGRAFQYRAAETREAAAARMVREVLAASGDAEGVLLHFAG
ATSPEESTVLRRILRRGGLA
169631364YP_001705013.1 putative integral membrane cytochrome c biogenesis protein [MycobacMIDVGVLGALLGGVLTLVSPCSALLLPSFFAYSFDRTGLLLRSTGLFYLG
MLTVLAPLGAGVGAIGALLTEYRSQVTTTGGLLMTTLGVAIIAGIGFRVG
PAARLSARLDLSSGLSVLLLGTVYALAGFCSGPILGSVLTVAAIGSSPIY
GALLMSLYSLGMAAPLFVLAFAWGKLGLSQRRWIRGRELRIGRFRTHSTN
LVSGGMFIAIGVFFLATDGTAALGGLTGSDTQYDVQARLQSLTAGLPNAA
VALGIACAAFVVVLMRLLRARITAAGDARKRSDSTREDADDRR
169631363YP_001705012.1 hypothetical protein MAB_4285 [Mycobacterium abscessus ATCC 19977]MRRSENGKRDIWIAGILGVVIVALATYLLVDHRSQSTASTDSPTVTGHSS
SLARLRPLDPLALGPVDAPVVLIIYSDYRCPFCAKFSRDTEPQLIERYVN
TGKLRIEWRDLPIFGTQSVQAAKAGRAAAEQGRFWEFNRAVYRHAPDRGH
AELTDKILLDRAREAEVPDLARFQTAVESDRLLPAVQQDIQEAVAIGAAS
TPVFLINDQPVVGAQPLDVFISVIEQAQR
169631362YP_001705011.1 hypothetical protein MAB_4284c [Mycobacterium abscessus ATCC 19977]MSIIDFILNLFRDPVEAASYVADPEAALANAGLSAVSAAQVGAVMPVVAE
SVASNYGYQSQWVNTGNPIHDLSGNLQNYYAAQPDGPSILSPSLLSPRDN
DFLSHNDTDFASHNPIASGNQVMSPSGNVDSFNRGPLLDLSFGDLQFGNR
DTTAIGDGAVAVGGSNSGPIASGQGSTAVNGDVRDSNIINADHGSNVGVD
QSQTRVGGDYTNVSGHGSADIDKSVTVVDDHSQRNTTNINDSFNTDRSTN
IGSGNTTNTEIGSHNQANIGTSTSAGGSAAVGGNAGLAGNAGLAGNAGLA
GNAGLAGNAGLAGNAGLAGNAGLAGNAGLAGNAGLAGNAGLAGNAGLAGN
AGLAGNAGLAGNAGLAGNAGLAGNAGLAGNAGLAGNAGLAGNAGLAGNAG
LAGNAGLAGNAAVAGNAAVAGNAAVAGNAAVGGVLNTGVSGAIGGSSHVG
GAINESLGGSGSVGGSTAVGGGAHTGVGGGVSTGVGVGSHVGGGISESLG
GSGSVGGSTAVGGGAHTGVGGGVSTGVGVGSHVGGGISESLGGSGSVGGS
TAVGGGAHTGVGGGVNTGVGVGSHVGGGISESLGGSGSVGGSTAVGGGAH
TSAINDALGGSGSVGGSTAVGGGAHTSAINESMNSSINASHSSSMNESFG
SSMGSHGAAGTGFEAQGHAQGHASETAHTTLPGAEHH
169631361YP_001705010.1 hypothetical protein MAB_4283c [Mycobacterium abscessus ATCC 19977]MSDTAQDGQQQLALINELLGHVRKIAGENDRGDLIDRLDRADQLLVDRPL
RVVVAGQLKQGKSQLVNSLLNMPVARVGDDETTSVTTVIGYGEQPSAALV
VAPAEQYDGGGLAGEPEIIPIPVADIGKDLKRAPQAQGREVLRVEVKVAS
PILKSGLCLVDTPGVGGFGQPHLSSTLGLLPDADVMLMVSDLSSEFTEPE
LVFIQQALDLCPVAAIVNTKTDLYPHWRAVVAANSAHLQRAKIAVPAIAV
SSALRSHALQLNDKELNTESNFPALVTFLSNAIADQQASTRQQAIAEIGS
ASEHLTLTLEAELSALQDPQSRDELTSDLERRKREAEEALAHTALWQQVL
GDGITDVSTDVEHDLQSRFRRILQRTEEVIDRTDPTKNWAEVGAKLEQAV
ANSVGNNFVWAHQRAMHLAAQVAETFAIDGLESIKMPRLRASEMGADLSD
LKSLSKLEAKQIKLGHKAITGLRGSYGGVIMFGMLTSVAGLGMFNLISLG
AGAMLGKKTYNEDMENRMLRIRGEAKTNVRRFLDDVSFVVLKESRDRLRL
VQRQLRDHFREIANQTTRSLNESLQAAIASARLEAEDRDARTNEVERQLH
ILRQVNSHVEGLQPADEQVGRRATRDV
169631360YP_001705009.1 isoniazid inductible gene protein IniC [Mycobacterium abscessus ATCMSSVVQARVIISDAMRAYQNDSRYLRVAEPHDELRRIAARLDEPIRVAIA
GTLNAGKSTLVNALVGEDIAPTDATEATRIVAWFRHGAAPRVTANLFSGV
RQDIPIRREGGLSFELDRLDPASVADLDVNWPAPELNEITLIDTPGTSSL
STDVSERSLALLVPEDGVPRVDAVIFLLRSLNAADIGLLTQIGKLVGGER
GGAVGVVGVVSRADEIGVGRLDAMLSAREVAARFAGEMERTGICQAVVPV
AGLLALTARTLRQAEFVALQRLAELDPQVLAKALLSVDRFVREDDSLPVD
AQTRAALLHRFGMFGIRISVAVMRVGVTDATGLAEELLERSGLVELHNII
ANQFGQRAGILKSHTALLSARRVLTTYPVHGGRRVIDDIDPLLADTHAFD
ELRLLAELSSRSTTLTEHETMLIRRLLGSFGTDAAARLGLDETRSDPRRA
ALDAVGRWRARAEHPLNDPFTSRLCLAAVRSAEGILTQLSAHDRPAY
169631359YP_001705008.1 hypothetical protein MAB_4281c [Mycobacterium abscessus ATCC 19977]MMMRLFVATLALVAGFSTATAAAEPTPSPAGPASKPVPAGVWISPAEIPM
NSDYHWSAVSPTATGRAAFLSMRLCGSPSADVLPPASAIATQAASGIAAS
VVQAAGQWPEGNTEGASAFQSGIRSQLNYCPGVGDVISVDLRPAPSWYGF
AATLLVGKERDNPTSEVHIYNVVPPESGTVSELAVTVPRTGREPSPWKPV
DDATVLRALAQPLCKGSC
169631358YP_001705007.1 hypothetical protein MAB_4280c [Mycobacterium abscessus ATCC 19977]MRGWLRTISALVVIAGLGAAVPAAAEPKSLPDSVWINPRDIPLDRASHWA
PLSRGAAPVDRPAFWSANLCFSLGESLPQSPESASATVSSDESGWTAVEV
VAHWPGEAAVTDQYASTVYRSLRGRLDHCFNAIGAQVSVTELTNGHAATV
TLPAQGGKQPQYHLYVVQPPGTGTVAELTVTNAITGAAGASWVEADDHQV
LRDLAAPICRTAKSTAC
169631357YP_001705006.1 hypothetical protein MAB_4279 [Mycobacterium abscessus ATCC 19977]MSYPEPPEDPTMFNQQYHDQEPDQPNPWYKQPAVLIALAGAGVAVVAVIA
ALIITRSDDKPAPAGNTSSVSSTTSSTPADSGGGGHEGHGGHSGGGNTTV
TETQTVPESPTSQDTTTTEPTTTTTTTTEPTTTTTQPTTTTTQPTTSTRP
SVVVPIPGGGNIQVPVGGQ
169631356YP_001705005.1 hypothetical protein MAB_4278 [Mycobacterium abscessus ATCC 19977]MSQTPKPPEDESYFSEMIEESEKPAPWYRTGPAIVGTIAAIIAIVAVLMT
IVLSTDKRVVRDNTPLTSTPSVSSTAPTVQLTSPSESSTAVPTATEAPSE
PAAPVQTSEPTYYETPTSTIYRYPIPAIPSPPPIPPIPAIPQIPQIPQIP
QIPGL
169631355YP_001705004.1 luciferase-like monooxygenase superfamily protein [Mycobacterium abMDFRVFVEPQQGATYSDQLRVAQAAEELGFSAFFRSDHYLAMGGADGLPG
PTDAWVTLGAIARETTAIRLGTLVTSATFRHPGPLAVTVAQVDEMSSGRV
DFGLGAGWFSEEHEAYAIPFPSLGERFDRLEEQLEILTGLWTTPTGDTYS
YAGKHYTVTDSPALPKPVQEPHPPIVIGGLGVKRTPALAARFATEFNLPF
QPVDVITDQYARVAHAVEAAGRPADSMTYSAAFALCIGDTDADIARRAAN
IGREVEEITENSPLAGTPDAVAEKLSIYVDAGVQRVYVQLLDIRDLDHLE
FFASTVIPQFS
169631354YP_001705003.1 lipoprotein DsbF [Mycobacterium abscessus ATCC 19977]MAVLALALSVGLSGCSGTEKGETSSAPSSRLLNFTAQTIDGADFAGSSLA
GKKAVLWFWAPWCPTCQKEAPDLQKAATAHSDVTFVGVAAQDQVPAMRDF
VTKYGLTFIQLADTDAKVWALYDVTHQPAFAFLGAEGKAEVVKSPLSGPE
LDKKIGQLH
169631353YP_001705002.1 hypothetical protein MAB_4275c [Mycobacterium abscessus ATCC 19977]MIDTAALTFALGAGLVAALNPCGFAFLPGYLGLVIAGSDGTASRMTAIAR
AATATVAMAGGFLTVFGVFGLVVSPVVASAGRYMPFATVVIGVVLVALSI
WLLCGRELTLVLPRVSGGAPTASLLSMFGYGLTYAVASLSCTVGPFLAVI
STTFKQGSIVSGVLAFIAYGAGMAVTVGVAALAVALLGNSVQATMRKVLP
YVGRIAGVIVLLTGLYVAYYGYYEIRLNFGDGSADDPVINAAGTVQAWLV
GVVDATGVWPLTGGIALIVAVAAASSYAVRKGR
169631352YP_001705001.1 hypothetical protein MAB_4274c [Mycobacterium abscessus ATCC 19977]MMARIRIKSGMAPVLALAAAAVLVGCQDEQPMRRISTDGSSTSAGTSSSS
VPQSTTPAKPVRTPATDEAAIRALFERERQANENYDIDALVDVSCAQYKE
ATRAAMMKAVQPMSSLKKPEPLNDPAAVKQLASRLQEMHPKMSSQTAQEL
ATAWGRQDEAAFDAGQRKMLAEITVVQDWKVENIKVMGDTATADVTMTTA
FDQYPPQTQNNHVPLLIENGEWKDCFPPPQG
169631351YP_001705000.1 molecular chaperone DnaK [Mycobacterium abscessus ATCC 19977]MARAVGIDLGTTNSVVAVLEGGDPVVVANSEGSRTTPSVVAFARNGEVLV
GQPAKNQAVTNVDRTIRSVKRHMGTDWTVEIDGKNYTPQEISARTLQKLK
RDAEAYLGEDITDAVITVPAYFNDAQRQATKEAGQIAGLNVLRIVNEPTA
AALAYGLDKGEKEQTILVFDLGGGTFDVSLLEIGDGVVEVRATSGDNHLG
GDDWDERIVTWLVDKFKASAGIDLTKDKMAMQRLREAAEKAKIELSSSQS
TSINLPYITVDADKNPLFLDEQLTRAEFQKITQDLLDRTRKPFQSVIKDA
GVSVSDIDHVVLVGGSTRMPAVTDLVKELTGGKEPNKGVNPDEVVAVGAA
LQAGVLKGEVKDVLLLDVTPLSLGIETKGGVMTKLIERNTTIPTKRSETF
TTADDNQPSVQIQVYQGEREIASHNKLLGSFELTGIPPAPRGVPQIEVTF
DIDANGIVHVTAKDKGTGKENTIKIQEGSGLSKEEIDRMIKDAEAHADED
KKRREEADVRNQAESLVYQTEKFVKEQREPAEGSEKVVSDETLSKVDEAI
SEAKKALEGTDIGAIKAAMEKLGEQSQALGQAIYEAAAAKAQADGAEGGA
GSADSDVVDAEVVDEEKDSK
169631350YP_001704999.1 protein GrpE [Mycobacterium abscessus ATCC 19977]MTSTGGQDREEEREPVTVTDKRRIDPNTGAVREEAKAAESKAATAEPGAS
ASGAAGSATSGPAAAASEGGSDADVKVAELTADLQRAHADFANYRKRVER
DRQAVIDSAKASVVTQLLGVLDDLDRAREHGDLESGPLRSVSDKLTAALE
GLGLATFGAEGDDFDPSLHEAVQHDGQDGHPVLAAVLRKGYKLGDRVLRT
AMVVVTDGDTAQQEPGTGDAETKSETESE
169631349YP_001704998.1 chaperone protein DnaJ [Mycobacterium abscessus ATCC 19977]MTQREWVEKDFYKELGVSSTATQDEIKKAARKLLAENHPDRNPGNQAAED
RYKAVSEAKDVLSDPAKRKEYDETRRLFAGGGFGRRFGDNGFGGGGFSGG
SNSAEFNLNDLFGNADTSGGGGIGDLFGGLFGQRAQPRASRPRRGNDLET
ETQLDFVEACKGVSVPLRLTSPAPCTTCHGSGARPGTSPKVCGSCNGSGV
INRNQGAFGFSEPCADCRGTGSIIENPCTDCQGTGVTTRTRTITVRIPPG
VDDGQRIRLAGQGEAGLRGAPSGDLYVTVHVRPDKVFSRDGDDLTLTVPV
SFTELALGATISVPTLEGRVGVKVPAGTSDGRILRVRGRGIPKRAGGNGD
LLVTVKVAVPSKLEDSALEALQRYQVAEKASGFDPRAGWAGAR
169631348YP_001704997.1 heat shock protein transcriptional regulator HspR [Mycobacterium abMTSSQGDGGASRRRQPERGARTFLISVAAELAGMHAQTLRTYDRLGLVSP
ERTTGGGRRYSQRDVDLLREVQRLSQDEGVNLAGIKRVIELTNQVEALQA
KLAELTAEVAQLRAATAGREVAVIPKSTAVVVWQPRQQR
169631347YP_001704996.1 monooxygenase [Mycobacterium abscessus ATCC 19977]MGLEDVEALHDLVGGVELSGNKLVRSFYSRWFAIDPTVGDLFPADMSAQR
EHFRQALQFVLWEMASYRTEGLVNFLAQLGRDHRKFGATDSQYDTMRQAL
LDTTREVLQPIWDQRMEATATEVYTVMIEVMRSAAASDIGQPWWDGKVIE
FHRTSRDLALIRLKLNAPMPYHCGQYVHVQVPQSPRNWRYLSLAIPPDPE
GYIEFHVRAVPGGLVSGDIVNKTKVGDTWRISPPLGALSVNRDGGDILMV
AGSTGIAPLRCLIMELSQWAENPRVHLFYGARYPQELYDLWTLWHIASTN
PWLSVTPVTEYPRNPDWATEYHDPTPPRGLHVRQTGLLSEVVTAYGGWGD
RQILIGGSASMIQATKEALVSRGADASRIQHDPL
169631346YP_001704995.1 hypothetical protein MAB_4268c [Mycobacterium abscessus ATCC 19977]MATPNEKLAIFWWDTKLDSPAGWRTRWTLGVVPKGTMVTLSRRTFESDDP
AVCGMAALSDLFRPAAMAKLRRLIDHAATTPTDRGGTEPHADEFAWLMDE
NTAVTQIDGV
169631345YP_001704994.1 hypothetical protein MAB_4267c [Mycobacterium abscessus ATCC 19977]MKGNPTNLESAVPDDANDIATIILDQFYRHPPERVWAVMVCPDAMEEWLM
DPVGFRPEVGTRFRFIAFPIPVADFSGALSCEVLAATPSRVLSIRWWDMK
SAKQREWTVTWTLQEVPGGTMVTLRHEGFDPSDPASRMYRTLSERGWPGT
MGRLGRCIASAPAGDDQPPHCLVTDVSA
169631344YP_001704993.1 hypothetical protein MAB_4266c [Mycobacterium abscessus ATCC 19977]MTTSPDDLTSVTVGQFFPYSAEQVWHAITSPASISDWATDIDRDSVVPGK
SFAFTTFPLPEVNFSGHGHCEFTDVVPNERLAYRFTTPESSLNLQATWTL
HPESGGTRLLVVHNGFDVGNPVHGRLRILVRDLWKLVVSRIAELMAEPKD
DAVPPPDDSTSFTLAEFYRHAPQTVWRVVTSREFVGDVVNDHDLVSVRTG
ARLTIGTYPIPLIGFGGRVDMEFLEVCEPELIVCTFEIPIMGGTTELTMT
WRLRPQDGGTQLWFTLSGFDPESPLNRQVRSVLRGGAIPVLSRLGELLEG
RGHRA
169631343YP_001704992.1 chaperone ClpB [Mycobacterium abscessus ATCC 19977]MDSFNPTTKTQAALTAALQAATTAGNPEIRPAHLLVALLGQTDGIAAPLL
QAVGVDPVSVRNEAQAIADRLPQVSNASANPQLSRDSIAAVTAAQHLATE
LNDDYVSTEHLLVGLATGDSDIAKLLVNHGATPQALRDAFVQVRGSGRVT
SPEPEATFQALEKYSTDLTARAREGKLDPVIGRDTEIRRVVQVLSRRTKN
NPVLIGEPGVGKTAIVEGLAQRIVAGDVPESLRGKTVISLDLGSMVAGAK
YRGEFEERLKAVLDEIKNSAGQLITFIDELHTIVGAGATGESAMDAGNMI
KPMLARGELRLVGATTLDEYRKYIEKDAALERRFQQVLVGEPSVEDTIGI
LRGIKERYEIHHGVRITDSALVAAATLSDRYITSRFLPDKAIDLVDEAAS
RLRMEIDSRPVEIDEVERVVRRLEIEEMALSKEEDEASKQRLEKLRVELA
DKKERLAELTARWQNEKSSIDAVRDLKEQLETLKGESDRAERDGDLGKAA
ELRYGRIPELEKQLEQALPGLDHDGNVMLKEEVSPDDVADVVSAWTGIPT
GRLMEGETAKLLRMEDELGKRVVGQKKAVEAVSDAVRRARAGVADPNRPT
GSFLFLGPTGVGKTELAKALADFLFDDEHAMVRIDMSEYGEKHSVARLVG
APPGYVGYDAGGQLTEAVRRRPYTVVLFDEVEKAHPDVFDVLLQVLDEGR
LTDGQGRTVDFRNTILILTSNLGAGGSEEQVMAAVRAKFKPEFINRLDDV
LIFDGLNPEELVQIVDIQLGQLQKRLAQRRLTLEVSAPAKKWLAARGFDP
IYGARPLRRLVQQSIGDQLAKQLLAGEVHDGDVVPVNVSADGESLILG
169631342YP_001704991.1 hypothetical protein MAB_4264c [Mycobacterium abscessus ATCC 19977]MALLWFTLSALCFVCAGVLLYVDIGRRRSRGHRRKSWARSHGFDYMPQDK
EIVKRWNRGVMSSAGSAAAANVVLGQIRGEAVYVFDLEDVATIIALHRKV
GTNVMVDLRLKVMQEPRESDIWLLGAIGPRMVYSTNLDAARRACDRRMVT
FAHTAPETAEVLWNEQHWTLAALPINSNREQWDEGLKAVRQFNDLLRVLP
PSGESAPSPIQAAARPSRPVGSNAAPVADRQPAPVGQGQPQGR
169631341YP_001704990.1 putative membrane protein MmpL [Mycobacterium abscessus ATCC 19977]MHDSPIFGRFAGVISRHAAAIIGLLMLVAGGLMALAPNLEELALTHGSPM
MPTNTQSAAALKHMAKAFGESESNNTAAVVVVKDQPFTEQDRQFRADLMK
KLRADTEHVEPGMDMWSDPQFATASESPDKMVALAQVQLSGEIGGPKAME
SAKAMQRIIDDIAKPPGTTVYATGTSQAAADQINTMMRDVVIIGGLSVVL
VGGLLLLVYRSLVVAFLPLITVGVAVGIATPMASFLTLAGLIPTSMMTNA
LMGALALGAGTDYSIFFIGRYQEGRRAGLSVDDAFRASYRGVAPVVIASG
LTVAGALSCMTFAQLDMMRSMGIPGAITMIFTVLSAVTVTPGALLIGARR
FGWFEPKSTVRSTRLWRRVGIRVARWPKPIFVTTFAALIVLMMVIPTASF
NYDELQFIPKDMPSAAGMNAIQEHFPAGQMNPDMILIRAPEDLRTSANIG
LLEKAAQQITKLDSVASVQWITRPTGTPMDQTSLTYSVGMAGTMMSQNKI
VMEQRQHRMRTMTDNMNSMMSTLQGLQGTLRTAQQSAAQFSAAAGPIQAS
LNQLKSQLNSVMGPAREAVRAQPNCAADPMCVGARSTLSNFENMSNVTDQ
MRSLVSTSGSMTGGLAQAARTMPRMLDSMSSMQDLMTETNEQMSQMMSQI
DTMTSLMQDLGRSSAGTGDYFYFPAQMLSDPRFKPYLKMMFSEDGTTTRM
IVIGSGSSYGDEGIQRVRDLAREMKYALKGTRLQGSVIEIAGPAALIGDM
RVMLDRDEKLIMIGCLTVIFTVVLLLLRGLVASLIVIGSVLVSFASTLGL
ALVIWQHVLGIQLHWSVPVAVFAILISVGADYNLLVASRFKEEMSAGIRT
GVIRSIAGTGGVVTTAGLVFAMTQFAMMGSSLVNVAQMGSTIGLGLIIDT
FVVRTFTVPTLAVILDKKFWWPLPMTQLWRRT
169631340YP_001704989.1 putative membrane protein MmpS [Mycobacterium abscessus ATCC 19977]MFDRLVGWLIARQRWIYPVLVVLWAAAGTYITTAPKVALPTAEVAPTAQA
VSAMSLSQPKTVTYEVSSGGQPVTVSYLDEKGQSRLFNGPAPWHTSLTTS
DFGFTAGVTAISTGTVTCRITVDGKVADEKTDVSRTPSVSCNLVAFQKLG
PQGGQ
169631339YP_001704988.1 putative short chain dehydrogenase/reductase [Mycobacterium abscessMAATNSARPVALITGPTSGLGGGFARKYASQGYDVVLVARDEQRLGALAD
ELTCRFGVYAEALPADLADAADRARVADRLAAGVSVLVNNAGFATAGEFW
TAAPELLHSQLDVNVTAVMELTRAALPSMIEAGAGTVINVASVAGLVSGR
GSTYSASKAWVVSFTEGLANGLLGTGVGMHVLCPGFIHTEFHERAGIEMG
TIPEFMWLQVDDVVNACLHDIAAGKVLIVPGVQYKAITSVTRLIPRGLVR
KYNSVVGRGRGRT
169631338YP_001704987.1 orotate phosphoribosyltransferase [Mycobacterium abscessus ATCC 199MAELDLGPDLNAADRDELAALVRDIAVVHGKVTLSSGKEADYYVDLRRAT
LHHRAGALIGRLVRELTADWDYAGVGGLTLGADPVATAVMHAPGRPIDAF
VVRKSVKTHGMQRLIEGFDVVGQQVLVVEDTSTTGGSALTAVHAVRQAGG
EVIGVATVVDRDTGAAEAIRAEGVPYRYVLGLADLGLAGS
169631337YP_001704986.1 hypothetical protein MAB_4259c [Mycobacterium abscessus ATCC 19977]MTCRRALLALLAGVLVLAGCSKEPEKQLVYGAQSAKIGETQSLLGWNLSV
ANLRFQNGYVLIDVTGAAARAGDKPSPAAELRFGLYGSLSHPLEAPALSG
CAGLADLSIHPLAVLAPDQLSGTVCLGPMQNQSAVRGVYAYSAKDRIAGT
TVAYPVAYPMGLLPTPQNDSGLVITTKSMEAWRASGQQISQVDLGDPNAF
TGNGYSLLGLNISGVAARYRDESAARGGPLMVTVAPTLPGPGLPRSCAVY
GASVLVLPDAALDAVQLQPSLCLQGEINAAVLAGTLSVIGTHAAVWMNRE
169631336YP_001704985.1 putative RNA methyltransferase [Mycobacterium abscessus ATCC 19977]MSKDSQDGPAEPSLWGATGNGVGPWELERGLPLPEDPRYDPELLRDGDAR
NVVDAYRYWRREAIVADIDRRRHRLHIAIENFENDANIGTVVRTANAFAV
HTVHIVGRRRWNRRGAMVTDRYQHLMHHDSTDELLDYAKRAGLTVVAVDN
VPGSVPLETAELPVDCLLVFGQEGPGVTDASKSGAVMTVSIAQFGSTRSI
NAGVAAGIAMHAWVRQHADLDGAW
169631335YP_001704984.1 hypothetical protein MAB_4257c [Mycobacterium abscessus ATCC 19977]MDVLWANRASSAEAAITARHLSPLWHLPGMQLGVVTWPPAPGATWFKNWH
YWWQAHLQDCLIDAQLRDPRPDRLKYIADMQRAHRFRNVFMWTNQYYDDM
AWLALAMQRASELLGLERPRALNRLRQQFLDAWMPQYGGGIPWRKQDRFF
NAPANGPAAIVLARTGRVWRAEVMSDWIDKTLVDPDSHLVIDGIQEDGTL
ERATYTYCQGVVLGLETELAVRTAEPRHAQRVHRLVRAVRDLMTEDGVIR
GSGGGDGGLFNGILARYLALVVTLLPQNSPQDADARATARDILLASAEAA
WANRLTVESLPLFGADWTRTADLPTAQSAASQFVAGAVNPSKVPERDLSV
QLSGWMLLEAAHVVA
169631334YP_001704983.1 4-hydroxybenzoyl-CoA thioesterase [Mycobacterium abscessus ATCC 199MAREDFSFLHPLRVRWAEVDMQGVVFNAHYLAYFDVALTEYWEALTGARN
ADGDGVFEHLYVVKSVIDYHASARFDDVVDIGVRIARLGRASMTCHFEIH
RGGEHLITGETVYVHAVDGSSVPFPDAFRCKVAEFERTQPTL
169631333YP_001704982.1 hypothetical protein MAB_4255 [Mycobacterium abscessus ATCC 19977]MILASSTTTLALMPSFLDPVKLLGQFGTLALLGLLVVIFVESGVLFPVLP
GDSLLFVAGMLAAGSAAAAAAEGAPQANFQLWQLLVFIPIAAILGGQVGY
WIGRGIGTSMFKPDARFLKQRYLDEAHAFFEKRGPFAIVIARFVPIVRTL
APITAGAARMSYPIFALYNIVGAVVWGVGITLLGYWLGQFPIIQKLLEPI
FILIVLASVAPMFLEWMRRRKAGKTAEGSETPTGA
169631332YP_001704981.1 fructose-bisphosphate aldolase [Mycobacterium abscessus ATCC 19977]MEVTQVPIATPEVYTEMLKRAKEHSFAFPAINCTSSETINAAIKGFADAG
SDGIIQFSTGGAEFGSGLGVKDMVTGAVALAEFAHVVAAKYDITVALHTD
HCPKDKLDTYVRPLLAISQERVNAGQAPLFQSHMWDGSAVPIDENLTIAA
ELLSAAVKAKIILEVEIGVVGGEEDGVEAEINEKLYTSSEDFEKTVDALG
AGDKGHYLLAATFGNVHGVYKPGNVKLKPEVLAEGQKVASAKLGLPEGSK
PFDFVFHGGSGSLKSEIEDSLRYGVVKMNVDTDTQYAFTRPIAAHMFSNY
DGVLKIDGEVGNKKTYDPRSYLKKAEANMSVRVVEACNDLKSAGRSVSAG
LA
169631331YP_001704980.1 hypothetical protein MAB_4253 [Mycobacterium abscessus ATCC 19977]MANPTGGNSEAKPDARGEEPTESAEQPEGAANAPEVSDTEDNTDTGPVPP
LDDAQTVVMAPAKPDVPRYTAPGFDANKTEMIDPVGDDPKTEFIQPLATQ
ARPKAATPETIAPRKEEKRSWGWVIALALVVAALAAVIVLAAVIISRTST
PKASQEELVRNSIQNYDNAIQTGNLAALRTITCGETRDGYVRYPDGEWSQ
TYQKVAAAKQYPVVASIDEVVVNGEHAEANVTSFMAFAPQTRSSRSFDLQ
FRDNQWKICQSD
169631330YP_001704979.1 hypothetical protein MAB_4252c [Mycobacterium abscessus ATCC 19977]MHDLLGPEPVLLPGDDDAESALLNGQDPAAVAAAYPAASIAWAELAENAL
DDDGSIASIVTAYAFARTGYHRGLDQLRRNGWKGFGPVPYSHEPNRGFLR
AVAALARAAKLIGEDHEYARCCDLLDDCDPAARPALLPA
169631329YP_001704978.1 hypothetical protein MAB_4251 [Mycobacterium abscessus ATCC 19977]MNVKQSVRPSPVFLVLVALTVAGAVFAWLGGDSTEPLARGGVFVFVFAGW
IVSLCLHEFGHAYTAWRFGDTQARGYLTLNPLQYTDPVLSIALPLVFIAL
GGIGLPGGAVYVHTAGMTNRQRTIVSLAGPTANAILAVLILGTTALFADR
EHVVFWAAMAYLGFLQVTAVVLNLLPVPGLDGYGALEPHLSPNTQRTLGN
AKTFGFLILFALLMSPPVNRAFFGAVYWIVAYLGVDPALAQIGGWLFRFW
SKLL
169631328YP_001704977.1 hypothetical protein MAB_4250 [Mycobacterium abscessus ATCC 19977]MSTPSVTETAAARVLLFGTRRLPRILRDLPVDRVDGSGAVRALVDALPDG
PARFIVVGGDGDLGQVLTRLMRAERLDVELGFVPDRPSRARRIYRIGFGA
ARRARRGRAQRVPLIRDDTGTALAGRASWQSSDGTPVTGEATVDDTLLFD
GAALVDVEPTESMPGLRASVRGRTRLLPRRWVTGRAAQLGTVGAVVVRDG
VAGPRPVTRSTFYRHQQSWLLVR
169631327YP_001704976.1 adenylosuccinate synthetase [Mycobacterium abscessus ATCC 19977]MPAIVLIGAQWGDEGKGKATDLLGGSVQWVVRYQGGNNAGHTVVLPNGEN
FALHLIPSGILTPGVTNVIGNGVVVDPGVLLTELAGLEERGIDTSGLILS
ADAHLLMPYHVAIDKVTERYLGSKKIGTTGRGIGPCYQDKVARIGIRVAD
VLDEESLRQKVHAALEFKNQVLVKIYNRKALDPDQVVDGVLEQAEGFKHR
IADARLQLNQALERGETVLLEGSQGTLLDVDHGTYPFVTSSNPTAGGASV
GSGIGPTRITTVLGILKAYTTRVGSGPFPTELFDEHGAYLAKTGGEVGVT
TGRARRCGWFDAVIARYATRVNGITDYFLTKLDVLSSLQTVPICVGYEVD
GKRTNEMPMTQSEIYRATPVYEELPGWWEDISGARQFEDLPAKAQDYVLR
LEELAGAPMSCIGVGPGRDQTIVRRDILSRS
169631326YP_001704975.1 hypothetical protein MAB_4248c [Mycobacterium abscessus ATCC 19977]MHWRRAGPGSNDREAGHTLAVMTADGDRLAALHEEMNRAIREIDGEHSGG
FPQYSPSSVGPGFGRFLTAMRRLQDLAVSADMDDPRWDEAADLTEKLVEL
MDPFEAPEGVGPANRVADEPANGHLLLPPWFIDKAGPDGIEAHGDFPRFY
LGGNGAVHGGILPLLFDHLFGMTVIMAGRTISRTAFLHVNYRQVVPVGVP
LTASSRIDEVDRRKAFVSAELCDAHGVVLADANGLMVQLLPGQP
169631325YP_001704974.1 putative dicarboxylate carrier protein [Mycobacterium abscessus ATCMSAAQILSLIMLVVVLAAAIWRRMNIGVLALGAALPVLALSGLDAKAMYT
TFPGDIFALIVGVSLLFAHLERSGTLSWFVELVYGAVGDRHVLLPWAGFL
VGAILSTAGAFSTAVIAFLVPLVAHVAVRYRSSFYLCELGVVIGANSAGL
SPLNPTGAVVRAAATKFHVDYPGWALWAVSMVVAALVVLCLQLLDAFRRR
RGGGFDLTPAPAAATETDAAESPSLRYAWCAGLALLTFVLLVVVVKTDVG
VTAIALAALMQIAFHPHERSLLARIPWPSILLLCGLLTYLGLMQKIGTID
SIASVLHRLGTGAVLILVLAYLTALLCNIESSTLGVLGLMMPIVFSTFTE
PAQMFWVVCAVCVPAALMVMNPIHVAGTLIIGNSAADEQDNLFRRLLALA
GSLALVVPGLLSIVPIALA
169631324YP_001704973.1 putative Na+/H+ antiporter [Mycobacterium abscessus ATCC 19977]MIHAETAASYLSSRMPTWMLQPLCAQNTNVNVSLLAVLTAALVLAAISRR
FGLATPLVLVVTGLAATAIPGLPSIEMDPDLVLFVILPPLLYTTALESSY
VNLRKNVRAVASLAVLLPLVTTVAVGFVAFYAVPELPLAGAMVLGAIVAP
PDAVSATAIGRRLGLPRNIMTLLGGESLLNDATALTAYRVAIAAAIGLGA
TVADGFRIFALAAVGGVFVGFVIGKLVNIIRCKLDDPLSESAIGLVVPFF
AYLLAEEIHGSGVIAVVVAGLMLGHRSVHAGYATRLQDDAVWKAVQLLLE
SFAFLLIGLQLPKVVAGLRGLSFNTIVLSSVAVLTTVIVVRIVFVFAFAY
LRPPGQRPSARGVFVVAWAGMRGVVSLAMAFAVPLSTVTGEPLPGHPHIV
FLTFVVVVGTLLLHGLTLPWVIRVLGVQSDDERKDALAEAAAQDKAARAA
ADRLEELLDDNDGIEDTNVRSRAAEILRHWNTRRRNAAWERLGRSDEDAG
ESPMAAFRNLRLEMLETERAVFIAERDAGNIDDEVLRTVLRGLDLEEATM
NQADR
169631323YP_001704972.1 phosphoribosylglycinamide formyltransferase 2 [Mycobacterium abscesMNGIVVTQEGSPPSEQGTATSADIVEPVPAAAAPVTEEAVRATNGAKSGS
KTAKAATPVEAVGKTVEAGAPAPEAVADLAEGHTEDRTGQAVPQPPEAPA
PADLPADEAEPPAGNRTTVMLLGSGELAKELAISFQRLGAEVIVVDTGKG
GPAQGVADRAVLAPIGESERLYELIEKERPRFVVPLVEAASREALDKLAE
GEVTQVIPTAKAVRLAGDREGMRRMAAEELGLPTPTYWFANSVEELRTVL
ETSGFPAVVRPVAAAYGQGQSVVLRDGDVTPAWEQAIAANIGGGQRVMVE
TAVDIDYEITLLTVRTAGIGGATRLYFCEPIAHRQSGTDAMQMWQPQPLS
QAALELARSIAARAVNALGGHGVYGVELFVRGDEVYFCDVSARPYDSGLV
TVRSQRLSEYDMHARAVLGAPVDTILVSPAAAEVVYGDGDGPSPRQLDQA
LQTPESDLRVFGHTEAHRRRRVAVALATAPNTALALNRAQQVARHLR
169631322YP_001704971.1 hypothetical protein MAB_4244c [Mycobacterium abscessus ATCC 19977]MTGQDEAPDGGSEDRGSIGPFVAGAVIFGIVVIAIAVSTFFRSGDGLTPE
GRVGRAVVAQNDALQRHAYADYLKATCRAIVTPEQNVLAAQEKSETAHGN
RFIDDVKDVKIGADTATASVTYHYMKSENNKLTADVSFVKEDGSWRVCSQ
Y
169631321YP_001704970.1 hypothetical protein MAB_4243c [Mycobacterium abscessus ATCC 19977]MGYAGDITPEAAWALLKENPEAVLVDVRTSAEWKWVGVPDLTELGRDVVY
VEWVRSTGERNGEFLEELAAAGVTGPSQGDDRPVIFLCRSGNRSIGSAEL
ATEAGITPSYNVLDGFEGNLDENGHRGGVGWRAIGLPWRQS
169631320YP_001704969.1 O-succinylhomoserine sulfhydrylase [Mycobacterium abscessus ATCC 19MTQTPSGGSSVRIPKALPDGVSQATIGVRGGLLRSEFEETAEAMYLTSGY
VYESAAAAERAFTGEVDRYVYSRYGNPTISMFEERLRLIEGAEAAFATAT
GMSAVFTALGALLGAGDRLVAARSLFGSCFVVCNEILPRWGVETVFVDGE
DISQWEEALSVPTQAVFFETPSNPMQSLVDIEAVCTLAHASGAKVVLDNV
FATPLLQQGIPLGADVVVYSGTKHIDGQGRVLGGAILGETEYIEGPVKTL
MRHTGPALSPFNAWTLVKGLETLDLRVRHANDSAYKIAQFLEQHPAVRWV
RYPFLGTHPQYELAKRQMRGGGTVVTFELDADGDAGKQRAFQVLDGTSLI
DISNNLGDSKSLITHPATTTHRAMGPEGRAAIGLSDGVVRLSVGLESTDD
LIADLERALG
169631319YP_001704968.1 hypothetical protein MAB_4241c [Mycobacterium abscessus ATCC 19977]MTQRSVHFAVLVFAAVVMTAAATACSMSDFVGGAVERTTYPPITPIPPPP
PGVSTLPADFPRDIPVIKGIYRQDGQGDSRTLAVSGVDPSAVPAAGKLLT
DAGFEHQTVLGQDAYLNNKYTVLVVGDDLGGTFTLRYTVMPMTGVPAMPS
VAFPPLI
169631318YP_001704967.1 putative membrane protein MmpL [Mycobacterium abscessus ATCC 19977]MAKHAKLVVLAWLAVGVLVNTAWPQLERVANEHSVSPLPTGEVSPALASM
KEMGKAFGRPGIDNAVIIVMHGDKGFDADAQARYSALIERLRGNTEYVTF
VQDQLGDPRMRNNPVARKQVLSEDGTTWYAMAGLAGDLGTPLAQRAFRSV
DDLVKQTFAGSATTANITGAAGTVTDMGNAALGDLPKIGAVTVVVIGLIL
LLVFRSWFTAMLPLLVMGVSLLIARGVIAGLAERGLVPVSSVSAGLMMAV
LMGASVNYTVFLVSRYHERIRAGESPPDALAHACGSMTRVILATAATVAI
ANIAQLTARLAFLAAAGPAVSMGVIVAFFVVTTMLPATLSLAAKRGLGLP
GSDRVDVYWHRMGVNIVRHPWPFFGVATVILLAAASFVPFMRPSFDISKV
LPESAQSNQGMRTLNAHFPANSIMPQYLLVQASSDLRNPRALADLDQMAE
RISQLKGVGKVVGITRPDGNKLTQATLAWQIGYMGTQIDKTSGQVNADLR
PQLERMSKLADVMSAMTNELGDGDPARLQQMMPQTLAMAKELEGQLDRYQ
SLISQMGTVAGMVDQLATMGPSVEATFTALDAGASLAQTLAESPFCPVQP
DCVTLRDQLVELRTTGPLSSVESLRESVRAVTGGKTITQLLGDMNSQFKQ
IRGLLAKLPEMERKFERIAGYFQQLQGLGVDLNSVKNMGVRIRDLNTQLE
DTVRSMGEAAATLQGIGKNSNSAAASGFSVPGAMLQNPGFKELSAAFLQD
DGRTAMYMIQSPLNPYGPEAMQLSRDMERVGNEATPNTALAGAKVSVGGF
PAINADLKKAYDSDLREIIVVTLLIIFLVMCLLLRAVVAPLYLLGTVLLT
YIASLGIGVLVFQVLLGQQLDWAVPAMTFVLIVAVGADYNMLFISRLREE
SARNMRVGIIRTVRQTGSVITSAGLVFAASLLGMMVGSVNQMVQMGFIIG
VGILLDTFVVRTLMVPTLAQAFGKLSWWPSKA
169631317YP_001704966.1 putative pyridoxamine 5'-phosphate oxidase [Mycobacterium abscessusMFGWGMAEIPAGFEDLLEQRLYGHLATVGGDGGAQSSPMWFDWDGERVRF
THTKKRAKFRNIQSEPRVAFSILDPTNPYRYLEVRGTIDQIDDDPTGSFI
QELAHLYQAPWAGTSTGDEADRVILYLRPTKFVSHG
169631316YP_001704965.1 amino acid ABC transporter permease [Mycobacterium abscessus ATCC 1MTSAPAAPPRARVADEAAEPVLRVRRRPRPGNWILSAVALVFVAMFVHGL
VRNPGWDWPTFARYFTAKSVLAALWLTLRLTFYGTVLGFLLGVALAAARL
SKNPVLQAISWTYVWIFRSIPLIVQLLFWFNIAYLYDTIGFGIPFGPALF
TVDTNELLSGLTAAVIGLTLHQGAYFAEIIRGGILSVDEGQLEAAAALGI
PRRRQFFRIVLPQAMRSVMPNAANEVISLVKGTSIVSTMAIADLFYQVQV
IFGRNGRVVPLLMVATAWYIVITSVLTVVQYYIERHYARGAHR
169631315YP_001704964.1 amino acid ABC transporter ATP-binding protein [Mycobacterium absceMSTIEVRGVRKSYGQVTALRDVNLTVHQGEVTVIIGPSGSGKSTLLRALN
HLEKVDAGTIRIDGELIGYRQRGSVLYELPERAILRQRSQVGFVFQNFNL
FPHLTVLENVIEAPLAARRAPRAELEAEATRLLERVGVADKAAQYPRRLS
GGQQQRVAIARALALRPKVILFDEPTSALDPELVTEVLDVIAQLARDGAT
LVIVTHEIGLAREIADTVVFMDRGAIVEQGPPKEVLDSPSHPRTASFLSK
VLS
169631314YP_001704963.1 amino acid ABC transporter substrate-binding protein [MycobacteriumMRFLTVLVCTALTVLAGCAEGAAPGSSSFNLSPDQDRVRVAKVDAIAAEV
PEGIRKRGTLVVTGDANSSPPLRFYADDDKTMIGIETDIAYLVADILGLR
VDLRSADWAQNFVKVDSGEVDAFISNVTVTEERKEKFDFATYRLDNVTFE
ARRSLDWKVKGARDIAGKTIGVGSGTNQEALLVRWNEENVAAGLPAADLK
YFQQATGYYLALASGRIDAYVGPNPSAVFHSEATGQTKLVGTFSGAGEAL
QGEIAVLTKKDNGLVRAYADAINHAIADGTYRKVLQRWGLEDEAVAKSEI
NPRGLPRQG
169631313YP_001704962.1 putative acetyltransferase [Mycobacterium abscessus ATCC 19977]MTACEDLLQFVTVGQQDPLAAPLLAELAVEYSTRYGGTLAEHHDLLVNYP
AAHFSAPDGGLLVGLQGGAAVTGGAFQRYDANTAELKRIWTSSAHRRQGL
AGRTLAALEVEIRRRGYRRIYLTTGPRQPEAKALYLSAGYRPLYDQTLTA
DEVGIHPFDKDL
169631312YP_001704961.1 putative FMNH2-utilizing oxygenase [Mycobacterium abscessus ATCC 19MGVAPTVTTLLGLALDGHGWHPDADKHAGKPLTGRYWTQQVQLAEQGLLD
FVTFEDSFAPTPGGRLDAVLTAGRVAPATHHIGLIPTAPATHNEPFHLSK
SIATLDIVSGGRAGWQVTIADTEDEADAFGRTKVLPLQDLLDEAADSVEV
VRRLWDSWEDDAEIRDVATGRFIDRDKLHYIDFEGRFFSVKGPSITPRSP
QGQAVVAALARSRPGQAFAAKNADLIFVTPHDGASAAEIPARLHNTAGHR
VIKVLADLVVSFDREDEFPSDAAVFTGRAPELAELIAQWHEWGIDGVRLR
PAANALDIPVVVDELVPLLQAHQGFRTEYENGALRERLGLPAAINRYARK
SA
169631311YP_001704960.1 putative monooxygenase [Mycobacterium abscessus ATCC 19977]MNVPLSVLDLSPVSEGADATTALRNSIDLAQHAEQWGYRRYWLAEHHFVA
VASTVPALVIAHIAAATHRIRVGAGAVQIASTTPAAVVESFGILDALYPG
RIDLGLGRTGHRIRDRLAGNEQKPEPAPAHEVDGLFIPRAPTEFGIKDNP
KLRATAAALQQPGAHVADFDQQVADIQAFLDGSYVSPEGVALHIRPGEGA
DLPLWLFGSSKGESAQVAARRGLPFVANYHVTPWSTVEAVEAYRDAFQPS
KALAEPYVIVSADAVAADDETTARHLTSTFGRWVHSIRSGHGAIPYPDPD
VAQPLTEEERQHSEDRVATQFVGDAGQVAERLDTLARVTGADELVITSIT
HRHEDRRRSYELIAKEWGLI
169631310YP_001704959.1 putative oxygenase [Mycobacterium abscessus ATCC 19977]MSNPADAVRTREGKDRKPVHLAAHFPGVNNTTVWSDPASGSQIDFDSFVH
LARTAERGLFDFFFLAEGLRLREHRERIYDLDVVGRPDTFTVLAALGAVT
ERLGLVGTINTTFNEPFNVARQFASLDHLSDGRAGWNMVTSSDAFTGENF
RRGGFLDHADRYRRAEEFITVARKFWDSWDAAGEPLPVNHRGPQFTVRGV
ATAPASPQRHPVLLQAGDSADGRDFGAKHADALFTIHSSIPAGQKYYADV
KARAVAHGRNPDQLKVFPGVTYVLGDTEQEAIEKAAYIRDQQVGPQTAIA
YLEQVWGRDLSEYDPEGPLPDVDPTGDASITRGKARHGDPREIAAKYREI
AEAKKLSIRELIKEVTSRQQFIGTPSQVATEVDRYIQADACDGFILVPHL
TPGGLDDFVDTVVPLLQERGAFRAEYEHETLREHLGLDPISRASGDFRRE
TASA
169631309YP_001704958.1 beta-lactamase-like protein [Mycobacterium abscessus ATCC 19977]MVEITQVSDAVHVVNGEAVNWVIASDDSGVTLFDSGYPGDRDDVLKSIAA
LGHKPQDVRAVVLTHGHIDHMGTAIWWAAEHGVPVYAHNAELGNVRRDYV
DQAEPLKVVLNLWRPGWLPWVIHAMRLGAGVRDGIPTAAPLGPELADLPG
APAPIPTPGHSGGHCSFLVAGHVLVVGDAIITGHPVAKRSGPQLLPTPFT
KDMEQARRSAEALADVDADVLAPGHGPAWIGSLRDAVQIALNT
169631308YP_001704957.1 F420-dependent glucose-6-phosphate dehydrogenase [Mycobacterium absMARELKLGYKASAEQFAPRELVELAVATESHGFDSATVSDHFQPWRYNGG
HAPFSLAWMTAVGERTQRLQLGTSVLTPTFRYNPAVTAQAFATMGCLYPG
RIFLGVGTGEALNEIATGYIGEWPEFKERFARLRESVRLMRELWTGERVD
FEGEYYRTQGAAIYDVPEGGIPVYIAAGGAVVAKYAGRAGDGFICTSGKG
EELYSGKLIPAVREGAALAERSFDDIDRMIEIKISYDPDPDKALENTRFW
APLSLTPEQKHSIHDPIEMERAADELPIEQVAKRWIVASDPDEAVEKVAD
YVGWGLNHLVFHAPGHDQKRFLELFKTDLEPRLRKLG
169631307YP_001704956.1 hypothetical protein MAB_4229c [Mycobacterium abscessus ATCC 19977]MSSLFRRFVDAVNTVPVMALNVPGLRSLAGRYFTVVTYTGRRSGQIFSTP
VNYWRSGDDIVIWVGIPESKTWWRNFLGEGRPLQLRLNGVDVPGYGIARK
DDNGRVTVTVRLGESV
169631306YP_001704955.1 hypothetical protein MAB_4228c [Mycobacterium abscessus ATCC 19977]MPGIGTTVLVSAYAARFNPPLLRAQSVASPLGLWLSQALIAPATEGTHRH
GVGYLCSARG
169631305YP_001704954.1 putative glycosyl hydrolase [Mycobacterium abscessus ATCC 19977]MHDDRRIVEDRIRRFVDKRLNGAVYVDSAPLTVTAWAAPGEPVPFAEAVG
QDFHEITPGTPWGPPWSTMWLHVTGTVPPSWRGRDEGSPEMRVELGFTGG
PGFNAEGLVYRPDGTVVKGIAPRNAFVPIDNPDGPVDFYIEAAANPDIGK
YFWSPMPLGDKATSGEDALYRLGDVDLALRDLNLWGLQQDIATLDGLMHT
LPEDLPRRHEILRALERMLDTVDPDDLAGTAAAGREQLADVLARPAYASA
HRITAVGHAHIDSAWLWPVRETVRKCARTFSNMVDLMDRHPDFRFACSSA
QQYAWIKDKYPSLFARIKEKVAAGQFIPVGGMWVEADTNMPGAEAMARQF
VMGKRFFLDEFGIDTPEVWLPDSFGYSAAMPQIVAASGSEYFLTQKISWN
SVNRMPHHTFIWEGIDGTGVFTHFPPVDTYNSDLGGGDLAHAQRNYRDSG
AGTMSLVPFGYGDGGGGPTREMLAYATRKRSLEGSPTVTLGTPAQFFADA
RAEYANPPRWSGELYLELHRGTYTSQANTKQGNRRSEHLLREAELWAATA
AVRTGFEYPYAELDEIWKLVLLQQFHDILPGSSIAWVHKDAERNYAAIAN
RLQAVIEAATGALAGTGARKLVFNAAPHARDGVPALGASVADRPRPVTPT
PAPGGFRLDNGTIAATFDADGLLVSLVDAVSGREAMAAPGNLLQLHRDTP
NQWDAWDIDGFYRNTVTDLAGADSVAIVDDALVIARTFGNSRVMQRITLR
QGSGALDIDIDIDWHESEKLLKLSFPFDVHADRSASETQFGHVYRPTHAN
TSWDEAKFEICAHRWVHVGESGYGVAVVNNSTYGHDISRRGSTTVVRMSL
LRAPLFPDPDCDQGRHRLQFSVRPGATIGDAVEEGYRRNLDPRIVNGAVD
AVEPLISLDNPAVVVESVKLALDGSGDVVVRLYESRGGRAEATLRSNFGH
GQPIVTDLLERPIDESGTVSFNGDEIHLTLRPFKILTLRFPSVERRA
169631304YP_001704953.1 phosphate acetyltransferase [Mycobacterium abscessus ATCC 19977]MTQPKASSIYIASPEGDTGKSTVALGVMHRLAASVARVGVFRPIARSGES
VDYILELLLEQSTADIAYEDCLGVSYHDVHQDPDAAIAQIVDRYHAVAER
CDAVVIVGSDYTDVASPSELGTNARIAVNLGAPVLLTIKGFDRTPDEVAA
LAEVCLGELKAQRAHTAAIVANRCNPGQLDEVRQALARFDKPAWVLPEVP
LLVSPSVEELMKAVKGSLVSGDEALLSREATSFMVAGMTAEHCLERLKEG
QAVIFPADRSDVLLAVASAHVAEGFPSLSAIILNGGLKLHPRIADLVDGI
GLRLPIIETDSGTFETASAAAHARGRVTVASARKIDTALALMDRYVDGAD
LVAQLAIPIPSVTTPQMFEYQLLDRARDNRKRIVLPEGDDDRILKAAGRL
LQRQVADLTILGEEAEIRSRAAELGVDISNALVVSPKTSDLAEKFADQYF
ELRKHKGMTPDRAREIMRNVSYFGTMLVYNDIVDGMVSGAAHTTAHTIRP
AFEVIRTTSGVSTVSSIFLMCLADRVLAYGDCAIVPDPTSEQLADIAISS
ARTAAQFGIDPRVAMLSYSTGSSGSGADVEKVRIATELVRSRQPELLVEG
PIQYDAAVEPSVAATKMPDSPVAGRATVLIFPDLNTGNNTYKAVQRSAGA
VAIGPVLQGLRKPINDLSRGALVEDIVNTVAITAIQAQERKQS
169631303YP_001704952.1 acetate kinase (AckA) [Mycobacterium abscessus ATCC 19977]MSAGGSVLVLNCGSSSVKYQLIEPESGRVIAHGLVERIGEEEIGNHEEAL
RLVFDSIDTGDVVVVGHRVVHGGQKFHEPTVLDDAVVAQIAELSSLAPLH
NPAGVQGIEVARRLLPDVPQVAVFDTAFFFGLPPAAAIYALDRAVAERYG
IRRYGFHGTSHQYVSQQAAAFLGRGYADINQIVLHLGNGASASAILRGRA
VETSMGLTPLEGLVMGTRTGDIDAGIVFHLARHGMSIDEIDTVFNRRSGM
LGLCGANDFREVHRLIDAGDAAAQLAYNVYVHRLRKYIGAYIATLGGADV
ISFTAGAGENDALLRADALAGLEVFGIEIDAARNQVRSGEARRISTDSSR
VTVLVVPTNEELAIARAAVEAI
169631302YP_001704951.1 serine/threonine-protein kinase [Mycobacterium abscessus ATCC 19977MSEDPEEPDDTSADEGPGTQPASLADLDVDSASTMRPISTRAVFRPPDST
QPATQPTTQPEVRATTTRVLLSPTRRLGGGLVEIPRVPEIDPLEALMTNP
VVEESKRFCWNCGKPVGRSTTDSPAQSEGICPTCGSSFSFLPQLNPGDVI
AGQYAIKGCIAHGGLGWIYLAVDRNVNDRPVVLKGLVHSGDAEAQNIAMA
ERRFLAEVAHPSIVKIFNFVEHPDQHGNPVGYIVMEYVGGTSLKQPKGNA
LPVAQAIAYMLEILPALGFLHSVGLTYNDLKPENIMITEEQLKLIDLGAV
ASINAYGNLYGTPGYQAPEISKTGPTVASDIYTVGRTLAVLTLRMPTRKG
RYKDGLPSDDPVLAKYDSYHRFLRRAIDPDPSARFGSAEEMATQLVGVLR
EVVALDSGTPRPGMSTLFSPSRSTFGVDLLVAHTDVYVDGLAHPPSLTAP
DIVTALQVPLLDPTDVGAAILQATVLSQPIQTLESLKAARLGRIDADGVD
LTESVELPLMEARALLDLGDVAKANSKLDQLEDRVGTPWRLTWYRGMAAL
LNGDYDQATKHFTAVLDFLPGEIAPKMALAATAELAGDEKNLDFYRTVWS
TDNSVISAGYGLARTLAARGERAEAVRMLDNVPPTSRHFTTARLTSAVTL
LSGRTLSEVTEDDIREAARRVEALPETEPRVLQIRALVLGTALDWIKSNH
STGHHILGVPFTKRGLRQGVERCLRALARRATERAHRYALVDLANATRPT
SLL
169631301YP_001704950.1 glutamine-binding protein GlnH [Mycobacterium abscessus ATCC 19977]MTRYAMQGTARRFGALAFVAALLAGCSTPENSTPLPQLTVPRPTPAEMTE
QEPNRAVLDKIDTSCDPTASLRPTSDRAANDEAVAAIRKRGRLVVGLDIG
SNLFSFRDPITGELTGFDVDIAGEVSRDIFGTPERVEYRILSSADRVAAL
KNSTVDIVVKTMTITCARRKEVNFSSVYLMNYQRILTSRDSGITNAQDLS
GRRVCAARGTTSLNRLSQITPPPVIMSVVTWADCLVALQQRQVDAVSTDD
SILAGLMSQDPYLHIIGPNMSDEPYGIGIKLENTDLVRYVNRTLERIRRD
GTWNALYRKWLSVLGPAPAPPSAKYRD
169631300YP_001704949.1 hypothetical protein MAB_4222 [Mycobacterium abscessus ATCC 19977]MTVGTTRLAHPSTEPVGATTRIAPAHPWWWFLKSTPGKILMLGIALAAAG
VLSAVATSASVQNRQEALSTVLNHTEPLAYSAGQLYSTLSVADAAATTAF
IAGTEPQSVRERYEQAITDASTALVAASSGLTDRPMQELLSRINAELSVY
TGLIETARTNNRASNPVGASYLSEASSLMQRTILPDAQLLYEETANRADQ
ETSASTRVPFPVILIVLSTMIAGVLGHRWLSKRTRRMINPGMLAGGLALL
LMVVWVGIALAVSASLGTEARNGGAHSLKTITQLVISAQQARADETLALI
RRGDENVRKKSYYDRIDEMDRKIGEYLSNPDAIARSDLEHAQQLLTRWRQ
ADDRINAYIGVGNYQAATQVALGNSDSDSTPAFDSLDTSLRSAVQDSRRQ
LRSGVLNAERALTLSSAGALILSVGGAICVGVGLWPRLSEYR
169631299YP_001704948.1 MutT/NUDIX family mutator protein [Mycobacterium abscessus ATCC 199MRGDGDGWVVADSGARFWGRFGAAGLLLRAPLPNGQPAVLLQHRAWWSHQ
GGTWALPGGARDSHESAEEAALREAAEEAGVDPAVMTVRSSVVTKRIDGQ
AHWTYTTVIADAAELLPTAANHESTELRWVPEEKIEGMRLHPGFKSSWPL
LRVVETLPHASNGFTGAGTVELESGRYAWQLP
169631298YP_001704947.1 hypothetical protein MAB_4220c [Mycobacterium abscessus ATCC 19977]MRVHLFLVLAMITSLLMSACGTEKSESGPDDRNEVVAAALARIEADLGKP
VKLEVRNFHRAGDWAFLDGQLQDTNGQPVDYSGTPFAEAAANGGKSKRYD
GLLKKTGPKWSILESAIGPTDVPWEGWKAKYPEAPPQIWP
169631297YP_001704946.1 thiamine-phosphate pyrophosphorylase [Mycobacterium abscessus ATCC MHSRSARLQSAHLYLCTDARRERGDFAEFVDAALAGGVDIVQLRDKGSAG
ERQFGRLEPAEELEYLAILSEAAARHGALFAVNDRADIARAAGADVLHLG
QDDLPLAVAREIVGPDVLIGRSTHDAEQAAAAARDDEIDYFCCGPCWPTP
TKPGRTASGLGLVRTAAELDTSKPWFAIGGIDEARVPQVVEAGASRIVVV
RAITAAADPRAAAASLRGSTRRA
169631296YP_001704945.1 thiamine biosynthesis oxidoreductase ThiO [Mycobacterium abscessus MMSSQKGSVAVIGGGVIGLSVAREAARTGWRVVIHDDGAKGPSWVAGGML
APYSEAWPGEDELLELGIESLGIWRDGFIDDVENPVITARGSLTVAVDTA
DVGELRTMTGWLAARGHPVTEIANARDVEPMLAQNVRRGFTAPEELSVDN
RKVLQALTAECEALGVGRGPAAVHTRDVDADQVVIANGVQAAALAGLPVR
PVKGEVLRLRQRPGAMPPPANVIRARVHGRHVYLVPRADGVVVGATQYEH
GHDTAPAVAGVRDLLDDACALLPCLGEYEFAECAAGLRPMTDDNLPMVGR
IDERVVVAAGHGRSGFLLAPWTAKTIGAVLDGGESPAAVDPRRFEKAHSQ
EAR
169631295YP_001704944.1 putative thiamine biosynthesis protein ThiS [Mycobacterium abscessuMNIQVNGDAREVTEGANIWQLLEQLGFPESGIAVAINHTVVPKSDWDTVV
SVGATVEVVTAVQGG
169631294YP_001704943.1 thiazole synthase [Mycobacterium abscessus ATCC 19977]MGTGESLCIAGRTFGSRLIMGTGGAANLSILERALVASGTELTTVAIRRV
DAAGGTGVLDLLKRLDIVPLPNTAGCRGAAEAVMTARLAREALETDWIKL
EVIADERTLLPDAVELVRAAEQLVDDGFVVLPYTTDDPVLARRLEDVGCA
AVMPLGSPIGTGLGITNTHNIEMIVAAAGVPVILDAGIGTASDAALAMEL
GCDAVLLATAVTRAADPERMAAAMAAAVNAGHLARHAGRIPRRFWAQASS
PAPDRPLEQ
169631293YP_001704942.1 ABC transporter ATP-binding protein [Mycobacterium abscessus ATCC 1MIELRSLTKVYGQTPAVDDLSVTIESGVVTGFLGPNGAGKSTTLRMIVGL
ARPTSGTATIGGKQYHEIDHPLREVGALLDPKQFHPNRSARNHLRWIAAA
NDISAQRVDEVLEMVGLTEVANRHAGTFSLGMSQRLGIAVALLGDPKVLL
FDEPVNGLDPEGIHWIRTLMQSLAAQGRTVLVSSHLLSEMANTADQLVVI
GRGRLIAATSMHEFVSRAGADVVRVRSPQIDILRSAAEESGFSVVGGERT
GEPGVLEISGALIEQVGELAARRGVTLYELSPQRVSLEDAYLSLTDDAVQ
YRSQVNDPLAARATGAVADAEGTH
169631292YP_001704941.1 ABC transporter [Mycobacterium abscessus ATCC 19977]MGVVAAERIKVCTSRSAVWCSLLALALGVGLAGLQGGSASIYAPISPGDA
AGGAALVGVPLLMVLAAMTVTNENRTAMVRTTFQATPNRLTVIGAKALVA
GGWVAVVTAVTALTSMALVRAMAGPVAGANLALDSTGVWNTVGAVTVYAF
LCAVLAVAVGVLLKHTAGAVAVLLLWPTVLELMLGWLTDAGKALQPFLPF
ANGIRFTGVPWYTSDGVRFVWDATGSLIYFATVVVITLVAALAVVQRRDV
169631291YP_001704940.1 lipoprotein aminopeptidase LpqL [Mycobacterium abscessus ATCC 19977MATNRVLYAVAVSAACALATVTACDRDAAEAPPRSAPQAGSEEAVGFAHS
LHEKVTVDNVVKHLSALQEIADKNNNTRAAGTAGFDQSVDYVVKALKDKG
FDVQTPEFSFKYFQAKSLDLTVGPKKVDAGVLSYSPGGRVEGRLVPARAE
ESPGCTVEDYDGLDVKGAVVLVDRGSCPFADKERVAAERGAVAVIIADNV
DENKTSGTLGEDSNPKIPVVSVTKSVGADLRAHPDKVVLNVDAETKDVKA
RNVIAQTKTGATTDVVMAGAHLDSVPEGPGINDNGTGTAAVLETALQLGP
SPDVKNAVRFAFWGAEEEGLIGSTDYVKSLDVAALKNIALYLNYDMLGSP
NAAYLTYDGDQSNEPDPNEIPVRIPEGSAGIERTEVAYLAEQGKKAHDTG
YDGRSDYDAFSRAGIPTGGIFSGAEDKMSDEEAKQWGGKAGQPFDPNYHQ
AGDTLANVNKDALKINAGGVAYTVGLYAQSIDGRNGVPVHEDRTRHQLKG
169631290YP_001704939.1 lipoprotein aminopeptidase LpqL [Mycobacterium abscessus ATCC 19977MALFSARGLARGCSLLAIAAVASCCAHPSTPGAAAPTAPNPNLAADLARS
VTVDAMMVHLQQLQQVADANGGNRAEGTSGYDASADYVAKVLKDRGFEVQ
TPELSRLKVLSEGKPLVDIGGRPYALDQASYFAQTPKGGLKANIIRPSGK
ASGCAAADYGTLKVDGQIAVVDGTGCSVVDKHNVAKQKGASAVLVAMQAG
AGEGLFTPNYYEQLSIPVGIIDSGVDTLLRRNSSPVNLVLDMNVAKVRSH
SVIAQTTTGDHANVVLTGAHLDSVSKGPGINDNGTGVAAVLETALQLGPK
PVVNNAVRFAFWTAEEDGLAGSLEYAKSRSPEELNDIALYLNFDMLGSPN
AGYFVLDGDQSAAKPDPNRPPLDVPEGSAGIERTFAGYLNLAGKRPAAEE
FSGRSDYGPFMAAGIPVGGISSGALERMSGPEAKTWEGHAGQPFDPNYHG
PKDTLANVGKTALGINGPAVAFAVGTYALSTTGPNGVPERKLRRHSPLER
169631289YP_001704938.1 hypothetical protein MAB_4211c [Mycobacterium abscessus ATCC 19977]MLVTLASGVVIGAAAAPMTAADPGVKLTYRVTLQDPGTNRQVTISYRTGK
GEKAVKQTWLDPFVPWEHDVTMTTREAVVSLFSDPGGNYLGEILRDGNVI
ASNSVYLEPGWVAEQSAPYGTPTLLARADVP
169631288YP_001704937.1 putative MutT/NUDIX family protein [Mycobacterium abscessus ATCC 19MIAYDEELRNRIRAHLARHERRTVDDPAKRRAAVAVVLVDSDLGEDRIDP
APLEEWIGGREIPGHGLDGRMVDVSGGAAFLLCRRASRLNSHAAQWALPG
GRLDPGEDAIQAALRELDEELGVSLPDSTVLGLLDDYPTRSGYVITPVVV
WGGGRLELSPSPDEVVAAYRVGLHQLQREDSPRYITIPESARPVVQIPLG
NDLIHAPTGAVLLQVRWLCLEGSGDRVDDLEQPVFAWR
169631287YP_001704936.1 putative dioxygenase [Mycobacterium abscessus ATCC 19977]MTDDQTRRIYRDAGITVEKLGEHIGARVNGIELRGDLSADRVEAIRLALA
INKVLVFTEQHHLDDAGQYAFARLLGEPTLPHPTVRSHGTELLNLEGAAN
GWHTDVTFVDRIPKASVLRPVTLPSYGGATTWASTVAAYEQLPKPLRSLV
DDLWATHTNLYDYASSGASGGVSAERRAAYYTEFTSSRYETVHPVVRVHP
ETGERSLLLGQFVKSFQDLPSAEFASLFQLLQARITKLENTFRWNWRLGD
VAIWDNRATQHYGIADFGEQQRELHRVTLAGDVPVDVHGRRSQILLGDAS
HYSGIETPQRLELFAA
169631286YP_001704935.1 putative succinate-semialdehyde dehydrogenase [Mycobacterium abscesMTDHSTLIDAIPTDLWIGGKQVPSSTGTRFPVHNPATGAVLTTVADAAAS
DGAIALDEATAVQRSWAATAPRERAEILRRAWELVIARRDDFALAMTLEM
GKPLAESQGEVAYGGEFLRWFSEEAVRINGRYTSSPTGAGRILVAKQPIG
PTLAITPWNFPLAMGTRKIGPALAAGCTMIVKPAAETPLTMLLLGQVFAD
AGLPAGVLSILPTTNASALTGPLIDDPRLRKLTFTGSTGVGKILLSQCAT
RVLRSSMELGGNAPFVVFDDADVDAAVDGAMAAKMRNIGEACTAANRFHV
DNAVRAEFTEKLTARMGALTIGPGDENGVQVGPLITAKQRASVDELVQDA
VSKGAVVTTGGVVADGEGYFYPPTVLTDVPADARILREEVFGPVAAITGF
DGEEAGIAAANDTEFGLAAYVYTANLDRALRVSQAVESGMVGVNRGVISD
VAAPFGGIKESGIGREAGSEGIEEYLETKYIALP
169631285YP_001704934.1 4-aminobutyrate aminotransferase [Mycobacterium abscessus ATCC 1997MTDITYRLAQKRTIVTPLPGPRSGALAERRRAAVSAGVGSTAPVYAVDAD
GGVIVDADGNSFIDLGAGIAVTTVGASHPAVAAAIADQATHFTHTCFMVT
PYEGYVQVAELLNALTPGDHDKRTALFNSGAEAVENAIKVARLATGRPAV
VAFDNAYHGRTNLTMALTAKSMPYKSQFGPFAPEVYRMPASYPLRDEPGL
TGEEAARRAISRIETQIGAQSLAAIIIEPIQGEGGFIVPAPGFLATLTAW
ASENGVVFIADEVQTGFARTGAWFASEHEGIVPDIVTMAKGIAGGMPLSA
VTGRAELMDAVYAGGLGGTYGGNPVTCAAAVAALGVMRELDLPARARAIE
ASVTSRLSALAEEVDIIGEVRGRGAMLAIEIVKPGTLEPDAALTKSIAAE
ALSQGVLILTCGTFGNVIRLLPPLVIGDDLLDEGITALSDIIRAKASHQ
169631284YP_001704933.1 putative amino acid transporter [Mycobacterium abscessus ATCC 19977MTEDLARAELDHAERSEGLVSKGLAAGRIGTFTGAVLGISTVAPGYTLTA
SIGLIVAAVGLKMPAILIAGFIPMFLTAYAYRELNSRAPDCGASFTWSTK
AFGPYVGWMCGWGMVIATIIVLSNLASIGVQYGYQFLGAVTHNQTVAELA
NNKAVNIISTVALLAIATYISSRGITTSEKVQYVLVGFQMIVLVLFAVVA
IVKAPGAAGHLDFDLDWFNPMTGLTLSAFVIGLVGSIFAFWGWDTCLTLG
EESKDPTKVPGRAGLLCVLSILLTYLLVAVAVMMFAGIGDTDLGLANENN
KDNVFGALANPVLGSWFGPLLLLAIFASAIASLQTTSLPAARTMLAMGTY
GAFPKRFASVSPRFLTPTFSTVVAGVVTAAFYTIVSLLSDRTLLDTIAAL
GIMICWYYGITAFACVWYFRAELFQNAHNLVYKFLFPLLGGLMLAAVFVI
SVQESMDPEKTGSGASIGGIGLVFYLGFGILAFGALLMGIMRWYQPAFFR
GELLTMDTPPLRE
169631283YP_001704932.1 hypothetical protein MAB_4205 [Mycobacterium abscessus ATCC 19977]MNTAATRIAVAYLATPGGDDALAVGAQIARSLGAHLDLCMVLPLDRPILA
PLPQQERQDILSQNAAHWLNHAEATVPDDLSVTTHISFHESIAEGLIAQS
EALGAAAIVVGGSGGGLVGSLSLGSVVNELVHSSPIPLVISPRGARYQKN
LRIREVTCAMGTRPGARVLLDTALRICKRAETPLRLVSLVSIDPIPGGDD
DQSARERATIHAQQSLETAKLVLPPDFPVTSTVAEGPTVEAAVNKLDWHE
GDIIMVGSSRLAQPRRLFLGSTAAKMLRVLQVPMVVIPKEEGGDSD
169631282YP_001704931.1 tyramine oxidase [Mycobacterium abscessus ATCC 19977]MNDTFHPLDPLSAEEFTTVAKILAQTHDVGASWRYTSVELSEPSKAEVAA
FDNNGTRPDRRALATCLDTTQNATYKAVISLTSGEVLSWNHIPGVQPNFT
VDEWEEADAVLRGHPDVIAALARRGITDMDLVFMDTWTYGDAVMPEKYRG
RRLGWSDTWVRAADGANPYAGPVNGFHCVIDMNSMELLDIEDTFTVERPT
MMGEYVPRHVPERLRKQSTRESLQPLHITQPDGPSFTIEGNKLQWQNWSL
RVGFNYREGMTLHAVTYNDNGRVRSVANRMSFAEMMVPYRDHCEDHYRRT
AFDIGEWGIGFMTTSLELGCDCLGEIRYLDAVLHNSKGEPYTIKNAICIH
EEDNAVLWKHVDHDHGAQVRRMRRLTVSFHVTVANYEYLTYWRFYQDGNI
ECEVRATGIMVVSNFTEGAAHPHGTLVDNRTYAPYHQHFLVARLDLDVDG
TENTVYATETEIEPVGPENPYGLSLRQRNTPLRTESEGKQDFCWETQRAW
KVVNDNTRNGIGTAPAYKLVPGAAIPSMFDPSSPVLARCRAIEHTLWVTP
NSPDERWPAGEFVTQSKEDHGLPAWTEGNRSIENTDVVLWYVFGIHHITR
PEDWPIMPVDTVNFWLKPVGFFDRNPSLDVAPTPPKSCHMSGHQED
169631281YP_001704930.1 putative aldehyde dehydrogenase [Mycobacterium abscessus ATCC 19977MPDSVLQNYIDGQFVDALSLKSSEPIDLINPVDESVVGRAPVSNLEDVNA
AVAAAERAFESWGRSTPSFRQQALLKLADAIEAHTDEIVDAQCRNTGQPK
AVIAAEEVAVSADQIRFFAGAARLVEGKSAGEYMEGFTSYVRREPIGVVG
QVTPWNYPFMMAIWKIGPALAAGNTVVLKPSDTTPESTLVLARLTKGILP
DGVFNVVLGTAATGSDLVSHPAIGLVSITGSVRAGIAVATSAAGQLKRSH
LELGGKAPAVVFGDVDIDKAALGIAQAAFFNAGQDCTAATRVIVHESIHD
DFVNALDTAAQTLRPGLPDDPDSFYGPMNNINHFTTVTEKLDNLPAHATV
VTGGKRWGETGYFIEPTIVTGVRQDDAIVQEETFGPILTVQSFADAGEAL
RLANGVRYALASSVWTKDHATAETFTRELNFGCVWVNCHIPLVAEMPHGG
FKYSGYGKDLSAYSVEDYTRIKHIMSAHA
169631280YP_001704929.1 putative regulatory protein [Mycobacterium abscessus ATCC 19977]MRWVLDQPELKLTLKSGAAGVGREINLALTTELADPAQWLSGGELVLTTG
IGLPKSSRDRRRYLRSLDENNVAALGFGTGLTFDEVPPELVSTADELGMP
LLEIPLRTPFAAVVKAVSTRIAELEYDAVLRASRAQPRITRAIVNGGVQA
VTAELGRSLRASVVVLDPGGTVVASHPRNLDVATVNLVRGALSPGASAGV
QQLDPGITVSQQAIGVGGTSYGVLAVVSKTPLTFVDQVLLGHTNSLLALD
FDKPSRLQEAQRRLNGQALGLLLGDERNLGPVWAQLGQAADARGRIRVLV
VDAESQTALVRVLPAVTRDMESAGYPVFAHTGERQLTVVLPGAETADFAR
RLFGDVDARIKKGLRAGLSGAHPVGRLADAVQNARLAASVAERGGTPLEF
TSLAGSALLSFGASREVLVAVANATLEPIVEHDAVHGSELMTSLRAYLEA
NGHWESAATVVGVHRHTLRKRIETVQSLLACDLDIARVRAELLLAMLTGT
PGTGN
169631279YP_001704928.1 TetR family transcriptional regulator [Mycobacterium abscessus ATCCMVEASPVRPAAMPSTRRQHEQYKRMLDAAEELAMTRELDHVQMHDVAKHA
NVAIGTLYRYFPTKRHLFVSALVRESERLVGRLPSLPDGGQAAADRVADA
LVRALRGLTRRRMLAIAMIRSSNSASLAEVPDLMQIEKRFHELISEVAGL
SDPTDDDEAVIRLLVHQWFGCIQVCLNGGLTVAQAEADLRRASRLLMRDW
PSVSS
169631278YP_001704927.1 putative sigma factor [Mycobacterium abscessus ATCC 19977]MINSDEHAERFTLLRPLLFTIVYEILGSATESDDVLQDSYLRWAQVDLAT
VRDTKSYLAQLVTRQALKALRTSVRRREDYIGPWLPEPLLLDEHDGSADV
LLAESVSMAMLILLETLTPDERAVFVLREVFGFGYDEIAGAVSKSATAVR
QIAHRAREHVHARRKRFDPLDAKESTRIAEQFLLATETGDVEGLMALLAP
DATWIADGNGRAGAARRPLTGAGKLARIFAGPFRKGMADRRTEIVIANAA
PAVAVYAGDALEVVITMEIADGKITRLYAVANPDKLVAAATTRMVSR
169631277YP_001704926.1 putative oxidoreductase [Mycobacterium abscessus ATCC 19977]MTDQHPHVVVLGGGYAGTMAANRLQQHTNIDITLVNPREEFVHRLRLHQF
AAGTGIATAEYAPMLGKRVRLVVDSAVRIDAPARMIRLESGDVLDYDYLI
YAIGSTDSTAAGVPGLSEFAYPLSEFESAQRLRVALETSGPDVQITVVGA
GLTGIEMASELADLGRHVRLVCGGQLAPTFGAPARRTIAQWFARRRVDVL
ENTSVTEVRPDSVVLADGTALSSAITVWAGGFGVPALAAHSGLSVDADGR
LLTDDTLTSMDDGRIIGAGDAVTTTSLPTRMSCYTANTTGAAAADTVLSR
LADTEPAPFRLAYVGQCLSLGRRNAVLQFTRKDDSPVGAHARGRLTAWFK
EFVLTGVPWGLRREGRKPGASVWFKSRPRPAEAAQHRAEVVQS
169631276YP_001704925.1 hypothetical protein MAB_4198 [Mycobacterium abscessus ATCC 19977]MSTEELPDIAGIAHHPDGHPRGAVVLTHGAGGSCHSPMLRLLCTAWAERG
WLAIRFDMPFRRNRPSGPPSASSADKDRAGIAEVINKARAMVDGPLLAGG
HSYGGRQTSMLVAEKGPIVDVLTLFSYPLHPPGKPDRLRIEHLPDIQVPT
VFTHGTSDAFGTIAELKEASVLIPGGAAIVEIAGARHDLGSKTIDVPALA
IDAALTALKS
169631275YP_001704924.1 phosphomethylpyrimidine kinase [Mycobacterium abscessus ATCC 19977]MRSPFLPLPEPGTTPVRAMTIAGSDSGGGAGIQADMRTMALLGVHGCVAV
TAVTVQNSLGVKDFHEIPPPIVAAQMEVVITDIGIQAAKTGMLASAPIIE
AISESWSNLAPSVPLVVDPVCASMHGDPLLHPSALDALRTRLFPLATLVT
PNLDEVRLLVDIDVVDEDSQKEAARKLHALGPQWALVKGGHLRSSDTSTD
LLFDGTEFHYFPVERVDTGHDHGAGDTLAASISCALAHGLPVTEAVAFGK
QWITECLKAAYPLGHGHGPVSALFRLDA
169631274YP_001704923.1 thiamine biosynthesis protein ThiC [Mycobacterium abscessus ATCC 19MSTPSSRSQAPETVTTGPIQGSEKIYQELPNGLRVPQRRVNLTNGEYLDL
YDTSGPYTDTNAVIDLHKGLPPRAGIVTDRGTQLQRARAGEITAEMEFIA
VREGVPAELVRTEVAAGRAVIPANHKHPESEPMIIGKAFGVKINANIGNS
AVTSSIAEEVEKMVWAIRWGADNIMDLSTGKDIHQTREWILRNSPVPVGT
VPIYQALEKTNGDPAALTWELYRDTVIEQAEQGVDYMTVHAGVLLRYVPL
TAKRVTGIVSRGGSIMAAWCLAHHRESFLYTHFEELCEILARYDVTFSLG
DGLRPGSIADANDEAQFAELRTLGELTKIAKSHGVQVMIEGPGHVPMHKI
VENVKLEEELCEEAPFYTLGPLATDIAPAYDHITSAIGAAIIAQAGTAML
CYVTPKEHLGLPDRKDVKDGVIAYKIAAHSADLAKGHPRAQLRDNALSKA
RFEFRWEDQFNLSLDPDTAREFHDETLPAEPAKTAHFCSMCGPKFCSMRI
TADIREFAAENGLETQEDIDAMLARGMEEKSAEFAEHGNRVYLPIA
169631273YP_001704922.1 major facilitator superfamily [Mycobacterium abscessus ATCC 19977]MTDLITRVDETAADIETARRRVRVDRDHPHYKWVALSNTTLGVLLATINS
SIVLISLPAIFRGIGLNPLAPGNVSYLLWMLMGYLLASAVLVVLFGRLGD
MYGRVRIYNMGFVVFTVSAVVLSFDPFHYGGGAVWLIAWRVVQGVGGAML
MANSSAILTDAFPSTQRGLALGINQVAAVAGSFLGLLIGGVLSEWDWRAI
FWVGVPLGLLGTVWSYRSLVEIDQPTPGKLDWAGTVTVALGLTVLLTGIT
YGIQPYGNASTGWSNPLVYGSLIAGVALLVLFCVIEARVADPMLDIRLFK
NRAFGLGNLANLLASVGRGGLQFMLIIWLQGIWLPLRGYSYESTPLWAGI
FLLPMTLGFLVAGPVAGLLSDRYGARPFATGGMVLSAVTFLALIAIPVNF
NYWVFALLIFLNGLGSAIFTAPNTAAIMSSVPAHQRGAASGVRGTFFNAG
SSLSIGIFFSLMIVGLSATMPAAMQSGLTVQGVPASTAAQVSSLPPVGSL
FAAFLGYNPVGELLAPSGVLEQPGVNTAELTGQSFFPNLITEPFHAGLVV
VFGAAALMMAVAALASLGAGGKYAHADD
169631272YP_001704921.1 hypothetical protein MAB_4194c [Mycobacterium abscessus ATCC 19977]MATWGISGPVDLLRRTGFLWWRCWPRLIGIWLAGWLVRHWLIKLAVYVGV
HFGGFWGDLVMPLAVVARLATYILMYLVLRSESDLTGEASGPWYRGFVGI
LLKAILPVFVLFAAWRLILADYSSYVGLLNIDLYYAMDAGLSPDKTLEQT
KEYMTPSDWRAYLAILLAFLARGALTKYSEKLPSWTQLVAVYLQALWVVL
LLNAASNRLVGSPRWISERKIIVWYTERKQHVLTYLSSFGEVWKWISDAV
GPMVLAVLLAVTWIAIVGAVYSVRPDTTWAGVSRAAFGEQQGARVTDVAS
RTGIAARARWQRLPRLVQTRGNEIFRNLLGVADQLGDTLRLTLHSGPITF
CFFVFAFMGTVVLDPNGAYFNVYVTDGYMWRAIATLLGPHEWMWWASYRE
SIRTAIAALVDPLRTCLVVAMYWHCVERASAPPVTQEV
169631271YP_001704920.1 hypothetical protein MAB_4193 [Mycobacterium abscessus ATCC 19977]MRNWLRHNILGVALVAVGTLTYGATVGYPAWKEGLGSDVPAATVPAGATV
RIDGVLWRMRVLEMPPPEYTRYDDPQPPGTRFVSYAFDRSRDGRPAPLGE
EWGACRATFVDQNYRHWYGQSGLLPMSVSQWLRKQGYDTCNTPGSFAAVM
VVPKDADITAVDVEFSPAKGSGKKYRYVRFTPPA
169631270YP_001704919.1 hypothetical protein MAB_4192 [Mycobacterium abscessus ATCC 19977]MRRGHVIIAMQTIACLLLLAGSAYLYTIVPQRTDSYAPAVVHGSAPTRVA
GRNLAITVHRVFSAPEVQVKRSVSDTSIDLYRTKGRYIAIDLSYETVRMP
DVIELQLMADHRNISRENFGTDKAFGQPEVGIRGTWVFDVPASTTSLKLL
AIIFPDNDFRIMQGWYDSELSIAIPPEMVEQRQSLSVVQHKVVP
169631269YP_001704918.1 hypothetical protein MAB_4191 [Mycobacterium abscessus ATCC 19977]MGGAEPTGESEEPEKNQFLDRFSLKRLHQVAIVAVLATTAAFGGLDKAEP
MKPVTLGASYTNGIYKITPHKVALICDVSRLPTRNALLLEKAAKDSTLVG
LFTTVENVSDSGRVVLHDVRPSDEDVFDLLGVDGIRDEGAYGPYGLVSGP
QPGKEQDVIVVWGFPFGKAKPGDEVTIRISDFAEQHGLASTVTTWGTTEE
YGELRTTMERCA
169631268YP_001704917.1 hypothetical protein MAB_4190 [Mycobacterium abscessus ATCC 19977]MRCLRVLAMALIVTACASPSNGVEIVTNGETPTAFSPPTTSTKAKPKPIV
ALPAPTGSIGDIKRRNLFNEAVRLTSSIVSPTLIEPRFDSAGLTGVVMLY
KEGLLDDSPGGTGKLLDSVIRDYGYVTGVRAEREPSGDASTTEILQNTVL
IFKDDASASAAAEAGFRLREEQDPDRRSRAQTEVIPGFADAKAFTRRIGE
GSAVFAYTTAFLQKGPLVIRISVGQRPETESVDIIARYLRRQLTALEDFT
PTPLDQLSSLSPPFDPDGSLLKLATDTTEFGPSGSGGVFDAQGALLFESD
IQSWSEVYRKTGVDRLVLASDGELTRAADTEKAAVLLAKIRPGFLARKGY
EPTGAPSTVPSAECLQYTSVVPSDDPLQRCLFARGRYVTWVEGTRSVIGQ
RAQDRWNRLG
169631267YP_001704916.1 exodeoxyribonuclease III protein XthA [Mycobacterium abscessus ATCCMRLATWNVNSIRARADRVISWLERSGTDVLAMQETKCSDKQFPMQAFTDA
GYEVAHVGFSQWNGVAIASRVGLEDVTVGFEGQPGWSSSEDIEEASEARA
LGATCNGVRVWSLYVPNGRTLEDPHYQYKLRWLSALRDTAAGWLADAPDQ
QVALVGDWNIAPTDDDIWSVEAYQGSTHVSEPERSAFTAMNDAGFADVVR
PFTPGPGVYTYWDYTQLSFPKKRGMRIDFVLGSPEFAKRVGNAHIDREER
KGKGASDHAPVVVDLD
169631266YP_001704915.1 hypothetical protein MAB_4188 [Mycobacterium abscessus ATCC 19977]MHLPGLGTRVAIRSRRPPGSVPPFTDTVGELVAAAPTVQVLHKSGAVVDI
SADNIVSVRVLPPVPVLNRDIRSMQRAAALAWPGLEHQWLDGWFVRASDG
HTRRANSAVPLDHSASSRALGELDAWYTERGLPTLLCLPDRLIHPPDDLA
TSDETVVMVRDLDNAGTDTLPAEPSADWLALHGDNHPLVVPVLTAVVDGT
LGFAAVASEGSTAAIARGAVTENWLGISAVRVAENQRRRGLAAQVCDILL
GWGAALGARRAYVQVRADNAAALALYPTLGFTEQHRYRYAQIRAAGHEK
169631265YP_001704914.1 peptide deformylase [Mycobacterium abscessus ATCC 19977]MAIVPIRIVGDPVLHTPTQPVPVGPDGSLPDDLPELIANMYETMDAANGV
GLAANQIGVPLRLFVYDCAETRGGGTRHRGVVINPVLETSEIPETMPDPD
DDEEGCLSVPGESFPTGRAGWARVTGLDADGKEVTLEGNDLFARMLQHET
GHLDGFLYIDKLIGRNARAAKRAVKSNGWGVPGLSWTPGQVADPFGH
169631264YP_001704913.1 hypothetical protein MAB_4186c [Mycobacterium abscessus ATCC 19977]MDGAQARAEQSKAANAGEDSPAVGSDGVEIAAGLSRREHDILAFERQWWK
YAGSKEDAIKELFGMSATRYYQVLNALVDRQEALAADPMLVKRLRRMRAS
RQKARAARRLGFEVT
169631263YP_001704912.1 hypothetical protein MAB_4185c [Mycobacterium abscessus ATCC 19977]MNERVPDSHGLPLRAMVMVLLFLGVIFLLVGFNALGSDKSASSDSTSTSV
SAAAAPKSTTPPPAPKPEVRVYNTTSVPDLARGAADQVTAAGWKVAEVGN
LPMPEVNVTTVFFGKTAGEEEAAHEIAKVLGVQAAPRAPELLEQPPGVVV
AVAI
169631262YP_001704911.1 superoxide dismutase [Mycobacterium abscessus ATCC 19977]MKPMVKPAVLASGTLAAVALSLSGCSPDQQASTTPGTTPPVWTGSTAPAT
AGEHGGHGGGEQPVPAGEKLNATLKLADGTPVATAAFVFQDGYARITVKT
TQNGKLTPGFHGLHIHSFKKCEANSVAPAGGAPGDFLSAGGHFNVPGYTG
HPSSGDLVSLNILKDGSGELVTTADSFTKEDLLAGNGTAIIIHEKSDNFA
NIPAERYTQANGASGPDDTTKSTGDAGKRVACGLIDAG
169631261YP_001704910.1 carboxylate-amine ligase [Mycobacterium abscessus ATCC 19977]MARPIEFRGSPRPTLGVEWEFALVDAQTRDLTNAASAVLAAIGETPHVHK
ELLRNTIEVVTGICGTVGEAMHDLQTTLATVRPIVQSMGMELFCAGTHPF
ARWSAQQLTDAPRYDELIARTQWWGRQMLIWGVHVHVGISSKHKVMPIVT
SMLNYYPHLLALSASSPMWEGQDTGYASNRAMMFQQLPTAGLPFHFQAWE
QFEGFVDDQMKTGIIDQLNEIRWDIRPSPALGTVEVRIFDGISNVAELEA
LVALTHCLVVDLDRKLEAGESLPTMPPWHVQENKWRSARYGLDAVIILDE
DSNERLVTEDLDDLLTRLQPIARLLECETELAAVEEIYRHGGSYQRQRRV
AEEHDGDLGAVVDAVVNELEPVRYTDSQ
169631260YP_001704909.1 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate MSTVMHTAEPAQELIRIATAGSVDDGKSTLIGRLLYDSKSIFADQLAAVE
ASSKAKGETQTNLALLTDGLRAEREQGITIDVAHRYFSTPARKFIIADTP
GHEQYTRNMVTGASTADLAIILVDARNGLTQQTRRHAFITSLLGVEHVVL
CINKMDLVDWSPQRFDEIKEEFRRFATKLELHDLTVIPVSALLGDNIVTR
STNTPWYEGPSLLHHLEQVHISSDRNLIDARFPIQYVIRPQGGAAAPGAE
RITDLHDFRAVAGTVASGVFKPGDEIVALPSGFTSSVAAIWGPGGSVVDE
AFAGSAVSVQLADQLDLGRGDMLCRPNNRPLVGAQIDAMVCWFTDVSTLS
EGSRFVMQHANSTVKAAIAGLDYRLDVNSLHRDQEAKELKLNEIGRVQLR
LQRPIMFDPYRRNRTTGSFILVDEATNNTVAAGMISGPTLHQSKVVWHSS
AVSRDERSTKGGTIWITGLSASGKSTVAVELERRLVARGIPAYRLDGDNL
RHGLNADLGFSAADRAENVRRVGAVAQILSDSGVVAVAALISPYRADRDK
IRAQHEKAGLPFVEVFVDTPVEICEQRDPKGMYAKARAGEISDFTGVNAP
YEAPENAELVLRPEEGDPEQQAATILDYWLSV
169631259YP_001704908.1 sulfate adenylyltransferase subunit 2 [Mycobacterium abscessus ATCCMPTSSDVLHPRGSSPADSYELSHLNALEAEAVYIFREVAATFERPVLLFS
GGKDSVVMLHVAAKAFWPSPLPFPVMHIDTGHNFDEVIAFRDETVGRYNL
RLEVGSVQDDIDSGAVVEETGPGATRNRLQTATLLRSINEHRFDAVFGGA
RRDEEKARAKERVFSFRDEFGQWDPRAQRPELWNIYNGRHRKGEHIRVFP
LSNWTELDIWQYIESESIVLPSLYYAHQRNVVERDGMLLAETRFLTLQPG
EKLVEKSVRFRTIGDATCTGAVESVASTPSAVVEEVAATRITERGATRAD
DRISEAGMEDRKKEGYF
169631258YP_001704907.1 IclR family transcriptional regulator [Mycobacterium abscessus ATCCMIEDRDNGAGRTSPPTERVMAVLDFLAQHRTERFGLSELARRLGLSKPTC
LGIVTTLAESGFLIRDDRDKTYSLGPALIRIGRAAQESLRAKPASRDQLL
ALTREFGHTAALSAVVSDRVTVLEVVSDPDHPVRVEVGQSYPFTPPVGLM
FVLWDTDETITSWLAKDPTAPGRTADDRLRKVIEECRADGYLVELLTPAG
RQLYSLMAGVPGDIPNELRALLGEIVSGIGERVYLRSENYTVGSGAKVRH
RVNVISAPVYDHNGKQAMVASLYIADDLTDAEITTRAKALVGTADGITEH
IGGTKPF
169631257YP_001704906.1 hypothetical protein MAB_4179c [Mycobacterium abscessus ATCC 19977]MYSEAFTAAIVEAEELIVAAPHIETEADLLEGLQYLAQGIAACTHMAFHT
DRDHPFLLSGTGPFTKMGLDNPDTLYFGARVSGEYEYVVTGKRGTTTDLS
FQVLGGGDYTDKNVPGSAIAFDDREIHIDSDGSFEVRFGPAPADDSRPNY
FTLGPGPAQLVMREVYSDWREQRGSLAIARVDTAGTAPAPLTKEQIEKRY
ASAGKQLVNRVKTWLQFPKWFYDNLPVNTMTEPRLTPGGLATQFSSVGHY
DLADDQAMIITVPKSDAPYQGFQLGSLWYISLDYINHQTSLNSSQAQIDP
DGNIRMVVSNTNPGVTNWIETLGHRRAYLQFRWQRADRQLTPADGPTVEV
VAVGDIPAKLPHYSQNQISEEGWRSRIAERQTAIGARMLG
169631256YP_001704905.1 short chain dehydrogenase [Mycobacterium abscessus ATCC 19977]MSLLNFDGKVVVVSGIGPGLGAALAIKFAEAGADVVLAARTQSRLDEVAR
QIAATGRRALAVATDITDEASAANLVERATEEFGGIDVLVNNAFSIPSMK
SLEKTDYQHIRDSVELTVVGTLRLTQRVAAALAQSKGAVVNINSMVIRHS
QVRYGSYKIAKAALLAMSQSLATELGPQGVRVNSVVPGYMWGENLKGYFE
HQAKKYGGTVEQIYEYTAANSDLKRLPTTDEVANAVLFLASDLASGITGQ
ALDVNCGEFHA
169631255YP_001704904.1 hypothetical protein MAB_4177c [Mycobacterium abscessus ATCC 19977]MSFESSAERTSVGTVDDLHESATRLIGLDDFGDGSVDNYREALGVLLDSY
QGEAGLTPLGSKMSRVFLRGALGARLLSEAAFKAHPDYAQVAIDRPIFVT
GLPRTGTTALHRLLNADPMHQGLEMWLADFPQPRPPRDTWDANPVYQQLE
GQFSKHHVENPEFMGLHYMSASEVEECWQLLRQSVHSVSYECLAHVPSYA
RWLSGQDWTPAYRRYKANLQLIGLNDIEKRWVLKNPSHLFALDALMEVYP
DALVIQTHRPAETIIASVCSLNEHATAGWSETFTGATLGADQLDTWARGL
ESFKSARAKYDESQFCDVDYFDFISDPIGTVESIYRHFGLELSASALVEM
QKMNDESQKGPRAPKHVYSLADYGLSKEAVMERFAGL
169631254YP_001704903.1 hypothetical protein MAB_4176c [Mycobacterium abscessus ATCC 19977]MTRVAVIGAGAAGTMAALHLLRRNDSRELHLTLVDPDAKTGPGVPYRTTD
PRHLLNVPAGKLGVDSAEPLGFVAWLHDNGQTDTGPGDFVSRGLFGRYLS
HTFERARGDRVSRLHHRAVAVRRGGDGLSVALGNGEIAHVDAVILAAGPN
MPGASWAPSSLRDSALFIRDPWRQDVLEDLPDDGDLLLVGTGLTMVDLAR
TLRRPGRVLHAISRSGLLPRAHRAFPAAPPPTFAMDRGKVLERSVRYIHD
VTAQSGDACAAVDALRPHAAELWARMIADERAVFLRKYRRQWDIHRHRMP
PQSAAQIEQDVAAGALRIYRAALAGTSTSGAEIRATLSTGQVLDVGAIIN
CTGPRYDIAAGADPLWSQLLDDGLVRPGPLNLGLDTDPSGRLLPGHVPMW
ALGPLRRGNLWETTAFAEIRSQAEALAALIGS
169631253YP_001704902.1 D-tyrosyl-tRNA(Tyr) deacylase [Mycobacterium abscessus ATCC 19977]MRVLVQRVVSAAVSVDGEVVGAIRPDGQGLLALVGVTHDDDAEKAAQLAE
KMWQLRILDDEKSAADVGAPILVVSQFTLYANTKKGRRPAWNAAAPGGVA
EPIVHAFADALRKLGARVEAGVFGAHMRVELVNDGPVTVLLEL
169631252YP_001704901.1 hypothetical protein MAB_4174 [Mycobacterium abscessus ATCC 19977]MPRRRKAEAMTEVSASAEANTSPPTVEELAQSMLSLHGAHGEDTAHEANA
PGRPNGHWSKAPAFEHDPERAARLHAATEGDKQRYLTSGLQEVDCRFCHG
SVMVKKLGVNHTAVQWNTAATDKCAFFAQMREEGTNTARIRGCPRLSDSI
AHAIAEGCLDPICSAPPPGDG
169631251YP_001704900.1 oxidoreductase [Mycobacterium abscessus ATCC 19977]MSTDTAGIGVREIDVGELPTRYARGWHCLGVAESFRDGEPHAIDAFGTKL
VVFADTQGDIKVLDGYCRHMGGDLSQGSIKGDNVACPFHDWRWGGDGKCK
LVPYAKRTPKLARTRSWITDVKSGLLFVWHDAEGNGPTDDVEIPEIPEYS
DDGWTTWDWNTIVIEGSNCREIVDNVTDMAHFYYIHFGFPTYFKNVFEGH
IASQYLRTVGRPDVQLGGSSQYTGEQILDSEASYFGPSFMINWLHNNYGG
YKAESILINCHYPIDQNSFVLQYGVIVQKPAGMDEKMTGKLSRAMTKGVG
QGFLQDVEIWKNKTRIDNPLLVEEDGAVYQMRRWYSQFYVDKADVTPEMT
DRFELEIDTTKANEFWHGEVDENLQRQALEKEKAEQAAAESGSHAEATQS
169631250YP_001704899.1 siderophore-binding protein [Mycobacterium abscessus ATCC 19977]MPLYSLDGKSPSVHPEAFVAPTACLIGDVTVEAGVSIWFNTVIRADYAPI
IIRVGANIQDGSVLHSDPGMPVDIGEGATVAHMCLVHSCTVGDGALIGNH
ATVLDGASIGARSMVAAGSLVLGGAQIPADVLVMGSPAKVKGPVAGTPAE
FLTKGVPAAYRELGKRYLAGLDK
169631249YP_001704898.1 NADPH-ferredoxin reductase FprA [Mycobacterium abscessus ATCC 19977MRKIRVAVIGAGPAGIYAADILTKEYEHAQVDVFDRLPAPYGLVRYGVAP
DHPRIKEIIKALRRVLSRDEIRFIGNVHYGTDIKLSELRRFYDAVIFSTG
ARADRGLDIPGIDLPESYGAADFVSWYDGHPDVPRDWPLTATSVAVLGAG
NVALDIARMLAKPADEQLSTEIPANVYQGLALNQATDVHVFARRGPAQIK
FSPMEFRELSHSPSVDVIVHPEGFEIDEGSQQAINSSKATKLVVDTMMKY
LGQEPTGAPHRIHIHLCQSPAAVLGIDRVEGLRTERTELIGDGTVRGTGE
FTDWPVQAVYRAVGYLSSHLADLPFDHHAGVIPHDAGRVLDIDGIPIEST
YVTGWVKRGPVGLIGHTKSDAAETITSLLADLPGIQPAEISDPDAIFAHL
RGSGIDYTTWEEWERLDAHEVALGQEQSRERIKVVPREEMISAGRQAS
169631248YP_001704897.1 hypothetical protein MAB_4170 [Mycobacterium abscessus ATCC 19977]MSLADQAGKRSRAAVEARDKQAWVDNFAEDGVVQDPVGPSPFDPDGNGHR
GKEAIAAFWDNIIAPTEKLDFIFDATYDCGTHQANVGRIITTMNGYQMTA
EGVFTYEANDEGKLVVLRAYWEFDKVAGTAKKV
169631247YP_001704896.1 acetyl-CoA acetyltransferase [Mycobacterium abscessus ATCC 19977]MGASKNLAAVIGTGQTKYVAKRQDVSMNGLVREAIDRAMTDAGVDWDDID
AVVVGKAPDFFEGVMMPELFMADAIGATGKPMIRVHTAGSVGGSTGVVAA
SLVQSGKYRRVLALAWEKQSESNAMWALSIPVPFSVPVGAGAGGYFAPHV
RAYIQRSKAPLDTGAMVAVKDRLNAAKNPLAHLHQPDITVEKVMSSPMLW
DPIRFDETCPSSDGACAIVVGDEQTADRRIKEGHAVAWVHATALRTEPLD
YTGRDRVNPQAGRDAAAALWKDAGITSPIDEIDVAEIYVPFSWFEPMWLE
NLGFAAEGEGWKLTQAGETAIGGKIPVNASGGVLSSNPIGASGLIRFAEA
AIQVMGKAGDHQVPGAKKALGHAYGGGSQYYSMWVVGSEKPAGKEQ
169631246YP_001704895.1 lipid-transfer protein [Mycobacterium abscessus ATCC 19977]MTDVAVVGFAHAPHVRTTEGTTNGVEMLVPCFRQIYSELGITKSDIGFWC
SGSSDYLAGRAFSFISAIDSIGAVPPINESHVEMDAAWALYEAYIKILSG
QVETALVYGFGKSSAGILRRTLALQTDPYTVAPLWPDSVSLAALQARVGL
DSGKWTKEQMAQVALDAFRRAQRVDSEPSASSVDELLARDYFADPLHKHD
IAPISDGASIMVLAAGDRARELRENPAWISGIEHRVETPILGARDLATSP
STAASAVAATGGDTGSIEVAELYAPFSHQQLILAEAIGLKDSTTVNPSGG
ALVANPMFSAGLERIGFAAQHIWNGSAQRVLAHATSGPVLQQNLVAVLEG
K
169631245YP_001704894.1 hypothetical protein MAB_4167 [Mycobacterium abscessus ATCC 19977]MTATQSSTTGPLPLLTAPLELSFDYTRSVGPTLSKFFTALRDRQIVGTRG
SDGKIHVPAAEYDPVTYAPLTDVVPVSSVGTVQSWSWQPEPLEGQPLAKP
FAWALIKLDGADTSLLHAVDVGTAGSAGITTGARVHAVWADETVGAITDI
AYFALGEKTAATPAPTSDQEPVTMQVTPIRLEVQHITSPEESAYLRALSE
GKLLGGRTGAGGRVYFPARGADPLTGEPTSDLVQVADKGVVTTFAIINIP
FPGQRIKPPYVAAYVLLDGADIPFLHLVYDIDPADVRMGMRVEAVWKPKE
EWGYGIDNIQYFRPTGEPDADYETYKDRV
169631244YP_001704893.1 putative luciferase-like protein [Mycobacterium abscessus ATCC 1997MKFGLQLGYWSASPPENAGELVAAAEEGGFDAVFTAEAWGSDAYTPLAWW
GSDTSRIRLGTSVIQLSARTPTACAMAALTLDHLSGGRHILGLGVSGPQV
VEGWYGQPFPKPLARTREYIDIIRQVLAREAPVRSDGPHYPLPLTGDKAT
GLGKPLKPIVHPLRSDIPIFLGAEGPKNVALTAEIADGWLPMFYAPRLAD
MYNEWLDEGFSRPGARRSREDFEIAATAQVIVTEDRRSVLDQLKPFSALY
IGGMGAVELNFHAEVYRRMGYGEVVDEVTELFRTNRKDKAAEAIPDELVL
DTTIVGTEAEVREQIKAWEAAGVTMLVVGCRSVEHVKQLSALT
169631243YP_001704892.1 hypothetical protein MAB_4165 [Mycobacterium abscessus ATCC 19977]MTPMFPLQSVLLPGEPLPLRIFEPRYVAMIRDVLAADHTFGVVLIARGRE
VGGGDVRHDVGTAARVLDCESLGADRFAVRCEGAGRIRITRWLEDDPYPR
AEVEPWPDEPDERVLPLSALNEVQVRIENLLRRVATARQVRLPRRWSIAT
GLPSGAEKRLYALASRVPMGQADRYAVLAAPTLEKRVSALNDAVDTVNAM
LDFRESDR
169631242YP_001704891.1 enoyl-CoA hydratase [Mycobacterium abscessus ATCC 19977]MTEADALRASGSSHTVTEQDAPHALVELRDHVLIVTMNRPHARNALSGEM
LEIMTQAWDRVDNDPEVRVCILTGAGGYFCAGADLKAMNKRAPGDQFSDG
SYDPSVIPGLLKGRRLTKPLIAAVEGPAIAGGTEILQATDIRVAGESAKF
GVSEVKWSLYPMGGSAVRLPRQIPYTVACDILLTGRHIKAPEAKDIGLIG
HVVPDGQALEKALELANMIAGNGPLAVQAVLKTIRDSEGMHENEAFKADT
KVGIGVFTSNDAKEGPRAFAEKRAPNFTGS
169631241YP_001704890.1 acyl-CoA synthetase [Mycobacterium abscessus ATCC 19977]MALNIADLIEHAIDTMPDRVAIISGDRKLTYAELEEQSNRLGHYLQSQGV
GPGDKVGLYCRNGIEIVIALTAIVKIRAISVNVNYRYVEAELHYLFENSD
MAALVHERRYSDKVANVLPSTPNVKTAIVVEDGADGSFDSYGGVPFADAL
AQGSPERDFEERSPDDIFLIYTGGTTGFPKGVMWRHEDIYRSLFGGINYV
TGEYIEGEWDLAKQGAEAAPFIGFPIPPMIHGATQAATFMALFQGRTTVL
APEFNPEEVWELIEKHKINMLFFAGDAIGRPLIDALDTETGRARDLSSLW
VLASSAALFSQTVKERYLELLPNRVITDAIGASETGTGGLSTVTKGQMHP
GGPTVKISSTTTVLDEEGNPVQPGSGVRGLIAKSGHIPVGYFKDEKKTAE
TFKTFNGVRYAIPGDWATVEADGTVTMLGRGSVSINTGGEKVFPEEVESV
LKGHPAVFDAVVVGVPDEKWGQHVGAVIAVREGVELTFEDLDAHARKEIA
GYKVPRSIWIVDSVKRNPAGKADYRWAKEVSETEKVDLVNSKHVNTGA
169631240YP_001704889.1 putative 2-nitropropane dioxygenase [Mycobacterium abscessus ATCC 1MRTDLCERFGIRYPIFGFTPSEKVAAAISRAGGMGVLGCVRFNDPDELDA
VLNWMDENTDGKPYGVDIVMPAKVPAEGTAVDIDKLIPQGHKDFVEKTLA
DLGVPPLPGERESAGVLGWLHSVARSHVEVALKHPIKLIANALGSPPKDV
IDQAHEHGVPVAALAGKAEHARRHVENGVDIVVAQGYEAGGHTGDVASMV
LWPEIVDALDGSAPVLAAGGIGSGRQAAAALALGASGVWTGSIWLTAAEY
DLGTVTAGGDSVVQQALLKATSGDTVRTRIYTGKPARLLKTKWTQAWDAE
DAPTPLPMPLQNILVSEAHERMNRAHDPETVCFPAGQIVGRMNEIRPTAE
IVADLVSGFEAAVDRLDEIRG
169631239YP_001704888.1 hypothetical protein MAB_4161 [Mycobacterium abscessus ATCC 19977]MGDVPWPLIRSEALTNRVVTGYALRQFTALYPGIYAPTDAQITPRKRAEA
AWLWSRRKGTIAGISAAALHGTKWLPQQGPVVLIHTNRRAPRGITLWSDS
LPEGERMFVDGLPVTTPARTAFDIGRRTPVDLAVQHLDALMNATRLSRTD
IETVATHHRGARGLHHLANVLGLVDGGAESPWETRTRLLVVRAGFPAPQT
QLVVRNRFGDFVARLDMGWPDHKVGIEFDGAQHWTSAQQRTRDIDRATEL
VDEGWRIIRVSSDMVRHRSGTILARVAEAFVAARAA
169631238YP_001704887.1 acyl-CoA synthetase [Mycobacterium abscessus ATCC 19977]MSTSEDATVTRLLVNLADVEDRGLHFEGSFTSWRDHIAESRRLASVLRAR
LDPSKPPHIGVILENTPGFARLLTAAALAGLVLVGLNSTRRGSALRRDIE
LADCQFVVADESDTVAGLQHPQIEIADVRPDDLYMLIFTSGTSGDPKAVQ
ITHAKVASAGIMLSSRFGLGSTDVCYLSMPMFHSNAVMAGWSVAVAAGAS
IALRRKFSASGFLDDVREYGATYANYVGKPMSYVLATPQRPDDAENPLRI
MYGNEAAAGDTDRFATRFGAVVVDGFGSTEGGVALGWAPGTPPGAIGPLT
PDIQILDIQTGRPCPPAIFDQSGKVINAAEATGELVNVTGPGRFTGYYKN
PEADAERMVGGRYHSGDLAYADENGYVYFAGRLGDWLRVDGENLGTAPIE
RVLLRHPDITEVAVYGVPDPTVGDRVMAALVGADFDPVTLSEFLSAQEDL
GPKQWPSFIRVSGELPRTATFKVIKRQLSAEALETADPVWALTNGTYTRT
169631237YP_001704886.1 acyl-CoA dehydrogenase [Mycobacterium abscessus ATCC 19977]MDFSLTEAQTDLAGLTRTIASTISTPERQKELDKQDSRFDRQLWTKLAEA
DILSTAAPESVGGAGFGVLEQSSILVELGRELAAVPYLESVVLAAGALAA
FGSEAMRNDWAAPAVAGKKVLTIALEGEPGEGPVAARTEGTGYVLTGNRV
LVPFGVEADAYLVPAETETGTAVFLVSADDAGVTQQALHTTGKDSSAELI
LSEVPVPAERKVGGAEVVEWLRLRESLGHSAYQLGVLERALELTADYART
REQFGKPIGGFQAVAQRLADGYIDVKGLCLTLWQAAWRVSEDLPSDVDVA
TAKFWAADAGHRVAHTAVHVHGGVGIDEDHPVHRYFLAAKRGEFASGSAT
EQLRRIGRELADTPA
169631236YP_001704885.1 acyl-CoA dehydrogenase FadE [Mycobacterium abscessus ATCC 19977]MHIAYTPEQEELRRELRAYFDKLLTPERREALASNQGEYGSGNVYRETVE
QMGADGWLALGWPKEFGGQDRSVMDQLIFTDEAAIAGAPVPFLTINSVAP
TIMHFGTDEQKKFFLPKIAAGKLHFSIGYSEPGAGTDLASLRTSAVRDGD
DYIVNGQKMWTSLIEYADYIWLAVRTNTEVKKHRGISMLIVPTTAEGFSY
TKVHTMAGPGTSATYYQDVRVPVTSRVGEENAGWKLVTNQLNHERVALVS
SAPIITALREVREWAQNTKGPGGRIIDAEWVQLNLARVHAKAEYLKLINW
ELASTTDAAPSPADASATKVFGTELATEAYRLLMEVLGTAATLRQDSPGA
QLRGRVERMHRACLILTFGGGTNEVQRDIIAMTALGQPAASR
169631235YP_001704884.1 ferredoxin FdxD [Mycobacterium abscessus ATCC 19977]MRVGVVPDRCEGNLVCLGIAPEVFDVDDDDYVVILQEEVPADQEDLVEQA
IAECPRAALIRKD
169631234YP_001704883.1 putative short chain dehydrogenase/reductase [Mycobacterium abscessMSAIADADLSGRVAIVTGAAAGLGRAEAIGLARSGATVVVNDIAPALDKS
DVLDEIAAAGSKGVTVAGDIGERATADELISTAESLGGLHVVVNNAGITR
DRMLFNMSDEEFDAVIHVHLRGHFLLTRNAATYWRGASKAAGAPTYGRLI
NTSSEAGLLGPEGQANYGAAKAGITALTLSAARALGRYGVRANAIAPRAR
TAMTADVFGDAPEDSIDPLSPEHVVTLVRYLAAPAAEAVNGQLFIVYGPT
VTLLAAPTVEAKFTADSDAWDPSALNSTLADFFAGHDPKRTFSATALMVE
D
169631233YP_001704882.1 hypothetical protein MAB_4155c [Mycobacterium abscessus ATCC 19977]MKQQLAAPARAVGGFVSMSLATFRNIFRRPFQGQEFLDQTWFIARVSLLP
TLLVAIPFTVLVAFTLNILLREIGAADLSGAATAFGTVTQLGPVVTVLVV
AGAGATAICADLGARTIREEIDAMQVLGIDPIQRLVVPRVLASTFVALLL
NGLVCAIGMVGGYVFSVFLQGVNPGAFINGLTVLTGLGELMISEVKAFLF
GIFAGLVGCYRGLTVKGGPKGVGDAVNETVVYAFICLFVINVVMTAIGVR
VLVKH
169631232YP_001704881.1 hypothetical protein MAB_4154c [Mycobacterium abscessus ATCC 19977]MSGPYLSTHTVTSYTVRYMRGLGRSFDKFGEQALFYAQSLSYIPAALTKY
RKETIRVLAEITMGTGALVMIGGTVGVAVFLTLASGGVIAVQGYSSLGNI
GIEALTGFLSAFLNVRIVAPVVAGIAMAATIGAGTTAQLGAMRVAEEIDA
LETMAVHAISYLVSTRLVAGLIAIIPLYSLSVLAAFFASRATTVMINGQS
PGVYDHYFNTFLVPTDLLWSFLQAIVMSVVVMLVHTSYGFNASGGPVGVG
VAVGQAVRTSLIVVVLVTLFISLAVYGGSGNFNLSG
169631231YP_001704880.1 MCE-family protein [Mycobacterium abscessus ATCC 19977]MSDTSTRRAVRLAGTVLASVLVLLTVLTYLAYNDAFADTKPITVVSPRAG
LVMEEGGKVKFHGLQIGKVTSISYANDQAKLELAVNAKDLRLIPSNATVR
IAGTTVFGAKSVEFLAPQKPSDSSLRPGATVTAEAVALEVNTVFENLTRL
LGKIDPVNLNATLTAVGEGLRGNGDNFGQGLVELDQYLDQLNPKLPALQQ
DFRQAGQVGQIYGDAAPDIVRILDNLPALSRTVVDQQQDLKATLLAAIGL
GNNGYETLAPAEKDLTAALQRLRAPATLLGRYSPEIPCTLQAISKALVTF
TPLIGGVRPGLFLTNSFPLGAPVYTYPDSLPIVNASGGPNCRGLPNIPTK
MQNGSWFRSPFLVTDNAYIPYKPLEELQVNAPDTLQYLYNGAFAKRSEF
169631230YP_001704879.1 MCE-family protein [Mycobacterium abscessus ATCC 19977]MKRATQIKVIVFTVVMLLVAAGLIITFGEFRFGSGKRYHAMFSTASDLRS
GQKVRIAGVPVGRVKNVSLNRDNSVEVTFDVDSKYQLYSSSRAIIRYENL
VGDRYLEITAGPGELHKLPDGGTLDKEHTQPALDLDALLGGLRPVLKGFD
AAKVNEISNAFIQILQGQGGTLSQLLGDTSSFTSGLAERDQLIGDVINHL
NEVLATVDSKSTQFSSSVDQLQQLISGLAQQRDVVAGALPPLASTASSLE
SVLKDTRPYIKGTIEQARQLATRVDERKADVNVVVENLAENYLRLNALGA
YGSFFNIYYCSIRIKVNGPVGTDWLIPFGGPPDPSKGRCAFKNE
169631229YP_001704878.1 MCE-family protein [Mycobacterium abscessus ATCC 19977]MPSKMSDIQEKDPVRTGIFGIAVVSMLVLVAFGYTGLPFWPQGKQYTGYF
ADSGGLESGGNVFVSGIKVGQVKDVSLAGNKVRVDFTVDRSIRLGDQSLA
AIRTTTVLGEKSLSVTPAGAGRITEIPLGRTTTPYTLNSALSDLGASAGG
IDKAQLDQSLQVITEAMRDATPQLRGALDGVASLSRTLNARDAALEQLLT
HAKSVSGILSERAGQVNKLVTDGNQLFAALDERRLAISELINRIQGLSQQ
ISGFVADNRQEFRPTMEKLSVVLDDLLDRKAHISEALKRLPGYGTALGEV
VSSGPGFHVNVYGFPPATLTAVAFDTYFQPGKLPASLSDYLNGLIGERQI
MRPKSP
169631228YP_001704877.1 MCE-family protein [Mycobacterium abscessus ATCC 19977]MTTSKTWLKRGAFAMLSVALVGGLLYWVWPSRGTYKIVGHFASAVGLYPG
DDVRILGVKAGRISAVEPREGDVKVTMEMPDKFKVPEGAQAIIMAPNLVT
ARFVQLTPAYTDGKALQDGASLGLDKTAVPIEWDEVKTELAKLSDSLGPQ
GQSKGPVSDFINQAATTFDGNGDSFRNAVRELSQAAGRLGDSRTDLFGTI
KNLQTLVDALANSNEQIVQFSTHLASVSKVLAASTENLGATLGALNQALT
DVRGFLGDTNSALIDQVNKLSDFVKIFSDQSDDLEQILHVAPNGLANFYN
IYNPAAGTLNGMLSIPNLANPVQFICGGVFETGTKTEYLKRAEICRERMG
PVLRRATFNYAPILLHPINQISAYKGQIIYDTPETEAKSQAPREDLVWVR
PNGAPPPPKPSPQDLSALMLGPDEVNAPPPPGTEVRPAEPGPVPPGFPVT
ADDAPPPAIPGAPR
169631227YP_001704876.1 MCE-family protein LprN [Mycobacterium abscessus ATCC 19977]MSRNVLRAAVMGVGVAVVVSGCQFNGLNSLNLPGTAGHGSRSYTVTVELP
DVTTLPQNSPVMVDDVTVGSVSGIDAFQKPDGSWYAGVKVSLEPEVHLPA
NAVAKVAQTSLLGSQHIELAAPVGEPAVGKLTGGATIPLSRTGKYPSTEE
VLSALSVVVNKGNLGALQDITDETYNLFKGRTGNLTQVLPKLATLISSLN
SQRDDIISAIEGIDKFSRVLAEHKESLGRAIDSIEPALKVLNENRANIIE
AFRSVGNLAKITDRVLRTTKDDIVADLKGLYPVVRALAENRDVLIDSLDL
LPTFPFSTKYLRNAVRGDYLNVFVTFDLTARRLGETLFTTSFFDPNMQHF
NDVVNPPEWLIGSMANLNGKETSPFDLPAPAAPQGGGR
169631226YP_001704875.1 MCE-family protein [Mycobacterium abscessus ATCC 19977]MERLIKIQLAIFAAVTVISVALMAIFYLRVPTALGIGKHDVKAQFVASGG
LYQNANVTFRGVQIGRVTDVELTPEGVTATMRLNDNVKVPGNVVAAVKSV
SAIGEQYVDLIPPPTGAAGTLRSGDVIGADRTSIPTDVSTLLRQADGLVN
TVADTRLREVLAEAFKAFNGSGQELSRLIDSSRLLIQEANTNYDSTTKLI
DQVGPLLDAQIRSGDNIRGSVSSLAALTEHFAKADPQLRQFLKVAPGASE
QASQLFAGIRPSFPVLAASLANLGRVGVIYNKSIEQSLVILPALFSALLT
VAGGAPMDEGAKLDFRLNLGDPPPCLTGFVPPPLMRTPADETLRELPRDM
YCKTAQNDPSAVRGARNYPCQEFPGKRAPTIQLCRDPRGYVPIGSNPWRG
PPAPYDTPVEDPRNILPPNKFPNIPPGAEPDPGTPTLPPPSPPAPEVPPA
GGDVMPVSAQSGPMAARAYDPKNGVFLDANNQPSVYAPALDRGTEAETWA
DLMLGPKPV
169631225YP_001704874.1 MCE-family protein [Mycobacterium abscessus ATCC 19977]MTEEKKSASQTTRRRAARPAGPTGEVSAEPISVSLGRTEALSKPEPTVAD
SRRPGNTRGVLRAATVLVVVLVGALGVALALMGRAQHRDDLRAARDQRFV
DTAVQTVTNMMTYSPDSIDKNVDQFVNSTSGPLRGTFNPDNTANLKALYH
QTGTSSEVVIKKASLESIDEVSKKASILISARVTLTNADSGVNEPSKSYR
MRMIVAEDQQGNMTAYDLRWPDGQS
169631224YP_001704873.1 MCE-family protein [Mycobacterium abscessus ATCC 19977]MRWLARIFVAVTVLVVVGLSAAAGGMYWHRVDTVASRAAGETLIKQAGKQ
IGSIFGYDYQTVERSLDEQYAGLTPEYRREFEDKANREIIPQAKQRKIVS
QTSIVGTGIIAAHRDSAQVVVYMNRTITDQSRTPVYDSSSIQVDYTRAGD
KWLISYITPL
169631223YP_001704872.1 alpha-alpha-trehalose-phosphate synthase [Mycobacterium abscessus AMATQSDERSPVKPVTGTSDFVVVANRLPIDLVKLPDGSTTWKRSPGGLVT
AMEPLLRKRRGAWVGWPGVPDADVEPVSEDDMVLYSVRLSTQEVAEYYEG
FSNATLWPLYHDVIVKPEYHREWWQAYVDVNRKFAEATAAVAAEGATVWV
QDYQLQLVPKMLRMLRPDLTIGFFLHIPFPPVELFMQMPWRTEIVDGLLG
ADLIGFHLAGGAQNFMYLARRLVGASTSRASIGVRSRFGEIRVGFRTVKV
GAFPISIDSTQLDSVSRSRQIRQRAKEIRAELGGPRKILLGVDRLDYTKG
IDIRLHAYEELLAEGRASREDTVFVQLATPSRERVDSYKKMRGDVEQQVG
HINGEFGEVGHPVVHYLHRPVPREDLIAFFVAADVMLVTPLRDGMNLVAK
EYVACRSDLGGSLVLSEFTGAAAELRQAYLVNPHDIDGVKDGIESALNQT
PEEGRRRMRALRRQVLAHDVDRWARAFLEALSTPATGDSIAPEQPAVLGG
EPL
169631222YP_001704871.1 hypothetical protein MAB_4144 [Mycobacterium abscessus ATCC 19977]MPAKTDPAAIDDLEPLTDETAHQAQRVVAAYANDADECRMLLAMLGIGPT
KVDA
169631221YP_001704870.1 putative anti-ECFsigma factor- ChrR [Mycobacterium abscessus ATCC 1MTTAHGDPAQFGPNAPGYAWRSAADVDPVELFPGVTIQPLWEGDNGAKAL
ITTIAPGTVWPGEDHHRPGPEEVYVVSGVLNDGVNDYPAGTFLHAPAESW
HIPQSDQGCVLFLFYPQG
169631220YP_001704869.1 hypothetical protein MAB_4142c [Mycobacterium abscessus ATCC 19977]MGVVLRLICVVVVAACTGPPRPGAQRLTLDVGHDYGDLFADGKLPVGDGK
IVTDGARGGYVYACPRYAESFAAGAAIGAAVRGPWFSADGQWYYPDMKTH
VQGHVQHHGEFSEARSEGVRVITTNDLPRDHSTGRFPIATDDTAYQYDRN
PNAITAQDLTYVLASEPTYGIPQCIGPEVGVMLSGVVLFSALDAGGRDAG
AWEVQDGCAGHPEVTGSYHYHTPSPCLATSDIAEVVGYALDGFPITGARV
SDGNILTTRDLDECHGITSSVRLDGRDVETYHYVMTQDYPYSVNCFRGRP
TTVQGGAQRPIPPGH
169631219YP_001704868.1 PE/PPE family protein [Mycobacterium abscessus ATCC 19977]MAGQYSVPGKRHSLRRYVATITAVAATCTVLAPLAMESRTIASTLASYVI
GIGGNNDGASANIPRKLGGAYSVDYHPVSYPGAIWPVSGLTAPTFKTSVA
QGRTNLNDEIVTAGNQPITIVGYSLGAVVVSKSHSDLLQRYPGGNPNIQF
VLMGSANTPNGGIFARFPWLKIPLADIESNGAWEPDQFKTKVINTEYDTY
GDFPAYFNPLALANSIAAIQYAHPDAYYDRIDPAALDDPDNPNVVKTVQG
NTTYYLVRAEHLPLLQPLRDLTNPIGASFVLDAIEPTLRVFIDMAYDRDT
GPGTTTQFSFFTPSKNIVDAFNKLPTAIAEGAHNVENGLAGATPKQSASP
EKPASPPVPQPGPTNPGSATTQIPAPEAPTPSVVSLSTAEPPAPPASAKA
ADPTAISVSTAGASTARDQDFQPDTKPDPKSTPPPTKDSVGEADKSKNTL
KPTLRLPKLPVAQPGTAPKSPKFPSLKNHLKSVPGLSEKKNPAADASSKH
SQPANAPAHTSDKTSDHASETGRGAA
169631218YP_001704867.1 hypothetical protein MAB_4140 [Mycobacterium abscessus ATCC 19977]MTNPLDATLAPCEDHEGRWVLTMSRDLNHPPEKVWPWLVDPDRLRQWSPA
IPDRPLDSAGPANVQETSADPVLDGEVLTVDPPRELIHRWGPEDTLRWRI
EPTDTGCRLTLEHSMADRGHAAGNAGGWHICLDTLSLAVAGTPRGRVVGM
DAMKYDWQSLNDRYTEILTIN
169631217YP_001704866.1 ArsR family transcriptional regulator [Mycobacterium abscessus ATCCMDAFMVIADPTRRRIIDALRGGPADVTTLIERLDISQSLVSKHLGVLRDA
EAVRVEVAGKRRVYHLADDPLPAVLAWVTPYHRKWASALDRLTFLIDSDA
GMHDTEKEVNRD
169631216YP_001704865.1 putative major facilitator superfamily protein [Mycobacterium absceMLLAEVAVGGARSLAQRRGEDYFLTKPLRMRVAVIGVFASFGLVVATWAV
HLPTMKQATGMSSTELGFVVLGLGVGALLGMQLSGVLVDRFGSGPIAIVG
GAAMALGVNIPLAAHTVWVAGVGAVLCGVTVGITDVAMNAAAVDVERFYG
RPIMASFHGVFSVGNVVGAGIGSAAFALHLKVWATVLGVTVLCLALLTCS
ASVLLRGKLRAGEVEAPDTVPYTMPPPVSYRRGQVVVLGLLAFLLMLSEG
SATDWSSLHAQEHLGASHSEGAFAFGVFMLAMTVGRFTVDKLVERVGRVR
VLRGGCALAAVGMLTVIAAPVLPLTLAGWVAVGLGLAGGVPQVFTVAGNI
DEQHEGRVLSRVVGTGYVAVLGGPALIGWVADALSLNTALVLPIFAVVIC
GCAAGALAVTPPSKSVKPPR
169631215YP_001704864.1 hypothetical protein MAB_4137c [Mycobacterium abscessus ATCC 19977]MTDTDIVAAASARELLRDSFTRIIEHVGEVTDGLSDPALTYRPTPDANSI
AWLIWHSARCQDVQICAMTGAEPVWTARGWEPRFGLDLPADSNGYGHTAG
DVAKVVATADQLSGYYRDVHEMTLSYVDTLTDSELARVVDRQWDPPVTAS
VRLVSIVDDCAQHLGQAAYLRGIIPTN
169631214YP_001704863.1 putative aldehyde dehydrogenase [Mycobacterium abscessus ATCC 19977MTTTSENLVSTPSDTSHDVRNPANGQVVGRVNWTDPSDIPGIVAQLAKAQ
PSWERLGPEGRGQVLARFAQWLIDNTGRIEAQLIAETGKSKIDGGIEIPS
ILAIIAYYAPKAAEFLAPESRPASSIAMNTKKITVHQRPRKVVGVISPWN
YPVALGYWDVIPALLAGCSVLLKPSERTPLSDELIANGWAEIGGPPVFEV
VHGAREVGEALVDNVDFVQFTGSTATGKKIMERAARRLTPVSLELGGKDP
MLVLPDADVKRAAHAAVWGSMFNAGQTCVSVERVYVHDSIYEQFVDLVVE
EVRGLEIGAGLDHSVGAMIDENQLEVVDRHVRQAVSSGARALTGGARIPG
HGSFYAPTVLVDVDHSMDCMREETFGPTLPIMRYSEESEAIALANDSEYG
LSASVWSKDRRRAERVALQLDCGTVNINDVIMNLSCLTAPHGGWKGSGLG
SRFGGVDGLRKYCRTEAIVDTRVTLPSEPLWYSGPSWLAPVALKSLTKLS
NKALRPFRR
169631213YP_001704862.1 hypothetical protein MAB_4135c [Mycobacterium abscessus ATCC 19977]MTDTITAAAEGYTVDDDDDDDPVLIAPDGVAVDTWRENYPYDERMSRHQY
ELEKRLLQIELLKLQNWSKRTGARHVILFEGRDAAGKGGTIKRFMEHLNP
RGARVVALEKPTERERTQWYFQRYVPHLPAAGEMVFFDRSWYNRAGVERV
MGFCSDEQHSEFIHQAPLFEQMLVNDGISLTKLWFSVSAAEQRTRFAIRQ
VDPVRQWKLSPMDLASLDKWDAYTKAKEEMFSLTDTDHAPWIVVKSNDKK
RARVNAMRHVLGKFDYDDKDLDVVGQADPLILGRALTD
169631212YP_001704861.1 putative lipase [Mycobacterium abscessus ATCC 19977]MTTGATNERKPEQARPPREEWETRDQVPLLPSRDPFYQPPVGFRTLPAGA
VLRWRRVDLALFGRIRQHVDAWQLLYRTNSMHHEPEVAVTTVVLPARVRA
PAHRPLLAYQCAIDAVADKCFPSYALRYGSRAIGAVPQFEWPLIAAAVAR
GWAVSISDHEGQDGCFVAPREPGYRILDGVRAAMSFEPLGLDQSTPVGIW
GYSGGGMASSWAAEMAPAYAPEIGIVGAVLGAPVSDPGQLAVRLNATAFS
GLTAIGIASLRRCYAGLDARINAHIDAEGQQILAAASQLDTVRAGARFAK
QDFNNHCDISLAELLTQPEIVEVFDDVRLGQHVPACPMLVIHPQHDQIID
VRDVDAQVQRYLAADGHVSYVRDHCSEHISLMLLSAPLALNWLKNRFRGT
GTSNAQNIPVFSIALSAKAIRGYLSILATMLRAVLARPLGPTTARSQHRI
169631211YP_001704860.1 hypothetical protein MAB_4133c [Mycobacterium abscessus ATCC 19977]MRFLFAALLWLLTTAALAVTIAAAWAQSRLVDENGYAALTAPAAADPRVQ
HAIAGELTTQIVSLGKKQGSRVDESQVAELVASYTSGPQFEADFGSVNRM
AHQWLFTNSSSAQRDSQGGWQIDIAPMIKSLAPQGLSIKAPETLKVSVTD
DKLAGLTPGRLVPVARFGQLAVWIFFGLTLVLAGLTQLAVRSRAKGLAGL
GISALLVGAAGWAGLEIGRSYLDRPLSRVTGNVRDVADSLVTAAVGNAHH
WLSLTMAAGGLVIVIGVVSGLLGALLRR
169631210YP_001704859.1 hypothetical protein MAB_4132 [Mycobacterium abscessus ATCC 19977]MTNNLFVGLSENGWDHAPWDAEPEFSPSELDILLDRRLSASDAAERIGCV
EHDVQRIRDAHAA
169631209YP_001704858.1 hypothetical protein MAB_4131 [Mycobacterium abscessus ATCC 19977]MSESNTVPPWVNKVVRGVLRSPLHPVLSGNIALFTFTGRKSGKEYNVAAT
YVRDGDVLTIFTDRTWAKNLRDGRPVTALVRGKRLEGTAELATGPQIAGP
LTELLLRVPRDAKYHNVRRDPDGSLNPSDINRAAARESMVTIRLT
169631208YP_001704857.1 peptidase [Mycobacterium abscessus ATCC 19977]MTSARRSLDPYLWLEDIGGDEPLNWVREHNAITTSEFSGARFEEMRDEAL
AILNTDAQIPYVRRRGEYLYNFWRDATNSRGLWRRTTLDRYRRHDPEWDV
VIDVDALAATEDENWVWAGAAVLRPDFQRALVSLSRGGSDAVVVREFDLE
TRQFVAGGFELPEAKTQISWVDADTVYVGTDFGPGSLTDSGYPRLVKRWK
RGQSLDDAELVFSGEASDVTVGASFDDTPGFERTLISRATDFFNSEVHEL
TADGELLRIDVPTDASASIHREWLLIELKSSWQVGDIEYSAGTLLAARYR
DYVAGDRTLTPVFVPDEHASLHHYAWTRDRLTVAILRDVASEILVFTPGS
WRSEPLPGVPDNATTQIVAIDDLGDEIFLDTSGFTQPSTLLRGEVGPAGA
SVSPIKTAPSFFDDAAFEVAQHFARSDDGTSIPYFVVRAKGSEAAGPTLL
GGYGGFEVARTPGYDGVLGRLWLSRGGTYVLANIRGGGEYGPVWHTQAMR
EGRHLVYEDFAAVARDLVARGITTAAQLGAQGGSNGGLLMGVMLTAYPEL
FGALVCQVPLLDMRRYHLLLAGASWVAEYGDPDNPEDWEFISKYSPYQNI
SMDRRYPPVLVTTSTRDDRVHPGHARKMTAALQEAGQPVWYYENIEGGHG
GAANNEQSAFKAALAIEFLWRQLAP
169631207YP_001704856.1 hypothetical protein MAB_4129c [Mycobacterium abscessus ATCC 19977]MIPLPRAQVVASAMLLGIAVGLGAGMSSVLVAHESVRPDLVIGLIVAIPS
LIGFLILIASTRKWMTAVAAFILAIAPGWFGILAAIQVIQGV
169631206YP_001704855.1 hypothetical protein MAB_4128c [Mycobacterium abscessus ATCC 19977]MSDKNAENTVEKTDAEADGAAAELVDDADQPSVVEGDLADPLAVPIDDGK
ARDGLDTATFTAFSAFKDDEDDLVPTGRIDTDALPLTEAFDVGSDRTGAI
PAAVGRSRAEAMTPDPYTGAVPVLGDEPAKPVRVPAEREPALLKRWVLLL
ILVGTWIPAAAVGLLLYQNWFATLLPHDRIVAVEYVLAWVFACVLIALLL
AMFEPRPLIVALAFAVLTAPAISVAAAGVKYGYVACTAPSVPGVKSLCPE
PLRSWGIQYRDRA
169631205YP_001704854.1 dihydrolipoamide dehydrogenase [Mycobacterium abscessus ATCC 19977]MTAHYDVVVLGAGPGGYVAAIRAAQLGLKTAIVEEKYWGGVCLNVGCIPS
KALLRNAELAHIFTKEAKTFGISGEATFDFGAAFDRSRKVAEGRVAGVHF
LMKKNKITEYEGVGTFTDANTLAVKKADGSHETLTFANVIIATGSSVRLV
PGTSLSENVVTYEKQILTRELPGSIIIAGAGAIGMEFAYVLKNYGVDVTI
VEFLPRALPNEDAEVSKEIEKQYKKLGVKILTGTKVESITDSGSQVTVKV
SKDGQESELVADKVLQAIGFAPNVEGFGLENTGVALTDRGAIAIDERMRT
NVPHIYAIGDVTSKLQLAHVAEAQAVVAAETIAGAETLELGDYRMMPRAT
FCQPQVASFGLTEEQARAEGYDVKVAKFPFTANGKAHGLADPTGFVKLIA
DAKYGELIGGHLIGPDVSELLPELTLAQKWDLTVNELTRNVHTHPTLSEA
LQEAFHGLAGHMINF
169631204YP_001704853.1 carbonic anhydrase-like protein [Mycobacterium abscessus ATCC 19977MSTTDELLKNAQAYAASFDKGELPLPPARKVAVVACMDARLNPYGLLGLH
EGDAHVIRNAGGVITEDEIRSLAISQRLLGTEEIILIHHTDCGMLTFTDD
AFKQSIQDETGIKPPWSAEAFTDLDEDVRQSLARINANPFVPRKDSVRGF
VYDVTNGTLREVTAAA
169631203YP_001704852.1 putative nitrilotriacetate monooxygenase [Mycobacterium abscessus AMSSRNGRQLHLLAFGNVRAGGAWRLPGVRNGPANQLNTLVATAKAAEAAK
FDAVFFADGLNFGPKATWAHKSTEDFEPLTATSYLAAVTERLGLVVTGSS
TFQPPYHLARQLLSLDHLSSGRAGWNLVTSFAQAAAANFGERGFLPHDER
YRLAEETLQVVKSLWHSLEPDTVIEDRAAGIYSDINKIHVANHDGEFHKV
KGPLGVTPSRQGHPVIFQAGSSTTGRAFAARHAEVVFTGQTDVERAKNFY
RQLHQEARAAGRTFAPLVTPSLGVVVGSTEAEALAAESTIYEHFIPEYQA
GWLLEVDVNVVGADLDGPVPASAFPDSTETHQTALAGYKHLATVGNPTVR
EFLYRTLNAFGTRFVGSAEQVADQIELWFSEGAADGFILSTSGLPGQFEL
FTEHVVPILVRRGLFRAEYTGSTLREHLALPWPVPARPPALLA
169631202YP_001704851.1 hypothetical protein MAB_4124 [Mycobacterium abscessus ATCC 19977]MAFTAQPQWPGASRRNNTGQEAVTDIRFLQSRAEHERAFTVFWRAMVGLP
ALGAVAADELLELGRYLGAFVQGELIGGADSYTSWLTVPGGSRVPHAAVT
HIGVLPTHTRRGILTALVTRQLTDIAGRGEIVASLRASEAVIYRRFGYGI
ATSSATYRIQRRRAAPLRPIDTGAIALLDAAASPEGLAAIYERAAWTGSV
ARPPQWWRLHELFDAADPVKPYVVTHPDGYVRYRPQDTAEWFSSSARTIS
VDDLVAHSDEAYRALVGHLLDLDLVDVIELGPRPIDDPLPHLVTDPRAVA
VAGIRDETWLRLVDVEAALAARTYTDGAPVVIEVQDTLLPHNAARFSVSS
DKVRRTQHTPDISVDVAALGSVYLGGNTWTRLERAGLVSAQSPGAIRAAD
ALFSTGTQPFAGTNF
169631201YP_001704850.1 monooxygenase [Mycobacterium abscessus ATCC 19977]MTTATTSPVHAYQGVSDTEFSEWEQVAARVAGELSATALTRDRANQNPIA
EIELLRRYGLLSFATAREFGGAGGSLVQALQLGRIIAAADGSIGQLLVYH
YSNGVWTYILGSPTQREYISRGVGGHGWFQGSVSNPRDPGITVTRTEEGY
RVNGKRTFATGVAVADLITVLLYEAEPINAIIPSERDGLRFNDDWDNLGQ
RLTASGSVEFDNVLLRHDEVLTGLDEYSGLDGSRERRDGLRALFSQLIFV
HLYLGIAEGALAAGVAYIRDKGRPWPEAHSTDVTEDPYHQQLLGRLSAGI
AAGVALADSATKEFEQALAFGEAPTEAQWGALAIRVDQAKSVATEISLDV
THNIYQATGARSTANSVGLDIYWRNARTHTTHDPLPYRQREIGRHLLTDQ
WPSPRSLNGLGRLAETTQGKKP
169631200YP_001704849.1 putative amino acid permease [Mycobacterium abscessus ATCC 19977]MSSATHQLTVNGRSLRTADSHGLERDAIGSWGVFAQGLAAAAPSVAVATV
PFSLFVAAGKGAAWSAVIGLVAVVLIATTISFQAKRTVSSGSLGTYAGNG
LGPGAAYAAGFSLLIGYITFATTGTLGGVLYFESFLDVIGIHSEANGFKL
ALVALVVAFAVYLPYRGVSISAKYELIFEIIATALILIIIVASYISYGWR
IDTEQWALTNLGNSTTFIAAVTAVGAYAGFESVASLGAESRDAHRTIARS
LLRVVLIIGVLYILATYPQILQFRNIDGDSAILPQIATNAGVAWAIYPIS
LAVTIAFIVFVTAVINSAARGLFTLAHEGALPAVLTRVHPTYKTPVAGIF
LIGIIATAFSVTATLSSVGRLVFDVYGNYVANWGFLVSYLLVVVATPIWL
YRIKALTPARLSVSAAATVAIGYVIFSNFYPIPKFPFNILPLIFGAILLA
GLLRYWYLRILRPEVAARIGSIQTLSESEKERLAELGILEVLHEEPAAEP
VPEPVDTGVLVK
169631199YP_001704848.1 MerR family transcriptional regulator [Mycobacterium abscessus ATCCMSTSEPSHAGFPISHVAQRTGLSIDALRWFEREGLFPRVPRDAGGRRRFS
DDDIERVQLMLRLRRTGMPVRDMRRFIELLAGGEETHAERLELLFAQRVR
ILAAMERLTEDLRVVDFKVAYYTESVNGASAQSAGGKKN
169631198YP_001704847.1 aldo/keto reductase [Mycobacterium abscessus ATCC 19977]MKHTWLGELSVSRIGLGAMSMSAYYRAIGSESGPDEATSIDTLRRALDLG
VSLIDTAEIYGPFVNEELVGRAIAGRRDEVVLATKFGLVSHGNGASQVLD
STPGNISTAVEGSLRRLGVDHIDLYYQHRVDPNVAIEDTIGAVAELVQQG
KVRYIGLSEAAAGTIRRAHAVHPITALQNEYSLWTRDIEDEILPTIRELG
IGLVAYSPLGRGFLTGAIGSRDQLAEGDFRREQPRFSAENFDANLALVEE
VRSVASSIGATSAQVALAWLLARGDDIVPIPGTTKVSRVNENVGAVDIEL
LPEHLVRLECLAAAAGDRYNAEHLARLEG
169631197YP_001704846.1 hypothetical protein MAB_4119 [Mycobacterium abscessus ATCC 19977]MSSGRIPSGGLRELGPINWVIAKGMARAVNAPEMHLATTLGQTGARFWPW
LAYSGAILRGTKLSTRDTEVVILRVAHVRECEYELQHHTRIAKSAGIDPA
YQERIFTGAGAEGLSDKERALITGVDEILTTRTLSDEAWEGLSKFLDRRQ
LIGFCLLVTQYDGLAATMSSLRIPLDH
169631196YP_001704845.1 transcriptional regulatory protein [Mycobacterium abscessus ATCC 19MSKTYVGGRLRQLRSERGFSQAALAQMLEISPSYLNQIEHDVRPLTVAVL
LRITEVFGVDATFFSSQDDSRLIAELREVVQDKDLDIDVDPAEIADVVAG
HPALARAMVNLHRRYRITTTQLAAATEDRYTDGSGSGSITMPHEEVRDYF
YQRHNYLHELDTAAEDLTVRMRMHRADLAREIADRLTEVHGVQIARRIDL
GDSVLHKYDPASKTLEISNHLSGGQQVFKLAAELAYLEYGDLIDTMVDDG
KFTSEESRKLARLGLANYFAAATVLPYRQFHGVAEDFQYDIERLSAFYSV
SYETVCHRLSTLQRPSMRGVPFSFVRVDRAGNMSKRQSATGFHFSSSGGT
CPLWNVYETFGNPGKILVQVAQMPDGRNYLWVARTVERRASRYGQPGKTF
AIGLGCELRHAHRLVYSQGLDLSSEGATTPIGVGCRVCERDNCPQRAFPA
LGRALDLDEHRSTVSPYLVLQEGAHP
169631195YP_001704844.1 MmpS family protein [Mycobacterium abscessus ATCC 19977]MRLWIPLLVIAVIAVGGFTVSRLHGVFGNEKRPSYADTNVSDAKSFDPKK
MSYEVFGSPGNVADISYFDVNGDPLFIQKVPLPWSVKFEIGKTTAVGSIM
AQGDGSSIGCRIIVDDEVKSEKVTNQTNAFTSCLLKAA
169631194YP_001704843.1 putative membrane protein MmpL [Mycobacterium abscessus ATCC 19977]MSADDGKVKSHRPIMATIIRRGAVFIILGWLAITVLLTVKVPPLEIVERE
HSVSLSPPDAPSVKAMTQMGKVFQESNSESVAVIVLEGEGTLGDDAHKYY
DAVIRQLKDDPKHVQHVQDFWGDPLTAGAAQSADGKAAYVQLNLTGRFGQ
ADANESVEAVQKVVRETPGLPPGVKAYVTGPAAIVSDMAESGNRTVILIT
LVSVGVIFLMLLLLYRSIITVIILLFTVGIELQVARGLVAFLGMHGIVGL
TTFVVNLLVSVGIAAGTDYGIFFAGRYQEARQSGEDRESAYYTAYKGVAK
VVLASGLTIAGAIACLHFTRLPYFKPLGIPGAVGILVAVAVALTLVPACI
AAGSRFGLFDPKRQVTTRRWRRVGTAIVRWPGPILAATVAVALIGLLTLP
GYNPSYTDAKFIPQDIPATQGLVAASRHFPESKMSTPDILLIEANHDMRN
SADLLVLNRLAKAVFAVPGIANVQSITRPEGTQIEHSSVPFMLSMSNASQ
RLSLPFQRARMDDMLKQADDMSKTIALMQRMSDLMNQMVDTTHRMVSTTK
DLQQDMRTLRDHIEDFEDFWRPIRNYFYWDKHCFDIPICWSIRSIFDALD
GVDQVTDKMQTLVGDLDELDKLMPQLLEQFPIMIETMKSTRESMLTMHST
MSGIFAQMDESTENSTAMGKAFDASKNDDSFYLPPDVLKNKDFQRVMKIF
MSPDGKSSRMLISQRGDPATPEGISRVEPIKTAAEEALKGTPLEHAKLSL
AGTAAGVSELVEGSKYDLLIAGVAALCLIFIIMLLMTRSLVAALVIVGTV
ALSLGASFGLSVLVWQHICGIQINWVVLAMSVIVLLAVGSDYNLLLVSRM
KEELGAGLKTGIIRAMGGTGKVVTAAGLVFAATMGSMIVSDLLTIGQVGT
TIGLGLLFDTLIVRAFMTPAIAALLGRWFWWPLQVSPRPVGAVRGWRGPR
LVRSVLQRN
169631193YP_001704842.1 putative membrane protein MmpL [Mycobacterium abscessus ATCC 19977]MKPGMSAETDSARSRPFIARTIRTLSPLIILGWLVLILYTTLASVNWDWT
KAIPALETVGDERSVSLMPQDAPAVKAILRMGKDFNESNSDSSAMIVLEG
KEPLGDDAHQYYAQLVRELRNDPEHVEHVQDLWGDRLTSSSVQSPDEKAA
YVQLNLVGNQGTAQGDQSVAAVRDIVKRTSPSAPKDVETYVAGAAPLASD
MQHAGNKSILKITAVTVVIIFTLLLILYRSVITVILLLIMVGVELAAARG
IVAFLGHHDVFVLSTFAVNMLVFLSIAAGTDYGIFFFGRYQEARQAGQDR
ETAYYTTYRSVAPVVLASGVTIAGAILCLHFTRLPYFQTMGIPCAIGMLA
AVAVAVTLVPAGIVVASRFGLLEPKRKLRVQRWRAIGTAVVRWPAPILVA
SLAVALVGLSTLPGYKTSYNDRLYISSDIPANQGFAAAQRHFSESRLTPD
VLLIETDRDLRNPADFLVLNKVAKAIFKVRGVSRVQGITRPEGTPIANTS
VPFLLSLQSAGQVQATRFQKKRIAEMQKQADDMAKMIATMQRTYGVMKKM
SETTHRMTADTHEVQQITDDLRGSIALFDDFLRPIRNYFYWEKHCFDIPI
CWSIRSIFDALDGADALDDGLVELVKNMDKLDAIMPQLLVQFPQMIEVMQ
SMRTSVLTMYATMSGQFAQMDETTDDVMAMGEAFDASKNDDSFFLPPEVF
KNPDFQRAMSSFLSPDGKTVRFIISHNGDPMSPEGIARIEQVRNAAEEAL
KGTPLVGGKVYIAGAASTAKDWKDGSTYDLLIAGIAAICLVFIIMLITTR
SFIAALVIVGTVALSLGASFGLSVLLWQYILGVNLHWMVLAMSVIILLAV
GSDYNLLLVSRMKEELGAGLNTGIIRAMGGTGKVVTSAGLVFAATMASMV
VSDLQIIGQIGTTIGLGLLFDTLIVRSFMTPSIAALLGRWFWWPQRVRPR
PPSALLTPVGASAPSAWHTDARHDDEGPTAELPRLSE
169631192YP_001704841.1 hypothetical protein MAB_4114 [Mycobacterium abscessus ATCC 19977]MNKLSLTKTIAAVGGITMALSAGAGLASADPVTDEMVNSTCTYEQANAAL
HAENPMAAEYFDASPPNQQFMREFLSSPKDKRVSMINQVKGNQGIEYVIP
VFQQMVRSCHKY
169631191YP_001704840.1 glucose-1-phosphate thymidylyltransferase [Mycobacterium abscessus MRGIILAGGSGTRLHPITTGVSKQLLPVYDKPLVYYPLSTLIMAGVRDIL
VITTPADAPAFERLLGDGSAFGINLSYAVQPQPEGLAQAFVIGAQHIGTD
TAMLALGDNVFYGPGLGTSLRRFENIDGGAIFAYWVANPSAYGVVEFDAA
GVPLSLEEKPATPKSHYAVPGLYFYDNDVIEIARSLQKSARGEYEITEIN
QIYLDQGRLSVEVLPRGTAWLDTGTFDSLLDASDYVRTIERRQGLKIGVP
EEIAWRAGFINDDQLAARAQKLLKSGYGSYLLQLLQRK
169631190YP_001704839.1 putative glycosyltransferase GtfA [Mycobacterium abscessus ATCC 199MAENIDVHSVAHSDIGEVYTVMKFAMASYGTRGDIEPAVAVGRELQRRGH
EVRMAVPPDLIGFAGSVGLSAVPYGIHVGPQLDEYRDLWTSWTRHFWRLQ
DLVALCRQALKLVTEQWSEMSETLVSVAEGADLLSTSVGYEEPAANVAEF
YGIPLVALHTMPWRPNGQLFPVLPPMLTRTGMTAYDWLTWRVTKGAEDAQ
RRHLGLPQATSPSPQRIGQRNSLEIQAYDAVCFRGLAEEWAKYGGRRPFV
GALTMELTTSADDEVMSWIASGPPPICFASGSIPVESPAETVEMIGSACA
ELGERALVCAGATDFSGVQTSPHVKLVGVVNYAAVFPVSRAIVHHGGSGT
TAASLRAGVPTLILWTVGDQPFWGNQLRRMGVGASRRFSTTTRDSLVSDL
RTILTPECAARARAIAPHMSKPHDSVSKAADLLEAKASHP
169631189YP_001704838.1 putative epimerase/dehydratase [Mycobacterium abscessus ATCC 19977]MLISGGAGFIGSALSNRLIQAGYDVAVMDVLHPQVHARGRAIDLPASVRL
FTGDVTHAPDWDAVLRLFEPSQVVHLAAETGTAQSLSEATRHGSVNVVGT
TQLLDALSRSALVPDQLVLASSRAVYGEGAWQSGAEVFYPRPRSHAQLLA
GEWDPQGPAGASATPLSSCADRTEPRPTNIYAGTKLAQEHLLASWAAAHD
TNLSVLRLQNVYGPGQSLTNSYTGIVTLFARLAREKQALEVYEDGRIVRD
FVFIDDVVDALFAAVHTPATERRTLDIGSGTATTIHELARKVADICAAPE
PVVVGKFRDGDVRAASCDIAPAVEGLGWSPKWTLEDGLHALLEWIDKDCP
NRF
169631188YP_001704837.1 acetyltransferase AtfA [Mycobacterium abscessus ATCC 19977]MKLGSVFDSRNNALNACRLALATEVILFHSFPLTGRVVESKAILQLLFSV
GVDGFFALSGFLITASWLRNPDVREYFVARALRILPGYYIVLAITAFVVA
PLSVAIQGGSAARLLFSSAPVEYVLKNSALVQLQLDVGGTPHDIPYPGIW
NASLWSLVFEVMCYIAVAGLGLLGLASRRWTAPVILILATIAAIMLPPLT
FPGLWTIPQLAVRSAIMFSAGALLYQWRDRIPARWSLVAVSVVIVLFSGM
LPDYRVLGALPLAYAVVVSGVLIKNKRMNIHTDLSYGVYIYASPTQQLLA
VAGLYALNPFVFFGVSAVATLIPAAFSWFLIEKRALALKSRLKRKRATSA
GTLGVEPAVADSVALRERALSPHEDS
169631187YP_001704836.1 putative methyltransferase [Mycobacterium abscessus ATCC 19977]MSADDTPAMDTPIGRIFEGAEKVHKLRHYLPIYQHALARTERMLEIGVDR
GGSLQMWREYLPDATIVGLDINPESARHDDPEHRVHVRIGDQTDVRFLGA
VVDELGPFDTILDDGGHTPKQMIGSFRYLFPRLRPGGVYIVEDVCANYWT
IYRDQRESFIDFTKWLMDAMHAHYLEMNSVYQIMEGHPRRLEGVQVPLAT
TIIDRIEVFDSVVVIHRAEKPKSLPRAVFR
169631186YP_001704835.1 methyltransferase MtfB [Mycobacterium abscessus ATCC 19977]MTVTDYDTRSAYLDLLRQDLTRYGVDELVPVGWNWLHRPFFKFGDYVLVR
KRAFDAHKRDLGLDWPADALTMIGMQRLTSLQQCVETVLADDVPGDLVEC
GVWRGGASILMRAVLAAYGDTTRSVWLCDSFEGVPPPDTANYKADKGDRL
HLAAPILAVTEKNVRANFERYGLLDQQVRFVPGWFKDTLHDAPIEQIAVL
RLDGDLYESTIQALDGLYARLSPGGFCIIDDYHALDSCKQAVTDYRAKHG
ITAEIMEIDGTGVFWRKE
169631185YP_001704834.1 glycosyltransferase GtfA [Mycobacterium abscessus ATCC 19977]MKFVLASYGTRGDIEPSVVVARELQRRGHDVVMAVPPDLISFTESAGLET
VSYGLDTKTWLDVYRNFWTFFFHTFWKVREIRTMWRQMWELSDECWAQMN
TTLMSAAQGADVLFAGQSYQEPAANVAEYHDIPLVTLHHIPMRPNGQLVT
ILPSRLGRAAMRAFDWVSWRLNKKVEDAQRRELRLPKASSPSPQRIAERR
SLEIQGYDSVCFPGLATEWAKWNGLRPFVGSLTMAMTQEADEEVASWIAG
GTPPIFFGFGSMPVESPSAALEMIGSACAELGERALIGAGWSDFGGAQLP
EHVKVVGAVNYATVFPACRAVVHHGGSGTTAASLRAGVPTLILSMDANQT
LWGGQVKKLKVGTTRRFSTTTRESLVADLRRILASDYADRARELAAGMTK
PGESAVAAADAMERFAQARCSA
169631184YP_001704833.1 acetyltransferase [Mycobacterium abscessus ATCC 19977]MTKAGATGQAKGLTLGQVFDPRNNALNAWRLALAVSVIFWHSWPLTGRTI
TYRPFEQLIEQVGVDGFFAVSGFLITASWLRKPKLRDFAIARGLRIFPGL
WVCLAIIAFVIAPTSVLIQGGSVSDLFASHKPIEYVINNGLLNVYYAGVD
GTPRGVPWPGVWNGSIWTLVFEMICYIAVAVLGVAGLLKRRWVVPAAFVF
FLAATAYLSYPVFAATSIPQMVARFAVMFAAGALLNQYKDILPARWSLVA
LSVAIVLVSGLLENYRDVAALPLAYAVIVSGSLIHKPRLNLRNDLSYGTY
IYAYPIQQLLVVSGLASLNLLLFFVIATVATVPLAAFSWFVVEKRAIALK
SRLTRKQAVTVAERPPIPLDRDAA
169631183YP_001704832.1 methyltransferase MtfD [Mycobacterium abscessus ATCC 19977]MADELSLRTRIQLWAVRKEYWLARTLLPKVYSNDALICFNSHAFLDDPDF
QRAYERGVRALGGTDWYQWHWRVHVGLWAAASANKVKGDFVECGVSYGFL
SSAIMEYLDWDRLGKTFYLLDTFAGLDPRFVSAGERNAGALEKSDKLVKN
GMYVSSVDSVKANFAQWKNQRVIVGAVPETLAEVDTDAVAFLHIDMNCAP
PEVETLRYFWPRLSPGAFVLLDDYANRGRDEQRIAMDDVARELGVSVVAL
PTGQGLIIKPPQ
169631182YP_001704831.1 putative glycosyltransferase GtfB [Mycobacterium abscessus ATCC 199MKFALACYGTRGDVEPSVSVGCELSRRGHDVSIAVPPELIGFAESAGLAA
VPYGPKLHDFLQDEFLRTFWTRLMRNPIGALRELWAPIARYWPDTSTTLL
SLAEDADLLSTGLNFEQSAGNVAEYFDIPLIMLHHFPMRPNGQLLPMLPA
RLVRSGGLLSEWLLWRATKDADDAQREVLGLPRATRPSAFRTARRGAVEI
QAYDAVSVPGLAMEWAKWGDSRPFVGALTMGLTTGADQDVAAWLAAGKPP
ICFATGSIPLESPSDTVEMISSACAELGERGLICAGGTDFSEITIPDHVK
VVGAVNYAAVFAASRAVVHHGGSGTTAASLRAGVPTLILWSSADQPYWGN
QLSRLKVGAARRFSATDRNTLAADLRRVLLPEYAVAARAVSAQMTSPTDS
VTKAADLFESTAGRKAV
169631181YP_001704830.1 methyltransferase [Mycobacterium abscessus ATCC 19977]MQRSRDWVMFKLNAVFTQRVQKFIYRHATRKLETEDVVFLNYGYEEEPAM
GVPLSASDEPDRYSIQLYHSTATQADLGGQRVLEVGCGHGGGASYLVRAL
QPASYTGLDLNPDGISFCRRRHDLPGLEFVQGDAEDLPFPDESFDAVINV
ESSHLYPHFPVFLTEVARVLRPGGNFLYTDARSVQDVAGWKVALANAPLR
MVSERGINAEVRRGMEKNLARWRYVIDRATPAPLRGIVRRFAPAQRAYDD
LRAGGSVEYRMYRFVKA
169631180YP_001704829.1 hypothetical protein MAB_4102c [Mycobacterium abscessus ATCC 19977]MNVVESIERGLDWLATPRQLPGRLEMETRRGRRLELEVVSVAIRLPILSG
AVVRLPVFVMLMPAGSSPISGTDVTAEQPVD
169631179YP_001704828.1 hypothetical protein MAB_4101 [Mycobacterium abscessus ATCC 19977]MRVSPNNPPGITDTIYIGAHYVVYSEYTAALPRIARSVRSEAPKHPHEDF
QPALNGYLENRPLNGHRSRMRNTWRSVTKTG
169631178YP_001704827.1 MbtH-like protein [Mycobacterium abscessus ATCC 19977]MSINPFDDDKGSFFVLVNDEEQHSLWPAFADVPDGWRVVFGEADRAACLE
YIEQNWTDIRPKSLRERLAQGGGLGR
169631177YP_001704826.1 non-ribosomal peptide synthetase [Mycobacterium abscessus ATCC 1997MLESEDRALPLSRGQLDIWLSQETGLVGAEWQLGLLVRIEGQVERVLLER
AIRQAVTEAEPARAAFFEVDGQIVQRPIDHSDLELAFEDLRDSDDPAGLA
RKKATDIQRTLMPLTGQLLKFALYRTADDEFHLFGLCHHINLDGLGMAVV
SRRVASIYTALATGEPIPPAYFGTLQDLVDWETDYVASAEYAEDREYWSN
NLPPDSGLDYRMPHASEESDGYKPSDSVQMDDVTVSEIKELTKVLRIRRY
SVITAACALLVRGWSTSGSEVALDFPVSRRVHPDSRTLPGMMAGVVPLVL
NAPPQSTVAEFCRHVDTRIRELLQHQRFPVHTLEDEEFGLRGPRHAGNRV
AVNFIPARLTLDLAGAPATASYTNHGPMGHFGLFFIGASDQLVLSSSGDG
EPFARFGVPNLAVRLQRLLSEMAADPDRRLSSLDSLVNDELADLAELGNR
AILTAPAARPVSIPELFTAQVSAEPDAVALTFGGSSLTYRELDEAADRLA
IQLGHRGVGPGDRVILFSDRSARAVIGILAVLKTGAAYLPVDPAVPASRL
EFIVSDAAPVAAITTTDLRGRLDGFGLAVIDLDAHTDSPAEGQSGLVPAA
PAPDDIAYIIYTSGTTGAPKGVAVTHHNVTQLMQSLDAGLPKPGVWPLCH
SLAFDVSVWEIWGALLRGGRLAVVPESITASPADFHDLLVAEQVTVLTQT
PSAVAMLSPDGLESTALAVVGEACPAAVVDKWAPGRTMINAYGPTETTMC
VAISAPLKADLPDAVVPIGSPVPGAALFVLDTWLQPVPAGVVGELYVAGD
GVACGYVGRSDLTASRFVACPFGKPGTRMYRTGDLVLWGDDGQLQYLGRA
DEQVKIRGYRIELGEVQAALGALDGVDQAAAIVREDRPGDKRLVGYVTGT
ADPAEIRGILSKRLPPYMVPAAVVVLETLPLTSNNKLDTRALPAPEYGGL
GADYRAPGNAVEEILAGVYAQVLGVERVGVDDSFFDLGGDSILSMQVVAR
ARAAGVLCRPRDVFIEQTVSRLAAVAEVSGGEAYVADEGLGTVAVTPIMH
WLRDVDGPIVEFNQTLVIQVPSSVTQDDVVIVLQALLDRHPSLRLRLQDN
DGDWSLLVPEAGAVDARDRLHVVGELSDEALVAARTALDPATGSMLSAVW
VPGTAQLALVIHHLAVDGVSWRILLEDINIAWAQHHGGADIELPAGGTSF
ARWSALLAEHALSTDVVEQADTWRQVLATPARVGTVQPEIDTYANAGRLS
VALDTETTRQLLGEVPAAFHAGVQDILLIAFGLAWNEFLGVSGAPIAFDI
EGHGRQEEIGEAVHRRIDLSRTTGWFTTKYPASLAVGELSWAQVSAGEAA
LGPVIKTAKEQLRALPDGLTYGLLRYLNPGVDLTGPEPTIGFNYLGRLGA
GAGDLSEDFWRISADSLRLTDVAAAISMPLAHSVELNAGTMDTAAGPELR
ANWSWAPSALDGAQADRLSRLWFEALAGICAHVRSGGGGLTPSDLAPARL
NQPQIDALVQQYDISDVLPLTPLQQGLLFQAGFAEATGDSTEDDVYAVQL
ALTLTGALDVARLHDAVSAVAKRHPNLVARFSEEYGEPVQIILADPVIAW
QHVELIGDIDQQVEQLCAAERAAVCRLFTEPVFRAALISGLGGAEDGEVG
KHRLVLTAHHIVIDGWSLPILLQEIFSIYYGHQLPAPAPYRNFVTWLAGQ
DRVAAQSVWGRALDGFEAPTLVGSLATAGRRGVESYRISEDITRSLGELA
RAQHTTVNTVLQAAWAQVLTWLTGQHDVAFGTAVSGRPADLAGADSMVGL
LINTVPVRANITAATTVADLLDQLQRMHNDTVEHEHLALNEIHHAIGLDR
LFDTLFVYENYPIDADALLGARELGITDFSSREYNHYPLSVVAMPGNELS
LRVEFDTDVFDSAEIDTVVDKLRQVLAAMTVDPATRLSSIDLLDAGEHDR
LDKWGNRAVLIRPEPALTSIPELFAAQVARAPEAIAITCGERSWSYGELD
ATANRLANHLVTHGARPGERVALLLPRTGEAIAAILAVLKTGAAYLPIDP
AHPDSRVDFVLGDAAPIVAVTTAELLPRLSASGVPVIDIDDPAVSAQNDT
TLPVPAVDDIAYIIYTSGTTGAPKGVAVTHRNVAQLLESLDAELALGQVW
TQCHSLAFDYSVWEIWGALLYGGRLLVVPDAVVRSPEELHALLVSEEVSV
LSQTPSAFYALQTADALQPEMGQQLKLQTVVFGGEALEPQRLSSWFDSHP
GLPRMINMYGITETTVHASFREIDDGDVDSNSSPIGVPLEHLAFFVLDGW
LRKVPVGVVGELYVAGSGQASGYLGRSDLTTTRFVACPFGAPGSRMYRTG
DLVQWGEDGQLRYVGRADKQVKIRGYRIELGEVHAALARVAGVDQAAVIA
REDRPGDKRLVGYITESTAGTLDPTAVRATLAERLPSYMVPAAVVVLDAL
PLTVNGKLDTRALPAPEFQDADHYRAPEDAVEEILAGIYAQVLGVEQIGV
DDSFFDLGGDSISSMQVVARARAAGLLLRPRDIFVEQTVSRLAQVAVFAD
GEATVVDAGTGPVVATPIIRWLHGLGGNVGEFNQTVVLQAPEGVSEDDVV
TVLQALLDRHATLRLRAEENDGEWALLIPEVGTVDARACLLAVEALSDEA
LRHARSRLNPATGSMLSALWESGKNRLVLIVHHLAVDAVSWRILLEDFNI
AWAQHHGGQAVELPSGGTSFARWATLLDERARTADVEALTDTWRQVEKIP
PALPAVHPTMDTYASAGQLSVSLDADLTRELLGEVPVAYHAGVQDILLIA
FALAWNEFLGSAGAPIGIDVEGHGRNEEFVADADLSRTVGWFTSKYPVSL
AVGELSWAQVVAGDPALGPVIKGAKEQLRTLPDGLTYGLLRYLNPDADVA
GPDPSIGFNYLGRLGAGGVDLSDDLWRIDQDGVAITAAATAVPTPLGHTV
ELNAGVMEDADAGARLHATWTWALSALSHNQVDRISRLWFDSLAGICAHV
RGGGGGLSPSDVMPARLTQQQIDQLDEQYEIADVLPLTPLQQGLLFHSNL
APEGLEGSDDLYAVQLDVALSGPLDPKRLQDAVHSAIRRRPNVVARFYEE
FGEPVQLIPADPELAWQYLELDADSEAEEQVERLAASERAAVCDLAGQPA
FRAALARTGTDQYRFLVTNHHIVLDGWSKPILLQEIFASYFGERLPAPVA
YRRFVTWLSGQDNDAARSAWGKVFEGFETPTLVGPPGRMVLGRRGVESFE
VSAETTQALGELARSCRTTVSTVLQAAWAQLLMWLTGQTDVAFGTAVSGR
PTDLVGAESMVGLLINTVPVRATITPDTTIASLLNQLQAAYGETLEHQHL
ALKEIHHAVGHDQLFDTMFVYENYPIDTAALSRVHELSITGFSNREYNHY
PLAVQATPGHELGLRVEFDTDVFNAVRIGKLVKRFQRVLEAMTSDVKGKK
KEPT
169631176YP_001704825.1 peptide synthetase NRP [Mycobacterium abscessus ATCC 19977]MSADPTRTLLSMDLLDDDDHDRLDEWGNRAVLTEPAAEPVSIPVVFAVQV
ERAPETVALVCRDRSWTYRELDQITNRIAHLLAGNGAGPGEVVGLLVPRS
GEAIIGLLAILKTGAAYLPIDPAHPDERIKFMVSDAGPVAVLTTADLGSR
FEGLDVSVIEIDDPLIDGQPSSALPTPEPDDLAYMTYTSGTTGVPKAVAV
THHNVTQLVDAVRADLPARPGEVWSQWHSLVFDVSVWEIWGALLHGGRLV
VVPESVASSPDDLHELLISEKVSVLCQTPSAAGMLSPERLESTTLIVAGE
ACPPELVDRWATSGRTMINAYGPTEATIYAAMSGPLTPGSGVAPIGSPVP
GAALFVLDKWLRPAPEGVVGELYVAGNGVAPGYAHRSGLTASRFLACPFG
GPGSRMYRTGDLVQWGEDGQLQYLGRADEQVKIRGYRIELGEIQAALSRL
DGVEQAVVIAREDRPGDKRLVGYIMGTADPVEARNALAERLPAYMVPAAV
VVLDALPLTVNGKLDKRALPAPEYRSVGTDYRAPSGPVEKVLADIYAQVL
GVDRVGVDESFFDLGGDSILSMQVVSRARAAGVHCRPRDIFVEQTVSGVA
AVASLSDGRAGIVDDGIGPVLATPIIHWLQGVPGPVDQFNQTIVLQAPVG
VTEDDVVVILQALLDRHATLRLRAESGDASGGWSLLVPDTGTVDARACLR
VAESLSDAELVAARSRLNPAAGAQLSAVWVPDSRQLALMIHHLAVDGVSW
RILLEDLNIAWAQHHGGQPVQLPAGGTSFARWAALLDEHARSQDVVATAD
AWREVTAVPAALPAVMPGLDTYATAKTLSVSLDADTTRELLSEVPAAFHA
GVQDILLIAFGLAWNEFLDSNTTSIGIGVEGHGRQEELGRVAGLDIDLSR
TVGWFTTKYPVSLSVGGLSWKEIADGSPDLGPIIKSAKEQLRALPDPLTY
GLLRYLNPDVDLSGPEPAIGFNYLGRLGAGAADLTDDLWRINEDSLSSAG
VASSVSMPLMYTVDLNAGIVEGGLGEEAGPHLRAGWTWAPSSVTEPQVQR
LSQLWFEALAGICAYVRGGGGGLTPSDIAPAQLSQQQIDELHEQHKIVDV
LPLTPIQEGLLFHTTFARAAGALEGDEAGIDFYAVQLDITVTGLVDQLRL
RDAVHTVVRRHPNLAARFCTQFGDPVQVILADPVIAWRYLDLRGDDLTPD
EEIQHLCAAERAAVCDLADRPTLRAALIRTEGNQHRFVLTFHHVVIDGWS
LPILLQEIFASYFGHRLPAPSSYRSFVSWLADQDLDAARTAWGKVLEGFD
TPTLVAPPAPPGARGVESYRVSAETTQALGDLARSQHTTVSTVLQAAWAQ
LLMVLTGQDDVAFGTAVSGRPAELAGSDSIVGLLINTVPVRARATASTTI
AELLGQLQSAHNDTIEHEHLALNEIHHVAGHEQLFDTLFLYESYPIDTSA
FMGVQELAITEFVTREYNHYPLSVMALPGHELGIRVEYDTDKFGLDDIQA
VFERFERVLVSMVSDADQRLSSLDVLQTDEHKQLDGWGNRKVLVRGPEPV
LSIPEAFAEQVDRAPEAVALTFEGRSTTYGELDEAANRLANLLSVYGAAP
GESVALLMPRSDEAIIAILAILKTGASYLPIDPSVPDTRLEFMLSDAVPI
AAVTTAELRARFDGSGVSVVQFDDAEDDPTGAIYGHTPLLTPAPDDIAYT
IYTSGTTGVPKGVAIAHSNVTQALKFPLTHMPTGPGEVWTQAGSLVFDIT
VWEIFGALLHGGRLVIIPDSVVRSPDDFRDLLIREKVTVLFQTPSAVGML
SPEGLNNLTLVVAGEACPTEVVDRWAPGRVMINGYGPTETTIYATFGELI
AGSGVVPIGVPVPDAALFVLDRWMRPVPPGVVGELYVAGLGVGIGYVKRQ
ALTAARFVACPFGEPGTRMYRTGDLVRWGVSESSVGQLEYLGRADEQVKI
RGFRIELGEIQAALADVDGVEQAAVIAREDRPGDKRLVGYFIGTGEPAEL
RAALAKRLPPYMVPAALVRLEALPLTVNGKLDKRALPAPEYDDAARYRAP
ANAVEEAVAGIYAQVLGVERVGTDDSFFDLGGDSISAMRVVAAINTSFDA
QLAVRTLFEAPSVRSLSGYLDGAAGAPANGPTYASVHGPGATEVRASDLT
LDKFIDEATLQKAPTLPRAEATARTVLLTGATGFLGRYLVLQWLRELEQV
DGTLICLVRAKSDEEARRRLDKTFDSGDPELIRVYEALAADRLQVIAGDK
AEPSLGLDQDTWQRLADTVDLIVDSAALVNSVLPYSELFGPNVVGTAELI
RFALTTKLKPYTYISTADVGREIEKSVFREDADIRVISATRPSDGSYANG
YGNSKWAGEVLLREAHEQVGLPVKVFRSGMIMVDTSYAGQVNASDTVARM
VLSVVATGVAPYSVYQLDADGNRQRAHFDGLPVEFVAEAITALGGGAAGS
FDGSADFETYHVMNPHDDGIGIDEYVDWLIEAGHPIERIDDFGEWVRQFE
ARLHALPDHQRQGSVLQMLKILQDHGWDGQPPEPVRGPMAPADRFHAAVR
KAKIGSDHDIPQVSAPIIAKYASDLQLHGLL
169631175YP_001704824.1 hypothetical protein MAB_4097c [Mycobacterium abscessus ATCC 19977]MWRELLGLAFLMSLNPVLLGLILVVISRPRPVQNLLAFWVGALVVNVPSF
VIALFALHMVPSFASFAKNLATADPGSSIKPLQLGTGVLCVVIAVWIATR
LRSRQRENQPVATGAGGDSSVLVLDSEAPAVEARPVGRIRGAVSYLGSTF
QRLLHRGKGAWENGALWVALVLGIGYMPPPPLVLLVDTIIVGSGTAMSTQ
VIAAVVFVFTMLAVFEIALISYVIAPARTQAVLEPIHNWALSHRQLVLLV
LFAVVGIWQVLTGVGLV
169631174YP_001704823.1 hypothetical protein MAB_4096c [Mycobacterium abscessus ATCC 19977]MSTEPSMGLDKDMMPVPHAHPHVYEARWPVRMADVDSGGRLRLDGAARHI
QDIGQDHLRGVEAEETHPLWIVRRTMIDVIKPIDFKEALWLRRWCSATSN
RWCQMRVRLDGRDGGLVESEAFWIHVSSETQGPARIDDDFLATVASTTDV
GRLRWKPYNKPGSRDTATDIRDFPVRFTDMDLFDHMNNSVYWSIVEDHLS
RESETRSAPFRVCLEHDSAVSLGDKLEIITNVYEDGTEFGVPGRGVTTLT
YVVGDEVKALASIFAR
169631173YP_001704822.1 isocitrate lyase (AceA) [Mycobacterium abscessus ATCC 19977]MSNVGKPRTAAEIQQDWDTNPRWKGITRDYTAAQVEELQGSVVEENTLAR
RGAEILWDAVSKDDDSYINALGALTGNMAVQQVRAGLKAIYLSGWQVAGD
ANLSGHTYPDQSLYPANSVPAVVRRINNALLRADEIARVEGDTSVDNWLV
PIVADGEAGFGGALNVYELQKAMIAAGAAGTHWEDQLASEKKCGHLGGKV
LIPTQQHIRTLTSARLAADVANTPTVVIARTDAEAATLITSDVDERDKPF
VTGERTSEGFYNVQKGIEPCIARAKAYAPYADLIWMETGVPDLEVARKFA
EAVKADFPDQLLSYNCSPSFNWKQHLDDSTIAKFQKELGAMGFKFQFITL
AGFHALNYSMFDLAYGYAREGMTAYVDLQEREFASEARGYTATKHQREVG
AGYFDKIATTVDPNTSTAALKGSTEEGQFH
169631172YP_001704821.1 3-hydroxybutyryl-CoA dehydrogenase [Mycobacterium abscessus ATCC 19MTDGITRVGVIGAGQMGAGIAEVSARAGVDVLVFETTEALTTAGRDRITK
SLDRGVSAGKITERERDAAVANLKFTTDLADFADRQLVIEAVIEDESIKS
SIFAKLDEVITDPDAVLASNTSSIPIMKIAAATKNPGRVLGLHFFNPVPV
LPLVELISTLVTTPEAAARTEAFASEVLGKQVVRAADRSGFVVNFLLVPY
LLAAIRMAESGFATVEDIDKAVVAGLSHPMGPLRLSDLVGLDTLKLIADS
MYDEYKEPLYAAPPLLLRMVEAGRLGKKSGVGFYEYKAK
169631171YP_001704820.1 putative allophanate hydrolase [Mycobacterium abscessus ATCC 19977]MSNSTVRVTAPGMLTTVQDWPGRTGYWQVGVPPSGPMDDLSFRLGNRAVG
NPEGAPGLEATLAGPTLHFTAETLVCVAGAPALVTVNGRPVPQWRAVTVP
ADGTLAVGAATDTGMRIYVLIAGGIAVPQFLGSAATFTLGGFGGPAGRAL
ATGDVLTLGQSRDGEPQCIPGAAQPAIGHHWELAVTEGPHGAPDFFTRSD
IDELLSTHYEVHFNSDRTGVRLIGPKPHWARTDGGEAGLHPSNIHDNAYS
VGTLDFTGDTPILLGPDGPSLGGFVCPVTVVSADRWKLGQLRAGDTVRFI
RIEASRSASLRSIGIDRRGHWPSVFSTRGDGDDGVLAYRPARDDAPEMTY
RRSGDDNILVEYGDLTLDLALRARVHALHQRLEDTHTTGIIDLTPGIRSL
QVHFDPDRLPMGKVLGLLDDIDEHLPASEELVVPSRRVAMPLSWDDPSAR
EAMERYRLGVRADAPWMPWNIEFIRRINGLDSVDEVHRTVYDASYLVLGL
GDVYLGAPVATPVDPRHRLVTTKYNPARTWTPENAVGIGGAYLCIYGMEG
PGGYQLVGRTVQVWNHQHPDNAGAFEPGTPWLLRFFDQINWYPVSGEELL
ELRDELATGRGNGGITITEGEFSMAGYSAFLAHNAASIGQFRDHQRLAYA
AEREAWSTAGEFARA
169631170YP_001704819.1 hypothetical protein MAB_4092 [Mycobacterium abscessus ATCC 19977]MDRRADGKDAVKDSTILDEVVPARAPWSTVVAAGDVLTIIDLKGNQAVDT
LLYSAADTGVRYSAQATIAAQSNLFLRAGTVLRAEDGSPLMTIVEDEVGS
HDTIGGACSQESNTLRYGHHTKHQHACVENFLLEGAKWGLGKRDLVSNIN
FYMNVPVDDDGTLGIVDGLSAPGKKIKLRAEVDTLVLVSNCPQINNPCNG
FDPTPVRMVVESL
169631169YP_001704818.1 hypothetical protein MAB_4091 [Mycobacterium abscessus ATCC 19977]MTTATTKGAREHARAQAGQITDSMPVLPASEWPWAPSDIDPLTFTWAETV
PGGRYASKVLGRGTRLRLTDITGSACMNIVLLRADAPWERLNVADTVKVP
WQAYLGAGHPLLSDQGRVLATIVADSSGHHDTFCGTTTLAGNTAKYGAGE
LYSASPAGRELFTLAAAKHGLSPRDIGPSVSFFHGIRAAADGALHSTGTA
GPGAEVDLLIHLPVIALLANTAHPLDPSDTFDTGPVRVLAWTTLGELADL
PNADPEYQRAVLNTEDAWTAAQTGKTQ
169631168YP_001704817.1 putative amino-acid permease [Mycobacterium abscessus ATCC 19977]MNASTATGTAAPSAAISAASDSDDLAAFGYKPQLHRSLGKFASFAAGFSF
VSILTTIFQLFAFGFSFGGPAFFWTWPIVFLGQYMVALNFAELAARYPIS
GAIYQWARRLGGAAVGWFAGWFMIIAQIVTASAAAIALQVVLPTVWSGFQ
LIGTDSSLTSVSGASNAVLLGSLLLVATTAINAVGVNWMSRINSIGVTCE
IVGVVAVVGMLFGHAERGPSVVLHTGDAGSGYPWAFLAAGLMAAYVLVGF
GSASELAEETRNPRRVAPRTILSAIVVSAIGGALMILGALMAAPSLTDGQ
LATGGLPYVLDSKLASPFGTLLLIDVAIAVFVCTLAIQTAASRLMFSMAR
DGKLPFSAVLSHVNPRTGTPIAPAVVVGVCCVLILAVNFGNAALFTSLCS
VCIALIYLAYLMVTTPLLLRRLGIGGSTWDANLGQTDADGRKLFSLGRCG
LPINILAVGYGAFMILNLSWPRPAVFDPTGEHPYLVWMAPICIIAVLLAG
LVAYPRHTASTTEETVR
169631167YP_001704816.1 TetR family transcriptional regulator [Mycobacterium abscessus ATCCMSGRPRRISPIREGNSTRDEILDASAELFTTDGFAATTTRRIAESVGIQQ
ASLYYHFKTKDDILDALLAMTIDQPLHYAALIADRPEAPVVRLYALALGD
AAQLAASRWNLGALYLLPDLRAERFSAFRRKRDQLRTHYQELAAAACRAS
MLRAGVERLPFRLVESVIMLRADGDSIAPEALADATLRVVGVTGDAGEIE
GAARVLLGQLGWPVAIPKR
169631166YP_001704815.1 mycolic acid synthase UmaA1 [Mycobacterium abscessus ATCC 19977]MSDLKPYYEESQSIYDISDEFYGLFLDEETMGYTCAYFERDDLTLAEAQI
AKFDLALGKLNLEPGMTVLDIGCGWGACLDRAMRKFDVNVIGITLSKNQS
EYSRKRLAQVAAETGRSAEIRMQGWEEFNDKVDRIVTIGAFEAFKQERYP
IFFERAYDILPNDGRMLLHTILAHTQQFFRENGIAITISDLKFMKFIGEE
IFPGGQLPAVEDIEKLAADSGFNLERVHLLQPHYAKTLDIWAQNLEQRRE
EAIAIQSQEVYDRFMKYLTGCADFFRRGVTNVGQFTLVK
169631165YP_001704814.1 hypothetical protein MAB_4087 [Mycobacterium abscessus ATCC 19977]MTQKFDTSALRYRPGLTFADVDSRATPGFDGSREDGEALQAELSGRLGLL
QEMLYANGRSGDHRSVLLVLQGMDTSGKGGIVKHVVGQVDPQGMAHASFG
VPTEDERKHHYLWRIRNALPSGGQLGVFDRSHYEDVLVVRVHNLVAPEVW
GARYEEINPFEKELTEAGTTILKVVLVVSLDEQKRRLAERLDRPDKYWKF
NPNDIDERAFWPAYQDAYQAVLEKTSTAHAPWYVIPCDRKWYSRLAVTAL
LDETLDGLNLSWPPADFDIEEQKRRLAQA
169631164YP_001704813.1 TetR family transcriptional regulator [Mycobacterium abscessus ATCCMAITVASKTQPAAIKTDGRKRRWHKHKVERRTELVDGTLDAIRHRGRDIS
MDEIASDIGVSKTVLYRYFVDKNDLTTAVMTRFAQTTLIPKMAAALSARL
DGYDLTRTVIKVYVETVAAEPEIYPFVMANSSASRSKAIADSERIIARML
ALMLRRRMHEAGMDTHGVEPWAYMIVGGVQLATHSWMSHPRMSSDELIDY
LTMIAWNALLGIVDVGGSREKFVDMVHPSPIPPPPQTRQTHSA
169631163YP_001704812.1 hypothetical protein MAB_4085c [Mycobacterium abscessus ATCC 19977]MRPMPDDGYVAGKHSDQPGARKASGGVFAMGNSAVDEQRRKQLRRMKAVA
TGFLIGATVLFLACRWWQSVGAPGWVGYVGAAAEAGMVGALADWFAVTAL
FRHPLGLKIPHTAIIKRKKDQLGEGLGNFVRENFMSPAVISAKVRDAQIA
GRLGKWMSDRSHAERVAAEASTVLRVGAQMLRDEDVQQAIDSVIVRRIAE
PKWGPPVGRVLSTVLKEDRHAPVIQLLCDRAFEWALGASDTIDRVVVRDS
PSWTPKFVDHFVGDRIYRELVDFTDKVRRNPEHDLRQSVNRLLYEFADDL
QHDDLTIAKAEAVKARLMARAEVQNAAATAWSAAKKMITESVDDPSSELR
TRIADTVVRIGETLRDDASVRDKVDGWVERAARHLVDQYGAEITAVITET
IERWDADEASRRIELHVGRDLQFIRINGTVVGSLAGLIIYTVAQLLF
169631162YP_001704811.1 transcriptional regulator [Mycobacterium abscessus ATCC 19977]MPQESDLATAVSNAASDIGGFIRAQREAAQVSVRQLAEKAGVSNPYLSQI
ERGLRRPSAEVLNQIAKALRVSAEVLYVRAGILDRSDASPVRDAIIADTF
ITERQKQVLLDVYSSFVQQNAEAQSDVAESDLELPATTE
169631161YP_001704810.1 Heparin-binding hemagglutinin [Mycobacterium abscessus ATCC 19977]MTKKNTSFDDLKTPFYVAVGAGDLALAAVADVVVKLRERAEEAASEAGAR
VDETRDRLRELSAELPTDVNELRDRFTPEELRKVAEAYLQVATDIYNNLA
ERGEEAIERLRSTPGIEENVTRAEGLVGNYAELTEQALGTVASQTRAVGE
RAAKLVGIDLSGKATPAKKAAPAKKAPAKKAAPAKKAAPAKAAAKKAAPA
KKAPAKKAAPRTVTQK
169631160YP_001704809.1 hypothetical protein MAB_4082c [Mycobacterium abscessus ATCC 19977]MAFSFHVFALISLITLIAAIVALVHAAIQPADAFVAAEKQTKTTWVVILA
GAAVLTLIPGLELLTAGIAAVAAGVYFVDVRPRVLEVQGKSR
169631159YP_001704808.1 hypothetical protein MAB_4081c [Mycobacterium abscessus ATCC 19977]MSVHGCLKCRASRGDEHVARKTLTSRRVTAVAAAMTALLVVNAVPAAAVE
PPLIDHVSWGTTSLGRTLRIYPTPLGRTYDAPDAVDVAWAEVVALAPDAQ
TPGMRMQFDCHWYGRVFIPDKPSWNLEPWRPQVDGALMAASQCNPGGPEI
169631158YP_001704807.1 hypothetical protein MAB_4080c [Mycobacterium abscessus ATCC 19977]MDRARWVRDRRAVCLIFTVLFMMSLSMTASVASADSMNWDAVAECESGGN
WSANTGNGFYGGLQFKPSTWAAHGGVGNPAEASREEQIAVAEDVLRTQGP
GAWPKCGGGGIGGGAGCQFVPGGSIFGIVNFRQMCNGVMGLIPPAG
169631157YP_001704806.1 carboxyvinyl-carboxyphosphonate phosphorylmutase [Mycobacterium absMTSQHERAVTFAALHQSGTFVVPNPWDAGTARILTAYGFPALATTSAGLA
FALGRRDSANLIGQAETLANAAQIAAATHLPVSADLENGGPTIGDIAMTI
REAAASGLVGGSIEDATGRPDAPIFPLAEAVDRITAAAHTTRDLPFPFTL
TARAENFLYGRPDLTDTITRLNAYAEAGADVVYAPGLPDAEAVRTVCAAV
DRPVNLLATGFVLNHSVGEIAEWGVRRISLGSAMARAALGAFVGGARELA
QQGTFGFATHALSYGDANALFPPG
169631156YP_001704805.1 deoxyribose-phosphate aldolase DeoC [Mycobacterium abscessus ATCC 1MAALIDHTLLKPEATPEDVRALVAEAVDLGVLAVCVSPSMLPVLLPEGVE
RLLVAGVVGFPSGKHLSSVKAHEAALAVAAGAHEIDMVIDVGAAVGGDFG
AVQGDIEAVRRAVPAATLKVIIESAALLERSGPEAVRAACRASEAAGADF
VKTSTGFHPAGGATVEAVRIMAETVGDRLQVKASGGIRTARDAAAMLEAG
ATRLGLSGSRIVLDGFAD
169631155YP_001704804.1 hypothetical protein MAB_4077 [Mycobacterium abscessus ATCC 19977]MTTPPQPPPGPSGSTPPEPSPWQPPAQQVPPPAHEQAPTLQNPVAPPPPP
VGPPPGEPAAAPEPVSPRKGRDYKSLVLIAVIVVAVALAAVLGIELYARQ
RTSSEVNAATSCLVQDGATASFGPMPLVLQYLGDHIDKLTIKTAGNQIAQ
AKKMTVAITVRDVSLKKTADSLGTIGRLDVEVSWPTAGITESARALVPGM
LGSMVGDATTNESTGEVTLSAAGGLAQITTKPVIKDGMVTLQSENVSAFI
GLPREIIQPALDTFSKGLVGGQYPMGLKAQEVKVTNDGITVKLSSTNQPM
KPTNEPCLQNLSF
169631154YP_001704803.1 putative nitrilase/cyanide hydratase [Mycobacterium abscessus ATCC MRIVLAQITSGADPTENLATVAATVRDAAAQGATLIVFPEATMCRFGVPL
GPVAQPVNGRWADGVRAIADEAGLTVVVGMFTPAGDGRVHNTLLATGPGV
DTHYNKIHLYDAFGFRESATVAPGHEPVLITVDGVAVGLTTCYDIRFPGL
YTDLARRGAQVITVSASWAAGTGKWDQWTLLARARAADSTCFVAAADQAL
PALEAPAHGSPTGIGGSLLASPTGELIAQAGPDPELIVADLNLGAVAETR
KILPVLNSSSAE
169631153YP_001704802.1 hypothetical protein MAB_4075 [Mycobacterium abscessus ATCC 19977]MAPPARPRGTITRGTTGINRLRRSDRWLVHHPGVQAALASAADPLVVDLG
YGAMPNTTLELAARLRTVRSDIRVVGLEIDPQRVVPARDGVHFGLGGFEL
AGLTPVLVRAFNVLRQYPESEVAQAWATMTDRLAPGGLIIEGTCDEIGRR
CAWLLLDASGPLTLTLACDPFDIDKPSDLAERLPKALIHHNVPSQPIHDL
LAAADKYWAAAAPHGVFGPRVRWRMMLKALRDNGFPVEQQRRQVRDCILT
TPWSAVAPVTGPSR
169631152YP_001704801.1 lipoprotein LpqH [Mycobacterium abscessus ATCC 19977]MGLLAAGAVVVGCSNDKPAGAAQVSSGSNAEVKVDGKDLAGLDLKSVTCV
KQGGNINVASAAINGQQGLGVVMTDEATPKVTSLGLVYDGAALAVSEGMG
AKVGSADVKVDGKTYTITGEASGADVKNPMAGMITKPFTIKVSCG
169631151YP_001704800.1 hypothetical protein MAB_4073c [Mycobacterium abscessus ATCC 19977]MRIAPAAFYYAEVTIIGDLERARHLALAAQEESAKEILLALLAQVEEADR
DDLACEVLAQLAEIYLVRTAYDGVVEGIRRIRECLDAYTEIRAGRRPDLA
GRVTMSEREIDHLVCRYTRRTEFLAAGLAAANGDHTGAAAHLRTLIETAG
DFEDLAGEHRGLICHARILIARGLCDDDMYADSVPVWTEVLGLLDEYARR
GDVESDHLFVHGALSYGRFCVETGRLDEAQPWLRRAEARAGARGWRLAGA
RAQLERAAARWADGDIAETQTLVHQAYPAIAEHVRAHDVSRSWLYFGLIR
FRVGALDEADECWGHAERHWREIEKPLHIHRILLQRSWIAIMRGDFAAAV
EKVAEARELLDSYPRHSWLQYARLDDQLGNIWRADALADLGLDPNTGTVS
ADPDSREYRSAMVKLKQAADLKVPAALAVDAVRYSISDAGARMRWARCVS
APLLAGAFAVAKEWENAALVSELIEYHSARGAFTTELGDDRPRPVEGAWS
SIATAAVPVEGELALVAAAPPVQADGGLTRLGPLPPLRMDPAGDQIMRGY
RELARQRYGREVTAVDDEWSTWP
169631150YP_001704799.1 hypothetical protein MAB_4072c [Mycobacterium abscessus ATCC 19977]MTDILVLRFADLGIATYASLRVVGEPSRTVTWVVDQRPLETVCTALDAAL
PEATGSETALTAIARALTVGALASPEAELQLARALGAELVAPEGWKLLSE
CVTSPRAVLFVTPSPKLARVPWGQLAMPGPDDYRLMELVDVLMSVPPNIV
HAPRHPARWRDRQRGPVALLLDPRIPGQRPDSTLGSVLGRPAAEGALTRH
FGELMDNHRVLPVAGTPRELFRRSDTDRDWLGGACAQNPARLLYVGHASA
AEGAVGHAARAALHLAEDHPLTAADLMAAQFPIPPRVALLACSSGGDYRF
DEATGLAAAMILGGAELVTATLWSLPTTAAYSQFVSYTADPMTDTVIGVD
HAHRDEDAGRAVNRWQRAQLRRWRDGDRAASPLHWAAVVSFAVDGAR
169631149YP_001704798.1 hypothetical protein MAB_4071 [Mycobacterium abscessus ATCC 19977]MDMTTGLFPAIVKAFGGCIALLSGRRSAAVHPDDEADERLVTVEEFAAEF
DHLLIRKRLLTRAQRAVIDSGIRSHGVVTGVKATGAGREMQLDLMVTRPD
GGQFPARETAMISACALSKMAPGSVIDAYYRPADHSIIAVRVRAG
169631148YP_001704797.1 hypothetical protein MAB_4070c [Mycobacterium abscessus ATCC 19977]MSIGSAPSESTLTVRSALPRRAVIDRAWRAIGDGVEVLSADDGGPLRRTV
KRILDPLVLRLRSNASFSAPVLAPEVASAMHALIVAHGPQLRATADWFVM
LKAERRRLRITTGNAQELYFPVCYELAVTQGIPREADHLTAAEVLRGLHR
GRDRTAIEVLNRYIENSDVVARLAKLRDRSWRDVRPGGGIAGPFFTGLAT
VLGAADSYREIAARQRVWTALIGDATPYNLGASVHGDVTAVPWSIVEIGL
SSVAPQRPPAIDGDTTGDRPMDRSVVDRVRATLRRALDRDELPDLPLLCA
EEVDRACAPWGLMGEDKQAALVAGIEVAMDLRPLDDSAPTRYELSGRVQA
RLVKEAYVMHARRYLAAGQVIHPRQRQVVDDLAAFARPYLSRLWARLHGR
DVWQEPCGDVDDMRSLLEGAARSVSLDHRQRIKVMLELQVSE
169631147YP_001704796.1 hypothetical protein MAB_4069c [Mycobacterium abscessus ATCC 19977]MRLVNEAGLWTTGPAPAPVPLVAVLEVSGAVLSWPVDDPSQPPVVSFTDA
MRADWMWRVFGEAGHVAVVEALRDAAPGKAIELPSVSVLPRPADSLRRLA
LGHWLRRWWPASLREGVGPLDRAVLDAEVAVLTATAEDYFTDDTLDADVA
GLLAPHAAALDSHRDPRVGLLAARCRDLADEMGLQWDVRDAEVARREDYA
LAAGAGDERGAPGTIAMGTATIAWSDVPPGIFDAAEHNLDWAVVSDGATV
TIRLRAAICGPGSALDLPITLHCGVFQAIGVLDAEGAATLPVLDTNGQPA
GEMQAWNADWSVAEVSVGAGRAADSSESRDRVRRFARARLAVPPADAFLA
ELLAAESDY
169631146YP_001704795.1 hypothetical protein MAB_4068 [Mycobacterium abscessus ATCC 19977]MSRRSVFTVSFPAPAEKIYQDFASRDYWETLMSAYGWLTPVSEIQAFSVT
DGGIDVVLKQHLPRIYLPPIAQKVMLTDLIITRVQHFAPFDQRTASAIGN
YSASVVAGPGSFTGVCALADTGEGSQLRLSSTCRVYLPFIGGKLEDLILY
HLNDLFRVEEGFIADWVAKHH
169631145YP_001704794.1 hypothetical protein MAB_4067 [Mycobacterium abscessus ATCC 19977]MARSFDLSVEYSATVEQVHAAFADESYWHERLAGSGADTATLDSLKSDDG
DLEIVTTQVLRSDRLPGIVSQFHRGDLQIVRTEKWGAIADGTSEGTVVGS
IPGAPVTLSGIARLQPGAKGSRLDLKVGVEVKIPLVGGKIEGFVGGKLMD
LLSAEQRFTSEWIATHG
169631144YP_001704793.1 UDP-N-acetylenolpyruvoylglucosamine reductase MurB [Mycobacterium aMGLARTTRAEIEDLGAVVTEGAALAPLTTLRLGPVAATLIRCESTRQVTG
TLAALDGHPALLLAGGSNVVLADDLADVTAVHIAAAGVTVDGSLLRAEAG
ANWDEVVALSLRAGLGGLECLSGIPGTAGATPVQNVGAYGVEVSSLLRRV
RVLNRETGRVRWYGPDELRFGYRTSILKGTSARVVLEVEFGLSTDGLSAP
IRYPELAKELGVAQGDRTDASAVREAVLGLRRRKGMVLDESDRDTWSVGS
FFTNPVVAEGDVDGVRARVHEHLGPGVVMPLYSAQHGVKLSAGWLVERAG
FDKGYPGERSAVRVSTKHALALTHRGGGSTDELLTLARTVRDGVLETFGV
RLVPEPVLVGCSL
169631143YP_001704792.1 major facilitator transporter [Mycobacterium abscessus ATCC 19977]MLTRPVIVLFSFSCGLAVATIYFSQPLLDTIGSQFSMPTAQVGIVLTLTQ
IGYAIGLLLIVPLGDIVDQRRLIVGQTVLLGVALLATAISPNAWTFLLSI
TTLGALAVVTQVMVTYTAVHAARERQGWAVGVVTGGIISGILLARTVSGA
LSDLLGWRSVYAVAAIAVAAIATILARTLVGSDPTRHGPPYGRLLLSTLR
LLRDESVLRSRAIIAMLVFAAITVLLTPMVLPLTSAPYHLSHTQVGLFGL
AGAAGAVGAFKAGTWCDRGWANRVTGAGLSLMLAAWALAATLHWTLLGLA
VAVVIIDFGLQSVHVANQSLIYRLDPELHGRVTAAYMTFYSIGSAIGAIA
STWVYAARAWSGVCLLGAAISLGALAYWAALQRAAHQHRLRHQTHAEGLQ
DPVTHGTGECQ
169631142YP_001704791.1 HxlR family transcriptional regulator [Mycobacterium abscessus ATCCMVGRASHAESSCTLARPLGEIGDGWSLLIVRDAFDGLRRFGEFQKSLGLA
KNILASRLSTLVENGILEVVPAGARHEYQLTEKGRGLFPVLVALRQWSGE
FCFRPGEPRVSLIDRKTSSPVRRFELRAADGRLLAPEDTTVAQTAG
169631141YP_001704790.1 hypothetical protein MAB_4062c [Mycobacterium abscessus ATCC 19977]MRIAIVTLVMWLGLTAAPPATADPGPTPMDPSSAEGAAVLAPAVADAAAQ
LGKPIRLDVRSLKAADGWAFLWSAMQEPDGSPVDYTGTPFAEAAANGVLS
KKYVALLHQDDQGWSLVDKRVGPSDIAWAGWSAHYGAPAAIFDIPVY
169631140YP_001704789.1 hypothetical protein MAB_4061c [Mycobacterium abscessus ATCC 19977]MKYPRPHLGDALTRRRALTILGLTVPAVAAACTTVGSNQPEEAPSPGASL
TFLPDDKAKDVNPTAPVSVTVTNGWFRDVKLVNADGKVVAGALSRDQTRF
HTTEPLGFDVKYTWKGSAVGLDGKAVPVSGAFTTLVPTAKVNGQFQLADG
QTVGIAAPVIIQFDAHIADKAAVERSLSISCDPPTEGGWAWLPDEAQGSR
VHWRSREYFKAGTKVEVKANLYGIPFGDGAFGNEDMSLDFSVGRRQVVYA
DAQSHRIRVTTDEGTILDLPCSYGEGDLPRNVTRSGIHVVTEKYEDFWMS
NPAAGYSNVHERFAVRISNNGEFIHANPNTIGQQGNTNVTNGCINLSLGD
AESYFRTAIYGDPVEVTGTSIELSYADGDLWDWVVDWPTWQSMSALPPNP
RERTVTSSPATSSIPTTVPLTPSGAPTLSGTPTSTPSTTSGAPSLSATPT
TTRR
169631139YP_001704788.1 putative short chain dehydrogenase/reductase [Mycobacterium abscessMTNPTFDGRVAVVTGASSGIGAATAKSLAALGFHVVVAARREDRVKSLAG
EIGGTAFVLDVTDADSVAALTQSLDRVDVLVNNAGGAWGLEPVLEADLEH
WRWMWETNVVGTLQVTRALLPKLIDSGDGLIVTVTSIAALDVYDGGSGYT
SAKHAQAALHRTLRGELLGKPVRLTEVAPGAVETEFSVVRFDGDQDRADA
VYRGITPLVAEDVAEIIAFVASRPPHVNLDQIVVKPRDQASSTRRATRQ
169631138YP_001704787.1 hypothetical protein MAB_4059c [Mycobacterium abscessus ATCC 19977]MTAPVRRPVSRHQIHPPALYIGDSAASSVFRAARVRGPVARDAIAQVTGL
SIATVNRQVTALLDAGLLRERADLAVSGAIGRPRVPVELNHEPFLTLGIH
IGARATSIVATDLFGRTLDVVETPTPNGPQGAALASLAGSAQRYLARWHR
RRPLWVGVATGGVVDGPAGTVDHPRLGWTEAPVGRVFADTLGLPVSVASH
VDAMAGAELLLGLRRFAARSLTSLYVYARETVGFALAIDGRVHSPSSGPG
TIAALPVDSELLGGSGKLETTVSDEAVLAAARKLRIVPAGDGVSVSAVYK
AARGGNESARELLSERGRVLGQSVALLRDILNPDEVIVGGQAFTEYPEVM
NDVETAFLDRSTLSKRDIRVTAFGNRVQEAGAGVVSLGGLFADPLGAMRR
ASARRGEASALA
169631137YP_001704786.1 hypothetical protein MAB_4058c [Mycobacterium abscessus ATCC 19977]MTHIHHVSSAKVPMAYAFDYVSDAHNLTDWMFGIEHVRFVNDVPRGLGAK
YDIAINLGATLRSTIEVTGWDPDTLFSTESRSGIDNQIECRFRPLSDGET
ELEINIDYRLPGGLAGRALGKVISPFISLAITHSDEKLRKILEEGHRQEI
ASR
169631136YP_001704785.1 glycosyl transferase [Mycobacterium abscessus ATCC 19977]MLSGDEFARRAVAALKPRRIAVLSVHTSPLAQPGTGDAGGMNVYVLQTAL
QLARRGVAVDIFTRATSSSDEPVVSVTDGVTVRNIVAGPFEGLDKYDLPT
QLCAFTAGVLRAEAVHEPGYYNLVHSHYWLSGQAGWLARDRWGVPLVHTA
HTLAAVKNQTLAEGDRPEPALRGVGEQQVVDEADRLIVNTKDEADQLVSI
HNADPARIDIVHPGVDLDVFTPGDKAAARAEFGLRADEQVVAFVGRIQPL
KAPDLLVRAAERLPGVRVLIVGGPSGSGLDEPTALQDLAVDLGIADRVTF
LPPQTRERLAQVYRAADIVAVPSYSESFGLVAIEAQACGTPVVAAAVGGL
PVAVADQRTGLLVPTHRTEDWADAIGELLVRKGAGFSRAAVEHAAGFSWS
STADSLLSSYGRAIADYRAPQRPSTQWASRARFRPRRLSGLRR
169631135YP_001704784.1 hypothetical protein MAB_4056c [Mycobacterium abscessus ATCC 19977]MTTADQAYATIVRTLVDREVTFSEHHGPDGKPALVVELPGERKQRITAML
SPGEHAVRVEVFVCRHPDENTEGVYRYLLKRNRRLYAVAYTIDNMGDIYL
VGRLPLPAITPDEIDRLLGQVLEAVDGDFNVLLELGFKTSIQKEWAWRTS
RGESLKNLEAFEHLIDD
169631134YP_001704783.1 putative acyl-CoA synthetase [Mycobacterium abscessus ATCC 19977]MTFRSPLPDVSIPDCSVYEYVFGDTGAEDSRIALIDGLTGAQTTLGELRS
QIDATAAGLAERGFGIGDVAAVFLPNCSAFAVVLHGILRAGGTASTVNVL
YTAEELAKQLIDSKAQLIFTVSPLLSRALEAAEIAGIDAAGVITVDPVEG
RLSLADIARPDLAPPQVTFDPATHLAVLPYSSGTTGKAKGVMLTHHNLVA
NIAQAKHLYGVQRGDRVLAVLPFFHIYGLVVLLNVQLKLGAELVILPRFE
LDTFLGSIANYRVDHVFVAPPVAVVLAKHPDVDKYDVSCLRSVFSGAAPL
DEQLGNAVAARLNCRVSQGYGMTELSPVSHLIPPDRPDIPLNSVGIPVPN
SENKIIDTETGDEIEIPAEGESAPGELLVRGPNVMAGYLGNEEATAATIE
PDGFLHTGDIAVVRADGVVTIVDRLKELIKYKGYQVPPAELEALLLTHPG
IGDAAVIGVPDPSSGEIPKAFVVRTDDDLTDEAVMAFVEQKVAPHKRIRQ
VEFIDAIPKSAAGKILRKDLRARI
169631133YP_001704782.1 hypothetical protein MAB_4054c [Mycobacterium abscessus ATCC 19977]MGHVYGEIDDKLARWLTEQPVYFVGTAPSGSDGHVNVSPKGMAGTFAVLG
PRQVGYLDYFGSGAETIAHVRDNGRIVLMFCSFDKRCRIIRLHGRARVVQ
FNEPEYPRLRTSFSKELEKGARSIILVDVTRVADSCGYSVPLMDFVGHRD
VYEKHVERVPEEKMTLQSALETNGSSIDGLPALR
169631132YP_001704781.1 putative short chain dehydrogenase/reductase [Mycobacterium abscessMTAPDVGIYPRRRPKVSYGASAVVTGAGSGIGRAFAQTLAARGGRVVCAD
IDVGRAQETVDIIGGGKAHAVPCDVTSYEQVAELARVATSWLRQPADLVI
NNAGIGTGGLPVGAMSMSDWEGTLAINLWGVIHGCQVFTPLLREQRFGGI
INVASAASFAAAPLMAAYNVSKAGVLTLSETLSAELSGSGVKVTVLCPTF
VKTNIVNDGRISGSASGLAASMMKYTGVSPERIARGTLDAHDRGRFYVVP
QLDAKLVWHLKRHIPNPYRWGAGLIGRLMPTAVEAKELLGADVR
169631131YP_001704780.1 putative lipase/esterase [Mycobacterium abscessus ATCC 19977]MTLHTDVAIIGAGFTGLSVAAALKRSGVHNFVVLDRRSAASSEEWRGDTV
RLFALAKHLHSGHEAAALAYDAADERWTIKVAGGEDLSVRSVVLATGSRT
AGDPTVPGIEAYTGVVMRGQDFRDVDLAGKRVAVVGNGAAAATLLPEIVR
EAASVKLFQSSPDWVLPRQGGRIVRLLEGVPVVREATRQAWFAGRRPQRR
GIMELLARIHLRRHVDDPWVRRQLTPLPLTGRPNVVIADEFYTALQAPNC
KLITWPIARCSARGIRTAEGIEHHCDVIIFASAPDDAGASQIPVTGDGGQ
PLPESDEISVAGFPNLFLADPPPWQPGRDAVQRIRGRVHRVAARVQGTVR
PETSIGVLPASRLTRATVALAAMGLRPLIERVPMSRLGVAASRRLVATAM
TAGSPMPTNVRIDRVREQGLRGEWVHAPDSDRDGPVIFYIHGSGYVVCSS
RTHRRLVARLSQASGLPAFSLDYRLAPEHPFPAAADDVRAAYQWLLSTGH
AAKDIVIAADSAGGHLAVDLIAENHRMGVAQPGALVLFSPLADLTLGLSA
ERERDAPDPIISAAAARRLVDCYTAAQPVDSPRLRLALGPGVMLPPTLIQ
VGGREMMVADAEHLELMITRAGGACELQVWPGQVHVFQALPRFSSEATAA
VREAARFITATLAARSELTAEQSA
169631130YP_001704779.1 hypothetical protein MAB_4051c [Mycobacterium abscessus ATCC 19977]MALVLEETLQTVKDKQWALADVDWDAPGAETISPELWPKLKSFMADLVWI
ENIGARGFAALAKKAPDPTLAEIYRYFHAEEQKHANAELALMRRWGMLEK
DEIPEPNINVRLAIEWLDKYSDGLSLTVLGTVIPLLEVALDGALLKFLLE
EVQDPVCHQAFRHINSDESRHLAVDFHVLDMMGHGNLRRVVIENVATVIN
PSLLLGLLLGLGTGIPLINRIKGNLIGMGLREQRLYDAMLRFINVGDRGD
GKRLLVYQVLKSGAKLITDPDNRFHRPYHALANSMVRLSDHYPRKRLAQQ
PSWSKELTYEATA
169631129YP_001704778.1 monooxygenase [Mycobacterium abscessus ATCC 19977]MSARRRKTNGPDRRVDHEVVIIGAGLSGIGVARDLLRAGVSDITIFERAA
AVGGTWRDNVYPGIGVDVPAQAYQFRDACNPEWSRFYAKGPEVLAYIERL
TDDFGVRALIRFNSEVGERHWDDDADLWRMKVNGKDVTARFVVVAAGPFP
EPKPAELPGLDDFAGTILKSASWDQRVDLAGKRVAIIGTGASAVQIIPEI
AREVGRLDVYQRTPIWIFPKFDPTTPRAVKTFFRRVPLAQRLLQEGLELV
YAGVLVYGVMYYANVKIVPQAVSSFLRNVTYRMAVPDKELRAKLTPDYDF
GCKRPAVSSSYLQTFTRDNVDLITDPIETITRTGIRTRGGAQRDIDVLVL
ATGFRLFYDPQIYRDTPVTGRDGFDLGDFYAHQLPQSYHGISIPGLPNYF
QVFGHYGWTGGTWHSVVDTAGAHISRVIAQAQRLGATDVEVRRQAAADWT
AQVRGRYATSLFQVGNCATANSYYFDHNGESAYIRPMSTQAARRSSRTFP
LHDYAFEGHAEPERAAAVANKAVV
169631128YP_001704777.1 2-3-bisphosphoglycerate-dependent phosphoglycerate mutase [MycobactMSGETSSKTNGATLILLRHGESQWNAKNLFTGWVDVDLTEKGRSEAQRGG
ELLAQQGLLPDILFTSLLRRAINTAHLALDTADRLWIPVVRDWRLNERHY
GALQGLDKAETKAKYGEEQFMAWRRSYDTPPPPIERGSHYSQDQDPRYAD
IDGGPLTECLADVVARFVPYYEEAIVPELRAGKTVLVAAHGNSLRALVKY
LDGISDEEIVGLNIPTGIPLRYDLDENLKPVTPGGVYLDPEAAAAGAAAV
ANQGAK
169631127YP_001704776.1 sensor-like histidine kinase senX3 [Mycobacterium abscessus ATCC 19MTAASALLVATAALAALAVGAALGVWYSRRASTHRNASEVAQTGLTVSQM
LERIVAISPTGIVVVDKHQDVVLVNARARELGLVRDRQLDGQAWNAAQRT
LATGEAVEVDLTTKPRAPGRAGFSLRGHVRRLSDADTRWVVIYVDDDSEH
VRMEATRRDFVANVSHELKTPVGAMGVLAEALLESSDDPETVRHFGEQVL
AESRRLGNMVTELIALSRLQGAEKLPDLEVVDVDFVVSEALSRSKVAAEN
ADIAVTTDAPSGFEVRGDPTLLITAISNLVANAIAYSPQGSPVSISRRRR
GDKVEIAVTDRGIGIAKEHQERVFERFFRVDKARSRDTGGTGLGLAIVKH
VAANHNGVIKLWSQPGTGSTFTLSLPVYEDDVDDDDAEDTQADSPTGDTT
PRKDATNHPPRPHGLPASGSSKADGLLTSTSPADGLRIGSSPADGLRIGS
SPADGLRIGSSPADGLRIGSSQVPPSRLREEHKATTREEHVRR
169631126YP_001704775.1 sensory transduction protein RegX3 [Mycobacterium abscessus ATCC 19MTSVLIVEDEDSLADPLAFLLRKEGFEATIVNDGPSALAEFERAGADIVL
LDLMLPGMSGTDVCKQLRAKSSVPVIMVTARDSEIDKVVGLELGADDYVT
KPYSARELIARIRAVLRRGSDSEETASGDGVLEAGPVRMDVDRHTVSVNG
EAITLPLKEFDLLEYLIRNSGRVLTRGQLIDRVWGADYVGDTKTLDVHVK
RLRSKIEADPANPVHLVTVRGLGYKLEG
169631125YP_001704774.1 TetR family transcriptional regulator [Mycobacterium abscessus ATCCMEQLVAQEPPRRGRPPVSGLADRRRQQIVDAAFAAFTENGYEQTSMSDIA
TRAGMGQGTVYRYVESKREVLDLVFDYGVERLVDTLALDDFLEVVGGTAG
IEERNDIIMEGGRRLYALVDQEPALLKLLTVQSAAADKELKQRVLGIQSM
LDSYVQRGLESGRRAGWLPEDAHNQAVLARLLPALVLPGFLLAQSRHDNP
STRERFVTTASLIAEKGILRDGVVLEPGEGRVAGETVDSVHVPLPAAADR
RNELLDAALTCFLSDGYHAVGVNEIVEKLGVSHGTFYNYYQNKRDLLDAL
MVREFSAMEPALSRSVARLDARRDIEHALAQGFRNALEAVAARLPALIFV
CTEAAGVDPEALQSIIQFFRFASVRSEQSVFSMIGADRINPAMDTEFLGQ
AFVSLLVGAVTLVVDDDGRTDRVDEYAQAITQFLLYGLNPVP
169631124YP_001704773.1 ABC transporter ATP-binding protein [Mycobacterium abscessus ATCC 1MRAKRAAALGKVVAGHAVRSAITTAIKPVSADVAARRDADILRFADDLVA
VAGSMKGAAQKLGQLLSVVDVGITSASVRDEFTARLAPLFDNAPRVPDAT
MHAALEGELGSLRSRIADIETGAIASASIGQVYRGRLDDGRTVAIKIQYP
DIAAKVRADLKNLQLITKLAAKKMPASNTQAIVAEVQRQMIKEVDYRTEL
VHHQRMFETFCGHPVCRIPAPISELCTEHVLVTEYLDGVPFDHLTDEDQP
VRDRVGEAIYRFYCGEMYRTGFFCADPHPGNIMLLPDGRVGFVDFGLCTD
MDPYDAEVQRKVFRALLTGDDDGAFELAVAAGFLADPASMERGAAIEYIR
AVSSWHLVDGSLRMTPDIARRSVADAVLPSSRFYDGIRNQRLVETHAMAR
RTEMCVAALLGKLGAEAPWSAIAREYLDLADTVTPMGADIEIWSQQR
169631123YP_001704772.1 putative hydrolase/esterase/lipase [Mycobacterium abscessus ATCC 19MTANVVPLHVERVEPVRSERGSLTVPLRLGRLAVRAVAYPVIALWARFPA
LPWPYRVVDLAAAVLRPVRGVRRSRVRLRNCEAELMSRADGPSNGAMLYL
HGGAFVVGGLNSHRRLVSRIVTTAGVTSLAVNYRKLPAHPVSAAVEDALD
GFRLLTEMGYRPSEIVIAGDSAGGFLSLVTSLIAQRRGYGAPGALVCISP
LVQRDPAGKLVLAAQSNDPLFPESALIAMERLMLSAEKTTAGLEVLDSFV
EGCLPTLACLPPTLFQVGSDEILRPDTEFAAARLSEAGVPVELQIWRNQV
HVFQIAADVLGDARTAVGEIADFVGAHVGGRSA
169631122YP_001704771.1 short-chain dehydrogenase/reductase [Mycobacterium abscessus ATCC 1MKFTEIPMDGAVALVTGGARGIGLAIAHRLADMGARVMIADLDGAAAKEA
AREVGSGARGFFLDVTEFDEYLRVVTEIEDSIGPVDIVVNNAGIMPVGPL
LGESRGVAEATMRVNFWSHYNSYQVLAPRMVDRGRGHFINVTSAAGAIHS
PGLASYVASKHAATGFARSAREELVGTGVTISTVMPSAVRTQLVDGIPFK
WWEKLGIIPPGWVARDAVRTVRNRPAVVGSPRGTVLALRLQHLVPEWLWL
LGRRVVNADRTVGPVDRQARSEYDGRIERQVEAAR
169631121YP_001704770.1 monooxygenase [Mycobacterium abscessus ATCC 19977]MNPEHETVIIGAGIGGLGAAIGLKRAGLTDFVILERSAGIGGTWYNNHYP
DVAVDVPGIVYQFSFAKNPNWSRTFPKGREVQQYIAGLVDQYRLNDHLRL
GHEVMARVWDEDNHLWRLTLADGRVITSRFVITAVGAFVEPKVPDIAGLE
SFGGKVIQTQNWDHDYDLSGKRIAVIGTGATSVQLIPQMARVASHLDVYQ
RRAIWVFAKPDFPIPRAARWALKYIPGLQSLIRGIAAAAVEVGLVAITVY
GKQIAPITLIPNWACRAFLFTQVRDRELRKKLTPEYGFGCKRPSVSNIYY
RTFTQPHVDLVTDPIAEITPTGIVTRDGVRRDIDVLVLATGFEMSQSPEV
YRARPVKGRNGFDLADYYENNRARAYEGVTMPQLPNTFMVFGPFAWSGSS
WHVMVENATRIAVRVITEARKRGATAFAVTEEANNRFFEFIAPKAESTLM
HGRACVNANSYYIDRHGDFSFLRPTTAYQSTRASKRFPLDDFRFDRLPEP
KSPQLAETATTRSN
169631120YP_001704769.1 hypothetical protein MAB_4041c [Mycobacterium abscessus ATCC 19977]MPLLFWVAAVLVVIGGVLAAVALAALASGSGGPQRFAVPASVPDVDEYFD
KGATWATVVETTVPASAEQIWQRLSAGGYFGSVPFVTGPQIIGLDMSYRA
VLIALSERVVRHNPARELVAVGTGLSIPLFLTSFAERWVLVPAPSGTTVR
WTVAFTPQWIGWFPLRWTAFAIRPFMSILLKRAMR
169631119YP_001704768.1 hypothetical protein MAB_4040c [Mycobacterium abscessus ATCC 19977]MDRLVPVALDRFCDPSIHVDPSQEGNALSEAFTSRSRLSDAEPGRLIAEL
TRLDRTDPARVDELTWQWLDELGKAGDVTTLEAIFLMGAPLVQRAGLTQA
RYLASPYGRFVDSLLRWGLTRWWQGHRFYDEGRRGISNTPRQFRWVWRLL
FPGYPRPSGCRGEEVFDFRAVTVADAKRPEHRVTLLDWHLPAGKMNRWIT
ALARPVIRWFVWDLTRSELVGLVGGRVILARIPVRIPFTRRWRTTTFYMH
RWLTDDPSSPSHQVSANCPSRTSSEELQ
169631118YP_001704767.1 monooxygenase [Mycobacterium abscessus ATCC 19977]MTASIPDHHVVVIGSGVGGLCAGVRLKQAGIEDFVIIDRAADLGGTWRDN
VYPGIAVDIPSVIYQYSFFRNPHWSRVFAPGDEVQAYHQRVAENFGLRPH
FRFGVDVRSEEWDEGQHHWRLNLADGSVMTARFVISAIGPFFDPKESGIK
GIESFKGTRVTPSQWLPEHDVRGKRVAVIGTGATGVQLSGAIADDTASLV
VFQRTPVYCIPKPDFRIPAIAQWALRIPGLTAAIEWGALVGGSVGLWFLI
NTPGVVMRPLMRLFDRAGRALYGAYLRAVVKDARVARDLLPSFGPLGNRP
TLNSAFPRVFNKPHCDLVTTPIDEVVPEGVRTTDGTVYEADFLITATGFD
LFSEPASYKRGRVIGAEGRDLGDFFNTHGMQAYESVSITGFPNRWIIVGP
YSWTGNGGWHGLADTAVTHIVRAISLARERHATRMEVRQEALDRFHQSML
RNGRNLKYYFTELNRGVRSYWKNADDDVPLLRPTTTLQARRAARNFPAMD
YVYEQHATNSTAAVVHSQATV
169631117YP_001704766.1 hypothetical protein MAB_4038c [Mycobacterium abscessus ATCC 19977]MLAPTCPIPVADDSAFESAAIVLRTSHTFDAPVGQVWAALDSDHAWSWLP
FGCGVRYDEPDRRAGMEREMGTVSAPWRFLWIQRERFWRYDPPHRITYSA
VAGTWPLLKLWAEDYVLTGTPDGCVLEWTVAITPRFVSWMPLRWLQPLLR
AVFTWGMRPGLRSLIELLDGPGRTPGNR
169631116YP_001704765.1 hypothetical protein MAB_4037 [Mycobacterium abscessus ATCC 19977]MSHRLRGLRAGIAATALLASAQVIHPVATARAALPPCASRTTMIVPESTM
AHTDCRLTAADGTGITFDVVYWKPLPDNNDAPGYPPLSVRVTIRDASGNT
LQEVNELLEPTSPSPVGLQDIDGDGRDEMIIPMSTRVMNGAVNTRFSVWR
AEKQTTHFERIQMFGQAIYPSGDGYVVVNSGAFSSRDLDFYLPTAAGYTH
IITLTMTTEEVDLNTRKVLTASCMVHKQAGLGAIDMDWQDSPVFCDSPAA
KAIWPDAERVETNRRVQGR
169631115YP_001704764.1 hypothetical protein MAB_4036 [Mycobacterium abscessus ATCC 19977]MTDIVERALTLDDADPEELAEMAEEPNPGSAETQTTGKAAKKKTAKTVKA
VERTADPVIGEGDDDSGPGIWKWIAIGLLALGIIGALLGVWQYQKLSDTL
ATVRSADAERTAATDAASAYAMKSLTYSYEDPDGFFKAVKENAAEPLKNK
YNDAEKLLKAIMLQAQVTSKGEIIASDAVAQQNGIYQVIVTTRQTTRNVQ
NPEPRATTLVLQITVKKDGDAWQVTDIGPKNASSTGTIMHPGDQKLMPEG
PEAPAAPGKTPAPGLPPLPVLPGQK
169631114YP_001704763.1 putative Mce family protein [Mycobacterium abscessus ATCC 19977]MRLKVLLTLAVLSIISLVGAVYMAFGVLDIASTSKTNHMTLMLNSSGGLM
STSQVTLRGIKVGRVTDIQATATGLAVSMALDSGYPIPVDSQVSVQNLSA
AGEQYVEFKPVRIEPPYYSDGAVIPASKAAPVYTVSDLLQKGNALMQAMD
ADALETTLNNVAAGFVDNTKTIDELATTARLFAQMVNDDKHYLAELIGNT
STITNGLGEIRAGDILKQSAKTVPRSLAGLGDLVKVIEKLEPIVEAGMGD
GKPLTDLVDKLFDYINALSEPLSEFTTVLEPIVAPLRDVKLDAGHWLDFW
DSTFNNQGGLRIHLGVPEWPQPDPHQTAPGTQPAQPTAKPSAPQPTPAPQ
TATAGRSGS
169631113YP_001704762.1 putative Mce family protein [Mycobacterium abscessus ATCC 19977]MIRSILIILFAAAFAVVPACSSEALDPTKMPMPGAYLPKNTYRLKIEFSS
VLNLPGRAKVDSGGVQVGLLDRVELKGTTPVAYVEIDGDAKFPENVRAEL
RQATVLGDIYIAMISPKDPATTHLKDGDTITLANTVPAANVEDLMRSMSN
LIGGGSLNTMQTTVANMNSAFPPPEELDRIHRALAGVIHDLSSNQDTLNK
ILTNMQTVSESFRANKGTYLRLLSEGPTKLPSLAKVVLSLSDLIINASEF
GRQIGQILDYPNLMQILSYLTPFVHSASTADTTIPVLGDKMVRTIRDRII
PFFKDGGPKYTVTDIQNPDGTLGVSPGERADSVIRNMQTMGLVR
169631112YP_001704761.1 putative Mce family protein [Mycobacterium abscessus ATCC 19977]MRPLMTQPVFVQNILTRLANMRPAARAAVVSAAALVLVAVMAIAGIFGAR
TIFPAVKNMVMPYLGNAHIPLLDHTRSLCANFRDGSGLYKGNKVLLLGVE
VGTVTAVTNKPDHVEVDFEIPSDMELPADVGAASYSQSVITNRSIELTRP
WSEGPKFAGAQCISTENTRTPVTVTESFSAIGELADTLMQATPGQDPGDS
PGVRALNKTLKGAARSLDGVGPGFKEMLNSLTKMVGDPYKANADYRQLFE
NSAIVTSNWLQYWNEFAGVVTSLPEVGRLIAGISDNFAQALDNLVSLLPT
LNGMVQRASGRLYKNVFDKLVPWIRDILNAYTPHILTFFNTLPPVINWLA
DDIYLPNTKTHGVTYIPPRVAISPEQASAICQNLRDRNTPGSQAACAPGT
GSDPVTLGLTNLIMGAALS
169631111YP_001704760.1 putative Mce family protein [Mycobacterium abscessus ATCC 19977]MFARNRPILDEHEAAKRNRRNGLIGVLVIAAVLAATGVAFVNTSGMKTYA
LHLRASGGLRAGDDVRIAGISVGKVSTVRIDKSLVEATFTVDHAVPVGSE
SRADIRMLTPLGGHYLALYPEGSTPLGKTPIPPERTSIPFEINELFQKFT
PVVKKVDAKVIHDSLMEVANAVDKYPNGLRDFFQSSQSLIKALEPTTEDF
HATLNYANEYLRAFKTGKEQLASIVTMMSKLGAKYSKSTTDLIEVFVLLR
DLARIFDRFFKAYARDYEPMLNGLDDIVDTLTKYPEKLGKAAEQWGQLVG
IVLPMLSGNGITINENDRVIPGQDVCLPHFFRFC
169631110YP_001704759.1 putative Mce family protein [Mycobacterium abscessus ATCC 19977]MKRIVFLMAGLTAIVAVAVVLTLIIVNALRTPVNGPVRHYDALFTDASGL
IVGNDVRISGVQVGKVEKIHLDGKNARITFNVLTDHPLYQNTTVAIRYQS
LVGQRYVEIAQAPTPSAPLAAGTTIPLGQTIPSFDIAKLFNGFRPIFETL
DPAQFNRLTENILQLIQGDERGIGPILRDIDAVLKLSVDRQAALQTIITN
LGDISKDLGGTSDQLFYLINDLNDVLEPFEKQADEFNRAGADALPVLRRS
VSLLRYIENSVDGAQLPLYDVASRTTPGTPTIMAGLSLIPDLVQGMRDAL
IEEKTAPPTAYECKNGVVKMPGIGEVSFANQDLVVCK
169631109YP_001704758.1 putative Mce family protein [Mycobacterium abscessus ATCC 19977]MAIYKDPSGRSAGPTALKVRGLVLALAVAAGGYSLYQSGIGSYGEPFELT
LITNTIGEGMGPGGEVKYRGYNIGHVKSLQTTGYNKQRMTVILDGRQAKA
LTSDTKAQFTSSNIFGTAAVELVSSGVGEQLKSGGVLEISSDVQAASITG
FLRMGQRLGAILDTPQFNAIIATFERHADLTGPVVKSFWDLFAMIADTQK
VPFSKTLDVMASLIEGANDFVPVIGSTNKLLDSLDFMVGPGNTERAAAAL
GSLSDLLKSAGDGLRANNDWLVPLIRSIMDLAVPFTYFLGSLAPAYDRLN
GLLDRTTAAFPVDNGKVRLNVQLIMDTAPGLGAALPVPLDGQAAPVAATA
PTGPAPGPTAGAPR
169631108YP_001704757.1 putative YrbE family protein [Mycobacterium abscessus ATCC 19977]MATSRPSRYFPDELPAAVRSVWNFTKGAGGSAEYLGHQITFVGLVLAAIP
QTLKRYRRQTGILLVDMTWGNGSIIVGGGVIGVLVFMGIAVGASVGIVGF
STLDMVGMGSLTGFISAYVNTREMAPMIAAIGFAAQAGCRMTAEIGAMRI
SEEIDALEAQGIRSIPFVVTTRVIAGIIIIVPLYVLTLLLAYGSCAFMVF
FVHNQSQGVYKHYFDSFVHPVDVLYSVIKAVVFVVIIIAIQCYQGYYAGG
GPEGVGMASGRAIRASLVAVVLFDMLLTLLFWGNNPGIQISG
169631107YP_001704756.1 putative YrbE family protein [Mycobacterium abscessus ATCC 19977]MSHVAADARLEPAADDWTETPDVESGSKSEDDHTSDPAAGALPQLLDRAP
RLIKRPVAYAVSQTDSMLKTLGRYVDLVVQSFAFLISDIVRLRHPWQDTV
IQSWFILTVTVVPAILVSIPFGVIVAVQAGSIISQVGASSISGAAGGLGV
IQQGAPIVAALLLGGAAGSAVATDLGARSIREEVDAMRVMGVNPVQRLVT
PRLAAILFVSPLLCIFIIFVGIFAGYLVNVGFQGGTPGSYLSSFAAFANV
SDVTVAVLKTWLFGVVVILVACQRGLEAKGGARGVADAVNATVVIGVVTV
MVLNTVITQIVAMFMPSKVG
169631106YP_001704755.1 TetR/AcrR family transcriptional regulator [Mycobacterium abscessusMASTSSGRRGPGRPPNPARARERQRALTEAAALEFAEKGYHKASITDITQ
RAGVGRGTFYLYFDTKRDVLDAVIDSYFQRTVAAVNDTSDLLGNASDFEL
HLRTVFTRLFDMLDNSPEIMQVILREGLLDTAMTKRMFGILDLIEAINVT
IIEQAVMDGAITAAVDIPFLAHAITGLSMAATLKAIRGELEGDAREAYIG
SFIQLVRTATTGSTPVANS
169631105YP_001704754.1 transcriptional regulatory protein TetR [Mycobacterium abscessus ATMSTQVYPERGLPELTGDARVDRWREHRAKVRAELVEATLNAIDELGPDLS
IDDVLKSAGISRPKLYRFFTDKEALFAAVAMRVQELVVERVVSNIDLSVS
LLELFRTGMAGYVDLVDERPNLVRFLLGVQYANATSLIESGRPLSDAIAQ
LVGSVFSSRGGNADHIEYVIDAMLASTGIAVLRWFDEPVISKETLVDELV
VYVWGGLAASAKARGVELNPDDPILLPTD
169631104YP_001704753.1 hypothetical protein MAB_4025c [Mycobacterium abscessus ATCC 19977]MRKFSDQITDPVLKKRVAGFIGQESVHGQEHRRVNEKLIEMGYPIAWLDS
KKQVDRLIRFENMLPPRAHLAFTAMAEHMTAILAERTLGSDEVQAIPGDP
EVWHLLNWHALEELEHKSVAFDVYRAVGGTETMRIGLMLAAMTIVPPLTL
GILAGSLLADPVARRQPLRLLREARGLFGGPLFKGIVGDVRKYLRPGFHP
DDINTDELLERWQQELFGSKGILVDHLK
169631103YP_001704752.1 monooxygenase [Mycobacterium abscessus ATCC 19977]MSPAARHATTAELEQPDHEVAVIGAGFGGIGTGISLQRKGIHDFIILDKW
DQVGGTWHANTYPGVAVDIPSVVYSFSYEQRGDWSRLFAPGIELQQYAES
MVHKYGLRDKLRLGTSITRAEFDERNSLWRLATDGGKEITARYCVMAVGG
LERPKMPDIPGVHDFGGTLMHTALWDHDVALAGKRVAVIGTGATSLQLVP
AIVDETSHLTVFQRTPIWVGPKFDLEIGPLGRIILGNSRIRSAIRAIATV
GIEMAMSGQVAGPAWLINAVRRAGEAPMRRWMRSQVDDPVIREKLIPRYG
LGCKRPSMSNEYLKTFNRDDVSLITESIECVTPDGVRTVDGVEHVVDVLI
CATGFRLWDKGSVPPFPVHGRGGQDLGEFWDRHRFQSYQGVSVPGYPNMF
SITGPYGFVLGSYLWMIEATSAHLARAIAETKRRGATVCEIRQEAHDEYF
RKCLKRQEKNFLFTDVCAGSNTYYLDQNGDSPFRPTTHGEMYWQNRHYNL
DVYRYSTASVVPETVASTAGESV
169631102YP_001704751.1 oxidoreductase [Mycobacterium abscessus ATCC 19977]MRVNPSEPRLVVVTGAGSGIGRATAIRFAKRGAHVVVTDLDLDTANETVD
LILAMGRNASAVQLDVTDPAHWADVARYVSIEYGVPDVLVNNAGIALGGP
FLKLTPADWDRLLSVNLMGVVHGCRVFGEQMVERGSGHIVNIASAAAFTP
TAVMAPYSVSKAGVKMLTECLRLELGPKGVGVSAICPGFINTNIGVHGTM
VGVDPEIADASQRRIQRIREFTEKLPWTPMSPELVARAVTRAIRLDLVVV
PVKLESWFGYFVSRALPAVNRRLMAPFGVDRFERLGARALVKQQEHYVPA
LVESVG
169631101YP_001704750.1 oxidoreductase [Mycobacterium abscessus ATCC 19977]MVKLNQLQPQLVVVTGAGSGIGRATAIRFAKRGAHVVVSDMDLDSAHATT
AMIQADGNTASAVQLDVTDPDQWETFARDVLADHGVADVLVNNAGIALGG
PFLKLTPADWDRLLSVNLMGVVHGCRVFGEQMVERGSGHIVNIASAAAFT
PTAVMAPYSVSKAGVKMLTECLRLELGPKGVGVSAICPGFINTNIGLNGI
TVGVDQEMVQRGKEIMRRAQEFAAHLPFSPMSPDLVARAVTRAVRYDLAV
VPVRTEAWLGYVLGRVAPGINRRTTQAFSIERAERWGAWALGKLDDLNLL
SRQGGVEEDRKPTAARR
169631100YP_001704749.1 hypothetical protein MAB_4021c [Mycobacterium abscessus ATCC 19977]MSRRIESPRRRGGNQMNDTAAIGEVALHARNVRFDFSDSPLQWIPGEPVA
SHALSALNFMLPAGELFFVEVFGRALPHIRDDKLREEVIGFIGQEQLHSD
THDKALLEYFSQHGIDAQPLHELTERVLATFRQQMDRLPPKLRYRVMVEG
IAIIAGIEHLTATAGDWLLNFEFENYGADPVITDMFRWHGAEEVEHRSVA
WDLARHVGVGRPRMMAYFIGSCATIPVGLILLSWLLARADPGVPKMSLVR
WLRETNRAMKRGATLKWSVLGEGFRSFLRPGFTPESIGDTAQAVAYLAKS
PAAKAAAAA
169631099YP_001704748.1 oxidoreductase [Mycobacterium abscessus ATCC 19977]MTHALPMATQTGRHPLAWGMRVLDVVGPTAVAALGKTLPAVLRLSPLLGP
VRPPKWVDRSLHLTVRERSVVAADQDVVALSLGAHDGGELPRWRPGAHLD
VTLPSGAVRQYSLCGDPRDRFSYRIAVRRIPNGNGGSIELHDGVSVGDVL
GVKGPRNAFPLATTGHLNTGTRRFHFVAGGIGITPILPMLAVATELGLPW
TMTYTGRSRESIPFRDELARYGDRITIRTDDEDGLPTPADLLPPLHPDLA
VYCCGPAPMLNVVRDAVAECDGAELHFERFSAPPIEHGVPFQVQLGIGGP
VLEVGADQSALAAVLTSRPGTPHSCRQGFCGTCKVKVLAGRPDHRDSLLT
ETQRAEGQMLLCVSRADGERLVLDI
169631098YP_001704747.1 short chain dehydrogenase [Mycobacterium abscessus ATCC 19977]MTLTTERDGVTNGGMTEHVVRNGDIDVAYFMQGNPEGETILLVHGWPDSH
HLWDGVAPLLRDRFRLVAIDNRGAGKSSNPKSFRDFRLTEMASDYVAVAD
AVSPDKPVHVLGHDWGSVAMWEAICDPELEHRFSSFTSVSGPSAHHMSKW
VRSRFGNPTPKNLALALGQIGSLLYMFGSMTPVIPNVLLKLTMNERRWRT
GLSLAEGAPVEDIHLGSTFMSDITRTLRVYRANALPAMLHPQDRHTRVPV
QVIVGTRDPAVRQSNYDDELKWNQQTWRRVLDGGHWLPFSHPQVLAAATA
ELIDAVSGNQPGRGLRRAEMGKSRRPFEDQLVVITGGGSGIGRETALEFA
RQGAEVVLSDVNLDGANETVSLIEQSGGVAHAYRLNVADEEAVNAHAEEV
VKRHGVPDVLVNNAGVGAAGGFLDTPSEEFRRVIETNLFGVVNGSRAFGA
KMAERGLGGHIVNLSSMAAYSPQKAFTAYSTSKSAVFMFSDCLRADLAAH
NIGVTTICPGVVHTNIVATTKISGVSADEEARMQQAGDRAYAMRRYGPEK
VARQIVGAVRKNKQVVPVTPEARLQYLNNRLAPGLTRYFATKAGMTDLIK
LVPNKK
169631097YP_001704746.1 UbiE/COQ5 methyltransferase-like protein [Mycobacterium abscessus AMLHHPTLADSLIDPARIDHPPRRDHGYLDVLGPESDEPVSVANRFMQSPL
LAAIYERAWRPMFTRGFSYGGKSTLKAHTALMDEIAGRGDHKILDVACGP
GLYTRELAAQLGTAGVCIGLDLSGPMLRRAVRDNSAERVDYIRGSAHSLP
FADATFDTVVCLAALYLIPDPEQAVRELCRVAGPDGQIVVFTSLRTRAAS
LPGVTTAMRIGGFRAFGRDEVTGWLRAQGWTDIDQTVTGQGQFIRARRAV
ALRVAT
169631096YP_001704745.1 monooxygenase [Mycobacterium abscessus ATCC 19977]MGLPDEPDYEVAIIGAGLGGICAAIKLLEIGIKDFVIIDRDEDFGGTWLR
NTYPGVGADIPVVAYQFTFAPKGDWQRFFASGAEIQQYALDLVAEHGLRA
HARFGTCVQREVFDEDNHSWRLHTTGGEVISSRFLISAIGAYINPRTAPD
IPGLDTFAGPVQVPSRWQHDVDMRGKRVGIVGVGSSTVQIAPAIAGEVEH
LDVYQRTPQWYFPKPDFRLPRPLQRLLSRRRFANALNGIALAGIELGLRV
LIYTPKPLFRAGGAIFDRVALWAYLGWLRYKVKDPEVRQQLRPRFGAGCT
RGTLGADYLPTFNRANVTLVSNGIERITPTGIVDRAGTERPIDVLVLATG
YEMFSDPETYRVGTVLGTKGFDLAEFYRDNGLQAYQSTSVPGLPNRFMLV
GPYSWTGTSFHYILENSMRHIEAVLKLARARRATWVEVTQEALDDFQASI
SRSGANLNRYFTVNCAGSNSYFINSQGDTPYVRPWTVLQSYRRSVQFPST
AYEFKRISSPVKEIEHAV
169631095YP_001704744.1 hypothetical protein MAB_4016c [Mycobacterium abscessus ATCC 19977]MRFDAVPIAADGVEDFFATAPFVTRVRRTFDAPPEDVWRVVSGDRMWSWL
PSVWGCRYPLDITPTPGTVRDFQMYIHSWMVFAQHEQIIHFDAPRVMRYT
ALDATLPVFGSWCEEYRVVPEPEPGKATVDWTLACAPRYLTNIPGSRFLI
RPVAAVLQPVFWFGLGGLARELPVRGPQRTG
169631094YP_001704743.1 hypothetical protein MAB_4015c [Mycobacterium abscessus ATCC 19977]MAVHAHPDDESSRGAATLAKYAAEGHQVLVVTATGGERGDILNPAMNRAG
VQENLRQVRRQEMALAAKTLGVEHHWLGFTDSGLQLDPGLLPADGFALVP
LAESVACLTAVIEQFRPHVMVTYNECGGYPHPDHIRCHQMAVAAYGACPD
VAKLYYFHEIVRVTPRMVRFAGRAERIVSRMPRRQSAAAASTDQRLGDVT
VPGWVRVSSMLTRRVGSRRATTLVACGDYFCVRDRALRAHASQVDPNGPF
FLVPWTWRQHLWPTEKFELAHSRVATKAPETDLFAGL
169631093YP_001704742.1 hypothetical protein MAB_4014 [Mycobacterium abscessus ATCC 19977]MTTLPKQPFGRDASLDGQEVELDFAREWVEFYDPENPEHLIKADMTWLLS
HWTCVFGTPACQGTVAGRPDDGCCSHGAFLSDADDRANLDDSVKKLTDAD
WQFREKGLGRKGYLEKDELDGEKQWRTRKYKGACIFLNRPGFAGGIGCAL
HSKALKLGVEPLTMKPEVCWQLPIRRTQAWVDRPDGSQILKTTITEYDRR
GWGEGGADLHWYCTGDPAAHVGKKQVWQSYAPELTELLGEKAYAELAAMC
KRRKGLGLIAVHPATVAAAPH
169631092YP_001704741.1 hypothetical protein MAB_4013c [Mycobacterium abscessus ATCC 19977]MRLGVLDVGSNTVHLLVVDARRGGHPTPMSSTKAALRLAEAIDESGKLTR
KGADSLVHTIGEFSKIARSSGCTEIMAFATSAVRDATNSDEVLSRVKKET
GVDLAVLSGVNESRLTFLAVRRWYGWSAGRIINLDIGGGSLEMSCGVDEE
PDIALSLPLGAGRLTREWLAEDPPGRRRVAMLRDWLESELVDAAKQVAAA
GVPDLAVASSKTFRSLARLTGAAPSGAGPRVKRTLTASGLRQLIAFISRM
TTADRAELEGVSVDRAPQIVAGALVAEASMRALSLEAVDICPWALREGLI
LRKLDSEADGTAFVD
169631091YP_001704740.1 hypothetical protein MAB_4012c [Mycobacterium abscessus ATCC 19977]MTESDDTQRPVSVAELLARNGAAEGKISGHRRRMRGNADAIPVAELTGEI
PVIRDKKGGRARPNPSPAAETAAPEATKAPEAAAPSETRSYLRSNEDALF
GGDSMADEAARRGPSTPSTPAQPSSMASSLRSIFPPTPTPATRPGEPRKS
IDFNDATGVISPVTSAPTSEPTPKPTPKPEAAKPVTPVPPAAPSAPPATP
PAPVSRPVEPEPEPEPEPEPEAVVQPEAEPEPDARPEVIADEYEDDAECE
EDDGEYGRSTAVEWNSHDAEHDVEGAENDYDENDYQLEHELQELVNEHGS
PVDTEASQLADVETEKKTDAEAKAERKEKIKTYLQGGWIAAQYLLAAAAG
AGLFFGFRELWSWNQGIALVLGVLFIAILVASLWVIRKTVDLISILIAIV
VGALIAFGPLVLMLQAVD
169631090YP_001704739.1 hypothetical protein MAB_4011c [Mycobacterium abscessus ATCC 19977]MRPAIKVGLSTASVYPLKTEAAFEYAARLGYDGVELMVWAEAVSQDVNAV
AKLSRKYGMPVLSVHAPCLLVSQRVWGANPIPKLERSVRAAEKLGAQTVV
VHPPFRWQRRYAEGFAEQVAALEDSSDVHVAVENMFPLRADRLFGAGQTS
VERMKRRGGRPGIGVSAFSPSFDPTDANHAHYTLDLSHTATAGTDALDMM
RRMGSGLTHLHLTDGTGASVDEHLVPGKGTQPVAQVCQELAGGDFTGQVV
LEVHTSTARTEDQREAILRESLEFARTHLVR
169631089YP_001704738.1 hypothetical protein MAB_4010c [Mycobacterium abscessus ATCC 19977]MVDAPFAQAMSLTPAGEGLFDAHLNDTWTIGPKLHGGVMLALLAGAARES
LTEGLRTSGSSAGQREPIAVSASYLFAPSPGDMQVRTSVRKHGKQISLVD
AELIQGDRTAVHAVVTLGTPEQHVGPLLTALPPALTQLPAEPPPGVAPIA
EGHPMGEIFHLFGGLDVRPSLRSMSDLSERGKPEIVLWARPRDMAPDGLF
ALVCGDISVPVTFPLGRFGWAPTVQLTTYLRTLPADGWLRVLCSTNQIGQ
HWFDSEHTVIDSEGALVVQSRQLAMVPVN
169631088YP_001704737.1 hypothetical protein MAB_4009c [Mycobacterium abscessus ATCC 19977]MGDKQKTPDWVAERGAWVLENGHRALLKLTGGRWPHKLGYMQTLELHTIG
RKSGERRSTLLSSPVFGPDRIIVIASLGGASHHPAWYLNLVADPHVEITV
RGETKPYIARTASAEEKAELWPEITRGFGNPYAGYQRSTTRDIPVVICEP
A
169631087YP_001704736.1 hypothetical protein MAB_4008c [Mycobacterium abscessus ATCC 19977]MSKQPDWAIRIGAWFLENGHRALLALTGGRYPKKVLGMQPVELYTIGSKT
GQRRGTLLTAPIYEPDRVVLVASYGGGTENPAWYKNLVKNPAVEIAVDDV
ARPFTAHTASAEEKAALWPTIVKVNPGYAGYQKNTDRDIPVIICVPA
169631086YP_001704735.1 ribonucleotide-diphosphate reductase subunit beta [Mycobacterium abMTRTQYGSLRAGGLNWDSMPLKLFAGGNAKFWDPAGIDFSRDRADWESLT
ERERDYATRLCAQFIAGEESVTQDIQPFMSAMRAEGRLGDEMYLTQFAFE
EAKHTQVFRLWLDAVGVSEDLHGYLDDLPAYREIFFDRLPDALGMLAADP
SPAAQVRASVTYNHVVEGMLALTGYFAWHKICVDRGILPGMQELVHRIGD
DERRHMAWGTFTCRRHVAADDANWSVFEARMNELIPIALRLTEEGFELYG
DDTPFGLSLDEFMQYSADKGMRRFGTISSARGRPLAEIDLDYSPLQLEDT
FAAEDRQALAATA
169631085YP_001704734.1 putative lipase/esterase/beta-lactamase [Mycobacterium abscessus ATMSQPQRRVETAPAIAPVPVRTELPGGVHGWAQPEFDRVVRKFASMYVGRI
GGGALCVYVDGEPVLDIWAGEARPGMPWTHDTAPIVYSASKGVTATVIHR
LADRGLLTYDAPVARYWPQFAANGKESITVREVLSHKSGLAALAPLASTP
EELLDHELMEERLAAAPVGRFYGKAAYHAMSYGWLLAGLGRAITGQDMRA
LYRAEIAEPLGVDGIHLGRPPADSPTIPAGIYAHLEKAVRTPFLSRGLSL
GARVIDAIPAARGATGAIHVPGAERIVADNGHTSAPLYDTQMGAGNAICT
APALAKLYAALSNRGSVDGRQLLSAEKTAELARGRGIRPGLPLARDIWDL
GYHCFPAPGLLGGFGHMGAGGSTGWADPKRRIAVGLAHNHLILPNPMHNV
AFPRLWAATVRSAR
169631084YP_001704733.1 pyrroline-5-carboxylate reductase [Mycobacterium abscessus ATCC 199MLVAMSRIAIIGGGNIGEALISGLLRAGRQAKDIVVSEKVPARARALADA
YSIRISEVADAVEGADFIVVAVKPSDVESATTEIAAALAKLDAEGSERET
EQVLVSVAAGVSTGFFESKLAAGAPVVRVMPNAPMLVGAGVSALAKGRFA
NDEQLSAVAELLESVGTVITVAESQMDTVTAISGSGPAYFFLLVEALVDA
GVASGLTRPVATDLVIQTMAGSAAMLLERAESDENRAPGLQTRTEVDTTA
AELRATITSPGGTTAAALRELERGGLRASVYAAVDAAKTRSEQLGITSE
169631083YP_001704732.1 hypothetical protein MAB_4004c [Mycobacterium abscessus ATCC 19977]MNGPSARDGAGAKPGRDASAAGQSGKAQFLTVAEVAALMRVSKMTVYRLV
HNGELPAVRVGRSFRVHAKAVNDLLQASYFDAG
169631082YP_001704731.1 putative UDP-glucose 4-epimerase GalE1 [Mycobacterium abscessus ATCMSAGESNLHYPRVVLVTGASRFLGGYLAARLVQNPMINRVIAVDAVAPSK
DLLRRMGRAEFVRADIRNPFIAKVIRNGEVDTVVHTASASYSPRSGGRAA
LKELNVMGAMQLFAACQKAPTVQRVVVKSTAQVYGASARDPVMFTEEMSA
RRPPADGFARDSIDIESYARGLGRRRPDVAVTILRLANLIGPGMDTALAR
YLAGPVVPTMLGRDARLQLLHEQDALGALERATMAGKAGTFNIAADGMMM
MSQAVRRSGQLGIPVPSFAVAAIASFTKGTRYTELSSEQRDWLAYGRAMD
NTRMKTELGYQPKWTTIGAFGDYVRGRGITPVIEPEWVRSLGDRAVAFAQ
KISS
169631081YP_001704730.1 putative acyltransferase [Mycobacterium abscessus ATCC 19977]MAGETKAKVIQLQANSERHAARARRAEARADAGRRHPSSLTNGAPVHDPA
ETAAVIHDLNEIRAAQGNAHVGDEESLTALAANIAAVAEFIRRRVGGDYS
VDDFGFDEHLNESLLLPLLRPLFNRWFRVDVTGVENIPATGGALVVANHA
GVLPLDGLMLSVAVHDRCPGNRTLRNLAADMVFDAPFLGQLARKAGHTLA
CTADAHRLLSGGELTAVFPEGYKGLGKPFKDRYKLQRFGRGGFVAAAIRT
GAPIVPCSIVGSEEIYPMIADLKVIARLFGLPYFPVTPLFPAAGPVGLVP
LPSKWHIEFGTPIPTDGYDEAAADDPMVTFEVTDQVRETIQQTLYRLLAG
RRNMFFG
169631080YP_001704729.1 putative 2-nitropropane dioxygenase [Mycobacterium abscessus ATCC 1MITNRVTELLGVERPIVQAPMGWIARSQLASAVCNAGGLGIIETSSGELD
AIKDEIRAMREFTDKPFGVNIAQAFVRDPSIAQFVVDQGVTFVTTSAGDP
NKYTRVLKDNGLTVFHVVPTLAAALKAVDAGVDGLVVEGVEGGGFKDPKG
ASTMVLLPLVRSHVDIPIIAAGGICDGVSMAAAFALGAEGVQMGTRMMSA
AESPIHHNWKAAVVAARETDTVLLNRLTKPGLRALRSARTEEMERRDLVS
LLETGDPLDLYFGGNMETFVPLGGQVAGRIGGVESVKDILDATMDEFTAV
IGKLAAQYV
169631079YP_001704728.1 hypothetical protein MAB_4000 [Mycobacterium abscessus ATCC 19977]MRRLTAALTVAVALAGLPITQPAANADVCVGGGRRITVSGCANIADTVQR
YAPPPEDYAPLPDDPPPPPPAPNVHACVGYNGRWVSASGCNP
169631078YP_001704727.1 hypothetical protein MAB_3999 [Mycobacterium abscessus ATCC 19977]MKPIATGLFTALGAAALFSAATANAEPERPANCTAADLAGVSAGVAASTS
SYLFTHPDVNDFFTSQAGKPHGEMQAAVKAYFSTNPEAENDLRAIRQPVV
DFRERCQLPQERQP
169631077YP_001704726.1 hypothetical protein MAB_3998 [Mycobacterium abscessus ATCC 19977]MKIWCTQWTKLLVVMSTVALATGLTSCSKEPGSQKLSADEAKSIAMDAYV
YGYALVTMEMTRRVMTNVEKAEPPRAPMGQLMRMREYPNAAFRDVTAPNA
DTLYTNGFIDVGKEPWILSLPEADGRYYLFPMLDGFTNVFEVPGKRTTGT
GPQTYAITGPGWKGTLPQGVQEYKSPTALVWLLGRIYCTGTPEDYAAVHT
LQDAISLVPLSSYGKPYTPAAGHVDPSIDMTTPVREQVNNLSTKAYFDLL
ATLLKDNPPAEADKPILEKMATIGIEPGKPFDTDKLGTQTVSALESVPKE
AFAKIMAHFKEAGNNINGWVFTTKTGQYGTDYLQRALITAIGLGANRPQD
AVYPTSEVDNTGKPYDGANKYVLHFDKGQFPPAEGFWSLTMYDAGMFFVD
NPLGRYTLSQRNTFTPNPDGSVDLYLQHQNPGPEKEANWLPAPTGKFNLM
LRLYWPKETPPSIIDGTWKPPAVQQVP
169631076YP_001704725.1 transcriptional regulatory protein [Mycobacterium abscessus ATCC 19MAVIRGSALTNYHELVAELGGDGSRLLAGARVSPTDAGSYERFISLPNGA
RALEATAAALNAPDFGRQLARRQGIEILGPVGLAARTAATVADAFAILEK
FMGAYCPVISARVTDHRDPALCRFEFEYLLNPAPPQAQAVELSLGVTLRV
LHHFLGAGYRPVSVHLPHQALTPASAYQRYFGCPPFFCEPVGGFTLRATD
MQKALPKDNLAHQTAVDYLTGTHASRKPDSSQLVRILIRQLLPTGAIGLG
DIALHLGVHPKTLQRRLRAEGMTFAELVDQIRREAAERLLSDTDLSLDHL
SRQLGYAEQSVFTRSCKRWFGTTPSAYRSDRRRA
169631075YP_001704724.1 hypothetical protein MAB_3996 [Mycobacterium abscessus ATCC 19977]MAIRQDIVGTHYRYPDYFEVGREKMREFAAAIKDECEVNSGVVAPITFLA
VAGRRVQHKIFTEMDLPINVARVLHRDQKLKFHRPIRVGDRLYFDSYLDS
VLESHGMVTAEVRAEVTDENGDPVATSIVTMIGEAEGHERDAAAMAANIA
SHRKN
169631074YP_001704723.1 hypothetical protein MAB_3995 [Mycobacterium abscessus ATCC 19977]MTSPQINGEPPAEGPTEEQVLAEAFAEDVARAASFAEADAAAEQPPGPPP
ADLTAAAFFDVDNTLVHGSSLVHFGRGLAQRDYFQYSDMLQFVWAQAKFR
LTGRENSDDVAAGRQKALSFIEGRSVDELVALSEEIYDETIADKIWPGTR
ALTQMHLDAGQQVWLVTATPRELAETIARRLGLTGALGTVAESVDGVFTG
RLVGDILHGPGKARAVRNLAIRNGLNLKRCTAYSDSVNDVPMLSLVGTAV
AINPDAELRDVARRRGWEVRDFRTARKAARIGVPSAVLLGAAGGALAAAL
ARREK
169631073YP_001704722.1 hypothetical protein MAB_3994c [Mycobacterium abscessus ATCC 19977]MTSLTLLTRAGCAACDRAESELAALADEFGVTLTVTDVDEAAATDSSLRA
EFGDRLPVVLLDGQEHSYWEVDEPRLRADLKRDR
169631072YP_001704721.1 glutamyl-tRNA reductase [Mycobacterium abscessus ATCC 19977]MSVLLFGASHRSAPVPVLEKLAIGEADQPKIIEHILQSPLVTEVMVLSTC
NRVEVYAVVEAFHGGLTVIGEAIARHAGMGMNELTKYAYVRYSEAAVEHL
FAVASGLDSMVVGEQQVLGQVRNAYATAESHQAVGRVLHELSQSALRVGK
RVHSETGIDAAGASVVSVALNLADNKLDGLPGRTAAVVGAGSMGSLATAQ
LIRAGIDNLWVVNRSAERARRLAATAREAGVNAQAITLDNLDQALAQADV
VVSCTGAVRPVISLADVHHALEGGRQLVFCDLGMPRDVDPTVAGLPGVVV
VDMERIQREPTARAAANDAGAARQIVNDEVARYLTGERMAEVTPTVTALR
QRAAEVVEAELLRLDGRLPGLAGAERDEVAKTVRRVVDKLLHAPTVRVKQ
LASAPGGDSYAEALRELFELDPHTVEAVATAGELPLATKELHE
169631071YP_001704720.1 porphobilinogen deaminase [Mycobacterium abscessus ATCC 19977]MIRIGTRGSLLATTQAGGIRDALRAKGHEAELVIVTTAGDQSAAPVEQIG
VGVFTAALREAIADDVVDVAVHSYKDLPTAADPRFVIPAIPPREDYRDAL
VARDGLVLGELPAGSVIGTSSPRRAAQLRALGLGLEIRPLRGNLDTRLSR
VSNGDLDGVVVARAGLARIGRLDHITETLEPVQVLPAPAQGALAVECRSE
ATDLVAVLAELDHADTRAAVTAERALLAELEAGCTAPVGAIAEVVESIDE
EGRVFDELSLRGCAAALDGSDVIRASGIGTPDRAAELGLAVARELLDLGA
RALIGR
169631070YP_001704719.1 uroporphyrin-III C-methyltransferase [Mycobacterium abscessus ATCC MTRGRKKPGRILFVGSGPGDPGLLTVRARAVLTGATVAFTDPDVPQAVLD
LVGSAVELPEPAPAKPATGGDEAPAAADNEAAAEPPLTIDIRPALGDPAD
VAKTLVAEARSGVDVVRLVAGDPLSIDSVLAEVHAVTRTQVAFEILPGLA
SSTAVPAYAGLPPGSAHTVADVRGDVDWAALAAAPGPLILHATPTHVPDA
AKALIEHGLADQTLVAVTAQGTTCAQRTVETTLASLIDGVPVDANDPHGP
MTGALVLTIGRVVAGRSKLNWWESRALYGWTVLVPRTKDQAGEMSDKLVG
YGALPVEVPTIAVEPPRSPAQMERAVKGLVDGRYQWVVFTSTNAVRAVWE
KFAEFGLDARAFSGVKIACVGQATADKVRAFGINPELVPAGEQSSLGLLD
EFPPYDDVFDPVNRVLLPRADIATETLAEGLRERGWEIDDVTAYRTVRAA
PPAAQTREMIKTGGFDAVCFTSSSTVRNLVGIAGKPHARTIVACIGPKTA
ETAVEFGLRVDVQPETAAVGPLVEALAEHAARLRTEGALPPPRKKSRRR
169631069YP_001704718.1 delta-aminolevulinic acid dehydratase [Mycobacterium abscessus ATCCMPFPYQRPRRLRATPAIRRLVAETTLAPRQLVLPMFVADGLTEPKAISSL
PGVVQHSTESLRRAAEDAVKAGVGGLMLFGVPQEKDKDATGSAGLCADGI
LNRALSVLSADLGDATVLMADTCLDEFTDHGHCGVLDAAGRVDNDATLTQ
YVHMAVAQANSGARVVGPSGMMDGQVAAIRAGLDAAGHSDVIIMAYTAKY
ASAFFGPFREAVGSSLRGDRRTYQQDVANGREALRELELDVQEGADIVMV
KPAMAYLDVLRQVADVSPVPVAAYQVSGEYAMICAAAQNNWIDLQAMALE
TLTSIRRAGADIVLTYWAAEAAGWLSD
169631068YP_001704717.1 hypothetical protein MAB_3989c [Mycobacterium abscessus ATCC 19977]MMYPDPHHRSGLAGQPSAGPAKPRPDDIDTGCWLWLAALPLMIVSYMAAN
VGQWQQDPEVHKAAPLWTVYAFNGFIVVVVGALVVTGIFLMRAGYRLART
FLTGGAVGSVVFTATRLIDLQGVPAIVQALSGITASVLICGGLFLLHRED
STAYLTRQR
169631067YP_001704716.1 hypothetical protein MAB_3988c [Mycobacterium abscessus ATCC 19977]MTAEQPRPRSVDVAFWFWVVSAAALFLNGLAGVTQRYDAVRAAARHGLTD
EDVRNLVTYFRAWGALCILLAAGIAFLAGRTRQGDKRYRRALIALSVVSV
LGAIVMASSGSVGPLLLIAALSLIVANVLIIRPAAQEWFDGGDHG
169631066YP_001704715.1 hypothetical protein MAB_3987c [Mycobacterium abscessus ATCC 19977]MAKELEAEPRLFYEPGGRWLWLLLGPLAGLIMFGLQVWGRGGVSPVMPLI
AAVLVAFFVSLQIYAVRVHASVELTPTELRQGGEILAVSQIRWLYSDDDR
HIWEESRPLGELTGVPKGRKPVGLRLTGGRRAQAWAKKHEELRAALATLV
PAPPAGMDLGDDPEIDSESEQW
169631065YP_001704714.1 hypothetical protein MAB_3986c [Mycobacterium abscessus ATCC 19977]MKFGTRVAVDLAIAMVAVALAAWAALAARVPTEVAPVAKGEPTLYFTVLD
GACVARALALTAVAGIFLVMAISRGVRARRGTARAIHS
169631064YP_001704713.1 hypothetical protein MAB_3985c [Mycobacterium abscessus ATCC 19977]MTETADIDSMPRAGFGAPVWDRKLQTDRLEYLDRDDVPAKKRSVVESLDL
LGEKKGLHRWNAEQAAGFLVGIDSPRVLELGAAHGGLSRELLKLRPDASI
TVTDIEPSSVAGIAASGMGSDPRVSVRVMDATAIDAPDGAFDLVVFALSF
HHLPPSLAAKVFVEGTRVGRTLLIIDLLRLPAPLLAPAYLFAAAVGWVRP
VAHDGAISQLRAYGPRALRSLAEHADPSIIIELRARLQLPMPLQIVVARR
GL
169631063YP_001704712.1 putative metal transporter ATPase [Mycobacterium abscessus ATCC 199METTNTGMETTDLRLHGMTCASCASRVEKGLNKITGVNARVNLALESARV
EHDGSVTGEDLVKAVESVGYTAQVVGGSHQDAHAGDHDGHDPHDHMNHDV
PDDQLKSRLIGSLILAIPVVVISMAMPLHFSGWEILVAALTTPILLWGGY
PFHRAALVNARHGASTMDTLVSLGTIAAYLWSLWVLFANAGHTHGDVHVY
FEVVAAVTVFLLAGRFAESRAKRSAGSALRALLSLGAKDVAVLRGGHETR
IPVDQLAVGDEFVVRPGERVATDGEVIEGHSALDTSTMTGESVPMEVTVG
GPVLGGYVNTHGRIVVRANKVGADTQLARMARLVSDAQTGKAQVQRLADR
VSSVFVPVVLAISALTFVAWAALGNSLASAFTAAVAVLIIACPCALGLAT
PTAILVGTGRGAQLGVLIKGPEVLENVKDIDTVVLDKTGTVTTGVMSVVE
VRRSIGSGVADADEILRIAASVESASEHPVARAIVAAAASARLTLSPVTN
FRNEPGVGVSGVVDGQEVSIEAIEGQNTTAAVSWGGLRRGEIEVADTVKP
SSRRAIDELKAMGITPVLLTGDNAEVAARVASEVGIAAGDVIAGVKPTEK
ADVVKRLQAEGKRVAMVGDGVNDSAALATADIGMAMGTGTDAAIEASDLT
LVRGDLTTVPTALRLSRKTLGTIKANLFWAFAYNTAAIPLAALGLLNPMI
AGAAMAMSSVFVVLNSLRLRTFR
169631062YP_001704711.1 hypothetical protein MAB_3983c [Mycobacterium abscessus ATCC 19977]MYTRVIALGVALSLSVVGCSDVRRKATDALESAASQAAGAPSNDIGRWNA
EALSKAFGTINDKVGANPADYLSISVAGPSLAVRAIDPKKRENVDEYRYD
GTSVKSTPVDVSDNEPGIVEESSFKSDIVDPAVLANVLTAAVKDSGIEDG
KVTHLSVDKFFANEPEPKIQVSVSSPRANKNVRYTLAGAFTEVV
169631061YP_001704710.1 hypothetical protein MAB_3982 [Mycobacterium abscessus ATCC 19977]MPVQEMVLIALAAFGAGAINVVAGSGTLITFPTLIAFGYPPVVATMSNAV
GLTVGSMTGVWGYRRELSGQWSRLKWQIPAVLLGALIGSFLLLHLPEKTF
VTVVPVLLILALVLVVVGPKIQAWARRRSEAQGRDADHVPPGRMAALTGG
NFLVGIYGGYFTAAQGIMQIAVMGALLPESMQRMNAAKNVLAMITNIVAA
LAYTIVAFDRVSWTAAGIIAAGSFVGGLAGARWGRRLSPGALRAVIVAVG
LIGLWRLLF
169631060YP_001704709.1 zinc metalloprotease [Mycobacterium abscessus ATCC 19977]MRLSRSAGVAALVLTVSIAGCTRDQPTTQVAANTPIPTFDNAQLSMRFAA
CADLNGFVNAKWIAQATIPADKASYGSFDMLNDEARKVQHEIVDGAVSGL
GTADHESVNYQVGLLYRAATDDAKLDAAGYDPIRPTLAAIDQIKTPEELA
AFLAADGATGQHLVFGLEAGADYANATEQIGYVRADALGMPTKDYYTDPR
YASVFDAYRAYIASTFGLIGADQELAKARAEQVASLESALAAATLSPVQE
RDPANQYKLVTVAQADAVTPHFEWGAYLKAQGAPSDRSFSLAETEFFTAF
DRLLTTTDLDTWKSYLTFHAVHRSADALSKAFRDNAFKYKSALTGTTAQK
QRWEQGLEIVNTLVGPALGQLYVERMFSDRDKRSATEVVQNVKEALRKRI
EAVDWMSPQTKLAAKRKWDKLLLKVGFPDKNRDFSKLKLAGDNFYTDRAA
ALKFNYDFEMAKIGRPTDRSLWGMTPQTVNAQYDPTENSITIPAAILQAP
FYDAKGDPAFNYGGIGAVIGHEFTHAFDDEGSQFDGEGNRVNWWTPNDRE
EFDKRANRLVEQFNAYTPIPGRPDLHVDGRLTLGENIADLGGVNTAYDAL
VAELAKHNDAEKAKGIVGFNEKQRFFLNYARIWRDKQRPEDAITQLASDP
HSPPALRINGVVPNVAPFAAEFGCLAGDPMVNSPDKFVKIW
169631059YP_001704708.1 hypothetical protein MAB_3980 [Mycobacterium abscessus ATCC 19977]MQIPQSVARFNKYVTNPVQRLWAGWAPSFAIIEHKGRKSGKEFRTPVTAF
TTPDGVAILLTYGPDRDWLKNLQAAGGGRVVRRGKTHDVVNPRVVSRDEA
ATLVKSRAFGRLPFEQAVLLTYA
169631058YP_001704707.1 hypothetical protein MAB_3979c [Mycobacterium abscessus ATCC 19977]MAYLKPPWFVRKVFNRLAMAANIGETLTITKRVSGEPQQIPVTTVDVDGG
KYLVSTRGESQWVKNIRANPQVTLTVKGVRAVYTATEVPVADRAPIIAAY
KPKAGKVVDGYFAQLPDDADHPTFALRPA
169631057YP_001704706.1 glutamate-1-semialdehyde aminotransferase [Mycobacterium abscessus MDDLASAETLDAVSDETPNSARLFADASTVIPGGVNSPVRAFAAVGGVPR
FVRSGAGCWLTDVDDNRYVDLVCSWGPLILGHAHPAVVEAVQRAAKDGLS
YGAPVEGEIELAREIIDRVQPVEKVRLVNSGTEATMSAVRLARGFTGRPK
IVKFAGCYHGHADALLADAGSGLATFGLPSSPGVTGASAADTIVLPYNDI
GAVAQVFAEQGDHIAAVITEAAAGNMGTVAPGPDFNAGLRRITENHGALL
IMDEVMTGFRVSRSGWYGIDQVAGDLVTFGKVMSGGMPAAAFGGRADIMD
RLAPLGPVYQAGTLSGNPVAVAAGLASLRAADAKAYETLDRNADALIALL
TASLDAEGVAHHIGRAGNMFSVFFGTEPVRDFQSAKATETWRYPAFFHGL
LSRGVYPPASAFETWFVSTALDDEAFDRIADALPAAARAAAAAEEN
169631056YP_001704705.1 hypothetical protein MAB_3977c [Mycobacterium abscessus ATCC 19977]MTDGLRASGSSQTRTIVHLMRHGEVFNPEGILYGRLPNFRLSDKGQGQAA
AVAKSLVDNKITAVVASPLLRAQQTATPIAEVHGLTIVTDDDLIEAGNSF
EGMKVSVGDGALRDPRNWWKLRDPFTPSWGEPYRDIASRMTAAIDRARLS
AEGAEAVCVSHQLPVWTARQHLLGKKLWHDPRKRQCNVASLTSLVFEGEQ
LVDVVYSEPAG
169631055YP_001704704.1 thioredoxin [Mycobacterium abscessus ATCC 19977]MRLLVAALAALALFITACSTGDDAVARGGQFQFVSPGGKTDILYDPPQSR
QTPGPISGPSLLDPTKTLSLSDFRGRVVVINVWGQWCGPCRSEFSALEDV
YRATHAQGVEFLGINVRDNEITKAQDFVTDRKVPYPSIYDPSMRTLIAFG
KKFPTGAIPATLVLDRQHRVAAVFLRELLAQDLRPVVERLAQESAKETAG
EVK
169631054YP_001704703.1 putative cytochrome C biogenesis protein CcdA [Mycobacterium abscesMILADAGSAFQDAATSGPLLLALGACALAGLVSFASPCVIPLVPGYLSYL
AAVVGADNGPENGAGAQPHRLRVTGSALLFVAGFTAVFLLGTVAVMGMTT
SLITNQVLLQRIGGVVTIAMGLVFIGLVPALQRDIRFTPRRVSTVAGAPL
LGAVFALGWTPCLGPTLTGVVAVASATEGADVARGIALVIAYCLGLGMPF
LLLAFGSARAVRGMDWLRRHTRMIQVIGGIALLAVGVALITGVWADFVAW
VRDSFVSDARLPI
169631053YP_001704702.1 putative cytochrome C biogenesis protein ResB [Mycobacterium abscesMTIAKRLLAYARNTWRGLTSMGTALALLVLLALGAIPGAMLPQRALNQAK
VDEYLAEHSTIGPWLDRVQAFDVFSSFWFTAIYVLLFVSLVGCIIPRTVE
HAKALRAQPVPVPRNLGRLPKHAERAVVADQGQLAEAISGRLRGWRRSTR
EKDGITEISAEKGYLREFGNLVFHLSLVGLLVAFAVGKLFGYEGNVIVIA
DNGPGFCSSSPAAFDSFRAGNTVDGTNLDPVCVKVQDFKATYLASGQAHS
FESNIQYQAGDDIQNNVWRPDRLAMNHPLRVNGNRVYLLGYGYAPTFTVT
FPDGRKRSETIQWRPDDPTTLLSSGAVRIDPPAGTYPDPNVRRKNQIAIQ
GLFAPTEQLHGTLLSSSFPEMRKPAVAINIYRGDTGLDSGRAQSIFDLDP
RMIEQKRLNQVARANLLPGQSVKLNDGTIVRFDGAVNFVNLQVSRDPAQL
WVLIFALTMMAGLVVSLVIKRRRVWARLSPGAAAGTVNVELGGLARTDSS
GWGDEFERLCDRCLEGFPPTGAARAGNGHKDEDAE
169631052YP_001704701.1 cytochrome c-type biogenesis protein CcsA [Mycobacterium abscessus MNSTNIDVNLAKFSDYAFTSAIVVMVGALVLLAIELAYRQSDRAAQRELV
SSGGDVVAAGENRPGLVVPQGRRPLAERVGGAGQALAYLGIGLLLLCIVL
RGVATTRVPWGNMYEFINLTCACGLVTAAIVLRPRGNAEGRRALWVFVLI
PVLILLAVSGRYLYTYAAPVMPALQSYWLPIHVSVVSLGSGVFLVAGVAS
ILFLAKMYFPDNSFVQRLPDAQALDRLAYRTTIFGFPIFGFGVIFGAIWA
EEAWGRFWAWDPKETVSFVAWVIYAAYLHARSTAGWRDKKAAWINVAGFV
AMVFNLFFVNLVTVGLHSYAGVS
169631051YP_001704700.1 hypothetical protein MAB_3972c [Mycobacterium abscessus ATCC 19977]MSDYPAHRAPDGPSPYAADEAQGGPTAPPWAAQEPAQPVMYGQSTPQQPH
EMTQQFQAVPFQDPFAPQQDIAGLGHDPAVPSLNSLGGSFAPLDFTPSGS
QEAGDPTAVGAAGSSGGPGGFRADNRFSDSGEQPAQPTPFTADRWASDTP
PSGIPQQAQQPPVGGSRYYTPVGGQQTGVGGQIRPELPPSSRDLSTSALL
RPHKPAPSAGWRKTVYRASFGTINLGEGTKKTEENDLIAQVNQPLQGCYK
IALLSLKGGVGKTTVTATLGATFASIRGDRVIAVDANPDRGTLSQKVPLE
TPATVRHLLRDANSIQRYSDVRSYTSQGPSRLEVLASESDPAVSEAFSAE
DYSRTLEILEKFYSVVLTDCGTGLMHSAMSSVLEQADTLVVISSGSVDGA
RSASATLDWLDAHGHRELVRRSIAVINAVRPRSGKVDMQKVVDHFSRRCR
AVRLVPFDPHLEEGAEISLDRLRPQTRRALIELAAVVAQGFTGTQRQQQT
FQG
169631050YP_001704699.1 hypothetical protein MAB_3971 [Mycobacterium abscessus ATCC 19977]MYYVLIAIVLGALVYAGWRISQSVPTRPQTRVTGPDDDPEFLWRIGKDNP
SGH
169631049YP_001704698.1 hypothetical protein MAB_3970c [Mycobacterium abscessus ATCC 19977]MAERSPGSRLAIDIALYTLARLGLAVVLTLVIFWLARLIGYEDFPLAIAI
LFALIIALPLGMAVFAPLRRRVTASIAVVDERRRADRADLQARLRGEKPH
GATGPGKPDAES
169631048YP_001704697.1 hypothetical protein MAB_3969 [Mycobacterium abscessus ATCC 19977]MATDDAVTQPFTDAIAEAEKLVASAPHIESEADLLEGLEYLAGSIAASLH
LVYNFSTEHPVLLSGTGPFTKMGLDNPDFLYFATQIDGHHDYVLSGTRGS
TVDLNFQLLDSAYTDRDVPESVTAFDDRNLAIHEDGSYRVSIGAAPVTGC
DTHIPIAPRPAQLIVREAYNDWTENRGTVAISRADTLGIGAAPLTKEFVL
GRYIGAGHHLINRVKTWLQFPQWFYMNNPPNVFEPPRITPGGLSSQFSSV
GYFELEPGQALMVTVPKSDAPYQGFQLGSMWYVSLDYINHQTSLNSHQSH
VDPDGKIRLVISDQNPGVVNWIETVGHRRGFLKFRWQRTNRPILDEDGPR
AEVVDFDRIKVSLPFHADHIVTAQQWRSRIAARQTAVATRMLG
169631047YP_001704696.1 putative sulfotransferase [Mycobacterium abscessus ATCC 19977]MRAGFKAARPWPIRALNRVGNPLTGIGAAPTLDTQWLRSAARRATGLEWV
ADAYLDDALEVLAASLRNDAKLSFLGRKMVQVRLVGMLSTRLRLRELIRK
NPGIAQLPVEPPIVIVGLQRTGTTLLHRLLAADPSAGSMSSWEGASPLPH
PEQPSGAPDLRIAQAAKDERSLRYLAPQFFAIHSVEAEAPEEDVLLLDFA
LHSQMPEVMFHVPGYAKWLADQDMTPAYELHRLLLQVLQWQQPRGRWVLK
TPAHLEHLDVLLRVYPGAVVVWTHRDPAQTTASSSSMLAHYQALFSDRVD
HHELARYWLGKNAQIIDRAIAVRAEHPAAFVDINYTELLDDPIAAVQRIY
HAADRRLSDDALTAMRVSLQQNRQHKHGEHRYSLAQFGLTIAEVDAAYRR
YIDHFAIQTERGGVRGDR
169631046YP_001704695.1 monooxygenase EthA- flavin-binding [Mycobacterium abscessus ATCC 19MNPAADRHIDALVIGAGIAGISAAWHITHHCPSLNVAVLEGRSEIGGTWS
LFRYPGVRCDSDMYTLGFSFAPWTGKEAIVEGAAILRYLKDVVEQENLDR
LIRFDHRVREARWSSQTSLWTLRVDTPAGEQTITCSFLMVCTGYYRYDGG
YLPEFSGIDDFPGPVVHPQEWPDDLVIAGKRVALIGSGATAMTLAPRLAD
TADHVSVVQRSPSYVISRPQRDRFANLLLRWLPRTVALPVIRAKNISLMT
FSLYLARRVPQRMGDAIVDRAKRELPPGYDSEKHFRPRYKIWDNRLCLIL
DGDLFQSIGRGDLTMVTGEIERFTGEGLLLTSGEHIPADIVVAATGFHMR
LFGGIEFYRDDEPIDFSSTVCYKGMMLDGIPNFAFTVGYQAATYTLKADI
VSRYVSRLLGYLFENGIASVTPHLEDSSVDLEPFTGYRPGYVQRVLADLP
RQGSKPPWRLSMNYYRDMWMARAQPVEDANLHFSRNSTVS
169631045YP_001704694.1 dehydrogenase/reductase [Mycobacterium abscessus ATCC 19977]MGGTSSRSLVLTGATSGLGLALARLLAESDAYRLILLCRNEERRDELISW
LGAHAAHYVVCDLSALASIRGAAAEIARAVRVGDLAPVGAVVLNAAVHPG
HLAGSTAEGLDATMITNLVGPHLLLALMSPYMSPGARTVLVGSGAHDRKR
WWTGLPEPAALALADACTPGTLSGPQAYVTSKRGMVYLGQAYAERFPEHS
AVLAYDPGIMPATGITRNMNAVSRWLFRRVLTKFVGAKGFSTPERSARWL
CAYLTREDPPVLSYAKVDRYQPWPSAACPPEAAGLLFSEANDIAGITADV
TATWWFLGSPRQSG
169631044YP_001704693.1 putative aminotransferase [Mycobacterium abscessus ATCC 19977]MTAHVGPSGDLDSRRYRAATRDTIDTLIDLNTSKRPNILVAGLAITAESA
QTGYLISDVLPADAGYVTYYANSLEEALSGAIRLVRHTSKVEAGYDPESW
ILVVDRDERLRRYFDPLSEGEHGALTQHVTFAVSAAEALTMLPTRAWSGL
VILDPGEDSTEVLSAAQRHNILRVIAESRAFGAIDAGRRLPAGDIFVFGE
NLTDFQVPFGSYSISQQAYRVWNNPLDAMAQTSTFAANATALTLVTENLR
RHGHISRSQEETLANIHADRRVRNNYFRRFCNPSAADLMEAFGLDFDLSG
ADGGQILLRDGTTLLDCALGNGASLRGHNSPDMARELAEHDPQIDYTGRL
SQLLRTLSGFDEMFPAVSGATSVENALGLARLARPNKPRIVTFRGNFSGK
TIATLNVSRYGPQRSASIEGAFRPYYPDVVFIDPFRADAAEKLTAALDHP
DVGLVWCELIQGMSCVAIPAELLQIVASAKQRGGFLIGVDEVLTGVWRSA
ETFLLQQTWMPDIVDIVTIAKPLSDMMFPMAAALTTADVAEAARSTNPQA
FSDLQNRYRNNLGAHIAWHALSTVNTPESHARRIAERAVLAEGLRRLTTN
SPLYQSVEGYGAHLRLVTHSRYFPFQENTLMGELLGQAMEDLILRRCHVV
LGRGRFFPPLFPPEGMMAEAVARLEKGFEGVTPATVYATLVRCVGGLAAF
MLGRQLKRLVPQSILLRRNGK
169631043YP_001704692.1 hypothetical protein MAB_3964 [Mycobacterium abscessus ATCC 19977]MEQLTGYDASFLYLETPTHYHQGYGVVILDTSTMPGGYSFPIVREWLASR
VAQIPTYTEKAYDPWYNLGHPFWVADTSFDLDRHVQRVVIPAPGTETELA
QACSEIASLPLDQRYPLWGIWVLEGLSDGNVAIFIKRHNASLDGVRGNSQ
LGQLCGNAATELAVVRDAGPVEPLALALGGVRTLSAKPVKMARMLAENIR
ARRRGVVPALPPGVPEPMSAPRTSFNTTLTANRNLAWASLPIADVLQVKQ
RLGVKLNDVMLALTATVIRRYLIERGELPDQPLRAFVPVSVHDKPGQHGR
NRTTGLLTSLQTLTDDPLRRAREIASITNAAKVHAEALGPGRIHDWFDFS
ARYWGVLFRVYSRLRMADRHKVMQNLVLSNIGGRHQDLYFAGARISRFYP
FGAPFDGGALFVTVASHDDRLNVGLIACPEIIPSLADLAADYQQALSELA
AALDTAEAVAE
169631042YP_001704691.1 hypothetical protein MAB_3963c [Mycobacterium abscessus ATCC 19977]MNSSADTSQERGGLVGVIRRAVLAVGHHDLAAPIRRSSVVADRLLYRIGG
GRWTITAVSRIPSLTLLVTNARGEGVVVPLQYLAIDGDLYIVGTNWSRPN
HPLWSSWLMKRPQCRVNIGGRESSRTAILMLGEDRDRVWARILQEAPYQA
NCERKANRQPRVFRLDESITGAN
169631041YP_001704690.1 cytochrome P450 [Mycobacterium abscessus ATCC 19977]MARITSVPCDGETTTYVSPPKLRVARALARLPRLGDTVGLMLDPTFYLFE
KYLRHGPVFTVKMPYQTYTVLAGSEAATFMSSKDGRECLTVGSSWRFVEE
QFGGKDSLVAVDGPQHKQWRTLLQRGYSREAIADRYSEAIDVIDDAVDKH
WRPGESVPVLPAMQKLSIAQVGTFLGGVRPTDDDIEDIALVTREILKIAP
VQHIPKFMLQLPRYVNARSRVARVAQNALALAGHSSASGRRGQSTLLEDI
LESCRDDPNAANQRNMLFHSVLPYFAGVETTSATATYALYLILRHPDVLC
RIQDEVAVMFERGGITHDSLFHSTPVLHGAIMEAMRLRPIASFIIRVAAK
DFEFHGHQIRSGEGVFIGTTVPHFLSEFYENPMKFDVDRYGDSAGPNRTP
GAYSPFGRGPHMCVGKGLAESLMQLMLARIIHRRTLELSSRSYRLSNRVS
SSSPSPKFAVRVVSSRR
169631040YP_001704689.1 cytochrome P450 [Mycobacterium abscessus ATCC 19977]MPAAQQRELQRAGTVHRVTTAVGDPAWLITGYATVRQLFDDERVGRSHPE
PDTAARSGDSAFFGGPIGSYETEREDHARGRRLMQPHFTPKQMRTLAGRV
HELADELITAMIDRGSPADFYTAVAVPLPMMVLCELLGVPYADRDEFREW
TVAASNTRDRSRSEWGMGQLFVYGMQLVGRKRQQPGDDVISRLCTIDGVA
DHEIASQSMALLLGGHETTVVQLGLATLLLLANPEQWALLVSQPDLVPNA
VEETLRASRTGGGEIPRYAREDLEIDGVHIAAGELLLLDVGAANHDPAVF
GCPDQLDVARKHLAHVIFGYGSRYCVGAPLARMQLTEVLGQLVERLPGLH
LRRDISELTMRGDLLTGGLREVPVGW
169631039YP_001704688.1 hypothetical protein MAB_3960c [Mycobacterium abscessus ATCC 19977]MSDLSSAHLDDAVSSTDPAVGLRAVQALRRLCERLEAIHVTNARNQGWSW
QAIAEALEVSRQAVHQKYNRARK
169631038YP_001704687.1 putative ATP-dependent Clp protease [Mycobacterium abscessus ATCC 1MLSQEEAREMDDTRIGAEHVLVGVLDSAGAPLSELMGGYGLTADGVRDRL
RAGSEQPPMDDEDAEALRAIGIDLSQVRESVSKVFGPQAFDKAFEKSGRR
KARVRGWRPFGMIPFNSSAKKCLELALREAIAHKDNWIGCEHMVLGILRG
GDPVALAVITERVSADELRQAVVGLLDQAA
169631037YP_001704686.1 1-4-dihydroxy-2-naphthoate octaprenyltransferase [Mycobacterium absMASIAQWIEGSRPRTWPNAVAPVIAGTGAAAAAGSAVWWKALLALAVSVC
MIIGVNFANDYSDGIRGTDDDRVGPLRLVGSRLASPASVKAVAFAFLALG
AAAGLALAITTAWWLVAVGAVCVAGAWFYTGGSKPYGYSGFGEIAVFVFF
GLVAVLGTEYAQTSTVSPVGVVLAVAIGSFSSAVLVANNLRDIPTDRESG
KITLAVRLGDARTRVLFPALLAVPVLASIGLGVAHPWRLLGLVMLPLIAK
AARPVVTRASGPALIPTLRDTGLAMLGWAILTAAALAWLS
169631036YP_001704685.1 superoxide dismutase SodM [Mycobacterium abscessus ATCC 19977]MNSIEHQLDRRQFLITAAASAGALALASCTNQTHEQTPPTKETGVYHLPN
LDWDYSALEPHISGEINQLHHDKHHAAYVKGANDALEQLAQAREKGDNAA
IVQLEKNLAFNLGGHANHSIWWKNLSPHGGDKPEGELGGAIDEQFGGFDK
FRDQFSAAANGVQGSGWAWLGYDTLGKKLLTFQMYDQQSNVPFGTIPLLG
LDVFEHAYYLQYKNVKADYIKAFWNVVNWPDVQARFAAAVSKTPGLIFP
169631035YP_001704684.1 5'-methylthioadenosine phosphorylase [Mycobacterium abscessus ATCC MLAVIGGSGFYSFFDKPVRTVTPATPYGEPSAPITIGLVGGREVAFLPRH
GSRHEFSPHTVPYRANMWALRAVGVRRVFAPCAVGSLTADLGPGAIVVPD
QLVDRTSGRAQTYFDSAGIHVEFADPYCPGLRAVSLQPGTIDGGTMVVVQ
GPRFSTRAESRWYASQGFTLVNMTGYPEAVLARELEICYAAIALVTDLDA
GVEHGQGVRAVDVFAEFERNIGGFKELVRSAVTATESVDTCGHCRAHDGV
TLPIELP
169631034YP_001704683.1 hypothetical protein MAB_3955 [Mycobacterium abscessus ATCC 19977]MTLTPRCDQRFSEPGACAPAWSDVSALLAAAELYWITTVRPDGSPHVTPL
VGTWHDESFVFCTGPAEQKALNLESNRAVAITTGVNTWNDGHDVVVEGTA
ERIVDATALQLLARSYVEKYGEEWTFTPSAGGFGEGDQFAVVYRVVPSKV
LSFTKRPHAQTSYVR
169631033YP_001704682.1 hypothetical protein MAB_3954c [Mycobacterium abscessus ATCC 19977]MRDSVTVHIAAPADKIWALVSDITNTGKFSPETFEAEWLDGATEPAVGVR
FRGHVKRNQKGPVYWTVCRVVECERGRSFGFAVLWPNGKTVNTWRYRFEP
AGDGTDVTESFELAPTLPLRIYWALLGWARGRTNRNGMRETLNRIKAVAE
AP
169631032YP_001704681.1 hypothetical protein MAB_3953 [Mycobacterium abscessus ATCC 19977]MTSSSLEIVRSNTMTREQFAPGSAPLVRDRDREIVSTATGNRTGLVLDSD
ATGGAVSVLSVYLPQGANGAAPHLHTRSTELFYVVSGRLEILAGDRIEIL
EQGDTLLVPRLMPHAFGATGNSDVNVLTVLSPGVQRFDYFRLLDRIVHQQ
ADISELQAAQETYDNHFVESAVWAQGRGLSALDAR
169631031YP_001704680.1 O-succinylbenzoic acid--CoA ligase [Mycobacterium abscessus ATCC 19MTRLLRALPVPSGQTVLGLLPRLAELLDGRGDAVLPVPADDADHAHFLAS
ELSADEPIADDVAVVISTSGTTGKPKGAMLTGQALTASGTATATRLGGPG
QWLLALPPHHIAGMQVLLRSIQAGSDPVVLDVSTGFSVPDFVRAVAEMTG
SRRYISLVATQLVKALGDAEASEALASFDAVLLGGGPLPATVAIRAAQAR
VPVVRTYGMSETCGGCVYDGVALDGVEVRIGPEGRISLGGATVATGYRNI
PEHKAFAEHGWFHTDDFGELDEGRLRVLGRLDEAISTGGLTVVPQVVEAA
LGAHPLVADCAVFGVPDDRLGQRVAAAVVPSAAGAPTLEDLREHVTAALD
GTAAPRELHLLDELPRRGIGKLDRRALVKRFS
169631030YP_001704679.1 hypothetical protein MAB_3951 [Mycobacterium abscessus ATCC 19977]MAGDNGQQQHYDRYSVDKIQDGRPSLQELEAVNAFLNKIVTWLRAGYPEG
VPPPDYVPLLALLGRRLSNDEVKTVARELMARGDFDNIDIGVLITQITDE
LPTGEDIERIRERLAKKGWPLDDPREPADHGEEPGSGQATDHPA
169631029YP_001704678.1 inorganic phosphate transporter [Mycobacterium abscessus ATCC 19977MDATMIILVLLIATALAFDFTNGFHDTGNAMATSIATGALKPKTAVLLAG
ILNLVGAFLSVEVAVTVTTSVIKVQDSKTGHLLPNITPSMGLTIIFAGLI
GGILWNLLTWLFGIPSSSSHALFGGLIGAALAAIGTSGVKWDGILQKVII
PAVAAPLIAGLVAAAGTWLVYRITRNVVKKRREEGFRWGQIATASLVALS
HGTNDAQKTMGVIALALITTGHLTGNVKETGLPFWIIASCALAIGLGTYL
GGWRVIRTLGKGLVEIESPQGLAAEASSAAIILSSSAAGMALSTTHVATG
SILGTGVGKPGAEVRWAVAGRMVLAWLVTLPAAGIVGALSYWLSHLVGNL
TTPMVGDLIIFALLVVLSGYMWWRAQQEKVDSSNVNAEWDDSTNSVVPAD
VRESRAEAPVEAPNKQAPNKEAANKEAPKKDSANDTASV
169631028YP_001704677.1 hypothetical protein MAB_3949c [Mycobacterium abscessus ATCC 19977]MNYLEAIGKVLVVGLILGAGLPAVFAAGLVAYSSGAGGTHDDGTVVAPNP
AVKFLGLALFTLVGAVVVLALLWITRTTIIHHTGVDFFPFLKK
169631027YP_001704676.1 hypothetical protein MAB_3948 [Mycobacterium abscessus ATCC 19977]MEILSSRILLRPKDYDATLAFYRDTLGLAVARDYGAGMVFFAGQSLIEIA
GHGRPDGPLTAFPGALWLQVRDVYETQTELESRGASISRAARQEPWGLHE
MHVAAPDGVTLIFVQIPPDHPLRKDTRR
169631026YP_001704675.1 short chain dehydrogenase [Mycobacterium abscessus ATCC 19977]MSKNSFGKRVSTTLARAAMQPFPSLPLVRARLDPNYGAPIKGKRVLITGA
SSGIGEEAAYQFGKLGAKVIVVARREDLLAEVAARIIAEGGEAEAIACDL
SDLDAIDKLVETVNEKHGGVDILVNNAGRSIRRKTYESLDRWHDAERTMQ
LNYFSPLRLIRGFAPGMVERRSGHIINVATWGVLTDVVPQFAVYNASKAA
LSTVSRIVDAEYGKYNVHTTTLYFPLVRTPMIAPTEAYTNAAALTSAEAA
EWMVLAARTRVVRIAPRISVMSAATNAVAPDLVTRVARNGRETLG
169631025YP_001704674.1 putative short chain dehydrogenase/reductase [Mycobacterium abscessMGSLAGKTIIMSGGSRGIGLAIALRAARDGANVAIMAKTAEPHPKLPGTI
YTAAEEIEAAGGHALPLLGDVRDDEVVASAVAQTVEKFGGIDIVVNNASA
LNLAPSESISMKAYDLMQDINARGSFSLSTSAIGALKEADNPHILTLSPP
ITLEPKWFERTTTAYTISKFSMSLVAIGLAAELRQYGIASNALWPRTTID
TAAIRNILGAELVARCRSAQIMADAAYEILTKPSREVSGNCFIDDEVLRE
AGVTDFSQYRECAEEDLELDFWMERA
169631024YP_001704673.1 naphthoate synthase MenB [Mycobacterium abscessus ATCC 19977]MTQDDGQTANPFDPTRWQPVPGFEDLTDITYHRNVEHGSNGARQTGTVRI
AFDRPEVRNAFRPHTVDELYRALDHARMTSDVGAVLLTGNGPSPKDGGWA
FCSGGDQRIRGRTGYQYAGGETAETVDPGRAGRLHILEVQRLIRFMPKVV
IALVNGWAAGGGHSLHVVCDLTLASREHARFKQTDADVGSFDGGYGSAYL
AKMVGQKFAREIFFLGRPYTAEQMHHMGAVNEVVDHAELENVALEWAAAI
NGKSPQAQRMLKYAFNLTDDGLVGQQLFAGEATRLAYMTDEAVEGRDSFL
QKREPDWSPYPWHY
169631023YP_001704672.1 hypothetical protein MAB_3944 [Mycobacterium abscessus ATCC 19977]MPQVRAIRFGRRTRSLVVAAALATALSGCTVYQTLTKPTEIPQTTTAPTV
SDQEQIRQVTAQMGKALGSLDLDAGNALTCPRYQVSSRTADEKLVPSINS
WQGAEQALMYGDTSTLASAVAQQFPSAGSGERASLVRAIVNRDQFSYTTG
VLQILRESTTVEKFAIDNIKIVGDSATGDITATYSFGGAGTQTQVKPNQF
RKEGGKWAWCQQPPPGLFTQWTTSSAAQASA
169631022YP_001704671.1 hypothetical protein MAB_3943 [Mycobacterium abscessus ATCC 19977]MSEHRVYIDKQTPSVYQGLSKTAAELRARAADTGLSRTTLELVNIRVSQL
NRCLFCLDLHTRVALEEGESAQRIAVLPVWQEAELFSDVERAALTIAEAV
TEVTDHHLTDEQYTAVREHLSDDQVSVLVWSAIMINTFNRISILSRHPIK
RR
169631021YP_001704670.1 hypothetical protein MAB_3942 [Mycobacterium abscessus ATCC 19977]MDESDVTVADAPDNHRFEITADGELAGFTEYLDTSLDGTAVRIFFHTEID
EKFGGRGLAGTLVQSALTTSRGTGRKIVPVCPYVKKFVGKHHEFDDIVTP
VTRDALAAVEARQG
169631020YP_001704669.1 hypothetical protein MAB_3941c [Mycobacterium abscessus ATCC 19977]MSNTETTPTETRCEGGPCPLDDAGRPVVEILTPREVPLGGPRAMTVLRTL
PQAQRSLIGAWCFADHYGPDDIGQTGGMDVAPHPHTGLQTVSWLFTGEIE
HRDSSGVHAMVRPGELNLMTGGRGICHSEVSTAQTTTLHGVQLWVALPDE
SRDAARDFQHYAPDAVVAGGVSLRVFLGTLAGQVSPVRTATPLLGAELLL
EPHSTARFDVDAGFEHGLLVDTEAIEFSGSRLTRGELGYVGTGVEQLTVT
NPTETTARAILLGGKPFGEQIVMWWNFVGRDHDEIAAFREEWQAESERFG
RVEGYQGAVPRLPAPPLPRVRMVPRRNAPTANPGYATP
169631019YP_001704668.1 hypothetical protein MAB_3940c [Mycobacterium abscessus ATCC 19977]MIVSYIRSTAWMGFLRQWWTEPVPTGWLRGFLHARKLDRTVRNLIGGYAL
IFAAICIAVQFSDTGPRSMIGRVIVGLCAVGSLGWALRWAVGPWPSLREA
VAFVAFADIGIAVACWQDSDPLAGLVGTVLFTPVGAYVSFFLANRLLVAH
VAWCAPMIIALSSRLFAEGTVGAAMTALVKVTSMLLVVVLIPAVIQFGIA
VVRWDALAAQRDPLTGLLNRRGIYAEWQRLYGELRREQPLDGDQVTAAAI
VDIDRFKSINDRYGHGTGDRVLIDVAHALTCGTTGTSVVGRSGGEEFLVV
TVCPASAVAEFATRLRQAVTASMPAGIAVTASVGVAAQAVSRVVSATSQE
AIEVLTACADRAMYEAKHDGGDQSRILHADDDSEGRYLWRSGA
169631018YP_001704667.1 hypothetical protein MAB_3939 [Mycobacterium abscessus ATCC 19977]MPVDIKPVPKWLKYFNKVVIGGHKVGLKLPMMVLTVPGAKSGKPRSTPIT
PFTLDGQRYAVGGVPGSAWITNARKAKTGTLTRGRHSEQVRIIELSPQDS
RPVLRAFPIEVPAGVGFIRNAGLVTEGTPDEFEALAGIAAVFRFDPLNG
169631017YP_001704666.1 putative Clp protease subunit [Mycobacterium abscessus ATCC 19977]MAAFPISLDNLIESVRGMHPDGTALDHLSDAMLLAGRLSDHADALIGHFV
DQARRSGASWSEIGSSMGVSKQAAQKRFVPSVRMFSRFTDRARRSVVGAA
GFALADGTPITVDHLLAGAISDPKGLAAVIVAQAGITADALGIPERPAPD
YDAVAPTLSTAEFDGDAQEALEATLHIALRLGHNFIGTEHLLLAILSGHT
DTSRRLSELGLNAVVAEEQVTRLLGEILQGRTP
169631016YP_001704665.1 hypothetical protein MAB_3937 [Mycobacterium abscessus ATCC 19977]MTTAHGVAGFQSGCRCPGCSTAEARRLRRIGDLERERWEPINQRATRRTE
HYFAEASDHPLNWQKPWTKEEISTVLDSSSTAAQVATRLGRSVGAIHAAR
RRFRARPCRN
169631015YP_001704664.1 phosphoglycerate mutase [Mycobacterium abscessus ATCC 19977]MELRRLYVVTHPESTHHVDGLVGGWYDSALTAAGRRAARAIASSLRTRVP
GGSEVEVYTSDLVRAAHTADAIGDALGVAPIVDVRLREKSYGEAGGRPQE
WLDQRFVPPPAVGERMAHDEGISGAETKIVFAQRIYDAMSDIVESRCRHQ
VIVTHGGALTFVVSAWIKMPVASTGYVSFRAPAGSISVLSEDDYFHNRAV
TELGSIDHLRSV
169631014YP_001704663.1 O-succinylbenzoate synthase [Mycobacterium abscessus ATCC 19977]MELPVLDDVLDRLHVVALPMRVRFRGITTREVALIDGPAGWGEFGAFPEY
QPAEASAWLSAAIEAAYRALPTPRRDRIPVNATVPAVTAADVPEVLSRFP
GAQTAKVKVAEPGQTLDEDVARVEAVRARIRTVRVDANGGWTVAQAVHAL
TALTRDGALEYAEQPCATVEELAELRRRLPGVPIAADESIRRASDPLRVA
QARAADIAVLKVAPLGGVHALLEIAARIGMPAVISSALDSAVGIGIGLRA
AAALPELDHACGLGTGGFFLADVADVPPVVDGHLPVTSCTPDPARLAALA
VPADRLDRWRRRVADCHALLNR
169631013YP_001704662.1 alpha/beta fold hydrolase [Mycobacterium abscessus ATCC 19977]MPLANINGIQISYDDRGPLALGASGDPVVFISGRGGAGRSWHLHQVPAFR
AAGYRTITFNNRGIPPTTESADGFTLQDMVDDTAALIEQLGAAPARLVGF
SMGALIAQELTLTRPELVTAAVFMGTRGREDATRSFFRKAELELSASGVE
VPAAYQAAMRLLLNFSPKTLNNDAAIKDWIDMFTLWPEPASGGIDHQRSA
IPAPDRPGAYADIKVPSLVIGFTDDMTLPPYLGKEVADAIPGGQYVEISD
AGHLGFIERPDEVNRVILEFFASTAQTV
169631012YP_001704661.1 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate syntMNPSTAQAHAVVDELIRGGVRDVVLCPGSRNAPLAFALHDADKAGRLRLH
VRIDERTAGFLAVGLAAASGSPVPVAMTSGTAVANLGPAVVEANYARVPL
IVLSANRPYELLGTGANQTMEQLGYFGTQVRAAISIGLAEEGSEKIEAQN
PHWRSATCRVLAAAKGSRTANAGPVQFDIPLREPLVPDRDGGPIPAGRPG
GAPWTYTPDVTFDEPVEIDLTADTVVIAGHGAATHPNLSMLPTVAEPTAP
QPDNPVHPLALTLLHPQQVIMLGRPTLHRQVSSLLADSRIPVYALTTGPR
WPDVSGNSQATGTRAVTSGSPDPAWLQRCAHAHHKALDAVRGQLSTHPLT
TGLHVAAHVCGSLRDGDQLVLGASNPVRDAALVPWGAKDVRVRSNRGVAG
IDGTVSTAIGAALAHRGGRTVALIGDLTFVHDSSGLLIGPTEPRPENLTI
VVSNDNGGGIFELLEQGDPRFHDVSSRIFGTPHDVDIAALCRAYHVDSQS
ISVEELGPALDEPARGIRVLEVKADRSTLRELHAAIRAAL
169631011YP_001704660.1 hypothetical protein MAB_3932c [Mycobacterium abscessus ATCC 19977]MNRRARVITRVRIGVLILAGLMTLQSLLLVAGAWRNDKAIERDMGVALAE
VLSAGPRRSTIEFVTPERVTYRPELGVLYPSELSPGMRIYVEYDKSNPDL
VRVQGRNASLSIIPAGSIIVVVWTVTGTVLLGLAWLRRRGPAPAHA
169631010YP_001704659.1 glycosyl transferase [Mycobacterium abscessus ATCC 19977]MRIAIVAESFLPNVNGVSNSVLRVLEHFRRTGHEAIVIAPDTPRGQAPAA
TEYAGVPVHRVPAIMFPKVSTLPLGVPQPRMVRIFREFAPDVVHLASPFV
LGYGGLRAAQHLDVPVVAVYQTDVAGFADSYGAGFAARAAWRWTKHLHGR
ADRTLAPSSSAMEDLAMHGIPRVFRWSRGVDIERFAPSARDDELRRAWSP
KGKPIIGFVGRLAPEKHVERLAVLAGRDDLQLVIVGGGVEREALEKLMPT
AVFTGELTGSALSRAYASLDVFIHPGEHETFCQAVQEALASGVPSIAPDA
GGPRDLVIPGRNGMLLPVADFEARLGMAVDHLVQPATRSRFSAAARRGVL
ARTWPAICDELLEHYAAAAGTTLGRGIMTA
169631009YP_001704658.1 ubiquinone/menaquinone biosynthesis methlytransferase UbiE [MycobacMNRATLEKDPHEVASMFDAVARRYDITNTVLSFGRDRFWRRATREALRLK
PGDKVLDIAAGTAVSTAELTQSGAWCVAADFSVGMLKAGARRDVPKVAGD
ATRLPFADHSFDAVTISFGLRNVVDHVEGLREMARVTKPGGRLAVCEFST
PVNRPFRTLYMEYLMKTLPEVARAVSSNPDAYVYLAESIRAWPDQEALAH
QIASAGWSNVRWRNLTGGIVALHIATL
169631008YP_001704657.1 oxidoreductase [Mycobacterium abscessus ATCC 19977]MQTSADLVVVGAGPAGSAAAAWAARSGREVVLVDSAVFPRDKTCGDGLTP
RAVEQLELLGLRPWLDEHIRYRGLRLHGFGGNLEVPWPGTSFGGTGSAVR
RTELDDKIRQVAVDSGAKMAESTKAVDVERDSAGRITSVRVLDDNGPGEI
ACKAVIVADGVRSTLGKILGREWHKDTVYAVAGRAYIESARGDEEWMTSH
LELRSPEGDVLPGYGWIFPLGGGQINIGVGALATSKRPADAALRPLIEYY
TELRREDFGLTGRLQSIASALLPMGGAVSGVAGPNWMLIGDAAACVNPLN
GEGIDYGLETGHLAAEVLDAGDYSQLWPQLLRDRYGRSFSIARRLAALLT
LPRFLPVMGPVGMHSAVLMRIAVRLMGNLVTDDDQDMIARAWRVAGGGSR
RLDSRPPFS
169631007YP_001704656.1 polyprenyl-diphosphate synthase GrcC1 [Mycobacterium abscessus ATCCMAGVDLGDPVFAAKVRDHLAAIETLIVSELGQSDPLLTESVLHLFHAGGK
RFRPLFTVLAAQTGPDPDNDEVILAGAVCELIHLATLYHDDVMDEAQKRR
GVPSANARWGNNVAILAGDYLLATASRLVSRLGPTAVRIVAETFAELVTG
QMRETVGVPEGGDETEHYLKVIHEKTGSLIAAAGRFGAMTSRCDDDQIER
LSRLGAIVGTAFQISDDIIDIESLTDESGKTPGTDLREGVHTLPMLYALR
DTGPDADRLRVLLAAPITDDAEVEEALALLRASEGLAQAKSVVIDYADRA
KAELVELPPGDARDALGVLIEYTVRRHG
169631006YP_001704655.1 protease HtpX-like protein [Mycobacterium abscessus ATCC 19977]MPAVPSHANGLKTVLLLGGMSAMIVFIGSLFHSKSILLLAIVFAVGMNAY
VYFKSDTLALRAMHAQPVTELQQPAMYRIVRELATVARQPMPRLYISDTN
APNAFATGRNPRNAAVCCTTGILDLLSERELRAVLGHELSHVYNRDILIS
SVAGALAAVISGLANMAMFLNFFGGGDENRPNPFALFLVSMLGPIAATVV
KMAVSRSREYQADQSGAELTGDPLALASALRKISGGVQAAPLPPEPQLAS
QSHLMIANPFRASDRVASLFSTHPPMADRIARLENMARF
169631005YP_001704654.1 hypothetical protein MAB_3926 [Mycobacterium abscessus ATCC 19977]MSASEEGQALMSASEEGRALMSASEEGRALMSASEEGRAATSGASAEDFA
RASDAIEALLAAVRPDQWDAATPCEEWNLRQLADHLVEVNYSLAGRFGGL
SSGTAADPVAAYRLSAQALRDALALPGVLDQTYPGPFAHTTGANQLQVRM
ADLLTHGWDLARATGASADLPVDLTENALGFVQKLAGAFARSGKFGAPQP
VAEDAPALDRLAAMTGRVV
169631004YP_001704653.1 hypothetical protein MAB_3925 [Mycobacterium abscessus ATCC 19977]MTTEIENLSGLELLRSMGGTADGMPPIARLLGMQLEDIEFGTVSFSVVTR
PEFANPLGTLHGGICATLLDSVLGCAVHSTLEPGIGYGTLELKVNYVRTV
PVDGERLVATGTVLHPGRRVATAEGKVVDSQGRLVAHGTTTVMVYR
169631003YP_001704652.1 TetR family transcriptional regulator [Mycobacterium abscessus ATCCMDRLVYVGEEGEVASGPRQRLIDSAIAMMRERGVHATGLADLLKRSGTAR
NSIYQHFPEGKAELIAAAEREASDLANGFLDALRARGDAEYLLTRFIAWW
VNQLEAHDFDTGCPHAAAALAGPGEEQIRAAAHDAFIGMRTRLAESFRDS
GVAHDVDSLASLTVSAIEGALLQAQAARSVQPLREVERELIALIRARAE
169631002YP_001704651.1 hypothetical protein MAB_3923 [Mycobacterium abscessus ATCC 19977]MSLPHQEDTNSVFTHSPHDDSDYIGEATVTVRGTDIPVELELKGYSEPID
GVFRWIGRIRPNEQLTAIVGDEARVKATIRTTHSARDAFIGDPDPWNRYR
VIGKSTPPFHVATDLSEVEAE
169631001YP_001704650.1 hypothetical protein MAB_3922c [Mycobacterium abscessus ATCC 19977]MTSSSYKDINYADYEFTPATTVGGDMPTRRRRVGDRLKTARRLLFEATEL
SYDPELDIDWDAPLDSGKHWLAAHRLSLFGTQEWDMLSDAQRGELACREL
VSLLSFVMDAQGALASLMFRDVIEGNTLADDYTRFQLASVRDISRNATMV
GRLINKTGLELQPAPMAVQRLQRFGVPAIPHGPLGRGFILLLHKLIHQLM
SELEADGLAQPVVRQVAKICVLVSRRQLEFAEDELYRAVDARKYLPAAWA
DVSLALLTVLATSLIVRPQVYAGVGLTPRKGRRAAARSENLRHRNSVLLR
GYFDIAEDAGMFRTGAARAILRGRGLL
169631000YP_001704649.1 hypothetical protein MAB_3921c [Mycobacterium abscessus ATCC 19977]MTTIDQPRALHEAGASSVRGKSVGDREKTAQRLLRSAAERAYDGEVDIDW
DAPPVPGLYWATPRRTSLYGTKLWDKLTQEQRIELTRHELGSILSFGIYV
ETGLSAMLWRQVVEQNGGATDHGRYALTEVSEEARHSTMFGRLVNKMGVE
PYTYPKFATRVIRLLGLVPLGPSGLGGLLLVEEVLDRAQRETMMDETVQP
HARQLMKIHVLEEARHITYAREELVRQIAERGPVSNAIHRAIFALAVIGI
YPVLFNPKAYRAVGIHPLRGFFAFLTSPHYRENATWVSEPLMRFMHEIGF
LDGKFTGRLLRMSRAMPEDILAEIKAR
169630999YP_001704648.1 monooxygenase [Mycobacterium abscessus ATCC 19977]MTVTETSHEEQRPDTVGDGGSSEPIRIRALIVGTGFSGIGAGIALQKMGV
PFHILEKAGEMGGTWRDNTYPGAACDVPTHLYSFSFEPRSTWDRLFSQQP
EIFDYLKEVGAKYGLYRHVTFNTRVTRGYWDEDEYRWHVFTDGGQEYICQ
FLISGVGALHIPSIPEIEGLDRFEGPVFHSAQWNHDYDLTGKKVAVIGTG
ASAIQFVPEIVGKVGELKLFQRTPPWVLPRTNVEFGALAKRAFAGVPGLR
ALFRSGMYFGAEAGAYAMNRRPALLKGIELLGRAYIKSQISDPEVRRKVT
PDYRAGCKRLLGSATYYKAIENRKTELVTEAITRVTTDGVVTSDGIERKV
DAIIFGTGFHVTDSYKYLDLKGQGGEDLGERWSSQGVTAHRGITIAGMPN
LFFLLGPNTGLGHNSIVFMIESQIHYVTEAIKQVDAAYAQALVPTREAQD
RFNAEVQRKLQGSVWNSGGCQSWYLDEHGKNRTLWSGFTFEYWSQTRKVD
PSEYEFEGAVRPAVRRTIPRADGPRQKSPSMAAQ
169630998YP_001704647.1 putative short chain dehydrogenase/reductase [Mycobacterium abscessMKNFDNKVAVITGAGSGIGRSLALALAQRGARLALSDIDTAGVADTAGRC
EKAGATAIPFELDVADRAAVYAHAADVKNEFGQVNLVFNNAGVALSADVK
DMEWDDFDWLMNINFWGVAHGTKAFLPHLIESGDGHIVNVSSVFGLMGIP
SQSAYNAAKFAVRGFTESLRQEIRAAKFPVGVTCVHPGGIKTNIASSARG
IPDGVDRETVRKGFQLMAITRPDSAARIILRGVEKNRPRVLIGPDARVFD
AIPRIIGPRYEDLMAPFYGMGRYGIGKKIAGRFGIEL
169630997YP_001704646.1 putative oxidoreductase [Mycobacterium abscessus ATCC 19977]MTDSVLPDTPRVTGNPHVHSLEVVEIIRETGDAVSLVFEVPDALVDAFRY
RPGQFLTLKIPSEQTGSVARCYSLSSSPHLDDDLVVTVKRTDGGYASNWL
CDNVGVGDHITVLTPSGVFVPRSLDSDFLLIAAGSGITPMLSIAKSVLLG
GAGTVYLFYANRDAQSVIFGAEIDDIMVEFPDRLRVVHWLEAERGLPTRD
AMSELFAAYTRYSTYLCGPAPFMEEARAALSAVGMPANHIHLEHYQSLSG
DPFADIVIPQGGADAAQATVELDGTRVTVEWPRNTPLLDVLLARGIDAPY
SCREGACSACACTVRRGEVRMLRNDTLVDADLAMGLTLACQAVPVTDSVD
IAFDQ
169630996YP_001704645.1 hypothetical protein MAB_3917c [Mycobacterium abscessus ATCC 19977]MRILPILGAVASAVVAVMLAGVASADPDTPNPLDPSGLPNVNGLTPVSPL
EYSTLADTAYGFTIPGGISCLIKRADASYGCSGPLPGAPDGANLVSGSNA
PGFATTDRPIYGMGGEPFKPLPPGSRLSYREVSCGLDSGGTLTCVNNRWQ
NGFVVGPGGSYTT
169630995YP_001704644.1 hypothetical protein MAB_3916c [Mycobacterium abscessus ATCC 19977]MRVGYLLIAAVCGVVLAGCGRGEVPSETAAPESADATTTSAPAVTADPGV
QAACPKHGGRWDAGQGCVIDEATPQATQHLVVPVQWDSSFPELQQAVDGT
VADIRANFRKSVERAGAPPEGKPWALQVSFETYQGKGAHPSDSVRFSISE
SLGGYHPGFAFRTLAFDRTSRQAITLDTLLIDPATALPKISALVRTDLRA
QLGGVGAEFVDTGTVPEPGNFKDFSLDGDALLFSFEPYRVAAYAEGPMQS
RIALSELRDVVKPEYLPA
169630994YP_001704643.1 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase [MycobacteriumMAALREPQVVVLGGGSWGTTVASIVARRSPTLQWARSPETVADINERHRN
SRYLSDEVELTESLRATSDLHEAVEQADVVIMGVPSHSFREVLTEIGQSL
RPWVPIVSLVKGLEQGSRMRMSQIIEEVLPGHPAGILAGPNIAKEVARGY
AAAGVVAMPDQHQAARLGELFRTSRFRVYSTNDVVGVEMAGALKNVFAIA
SGMGYAIGIGENTRAMVIARALREMTKLGVAMGGNPETFPGLAGLGDLIV
TCTSSSSRNRHVGEEIGKGKTIDEIITSMNQVAEGVKASSVVMTLADEYG
IQMPIAREVDGVINQGSTVEQAYRGLMAETPGHEVHGTGF
169630993YP_001704642.1 oxidoreductase [Mycobacterium abscessus ATCC 19977]MLIDVTLTTGLNTMAAEAAEAEESGYAGIWTFEGAHDPFLPLLLAAEHTK
NVMLGTSIAVAFARNPMLLATIGWDLQAYSGGRFILGLGTQIKPHITRRF
DMPWSSPAARMRDMVLAVRAIWQSWQERGALDYRGDFYQNTLMTPMFMPD
PAEVSAFGPPPIWLAGVGTGMTEVAGEVADGFMSHPFCTPDYLAQVTRPA
LGRGALKSGKALADIQIHHSPMIIIGRDDAELASARAAVRKQLAFYGSTP
AYWPILELHGRAEMGPELKERSKQGEWEAMAALVDDDFVDTAAVTVTDPG
QGARELQERYGDLVHRLGFNTPYRPDRALLPELLAAFPTR
169630992YP_001704641.1 putative translocator [Mycobacterium abscessus ATCC 19977]MLPAVSPTHLIGFAVAAYALIVIPGPSVLFAVGRSLSLGRRSGLVTVLGN
TTGTVVPLVLTTAGLGAVLAASTWALTVVKLVGAAYLIYLGAQAIRNRKS
LVTALDAAAPAVGSQRVFRQGFVVGMTNPKTALFFAAVLPQFADPAVGSV
PMQMAVFGAIFVLIALVSDSVWAVLASTARNWFARSPKRLEAVGATGGWM
IVGLGAGVAVSSP
169630991YP_001704640.1 putative nucleotide-binding protein [Mycobacterium abscessus ATCC 1MADSSFDIVSKIDRQEVDNALNQAAKELATRFDFRGTDTTIAWKGDEAIE
LVSSTEERLKAAVDVFKEKLVRRDISMKAFDAGDPQPSGKTYRLTGTLKQ
GIDTENAKKINKIIRDEGPKGVKSQVQGDEIRVSSKKRDDLQAIIALLKG
SDLDIALQFVNYR
169630990YP_001704639.1 hypothetical protein MAB_3911 [Mycobacterium abscessus ATCC 19977]MEPINGLRRFEVQFNADGSFNTEDGGDGGLAAAVATGGITDLYVMAHGWN
NGMASARALYDAMFGLLAGQLGDRRATSAAVGIIWPSILFPDDDPATASA
QPASPTQVTAALAATMPDQKRTLDELGRQLEIQPQDPVELKKFVTLATGL
VTTAPQSEEDSGEAAILDSDAMKVLGHAATLAPRPTGNAQGSGNPFTRLW
SGARELLRTMSYYEMKNRAGVVGERGLGPLLGSLSGPDGPPRIHLIGHSF
GARLVSYALAGLPATGTSPVKSLTLIQGAFSHFAFAHSLPFDIDRHGGLS
GLEARVDGPLLATFTAADRAVGWWYPAASALARQDSQAAQELTFRWGAMG
HDGYQQDPAATTVMLKEAGKPYAFERGRFYALDANAVIAADESPFSGAHS
DIKHPEVTWAIAAAAQAA
169630989YP_001704638.1 Serine peptidase [Mycobacterium abscessus ATCC 19977]MSDPAPRGPKRPSVISPMVLAPAGTTEAKALATDAADHERRLVLIELRLD
GGMDPNEVRADFLRLFRRALGGVPPAPTPIAGHYVRCSLTADEVKLLVNG
GSKSGGTKSAQRALQLIYRVWPDLRVKPHLDKSVATIKADAALRTYGSGG
SGIVWGVLDSGIEASHPHFAKNGNLTGDAVSSLHKDFSLSQHPSTGPLVD
MQGHGTHVAGIIAGECPDPTNVVIASTQPTAEGFPEWIPRTLAPGSRLSG
VAPQAGLVSLKVLNDEGTTVESVLIDALHYVRERNSYGNELRIHGVNLSL
GCDWIPRYYAAGQSPLCRELDLLTDSGVVTVVSAGNMGAGTDTGGLSGGI
VGPQAGVYGQLSTITDPGNAASAITVGSTHRSRPHTSGVTYDSSKGPTLD
GRTKPDLVAPGERITSAAAGQMAEAFEMLTRGATGNEARYVEDSGTSMAA
AHVSGAIAAFLSARNEFIGEPERVKEIFRKAAIDLGRHEFFQGSGLVNLM
QALSDV
169630988YP_001704637.1 putative peroxidase [Mycobacterium abscessus ATCC 19977]MTEKAVPTRLASWFGTQIDRFIGWPRLPKMAGIAVLYTLRRALQSDNLFD
SGRGALDAPQHDPGVADHRAARTIDGTYNNLDDPLMGSVGSRFGRNAPLD
QTFPEPPDRLMEPNPRSVSRRLLTRDEFVPATTLNALAAAWIQFEVHDWF
SHGTTDSQPWDVPLESDDPWPQEQMRIRRTPPDPSADASGPPTYVSQDTH
WWDGSQLYGSNRVFADALRTGQGGRLRLDRLGLPPEDVEKIASQSETAAN
FWVGLAILHSLFMREHNTICDHLGTAHPDMSDQQLYDTARLVNTAVMAKI
HTVDWTPAIIGHPTTVYAMHANWFGLFGERVAEFLRRGTRNALICGIPGS
PTNLHDVPYSLTEEFVAVYRMHPLIPDDFVFRSATDDSVIAEHTLPGLAM
QHVRTRFREMSIEDLAYSFGRAHPGALTLHNYPRHLQILERPDGSVLDLA
SIDVLRVRERGVPRYNDFRRMLRLRPASDFNDLTDNPVWARELAAVYGDV
ERVDLMVGLYAEPKPKGFGFSDTAFRIFVLMATRRLEADRFFTTDFRPEV
YTPEGFAWVRSNSMRTVLLRHCPSLAPALDGVTNPFAPWRPVRTSNRSAR
169630987YP_001704636.1 hypothetical protein MAB_3908c [Mycobacterium abscessus ATCC 19977]MSESGELLDAQRSYLRYRDDMAVAPPGEEEVIDRIIRVLHKNNERAYQKY
RHGVRDAHAKSHAVLRGELTVYPDLEPELRQGMFATPGTYPVVVRLSSTS
GALRSDKVRGVRGLGIKVLGVDGPRTLPDDDATTQDFVMVTHREFLFADA
REYLRKGMPTAWLIARLSDTALAGGARVLGAIAKCLSRIGISIPETVTVF
VRPNVHILGDTFYSSAPLRFGDYVAKLQYVPLSPSVAELKDKPLSDDVDD
DVFRHMIAEFFRTHSAEYELQAQLCTDVKKMPLEDATVAWPEELSPHRPI
AKITFPVQDSYSAQRRAYGDDVLSYNSWRALEAHRPLGSINRLKLRVYEA
SSNFRHDKNMVPRVEPARAEEIPD
169630986YP_001704635.1 LuxR transcriptional regulator [Mycobacterium abscessus ATCC 19977]MTTTTGTIDGRGQAPRLSPAKVHPDLHSYPMARSWQLLDRQTEFGAVRSA
MADDSTCGAVLVGAAGVGKTTLARAVTKSLDADVRWVACTESSRSIPLGV
FAHWIQASGSRDPTALIAAARESIVSTANPIIGIDDAHLLDDLSATLLHQ
IAVDHVGHVVATVRSGEPVPDAVTALWKDNYLQRFELDPLTQRQSIALVE
KVLGGPLEGLSADVMWRSSRGNPLFLRHLVEGSMQAGSLTEVNGVWQLRG
DAVVPSGLDTLIGDRLEHVDDTVFSALKVLSMCEPLDIDTLCEIASDEAV
DAAEIADLIRVERDGVRTVVRFSHPMFGEAVRRRVGTASGRRLRGKLVRV
LRDRDLGTASNRIRLARLSIDCDEPVDVDLLVTAAKDAVYLSNLPLGEEL
ARAAVDGGGGLQAAAMLSRSLLWQGRPEQAEEILAAFDPDDLDELSLVLW
GIPRISIAFWSMGENERAHELLALLHERVRHHILKPVVDATDAAIALHEN
RFDEGLARAHAVLSDPVAPKQAVEFAAFGVGLTLPVAGRGHEFEPIAQRC
RDDKKRTTDGLIAAMVRYCDVLALTYTGQLDLAEERVAEYTKFSSAGQFL
AWAIARIMAGVVATQRGLFREAIEAFEQALAAQRADRPLPWQLPARLLLA
RAYAALGRAVDGERVLDEAREHSGPHVAIHMPQMMLAKAWLVAARGSDRG
AVDAARRAADAAHSAGQYALEAEALHHAARFGDRTVGRRIESLCTRVHGP
LTGLYARHALAVAHSDITGLEAVSADFEAAGLLLSAADAAAQAVALRMRA
GDRGKGSDAAARVLRMADRCGGVVTPAILAAAKPLPISSREREIAVLIGE
GLSDKDIATRLQLSVRTVEGHIYRARMKLDADDREEFAKIVGSDLKPPEA
S
169630985YP_001704634.1 hypothetical protein MAB_3906c [Mycobacterium abscessus ATCC 19977]MPTQRVLVTVMERHFDATVTAMRAAGMTNIREYEELGVVAGEIVNPDALV
GIPGVMGVESARPMPAPRTVRRSDGGR
169630984YP_001704633.1 hypothetical protein MAB_3905 [Mycobacterium abscessus ATCC 19977]MTIQTPAGNAGPEIDLILLVEAGPARDLREQPSGRNSATPIAQAVASAGH
RIVPLYTNPDRVPPELRSIFVVTAPASPEFSDFAERLRTLPGVTSAYLDS
AA
169630983YP_001704632.1 hypothetical protein MAB_3904 [Mycobacterium abscessus ATCC 19977]MNEIRTPGPAVLVGIDGSRSAVRAALWAVDEALHRELPLRLVHVTPQTEF
PEFSDERSPAGTAVRHAFRQIGATHKPVKVEAEIRHGRVADVLLDASRSA
VMLCVGAIGISGADTRKVGSTAAEVLRSVRCPVAVIRDDPSSLRGTSAVV
VEIDESHESVTPLELAAHEARLRAAPLRVLLRHRPISLSGQRVATLTRVD
RRVAAVHVERRLAPLRVRYPDLDIRALDPVGGTLDYLERHGHTVQLVVVG
AGDAAHVQELVGPNGCGVLGRTHCSVLIAERQRLL
169630982YP_001704631.1 hypothetical protein MAB_3903 [Mycobacterium abscessus ATCC 19977]MPKTMVHIDVIQTAIQLACRAPSLHNTQPWRWIVDLGASAGDLHLYLDRT
RCVTRTDGAGREAIISCGAALDHFRVAMASAGWMTRIERIPDPDNPDHLA
AITFSPRTVVVVGDRRRADAILQRRTDRLPFETPPNWSQFARMLNTVIAD
RAVLLDVIDDVMRPKLADASALSDALRIYDSAYQTELDWWTAPFTLEDGV
PRSALVSAADSDRVDIGRTFPVVAERASRPGLQEDQAKVLALSTARDTPK
NLLRCGELLSEVLLEATLAGMATCTITHMLELTASREVVGAAIGRSHPQA
LIRVGLAPTFGRIPPPTPRRSLADVFEIRS
169630981YP_001704630.1 hypothetical protein MAB_3902c [Mycobacterium abscessus ATCC 19977]MTGCPQLPPRNDEVMRSLRSTLSPTSVGAEIRETHTGIVILVGGMAYKIK
KPVITNFLDFSTPELRERACAREVALNSRISQDSYLGVSHLTDPDGGSGE
PVVVMRRYPDAARLSAMAKSKRVTKAHLDAIAEVLAGFHKRADRSPSIDE
AGSLDAIVDRWDDTLTALEKYAGTVLAADDVRLVRTLATQFISGRAVLFA
QRVADGRIIDGHGDLLASDIFCLPNGPVLLDCLEFDDRLRHVDGLDDAAF
LAMDLEFLGRPDLGDYFMNRYVELSADTAPEPLRHFYIAYRALVRAKVDC
IRFTQGQRSAAGRAAKHVAMALSHLGAATVRLVLVGGGPGAGKSTLARRI
SEDIGAQVISTDEVRQQLHRLGVISGGKGVLDAGLYSTENVGAVYDAVLR
RARLALAGGHTVILDGTWRSPRHRLRAHQLAYEAGAPMVEFLCLAPLVTA
QHRVAARHDGVSDATGDIAAALGAEFAGPDRGWGEAHVIDTRLPLDRSTA
EAEELCRQALYAPVPCHPR
169630980YP_001704629.1 peptidase C56 PfpI [Mycobacterium abscessus ATCC 19977]MSDSLEGQVVAILAADGVERVELEKPREAIPAAGGRVEVLSPRPGEIQAR
DHDLVPAGTVRVDRAVGTASVDDYAGLILPGGTVNPDKLRIDPGAVRFVH
EFVVSGKPVAAICHGPWTLVEARVLAGRTVTSFPSIRTDLRNAGASVLDE
EVVIDHNLITSRSPDDLPAFCQALVDNLAAARIQR
169630979YP_001704628.1 hypothetical protein MAB_3900c [Mycobacterium abscessus ATCC 19977]MTEFTIPGLTDTQSRKIADLLQSQLSTYNDLHLTLKHVHWNVVGPNFIGV
HEMLDPQVELVRGYADAVAERIAALGRSPQGTPGAILKDRTWDDYSVGRD
TVQAHLAALDLVYSGVIGDTRKAIEQLDELDLVSQDLLIGHSGELEKFQW
FVRAHLENSGGQLSNRDALTEKGAAARAKKKSPVK
169630978YP_001704627.1 50S ribosomal protein L33 [Mycobacterium abscessus ATCC 19977]MASSTDVRPKITLACETCKHRNYITKKNRRNDPDRLEIKKFCPNCGSHQP
HKESR
169630977YP_001704626.1 (3R)-hydroxyacyl-ACP dehydratase subunit HadA [Mycobacterium abscesMALSQDLVGTHYRYPDHYVVGREKIREHAEAVKCHHPAHHDEAGAAELGH
SALVAPPTFLAVFGYTAQSAFFEDANIGIKDEKIVQVDQAFKYIRPVRSG
DTLYCDVYVDSIRRSFGTDIIVIKNIITNDKGEFVTESYTTLAGRAEDDG
EEGGFN
169630976YP_001704625.1 (3R)-hydroxyacyl-ACP dehydratase subunit HadB [Mycobacterium abscesMALREFSSVNVGDQLPEKTIQLTRQDLVNYAGVSGDLNPIHWDDETAKLV
GLEDGAIAHGMLTMGLGGGYLTEWIGDPAAVTEYNVRFTSFVTVPNDGVG
AEIVFSGRVKSVDADAKSVTIALTATTNGKKIFGRAVASATLA
169630975YP_001704624.1 hypothetical protein MAB_3896c [Mycobacterium abscessus ATCC 19977]MALSLDVVGMTHKYSQTYVVGREKIREFAKSIKCESPASHDVAAATALGH
DGLVASLTFPAVMALLVQKEFFRTYDVGMETMQIVQTDQKFVYHRPLKEG
DELSCDFEVESHKESFGVDIVTTRNVVRDQTGEVVLEAFTTLMGRDSDRM
ADIKLI
169630974YP_001704623.1 preprotein translocase subunit SecE [Mycobacterium abscessus ATCC 1MSDELDEPDIGTADSDRAVTSTKPLRPTGKRTRRADATEAVTEGSEASAS
ETGEVKKKAGKKSRKPANKKDKSGPSRNPLVQLWVFLQQVVAELRKVIWP
NRKQMVSYTSVVLVFLVFMVTLIGVIDLGLARLVMLVFG
169630973YP_001704622.1 transcription antitermination protein NusG [Mycobacterium abscessusMTTFDGDAASEPEDTADTAASVDVIDESDTDVAPEPTESSSEESGAEVEA
DEDADPAATLKAQLRREPGEWYVIHSYAGYENKVKANLQTRVQNLDVGDY
IFQIEVPTEEVTEIKNGQRKQVNRKVLPGYILVRMELNDESWGAVRNTPG
VTGFVGATSRPSPLSLDDVVKFLLPQAPAKKPAKGAASADAATASSSEPG
GLERPVIEVDFEVGESVTVTDGPFATLPASISEVNAEQQRLKVLVSIFGR
ETPVELNFTQVEKL
169630972YP_001704621.1 50S ribosomal protein L11 [Mycobacterium abscessus ATCC 19977]MAPKKKVVGLIKLQIKAGEANPAPPVGPALGQHGVNIMEFCKAYNAATES
QRGNVIPVEISVYEDRSFTFALKTPPAAKLLLKAAGVPKGSGEPHKTKVA
KVSWDQVREIAETKKEDLNANDIDAAAKIIAGTARSMGITVE
169630971YP_001704620.1 50S ribosomal protein L1 [Mycobacterium abscessus ATCC 19977]MSKNSKAYREAAEKVDREKLYTPLEATKLAKETSSKKYDATVEVAMRLGV
DPRKADQMVRGTVNLPHGTGKTARVIVFAVGDKAEAAAAAGADVVGSDDL
IERIQGGWVDFDAAIATPDQMAKVGRIARVLGPRGLMPNPKTGTVTPDVA
KAVTDIKGGKINFRVDKHSNLHLIIGKASFDAEKLTENYGAVLDEILRAK
PSSAKGRYLKKVVVSTTTGPGIQVDPGVTRNFLEA
169630970YP_001704619.1 LuxR family transcriptional regulator [Mycobacterium abscessus ATCCMITVFLVDDHEVVRRGLADLLEEEADFSVIGQASSVAEAMARIPALQPDI
AVLDIRLPDGNGVELCRELRSKLPNLNCLMLTSFTDEHAMLDAIMAGAGG
YVIKDIKGMELISAVRTVGAGRSLLDNRAAAALMNRLRAAADNPSPLAGL
TAQERTLLELIGEGLTNRQIAERMFLAEKTVKNYVSRLLTKLDLERRTQV
AVLATKLARENQGLHG
169630969YP_001704618.1 histidine kinase response regulator [Mycobacterium abscessus ATCC 1MVEDVGAQPNRVTAELAHLQLRELLAEVQGRIEQIVDGTRGRMDALLDAV
MAVSSGLELDATLREIVCAASELVSARYGALGVVGSDEKLAEFVYEGIDE
ATRDLIGPLPTGHGVLGVVIDEAKPLRLRDIAAHPASVGFPANHPPMRTF
LGVPVQVRGEVFGRLYLTEKLDGQEFTEDDEVVVRALAGAAGIAIENARL
YQHARRREQWQRATADITAELLGGVDPGKALHLVASSAALLAEADFAFIA
LPAGDEEDTAELVVAVCEGKGAEVLNDKLIPIDGSTSGSTFIDHEPRNVG
RLAVNLAEGTDLAFGPALVLPLGGGESTAGVLILLRTVGAIAFDEEQLDM
AASFAGQAALALEQAEVRLAKHELDVLADRDRIARDLHDHVIQRLFAVGL
AMQSTHRRSVDPTVAARLADHIDQLHEVIQEIRTAIFDLHTNDESLRATL
RSTINELTAETGLRVSVRMSGPLDVVPASTSGDAEAVVREAVSNVVRHAR
ARELSVTVSVDDELVIEVVDDGIGIPDVVARSGLSGLANRAAQSGGTFSV
SAMDTGGTRLVWSAPLP
169630968YP_001704617.1 putative triacylglycerol lipase [Mycobacterium abscessus ATCC 19977MIKRGLALAAVTALTVAGLNSSQVVAGYGDVTQISATPRTVTARFSLTVN
SGVLAISPDGNTTIYENPGNALSVTADPAGLATAGAISHNAATSAAQALS
TTSAVSGVAPSAPGPTLVVVDPQRRTDTSPTPSAGTAQAAGSARYLPVIL
VHGTWGSTAREFAPTLLPALAAAGIQAFTYDYGRIPWLPINLVEPYDAGG
EVPVQQSTQRLSEEITRVLNVTGAPQVNLVGASQGGLVIKNYLAQVTGDS
VANVVDINATNHGTTLGGIAKLIDPAIVDEAFAPIHTVITSATQSAKDLL
GRAGPLQVLQSPVALVGSAAHLAVDVAQAAVRVVVTAIQRVVRVGLSLAM
GPAGVQQAVGSDFLNRLNKTPDTRPGVNYLVLGSKNDTTATPYESTFLKA
GPGSAVFNVEEHSLPGAKPTDVIKHVDTPQPVVDAIVRFLISADTNPHID
SKIDRSRGVTATQDSGNTTIRSGENNVLYQGTSSNGAAIKQAIGQAIDTT
ATSGSTTSMPTKPTALASTPETDRTLAPAKASSSLNVLVAAAPTIPTPQS
AAAEATAASASPVNSNHDAEKTTKTAVGQITDAGTNSAASSNRATAQTQT
ATTSDTSPNTQAKQRTNLGAISSGGHSPTAPESKESAATITSNATSGTSV
TKSDKTSQVNAKGSPAVAEPKTSVAKADMHHTDTAASKPDNTTHRTKGAS
TSAEHSSSGESSRAGQSSAGSAHERTARHSKAARSSE
169630967YP_001704616.1 putative RNA polymerase sigma-70 factor [Mycobacterium abscessus ATMIELEGVFRREWGPTVAAIARWSGDLTVAEDAVQEACADALRTWPRDGIP
DTPGGWLLTAARNRARDRLRRETLRPGKELAAVVDDITARTDVADPHPVR
DDELRMMFTCAHPALERTSQLALTLRLVSGLTVAEIARALLHSEAAIGQR
ITRAKAKIRTANIPLRVPPAELLPERTPHVLSCIYSVFTEGYWSTGGPSA
IRDELCDEGVRLAGELCRLMPQEREANALAALVLLHDSRRLERMDSAGAL
VPLEEQDRTRWDHGRISRGLSQLRLAAGSTGPYLPQAVIAALHATAASWE
ETDWHAICLAYDRLLTMTDSPVVLVNRALAIGLRDAPEAGLAALEKVAHD
PRLARSNLAATVRADLLRRAGRYDEAIDWYRTALSANGSDPGRDFLRRRI
AECLNNSG
169630966YP_001704615.1 hypothetical protein MAB_3887 [Mycobacterium abscessus ATCC 19977]MYYLALLIGPQQERTPDEAAQELTDYLNFQAKAASSIRAGDALYPEADSV
RVTGGPDAPVITDGPFAEGAEVANGYYVLEADNLDDALALARDIPEAKRG
AVEVWPLVDCSREFGGKGSTSWLALLLEPADRAYVPGSPEWEAVAARHGV
FGEKASGHIKIAGPLHPPSTATTIRVRDGEAVLTDGPYIEGTEIANGFYV
ITTDDRDSAIRLASQIPASAVQLRQLTGVSGF
169630965YP_001704614.1 hypothetical protein MAB_3886c [Mycobacterium abscessus ATCC 19977]MARRDGDSWEITESVGTTALGVASARDAETRSPNPLISDPYAGHFLAAAG
DGAWNAYRFDGEPPAALVEAEPRLVERIDAMRSYVACRTKFFDDFFGDAS
TSGIRQAVILASGLDARAWRLDWPRDAVLFELDLPRVLAFKAETLDKQGA
TPRIRHVPVAVDLRDDWPAALRAGGFDVGRPAAWIAEGLLPYLPPAAQDL
LFERIDTLSAPGSRIAVENFGEDFFNPETLARQRERGQAFRRVAEEMQGQ
DIPDVADLWYLEERTDAGEFLAGRGWRVTSETAVALLGRHGRDIPADLPD
ATPNSAFLFAQKAD
169630964YP_001704613.1 hypothetical protein MAB_3885 [Mycobacterium abscessus ATCC 19977]MTHLTVLTNPTAGHGAAQAAEAAIAHLRARGLTVTHHAATSAAESHALAQ
EAARTGARGIVAAGGDGLVSIALQAVAATPVALGVIPIGTGNDCARMLDI
PLSDPVAAAEVIAAGRIRVIDAGRIQYHGDTTWFATVVASGFDSLVNDRA
NRMRWPRGRRRYDIAMALEAAKLRPLPFRIELDDQVIDTDVTLVAVGNGT
SYGGGMRICPGAILDDGLLDITVVAAGGRLRLLRLSPTVYKGTHVDLPEV
STFRSRRVRLSAADITAYADGDPVAPLPVDIDVVPGALSVFA
169630963YP_001704612.1 flavoprotein [Mycobacterium abscessus ATCC 19977]MMEWDAWGVAEKRQTLSPQVKALLASALGIPEREPVHRDESHVTLTPNSL
TDAQRAALGGLLGAEHVSTDHGARLRHSGGKSTPDLLRRRSTGVQNAPDA
IVYPASHDEVSALLTLCEEQGIAVVPFGGGTSVVGGLDPERGAFGAVIAI
DLRRMSGLLSLDEVSGTAVLLPGTTGPEAEELLGAQGFSLGHFPQSFRFA
SIGGFAATRSSGQASSGYGRFDAMVDAVRIATPRGDLNLGRAPASAAGPD
LRQLFLGSEGALGIITEVTLRVHRLPEETWYQGWSFPSFEAGAQALRTLV
QSDAAPTVLRLSDEAESGLNLALAKDIGGKNPAAGVLAITTVEGTHGHVA
ARSAEVAAVLSAAGGTALGDEPAKAWDHGRFDAPYLRDALIDAGAVVETL
ETATSWQNLANLRTAVTTALAETLGAQGTPPLVLCHISHTYRTGASLYFT
VVCAAAEDALTQWGRAKQAAGDAIVAAGGTITHHHAVGRDHQPWLADEVG
ELGIEILQAVKRTVDPRGILNPGKLIPVQG
169630962YP_001704611.1 TetR family transcriptional regulator [Mycobacterium abscessus ATCCMAPLVDAGGGVTVQAMDAQASADPVTERILDAALSCVTEFGVRRTTLVEV
AKRAGVSRPSVYRRWPDVRTLVAELLTREMGSILPATGRGCARERLVRSV
TGLVTQVREHSIFAAILRSDPELLLTYIVQRLGTSQRALIGWTAMLIVEG
QADGSIRAGIPEQMAAMVLLIGQSVLQSARIVADILSPDELVDELATAID
GYLKA
169630961YP_001704610.1 glycerol-3-phosphate dehydrogenase 1 GlpD1 [Mycobacterium abscessusMTTQLNSTRRSADLDALSGGAPIDVLVIGGGITGVGVALDAASRGLRVTL
VEKHDLAFGTSRFSSKLVHGGLRYLASGQVGVARESAVERHILMTRTAPH
LIHPLAQVVPLHPAVSMFSRTLVRVGFIAGDGLRKLAHTSAEVLPRSRAI
NAGEVIRRAPTVRRNGLRGGLMAFDGQLVDDARLVVSIARTAAGLGARIL
TRVAAEQVTGDGAVLRDRLTGNAIRVRAGLVINAAGVWAGQVDREIKLRP
SRGTHLVFRAASFGGLSAALTVPVPGTINRFVFALPAIHDRVYLGLTDEP
APGPVPDVAEPSAAEERFLLDTANTVLQTSLSETDVVGRFAGLRPLLDGD
DSATADLSRKHAVRVSESGVVSVVGGKLTTYRKMAQDALDAGLQRRPLAA
SECVTQNLAVVDDWPGAAGAGLVEGVDITREQVEFALTHEGALDADDILD
RRTRIGLVPVDKNQAIGAVQRLVDSYFSQVN
169630960YP_001704609.1 cyclopropane-fatty-acyl-phospholipid synthase 1 [Mycobacterium abscMSKLTPKFSDVQAHYDLSDDFFALFLDPSRTYSCAYFEPETLTLEQAQQA
KIDLALGKLNLEPGMTLLDVGCGWGSTMKRALEHYDVNVIGLTLSKNQFA
YVNTLLDSAGSSRNYEVRLAGWEEFEGTVDRIVSIGAFEHFGHERYDSFF
AMAHRVLPSDGKMLLHTIVSHHPDEWKRMGIPLLMSRVRFIYFIGTEIFP
GGRLPSVPMVDKHAALAGFHITRHHSLQPHYARTLDCWATNLAAHEDEAI
SVQSQEVYDRYIKYLTGCAEGFREGWIDVVQFTCEK
169630959YP_001704608.1 lipase/esterase LipG [Mycobacterium abscessus ATCC 19977]MSTTAREISEMTASTATVGDIELCYEEFGNPADPAVLLIMGIGAQMVFWR
PEFCQQLADQGYRVIRFDNRDCGLSTKLDGVRAGGGSLIPSMAKFLAGVK
ITGTAYTLVDMAGDAAGLLDHLGIEQAHIVGASMGGMIAQVFAAEHPDRT
ATVSIIMSSNNQPFLPPPGPRQLMALLKPPPEGASREQIIANSVQVGRII
GSPKYRQSQSKSYLHAAEYYDRSYYPKGFSRQFAAIMGTGSLAPFDNRIT
APALVLHGKADKLMRPSGARAIARAIPGSRLALIDGMGHDLPEPLWNHII
TKLTENFARSEPAAETPESEAAGR
169630958YP_001704607.1 hypothetical protein MAB_3879 [Mycobacterium abscessus ATCC 19977]MTAQERSGRSAGEGRGAAGPAASSRGRQVAPLGRVALLSEAARLGTTGWQ
VARTAGRVLGKLTKKGSLEQKFIAELPQTFSDLGPTYVKLGQIIASSPGA
FGEPLSREFRGLLDRVPPADPAAVRELIIAELGSEPEKLFASFDTEPFAS
ASIAQVHYATLHSGEEVVVKIQRPGIRKRVAADLQIMKRGAALLELGKVG
RMLSARDVVDDFSGNLSEELDFLAEGQAMQTWVEHLHTSSLGKNIRVPDV
HWHYTTSKVLTMERVHGIRIDDAPAIRKAGFDGTELVKSLLFSVFESGLR
QGLFHGDLHAGNLLVDDEGRIVFLDFGIVGFIDPRTRWLLRELIHALLVK
KDHRAAGKIVVMLGAVGNPGDAEQGTQDIQAFATPLTMKSLGDMSYSEIG
KQLSTLAEQYDVKLPRELVLIGKQFLYVERYMKLLAPRWQMMDDPELKGY
FGNFIVDISREHNREGDI
169630957YP_001704606.1 lipase/esterase LipG [Mycobacterium abscessus ATCC 19977]MVPLSSEVPTRSGIARNGDVELFYEDLGNPGDPAVVLVMGVAAQLPMWPD
GFCRQLLDQGYRVIRFDNRDCGLSTKLDGQKAPGSVQRRVVRYALGMGSK
VPYTLIDMAEDVRSLVDHLGLEKVHIAGASMGGMIVQVFAGTYPERVHSV
GIIYSATGRPFSRLPSWELIKTALNAPGKNATAEEWLEFEVNNGIVYNGP
DNLPSREQLRQRILDHRARSDYKIGTVRQFDAILGTGSLLRFTRAVVAPA
VVIHGRNDPLVPYQNGRVVAKNMRNARFALIERMGHDLPEPVWKPVTSEL
LTTFECAVQD
169630956YP_001704605.1 50S ribosomal protein L10 [Mycobacterium abscessus ATCC 19977]MAKTDKVTAVAEITEQFKDSTATVITEYRGLSVSALATLRRSLGASATYA
VAKNTLVKRAAADAGVEGLDELFAGPTAIAFIKGEPVDAAKAIKTFAKDN
KALIIKGGYMDGRALSVAEVERIADLESREVLLAKLAGAMKGNLNKAAGL
FAAPASQVARLAAALQEKKAGEESAA
169630955YP_001704604.1 50S ribosomal protein L7/L12 [Mycobacterium abscessus ATCC 19977]MAKLSTEELLDAFAELTLLELSEFVKAFEEKFEVTAAAPVAVAAVGGAAP
AAADAAEEQSEFDVILESAGDKKIGVIKVVREIVSGLGLKEAKDLVDGAP
KPLLEKVAKEAADDAKAKLEAAGATVTVK
169630954YP_001704603.1 TetR family transcriptional regulator [Mycobacterium abscessus ATCCMNVLPLCEHGKTMSSSARRNSEGTDRAVVRNPRVDLVSAAVRLLNEQGPD
ALQTRKIAAAAGTSTMAVYTYFGGMRELIAEVAEAGLRQFAEAQAAVEQS
DDVIADFMLTGMAYRQFAIDYPHMYRLMFGVTSAHGVNAPRRNMFDTSHV
TPEHPSAAYLFRCVQRAMAAGRIDGSPEDAAKVAATAAKFWTVMHGFVML
ELAGFWGEDGAAVGPVLASMTTDLLVALGDTPERLNSSAAAAAARLAPSA
169630953YP_001704602.1 putative dioxygenase [Mycobacterium abscessus ATCC 19977]MTATAQPAASTSPYLSGIWEPVQQEMDSVDLEVTGTLPAHLDGRYLRNGP
NPAAEVDPATYHLFSGDAMVHGLSLREGKAQWYRNRWVRTPSVSKTLGET
RPAAISANAGMGVIGPNTNVLGHAGRTLALVEGGIANYELTEDLDTIGTC
DFDGTLPGGYTAHPHTDPDTGEMHAVSYSFARGSTVQYSVIDAHGRARRT
VDIPVHGAPMMHDFTLTEKYVVFYDLPVTLDMSMISQSVPVPRLLRKPAQ
IVMNSLIGKVKIPGPIAAKASQYSGKSPSIPYSWNPKYPARIGVMPREGD
DASRHAPVRWFEIDPCYVFHPLNGYSEMRNGAEVIVIDLVRYDSMFSQDV
LGPSDAKGQLDRWTIDLAKGTVHMERKDDRHLEFPRINETFTGKKHRYGY
LPDVENFFGSGEAAGASIVKYDYETGSTLSSRLDPAIVLGEMSFVPNPTC
AAEDDGVLIGFAVDRRSDEGQLLLLDATSLDLMATVHLPQRVPAGFHGNW
APR
169630952YP_001704601.1 hypothetical protein MAB_3873c [Mycobacterium abscessus ATCC 19977]MEITSAISAILGAFGLSGAAGLNAWLPLLAVGAADRLGWIELGPSYGWLS
STPALVVLAVVFVLDLIGDKVPALDSVLHAIGAFIAPASGAVLFTAETSL
SSNLPPAVAAILGAITAGGVHASRTVARPFVTGTTAGVGNPVVSTAEDGT
SLVLTILALAVPILAFLVVLVLLAGLGWLTYRAIRWARGRRESDATDG
169630951YP_001704600.1 drug-transport integral membrane protein [Mycobacterium abscessus AMNLAVRHVVIACTALFVARLTMLDHGLAAVWGVDRGEDALGTIEWATVAG
DIVAVVTLLVFARLGNHFRPTTFLATGLVILGLSTAGSLIPGSATLLAWV
MLVSALGAGLTMVASMLIVLHSTPRQGRGFSLGFWVAMYPLAMLAGQILD
INSPQNWRSITYGILAATVVVLVVVLTQPHREFVGTFDTFDLVGALLWLV
GVSALAWLLVDDSSPARAVILGIIALSAFGGLFAQTRRRGSAALIAIDVL
TRPVVLAALLAITVLTFLVRFADFDHAAMWWSIDRELAPSDAPPVALFAA
GLVFAPLAGYLIDAGKRTLIAVLGTVLLVAGVAATVIELHAASTESGLIL
GLLLSGAGISTLAVYLFYAVFHGVSPVQLTVVGGLAVTASALGVVLGEFV
RQRAEIDLLTGYGLGHPSVFADIVGLIVVLVALLAGALLIVERRRGSSAA
ATPAESTSD
169630950YP_001704599.1 ribonucleotide ABC transporter ATP-binding protein [Mycobacterium aMLRKERLVGAEVSVEGLTKSFGSQRIWENVTLSLPPGEVSVLLGPSGTGK
SVFLKSLIGLLRPEQGAIYIDGTNIMECSSKELYEIRKLFGVMFQDGALF
GSMNLYDNTAFPLREHTKKKESEIRDIVMQKLDVVGLTGHETKFPGEISG
GMRKRAGLARSLVLDPQIILCDEPDSGLDPVRTAYLSQLLIDINAQIDAT
ILIVTHNINIARTVPDNMGMLYRRNLVMFGPREVLLTSDEPVIKQFLNGR
RIGPIGMSEEKDEATMAEEQAHLDAGHHDGGVEEIEGVPPQIQATPGMPE
RKAVGRRQARVREIMHQLPPNAQAAIQDSFAGTHQYRVHDFGDEPTGVTT
ATLAPPQAEQPTQSIDTSDDDTPTGQIPPVRG
169630949YP_001704598.1 molybdopterin oxidoreductase [Mycobacterium abscessus ATCC 19977]MVATVEGGKLLSLRPDKDNPASSGFSCQKGIAFADVHNDPDRLTTPMRRT
VSGEFEPVEWDTAMADIAERVRAIHRMHGSGAIGWYFGNPGAFSYSHVLW
LLLLSMGFGSRLHLFTAGSQDINSRFVASQLLYGNSATMPVPDIPRTDLL
VVIGANPVVSHGSGVTMPRIREHMKAVVKRGGRVLVIDPRKTETAADFEW
LGIAPDGDAFLLLSLLQVMFTENLVDRALVAQHARGVAWLEGLVRPFTPE
STQAQTGVDPGVVRQLARDLAGADRAVVYGRVGTCLGQNGTLTTYLLDVV
NLVAGHLGRVGGSMFGSFGIPGERFAMKAVGALLGAVYRRRRSRVGGFPS
VLGSEPAGIMAKEITTPGRGQIRALFVGAGNPVLSVPNGDELEAACEQLD
LMVGIDLYLNETLAHCHYVLPATTMYERDDFMIPFATLRPAPYRQATEAV
VAPAGQARQEWQIIEDLTSRLWNLTPGLRFIEGLRRTVALFGARLQPRLL
ADALIRMSAGGDLFRLRRQGLTFDRLTRDYPHGKVLAEHLPEVPLSRSVS
YLDGRMRLEHKDIESEVASLAAREHDPRFPMRLIGMREARSENSWMHNVP
MLMRGGRVQRALIHAYDADQLGVTTDDLLAITSPHGEIELPAQVSKDILP
GVVAVPHGWGHRRRAGWSTANANPGANVNLLMSSRPEDLEALAGMAHLNG
VPVRVQRA
169630948YP_001704597.1 DNA-directed RNA polymerase subunit beta [Mycobacterium abscessus AMRGNTGGPILAVSRQTKTDNATTNSVPGAPSRLSFAKLREPLAVPGLLDV
QTESFEWLVGSPRWREVATARGEVNPTGGLEEILTELSPIEDFSGSMSLS
FSDPRFDEVKAPVDECKDKDMTYAAPLFVTAEFINNNTGEIKSQTVFMGD
FPMMTDMGTFIINGTERVVVSQLVRSPGVYFDESIDKSTEKTLHSVKVIP
GRGAWLEFDVDKRDTVGVRIDRKRRQPVTVLLKALGWTNEQIVERFGFSE
IMMGTLEKDNIAGPDEALLDIYRKLRPGEPPTKESAQALLENLFFKEKRY
DLARVGRYKVNKKLGLGGTNPAQVTTTTLTEEDVVATIEYLVRLHEGQTT
MTAPGGVEVPVDVDDIDHFGNRRLRTVGELIQNQIRVGLSRMERVVRERM
TTQDVEAITPQTLINIRPVVAAIKEFFGTSQLSQFMDQNNPLSGLTHKRR
LSALGPGGLTRDRAGLEVRDVHPSHYGRMCPIETPEGPNIGLIGSLSVYA
RVNPFGFIETPYRKVSDGVVTDDIHYLTADEEDRHVVAQANSPVDANGRF
TEEKILVRRKGGEVEFVSATEVDYMDVSPRQMVSVATAMIPFLEHDDANR
ALMGANMQRQAVPLVRSEAPLVGTGMELRAAIDAGDVVVAEKAGVIEEVS
ADYVTVMADDGTRQSYRLRKFARSNHGTCANQKPIVDEGQRVEAGQVIAD
GPCTENGEMALGKNLLVAVMPWEGHNYEDAIILSNRLVEEDVLTSIHIEE
HEIDARDTKLGAEEITRDIPNVSDEVLADLDERGIVRIGAEVRDGDILVG
KVTPKGETELTPEERLLRAIFGEKAREVRDTSLKVPHGESGKVIGIRVFS
RDDDDDLPAGVNELVRVYVAQKRKISDGDKLAGRHGNKGVIGKILPVEDM
PFLPDGTPVDIILNTHGVPRRMNIGQILETHLGWIAKTGWNIEGEPEWAA
NLPADLTSAPADTRTATPVFDGAREEELTGLLSSTLPNRDGEVMVDGDGK
ARLFDGRSGEPFPYPVTVGYMYILKLHHLVDDKIHARSTGPYSMITQQPL
GGKAQFGGQRFGEMECWAMQAYGAAYTLQELLTIKSDDTVGRVKVYEAIV
KGENIPEPGIPESFKVLLKELQSLCLNVEVLSKDGAAIEMRDGDDEDLER
AAANLGINLSRNESASIEDFA
169630947YP_001704596.1 DNA-directed RNA polymerase subunit beta' [Mycobacterium abscessus MLDVNFFDELRIGLASADDIRNWSFGEVKKPETINYRTLKPEKDGLFCEK
IFGPTRDWECYCGKYKRVRFKGIICERCGVEVTRAKVRRERMGHIELAAP
VTHIWYFKGVPSRLGYLLDLAPKDLEKIIYFAAYVITAVDDELRHNELST
LEAEMEVEKKAVADQRDADLEARAQKLEADLAELEAEGAKSDVRRKVRDG
GEREMRQLRDRSQRELDRLDEIWTTFTKLAPKQLIVDEVLYRELVDRYGE
YFTGAMGAEAVQKLIQNFDLDAEAENLRETIRSGKGQKKLRALKRLKVVA
AFQNSTNSPGGMVLDAVPVIPPELRPMVQLDGGRFATSDLNDLYRRVINR
NNRLKRLIDLGAPEIIVNNEKRMLQESVDALFDNGRRGRPVTGPGNRPLK
SLSDLLKGKQGRFRQNLLGKRVDYSGRSVIVVGPQLKLHQCGLPKLMALE
LFKPFVMKRLVDLNHAQNIKSAKRMVERQRAQVWDVLEEVIAEHPVLLNR
APTLHRLGIQAFEPQLVEGKAIQLHPLVCEAFNADFDGDQMAVHLPLSAE
AQAEARILMLSSNNILSPASGRPLAMPRLDMVTGLYFLTTEIPGDIGAHA
PAGKDQPEVGVYSSPAEAIMAMDRGALSVRAPIRVRLTQQRPPAEVEAEL
FENGWQPGDAWVAETTLGRVLFNELLPHGYPFVNKQMHKKVQSAIINDLA
ERFPMIVVAQTVDKLKDAGFHWATRSGVTVSMADVLVPPQKAEILDRYEK
EAERIEKQYQRGALNQQERRDALVKIWQEATDEVGKALEEHYPADNPITL
LPKSGATGNMTQVRNLAGMKGLVTNPKGEYIPRPIKSSFREGLTVLEYFI
NTHGARKGLADTALRTADSGYLTRRLVDVSQDVIVREHDCGTERGINVVI
AEKQTGPDGKATLIRDAHIETSAYARTLAADAVDADGNVLVERGHDLGDP
AIEKLLAAGVTTVKVRSVLTCTTGTGVCAMCYGRSMATGKLVDIGEAAGI
VAAQSIGEPGTQLTMRTFHQGGVGDDITGGLPRVTELFEARVPKGKAPIA
DVTGRVRLEEGERFYKITIVPDDGGEEVVYDKLSKRQRLRVFKHEDGSER
PLADGDHVEVGQQLMEGAADPHEVLRVMGPRQVQVHLVNEVQEVYRSQGV
SIHDKHIEVIVRQMLRRVTIIDSGATEFLPGSLTERAEFESENRRVVAEG
GEPAAGRPVLMGITKASLATDSWLSAASFQETTRVLTDAAINCRSDKLNG
LKENVIIGKLIPAGTGINRYRNISVQPTEEARAAAYTIPSYEDQYYSPDF
GSNTGAAVPLDDYGYSDYR
169630946YP_001704595.1 hypothetical protein MAB_3867 [Mycobacterium abscessus ATCC 19977]MINRQSIGDVALPTLSIMLPFAIIVGQLGFDPCRWWIVYCTAAAVAIGLA
VGTSRMRKTSGARPTTSPPWTFFWIGLAALTAVQGGFYSQFRNQCPVVGP
IIPIDMFLEWIVAPTVLVAAALSVCRRGRAHI
169630945YP_001704594.1 putative amino acid permease [Mycobacterium abscessus ATCC 19977]MTVANSESETPDAGYSRGLSARTVQMIAIGGAIGTGLFYGAGGAIEKAGP
GLILTYLVAGLAIFVIMRALGELLVYRPVSGSISEYAEEFMGRFAGFANG
WTYWAVWATTCMAEITVAGVYIQRWWPGIPQWVTALVVLLILFGANLISV
KIFGEAEFWFSMIKVTAILGMIIIGVGVLLPISGLGPETGPSVANLWNDG
GVFPTGFSQALLSLQIVVFAYVGVELVGVTAGEAENPKVTLRKAINTLPF
RIGLFYVGALIVILSIQGWRNYHKGESPFVAVFEYLNIPQAANIVNFILL
TAALSSCNSGIYSTGRMVRSLAQRGDAPAGLQALSSRHVPMLAICFSALA
MGIGVFVNWLSPDKAFAYITSVSTIGIIFVWGSILVSHMIYRKRVADGLL
PASDYKLPGAPVTNILALGFLALVVLLLFFTEDGRTAILVGVVWFIIVVL
GYFVHHGEPAHRETQDA
169630944YP_001704593.1 hypothetical protein MAB_3865 [Mycobacterium abscessus ATCC 19977]MVDYRDPGAITFEATIEKPEGPGAYVEFPYSAFDSFGVRIRVPVHVMFDG
SVPYTGSLAPYGGRHVLGVRKDIQAQLGKGPGDRVMVEVRLDIDRA
169630943YP_001704592.1 hypothetical protein MAB_3864c [Mycobacterium abscessus ATCC 19977]MSGRTRNTPKFDFRRLFVLLFTPLLVLGPWVTNSPVWFSLFCTVFFGLGW
LVTLRNGDLPAYRRNPPAEYWMAAPWQWRVDGRDHSGVRIPLRYSPGPLG
IAVLAAVGLALLAPVVMRVAADGDVFAHPATGAHTPKEGTAYAVAFYGSL
AFGIVALGGAAKFLIDLPVPRRSVLLSHEGLWVPGQQVLSWTELGGVSET
DRTRSRVRYGVLGRDGAQLALSTEPAALPLHVVVVGLQHDPMLIARLHQR
RAAEDVNALILGHADGDTAF
169630942YP_001704591.1 hypothetical protein MAB_3863 [Mycobacterium abscessus ATCC 19977]MPVTNVTHDIDTRTIVINAEFEAPIQRIWQIYADPRQLEKVWGPPSCPAT
FVDHNFKPGGRANYYMTGPDGERYAGWWEIIAIYEPNSLEFIDGFSDDKL
NPVDNMPTSRNVYTFVEKDGRTLATYVSTFETAEALQQVLDMGVIEGASS
AINQIDELVRS
169630941YP_001704590.1 ArsR family transcriptional regulator [Mycobacterium abscessus ATCCMTDADEDKADAMFHALSDRTRRDILRRVLAGEHSVSTLAANYDMSFAAVQ
KHVAVLEKAGLLTKRRNGREQLASGDVEAVRSVGAMLSELEQLWRGRIAR
IDELIARDRPSKD
169630940YP_001704589.1 hypothetical protein MAB_3861 [Mycobacterium abscessus ATCC 19977]MEKVVFVLRQPPDATTDAWAERLRTAAIDKIPAAGVHGLSVCVHDGSVRA
ANLRLVTLDPPFAAAVSVWVQQSYGPEIREIATVLSRTSAAVHGYLVTES
VPLPSPDTENDTRSTGFTNIALLRRPTDMSFDRWRQQWQGVHTQNALDLQ
STIGYEQNLVVRAITPEAPVISAIVFEQFPISALTDPLAWYGASDQQQLS
ERVIAMLDSVKAFGADTNIDTVATSRYDIVRPF
169630939YP_001704588.1 acyl-CoA dehydrogenase FadE [Mycobacterium abscessus ATCC 19977]MADTHVVTNQVPALRDYNAATSPVLMEALIREGGQWGVDEVLEVGALNGT
DRMQRAGELANRNRPVLHTHDRWGHRVDEIEFDPAYHELMREAVAHGLHG
APWADERPGAHVVRAAKTGVWTADPGHMCPISMTYAVVPALRANPELAAV
YEPLLSSRVYDPVLAVPTAKAGLTAGMSMTEKQGGSDVRAGTTTATPSAD
GSYTLVGHKWFTSAPMCDVFLVLAQAPGGLSCFFLPRVLPDGSRNRMRLQ
RLKDKLGNHSNASSEVEYDEATAWLVGEEGKGVKTIIEMVNMTRLDCTLG
SATSMRTGVALAMHHAQHRKAFGEYLIDQPLMRNVLADLAIEAEAATMVA
MRMAGATDRATRGDETESLLRRIGLAASKYWVCKRATPHAGEAMECLGGN
GYVEDSGLPRLYREAPLMGIWEGSGNVSALDTLRAMATKPECVEVLFKEL
ALAQGQDERLDRHINGLHSQLSDLESVTYRARKVAEDICLALQGALLVRH
GHPAVAQAFLATRLAGDWGGAFGTLPTGLDLSPILERATVKSGD
169630938YP_001704587.1 enoyl-CoA hydratase [Mycobacterium abscessus ATCC 19977]MVDTLKTMTYEVTDRVARITFNRPEQGNAIIADTPLELAALVERADLDPQ
VHVILVSGRGDGFCGGFDLSAYAEANDEGSVRYSGTALDGQVQLRNHLPN
INWDPMLDYQMMSRFTRGFSSLLHANKPTVVKVHGYCVAGGTDIALHADQ
LIVAADAKIGYPPTRVWGVPATGLWAHKLGDQRAKRLLLTGDCLSGRQAY
DWGLAVEAPEPDELDERTERLVERIAAMPLNQLMMIKLACNSVLINQGIA
NSAMIGTVFDGISRHTPEAHAFTADAIANGYRQAVRHRDEPFGDYGRKPT
EL
169630937YP_001704586.1 hypothetical protein MAB_3858c [Mycobacterium abscessus ATCC 19977]MDNPVDHHPMTARSVILSLLLGAHPAELSVREIRALTTLFGISDTTVRVA
LTRMVAAGDLVRTEAGYRLAERLQARQLRQDEACDPHRGSWDGTWKQLVI
TSVGRDARDRNDLRTTLRQSRFGEFREGVWLRPENLEVDLPPSVTDHVWI
LHTRTDRPEVLAAQLWDLTGWSTYATALLRWWDQAEAIPARFVLAAAMVR
HLLADPVLPDELLPADWPADEMRARYREFKDELVTLRDTAEMEEASL
169630936YP_001704585.1 enoyl-CoA hydratase [Mycobacterium abscessus ATCC 19977]MSEEMQPAVRVEKAGPVTTVILNRPHARNAVDGPTAAALLAAFTEFDADP
EASVAVLWGDNGTFCAGADLKAMGTDRGNELHPHGPGPMGPSRLRLSKPV
IAAISGHAVAGGIELALWCDLRVVEEDAVLGVFCRRWGVPLIDGGTIRLP
RLIGHSRAMDLILTGRPVHANEALDIGLVNRVVARGQAREAAETLAAEIA
AFPQQCVRADRDSAIAQWGMAEEAALDNEFGSIERVATEALEGAGRFAAG
EGRHGAGV
169630935YP_001704584.1 putative lipoprotein LprB [Mycobacterium abscessus ATCC 19977]MTVRMLPVSALVIAAAVLVGCSSRPSSDGDGDGGSPDAQVTTVPEVNNGP
GKGFKLGDCGGMTDAEVNAAVGVPGLKRDVDSLLGCRWSTGPGTGDTSIS
LYWYRGSSAQKEASVARNLGHTVEAVTTKSYPGYRVSNVGLCELSAGSGP
DFLHWSLQSSAVKNDPCKAVETLMDSLLGKVGKQ
169630934YP_001704583.1 putative lipoprotein LprC [Mycobacterium abscessus ATCC 19977]MRKIFGTLAAVLLLLAAPTGCAHTVDGTAVAPGEGLSSNERGENDKLDPY
GFANGQCGPLDEKTIVETVKAAQIYQNFFGALCYWVAADDAGNLIDLLYA
YYEGGDVERDRTSADGMGQKTADITINSRKGFTSSGPGSGCGVTVPAGTG
SLTWWVQYRKGGDSCAAARQLVEHIVQTVL
169630933YP_001704582.1 hypothetical protein MAB_3854 [Mycobacterium abscessus ATCC 19977]MYRTRPTLVALAVAVTAVGLAGCGIIKPGSSNPTPGTWTPPSTSTSTSTS
PSASTPTSAKVNIGDETVIGYFGQTTTATCEAGKSLNITGANNTLTITGP
CETVTVSGFSNTVTFGELKTEVTVTGYGNKLTYKTGEPKVNNYGSNNTIQ
KAS
169630932YP_001704581.1 hypothetical protein MAB_3853 [Mycobacterium abscessus ATCC 19977]MLVGVLVTAGIAALTGSHTIGPDLADNIRLAKNGDTHITQYGLVTTIDCN
DSTVFVNGSQNVITALGSCYAISVQGSHNTIIADNVVNDITVYGFNQKVL
YKSGEPAIIDRGRELGMMNFIDRVPG
169630931YP_001704580.1 TetR family transcriptional regulator [Mycobacterium abscessus ATCCMTTEPATAHRRTPARATRLNRDAVVNAALSFLDRAGWDALTINALAVELG
TKGPSLYNHVDSLDDLRHEVRDRVLAEIVGMLHTVSSGRSSEDAILAMAG
AYRSYAHHHPGRYAALTRMPFLDAVNRPTIDARELAKPATEAIGVYGLNE
DTAFHAGVELWAAMHGFVMLEMTGFMAGIEMDPDTAFAEMVHRFASGLAE
RK
169630930YP_001704579.1 30S ribosomal protein S12 [Mycobacterium abscessus ATCC 19977]MPTINQLVRKGRRDKIAKVKTAALKGSPQRRGVCTRVYTTTPKKPNSALR
KVARVRLTSAVEVTAYIPGEGHNLQEHSMVLVRGGRVKDLPGVRYKIIRG
SLDTQGVKNRKQARSRYGAKKEKS
169630929YP_001704578.1 30S ribosomal protein S7 [Mycobacterium abscessus ATCC 19977]MPRKGPAPSRPLVNDPVYGSQLVTQLVNKVLLDGKKSIAERIVYGALEQA
RDKTGTDPVVTLKRAMDNVKPALEVRSRRVGGATYQVPVEVRPDRSTTLA
LRWLVTFSRARREKTMVERLANEILDASNGLGASVKRREDTHKMAEANRA
FAHYRW
169630928YP_001704577.1 elongation factor G (EF-G) [Mycobacterium abscessus ATCC 19977]MAQDVLTDLNKVRNIGIMAHIDAGKTTTTERILYYTGVNYKIGETHDGAS
TTDWMEQEQERGITITSAAVTCFWNGNQINIIDTPGHVDFTVEVERSLRV
LDGAVAVFDGKEGVEPQSEQVWRQADKYDVPRICFVNKMDKLGADFYFTV
QTIKDRLGAKPLVIQLPIGAENDFEGIIDLVEMNAKVWRGETKLGESYET
VEIPADLADKAAEYRNELLETVAESDEALLEKYLGGEELSIDEIKAGIRK
LTVASELYPVLCGSAFKNKGVQPMLDAVIDYLPSPLDVESVKGHVPGHED
QEIERKPSTDEPFSALAFKIAVHPFFGKLTYVRVYSGKIESGAQVVNATK
GKKERLGKLFQMHANKENPVETAAAGHIYAVIGLKDTTTGDTLCDPNSQI
VLESMTFPDPVIEVAIEPKTKTDQEKLGTAIQKLAEEDPTFKVKLDQETG
QTVIGGMGELHLDILVDRMRREFKVEANVGKPQVAYRETIRKKVENVEFT
HKKQTGGSGQFAKVIVTVEPLVDAEDGATYEFENKVTGGRVPREYIPSVD
AGAQDAMQYGILAGYPLVNIKVTLLDGAYHDVDSSEMAFKIAGSQALKKA
AQAAQPVILEPLMAVEVITPEDYMGDVIGDLNSRRGQIQAMEERSGARVV
KAQVPLSEMFGYVGDLRSKTQGRANYSMVFDSYAEVPANVSKEIIAKATG
E
169630927YP_001704576.1 elongation factor Tu [Mycobacterium abscessus ATCC 19977]MAKAKFERTKPHVNIGTIGHVDHGKTTLTAAITKVLHDKYPDLNEASAFD
QIDNAPEEKARGITINISHVEYQTEKRHYAHVDAPGHADYIKNMITGAAQ
MDGAILVVAATDGPMPQTREHVLLARQVGVPYILVALNKSDMVDDEELLE
LVEMEVRELLSSQDFDGDNAPVVRVSALKALEGDAEWGKTVADLMDAVDE
SIPDPVRETEKPFLMPVEDVFTITGRGTVVTGRVERGVINVNEDVEIVGI
KDTTTKTTVTGVEMFRKLLDQGQAGDNVGLLVRGVKREDVERGQVVVKPG
TTTPHTEFEGSVYILSKDEGGRHTPFFNNYRPQFYFRTTDVTGVVTLPEG
TEMVMPGDNTDISVKLIQPVAMDEGLRFAIREGGRTVGAGRVTKIIK
169630926YP_001704575.1 hypothetical protein MAB_3847 [Mycobacterium abscessus ATCC 19977]MPKLIVVDEPQSGDPHPFDYYYRPGMDLRPIPEGKNEFGWIWSHCRHYLF
DPWFDVEDEVTPTPATRMFDDHMWQGDELMDAVVELFHELGSAEARALFE
QAVEHGIDSLGDPPEALRALFADAYRVPPWWDPEKAERGRQRARQVTTAT
TAVMATFAVFDTVMNSDVSAATGATGRFRYQSAQRLAETNRFFSMIFDRD
GLVPGSEQIKLTMRVRLVHSLARRGLRSAWGEDNFAQFGAPISNASMCGF
IEAMLGALLVDYRLGRSCTLREIDDVWHYLLRWALMFGVTEDLLPRTGID
AMRNLDYLLARSGDASRWRVELVEALATGMSGARTGPVRRLFAEVIAGPG
SMLMGPAAMDEFFRDTTFAGVNHRLSGWLFSRAATVNANATSVVDRLPGI
GLVRRQLDALNPNPSRVNNLLSELIEKRAKVSSTYTMHDNNTAGHAFAR
169630925YP_001704574.1 hypothetical protein MAB_3846 [Mycobacterium abscessus ATCC 19977]MPKLTAVDRPLPGKPHPYDYYYRPGMDLRPIPEGKNEFGWIWRHCRHVLF
DDWFDVEDHVTPTPLTRIFDDHMWQGDELMDAVVVMFERLGSAQARPLFE
RAITDGIESLDDPPEELRVLLEDAYRVPAWWDPAKAERGRVRLNQMSAPT
MLLMTSFGVFDTVMNSDVSATTGASGRFRDQGQQRLLETARFFAALRDRD
AMRPGSWQMQMTLRVRLVHSLARKGLRSAWGPDNFADFGVPISNSSMCGF
IEAESLGQMLIEHRFGRPCTLDELDDAWHYMTRWALLFGITEQMCPKTGA
DAMRNLDYLLARSGDASRWRVELVEVLSALPSAVIAPVPMERFRKLLSDV
MFVAGIGAPGWVLLGPKAMDEFVRGTSYERLPRRLPGMALHAAMSAAARL
AAVRDRVPGTHLARRIVYGTLLPNPSTMMNPAFGLLERLNRVNSTYTMHD
NNTAGHAFAR
169630924YP_001704573.1 hypothetical protein MAB_3845c [Mycobacterium abscessus ATCC 19977]MNVVARFLKILAFSLLCGIVGPIFIVMYYVIDEPATSWMLYSGIGITIGI
VVLAFVLTLLFTKNEEARKLLEANGILALADVMAANETGMTVNDQPVIKL
TLQVHGDGISPFRAETRARVSVLQVPTLSRGKLVVLVAPGTEQFQIDWQR
SALLNGQVPAKFTSSSQGREYDLTGQAGPLFEIMKVLKANGIGSDGVIDI
RSNPVARQQIDAILRKTEAGERSMGAETGNGGSVADRLAELDRLKLASLI
SEAEYGDKRTEILRDL
169630923YP_001704572.1 putative short-chain dehydrogenase/reductase [Mycobacterium abscessMADQPLAGKVAFVTGAARGQGRQHAVRLAQAGADVVAIDACAPVSEYAGY
EAATPEDLKETVRLVEAAGRKIIAEQADVRNGAALQSVVEEAVAQFGHID
ILIANAGVLSWGRLWEMSDQQWEDIIDTNLTGTWKTVKAVVPTMIEAGNG
GSIVIVSSVSGLKGTPGNGAYVASKFGLTGLTKSLTIELAEYGIRVNSIH
PYGVTTPMITGDAMMKILAEHPNYLPSIAPMPLSPTKMLEPDEISDVVLW
LASDASGTLAGAQVPVDKGHLTY
169630922YP_001704571.1 hypothetical protein MAB_3843 [Mycobacterium abscessus ATCC 19977]MTVVVGYLSGKGGKGALHLAVESARVLETSLTVTTVVPKPWTTLSKAKID
AEYAQWAQKLSDDSKSEATAYLEKIGAGIDVTFHNVAHRSVSGGLLEAVE
ASDADVLVVGSASEGRLGQVVLGSTGDRLLHSSPVPLAISPRGYRGSRAG
TVSRVTCGYPGTEDAVDVVQQAVRLTQRLHAPLRVVTFAVRGRTMLTAGV
GPEAEDAVLASWVTQSEEALSELRQAGIVTADVELKVVTGDTWDDALDNA
EWNDGELLVLGSRPHSAVARVFLGSRATKIVRHSPVPVVVMPG
169630921YP_001704570.1 cationic amino acid transport integral membrane protein [MycobacterMAPSSPSLAQQLLRRRPTSGAPTAHGAGGHLKQSMGTFQLTMIGVGATVG
TGIFFILAESVPKAGPAVMASFLVAGLAAGLAALCYAELASAVPVSGSSF
SYAYTTLGELAAMVVAACLLLEYGVSAAAVAVGWSQYLDKLLVNLFGWHL
PHAISAAPWDSADPAAPHPWLNLPAVLLIIMCAILLIRGTSESALVNTVM
VLLKLAVLSVFAIIAFTAFHAGNFSDFAPFGVSGIGAAAGTIFFTYVGLD
TVSTAGEEVKDPQRTMPRALIAALLIVTAFYLVVALAALGAQPWKEFEGQ
SAGLALILDKVTGSTSASTFLAAGAVISIFSITLVSMYGQTRILFAIGRD
GLLPSVFAQVNPRTLTPVNNTIIVAVVVGFMAAFVPLDSLANMVSIGTLT
AFIVVSIGVIILRVREPELPRAFRVPGYPVTPVLSVIACGYILFSLPWIT
WIAFGAWVAIVLVFYLVWGRHHSALNDLPSDPAELSEKEPV
169630920YP_001704569.1 ornithine aminotransferase RocD1 [Mycobacterium abscessus ATCC 1997MTVTEAPGMSPDSYKSAEYIELAEQYGAHNYAPLPVVAHRAEGAWIEDVD
GKRYLDCLAAYSAVNFGHGNPEILATSHAQLDTVTLVSRAFHSDRLGRFC
RDLARLCGKGMVLPMNTGAEAVESGIKVARKWGTDVKGVPVDQANIVVAH
NNFHGRTISIVSFSSDETARGGFGPFTPGFRIVPFGDAAALERAIDGNTV
AVLLEPVQGEAGIVIPPDDYLPAVRALCTENNVLFIADEIQAGLARTGRM
FACDHWNVVPDVYLLGKALGGGVVPVSAVVADADVLGVLHPGEHGSTFGG
NPLGAAIGSTVVAILERGEFQRRASVLGRHLRTRLDALIGHGVTEVRSLG
LWAGVDIDPNLATGRQIGLRMAEFGVLVKDTHGATLRFAPPLVITEGEID
WAVDQFADALASFR
169630919YP_001704568.1 hypothetical protein MAB_3840 [Mycobacterium abscessus ATCC 19977]MTAVHQGGHPADSPIQQPDRTPTTRHYVMVPPTHYAVEYAINPWMDTSNP
VDATLATAQWDALRATYERLGHRVDILPPVAGLPDMVYAANGGIVLRGNA
VVARFTHAERAGESDAHAAWMRQHGLRPMHSRYTNEGQGDFLLAGDIMLA
GTGFRTDVRSHTEIARMLDIPVVTLELVDPRFYHLDTALAVLDPQTVAYY
PPAFSEASRARLRCMYPNAIIASSTDAYVLGMNAVSDGRHVMLPAAATGF
AEQLRDSGFEPIGIDLSELLKGGGSVKCCTLELHS
169630918YP_001704567.1 AsnC family transcriptional regulator [Mycobacterium abscessus ATCCMAELDATDERIVTLLMRNARATFAEIGEEVNLSAPAVKRRVDRLVGTGVI
KGFTTVVDRAAVGWNTEAYVQVYCQGTITPEALRRAWIDIPEVVSAATVT
GTSDAMLRVLARDIQHLERALERIRASGDIDRTESIVVLSNLVDRAQVQG
169630917YP_001704566.1 putative ferredoxin reductase [Mycobacterium abscessus ATCC 19977]MTDAERGVLIIGGGLGAVRTAEQLRRAEFTGPITIVSSETHLPYDRPPLS
KDVLRDAEKTIDAVVLKPREFYDEKQIELRLGSEVTALDPVARTVTLSDG
GTLEYGEVIIATGLVPRRIPTFPDLAGVHVLRTADDSFALRGDAENARRA
VVVGAGFIGCEVAATLRANGVEVVLVEPQPAPLLAAIGQQLGDLVARLHR
NEGVDVRVGVGVDAVEGQDRVQSVTLSDGTRLDTDLVVLGIGSRPAIDWL
DGSGVAVDNGVVCDAVGATGTPHVWALGDVAAWAGADGRPNRVEHWSNVA
DQVRALVPALLGQETSANTVAVPYFWSDQYDVKIQSLGHLGSSDTVHLIS
DDGRKFLAYLERDGVLTGVVGCGMAGPVMKMRAKIAAGTPIAEVLAGS
169630916YP_001704565.1 transcriptional regulatory protein TetR [Mycobacterium abscessus ATMNAQPARVGRRPSTTRDEITAVAMTLFAQHGFDEVSVDDIAAAAGIARRT
VFRYYSSKNAIVWGDFDSHLGVMRALLDETADTVDTSTALRQAVLTFNDF
PVDETPRHRMRMRMILEVPALQAYSMLMYTGWRDVIAQFVARRSGTDPGS
LLPQTVAWTLLGVALAAYEQWLADESSKLTTLLGKGFDAAEVGLRALR
169630915YP_001704564.1 hypothetical protein MAB_3836c [Mycobacterium abscessus ATCC 19977]MSAMIDEAPTGFDWTRPWQLHSQVSLRPEPFGALLYHFGTRKLSFLKNRT
LLQIVQSLAEHRSAESAWLAAGVADGQVSAYQQALTVLADSQMIVTREDA
S
169630914YP_001704563.1 coenzyme PQQ synthesis protein E PqqE [Mycobacterium abscessus ATCCMSAPAVPRLNVAAVAAPKLVDQFEQGLDAPICLTWELTYACNLSCVHCLS
SSGKRDPRELSTQQCKDIIDELERMQVFYVNIGGGEPTVRSDFWELVDYA
TEHHVGVKFSTNGVRITEEVAARLAASDYVDVQISLDGATAEVNDAVRGA
GSFDMAVRALENLAAAGFKDAKISVVVTRHNVDQLDEFASLAARYGATLR
ITRLRPSGRGADVWDELHPTAAQQRQLYDWLVRNGERVLTGDSFFHLSAY
GDGSGGLPGLNMCGAGRVVCLIDPVGDVYACPFAIHDRFLAGNVLSDNGF
DQVWKHSQLFSELREPQSAGACGSCGHYDSCRGGCMAAKFFTGLPMDGPD
PECVQGYGEAALAADRVVPKPSGDHSHSKSKRGPATGPVALTLTRRPPSR
ACDENPLSTLRAGR
169630913YP_001704562.1 L-lactate dehydrogenase LldD1 [Mycobacterium abscessus ATCC 19977]MARNKWFETVAIAQQRAKKRLPKSVYSSLISASEKGLTVSDNVEAFGELG
FEPHVVGIQPDRELSTTVLGQDISLPVMISPTGVQAVDPDGEVAVARAAA
ARGTAMGLSSFASKPIEDVVAANPKTHFQIYWLGGRDDVAQRIQRAKDAG
AVGLIATLDWSFSHGRDWGSPAIPEKMDLRSMIRLAPEVVTKPSWLWSFG
KGMNIPDLRVPNQAARGEAGPPFFDAYGQWMGTPAPTWDDVRWMREQWDG
PFMLKGVMRIDDAKRAVDCGVSAISVSNHGGNNLDGTPASIRALPGIADA
VGHDIEVLLDGGIRRGSDVVKALALGARAVMIGRAYLWGLAASGQAGVEN
VLDIMRGGIDSALMGLGKKSVHELSPDDLLIPEGFARGLGRH
169630912YP_001704561.1 hypothetical protein MAB_3832c [Mycobacterium abscessus ATCC 19977]MNSAYHRRVAVPTVLSTAISPELSDEAITLFTPLGSTEQHGPHLPLDTDT
RIAGAVATGAAAELAADGGDGRTALAPAIAYGASGEHQSFAGTISIGTEV
LGRLLVEYARSAIQWCRRIVIVNGHGGNIQGLVSAVRLLRSEGRDVAWWA
CAVEGGDAHAGHVETSLLLHISPDVVRREEVLAGNVAPLHELMAPMRAGG
VAAVSAIGVLGDPTTASSQDGARMLETMTRQCADAVRRWTPDADGRLV
169630911YP_001704560.1 putative glycosyltransferase [Mycobacterium abscessus ATCC 19977]MTTSDEQAQHAAPSQERLPDGFAVQVDRRVRVLDEGSALLGGSPTRLLRL
APAARTLLSGGRLEVRDATSAQLARTLLDATVAHPRPVGGPGYRDVTVVI
PCRDNGFGLRRLLRALRGMRVIVVDDGSTIPIVESDLEGMHCHVEVVRHA
DSQGPAAARNTGLKLATTDFVAFLDSDVVPRRGWLEALLGHFSDPAVALV
APRIVGLVLSDNAIARYEAVRSSLDLGLREAPVVPYGPVSYVPSAAIVVR
RSAINEIGGFDEALQCGEDVDLCWRLIEAGSRLRYEPVSHVAHDHRLTLR
EWFARKAFYGKSAAPLSTRHPDKVAPMVISRWTLLVWILAAVGSGMGYLA
AVGMAALAAGRVARTLRGVDTPPRDVVRVAAQGVGGAALQIASALCRHYW
PLALFAAALSRRSRQVLVVAAIVDGVVDWMKRNDSSASPDDRIGLIEYVL
LKRLDDIAYGIGLWSGIVRERDLGALRPELRP
169630910YP_001704559.1 lucose-methanol-choline oxidoreductase [Mycobacterium abscessus ATCMGAGSAGSILAGRLSEDPSFRVVLVEAGPVSSADEAGVRNGYRLPIGPGS
QIATYYWATLTSTGDQAELVRGSVVGGSGAINGGYFVRGRPADFDGWAVS
GWSWAEVRDHFRAIETDHDFRDDPLHGSQGPIPVGRRHEQSSAGTELMDL
AVNRGYPVVADLNGSAGAGVGLVPLNIDSGIRVGPARAYLESAVWRPNLA
VYSGTRVLRVLCSGGKATGVQVAVGNSVRTLTADRIILSAGAIESAKLLL
LSGLGPADELRAVGVQPVVDLPGVGTRVMDHAEWVLDTGEQGQQGHPVLD
TVLHTDHPMCLEIRPYTTGFAAMAGVVADGADARQIGVALMTPQCRGRLE
LRSTDPAAPVYIDLRYDSETADMDRLRDGVHLVSELYGRRFGGPRWSTSQ
HLCGTAPLGNDRDKHAVVDKYCRVRGIDGLFVIDGSILPTIPSRGPAATI
AMIGHRAAQFVAWS
169630909YP_001704558.1 ethanolamine permease [Mycobacterium abscessus ATCC 19977]MSTSDDAASSPPEASHDHAGVQSHLEGADYLARRQLRSGTAGWVLLAGLG
VSYVISGDYAGWNTGLSKGGFGGLAIAAVIIAAMYLSMVLSMAEMSSALP
TAGGGYTFARRALGPWGGFATGTAILIEYAIAPAAIATFIGSYVESLHLP
GLADGWWIYLAVYAVFIGIHLSGAGEALRTMFIITGVALVGLVIFTIGAV
GRFDVHNLTNIPVDESARGASAFLPYGYLGIWAAVPFAIWLFLAIEGVPL
AAEEAREPAKNIPRGILMAMLVLVITGTAVLLLVPGVGGAQEMGESGNPL
VEALGTATVAKVVNYIGLSGLIASFFSIVYAYSRQTFALSRAGYLPTGLS
VTNGRKAPVLALIVPGIVGFLLSLTGEGAMLLNMAVFGAALSYVLMMVSH
IVLRIREPEMERPYRTPGGIATSGFALVIACVAVVATFIVDTTAAFATFG
VFVLFMAYFGLYSRHHLVANSPDEEFAALAEAENELK
169630908YP_001704557.1 ethanolamine ammonia-lyase- large subunit [Mycobacterium abscessus MSTFRHIAGPVTYQFGSLAEVLAKASPPRSGDELAGCAAHSDAERAAARW
VLAEVPLAAFLTEEIVPYDTDEVTRLILDSHDAAAFAVISHLTVGDFRDW
LLETITKPHGAQILKEVSPGLTPEMVAAVSKLMRNQDLIAVGAAVRNHSA
FRTTIGLPGTLATRLQPNHPTDDARGIAAATLDGLLLGCGDAVIGINPAT
DSPHAAGDLLRLIDDIRLRFDIPTQSCVLAHVTTTIELIERNLPVDLVFQ
SIAGTEGANESFGVNLALLREANEAGRSLSRGTVGNNVMYLETGQGSALS
AGAHLGVGGVAVDQQTLEARAYAVAREVEPLLVNTVVGFIGPEYLYDGKQ
IIRAGLEDHFCGKLLGLPMGVDVCYTNHAEADSDDMDVLLTVLTAAGVAF
VIAVPGADDVMLGYQSLSFHDALFARRTFGLRPAPEFNDWLERMGMLERD
GGLREIAVSDSPLRALI
169630907YP_001704556.1 ethanolamine ammonia-lyase small subunit [Mycobacterium abscessus AMSHIANNVAAQNIWDTLRRSTQSRIGLGRSGDALPTTRVLEFGTAHAAAR
DAVHTPLDAQALAGRIDGLGLGAPLLVTSRATDRSEYLRRPDLGRAPADG
ALDVLPGSGGDIGIVLADGLSPRALDDHGVPLLQALHRRLRGYAIAPLVV
ATQARVALGDHIGAALGVDTVLVLIGERPGLSVADSVGIYLTHNPVVGCT
DAQRNCVSNIHPPEGLGYDQAAQVVAALVAGARQIGRSGVDLKDMTGAGN
QIEGAGPALPT
169630906YP_001704555.1 acetyl-CoA acetyltransferase [Mycobacterium abscessus ATCC 19977]MAFDPRTPVLVGTGQVNQRTDADTPFSEIPEPIDLMEQAARLAAGDAGAT
ELLGAIDTISVANIFSWRYRDPGVLLGERLGAVPKRTFYTGPSGNSPQLL
VNHAAADILAGDADVVLIGGAEMWRSRNKMMATGVQPTWTIQDESVAEAT
VLGGRMDQVGGAETAIGLISPGHVYPLFEEAIRIAGGVSIADHRAAMSQL
WQRFNAVAVTNGHAWSNDAYTAEEIATPGPDNRWISSPYTKLMNSNNMVE
QGAVVLLTSVETALRLGISKDRWIFPLAGAQANDTFALSERHELHRSPAI
RLAGRRAFEIAGLGTDDVELVDIYSCFPSAVQVAAAELGLALDDPARPLT
VTGGLTFAGGPWCNYVTHSIATMAERLRERPGAKGLITANGGYLTKHAFG
IYGTEPPASGFAYEDVQADVDQEPRTEAADGYTGTAAVEAWTVNYGRDGS
PFQTFVSVRTPTGARTFAKIDDRDASAHIADTDIAGASIEVAADGSARLN
169630905YP_001704554.1 cytochrome P450 [Mycobacterium abscessus ATCC 19977]MATALSEIEEAGRVLADPAAYADELRLHAAMTLLRREQPVTKVITDDYRP
FWAVTKHDDIMAVERDNALWINEPRPLLMNLEQEAELDKQAAMGIELKTL
VHIDDPKHRVLRAIGADWFRPKAMRDMKLRTDELANRYVNKLLEAGGSCD
FAQDIAVHFPLYVIMSLLGIPESDFDRMLKLTQELFGGDDSEFQRGTTPE
EQLMALLDFFGYFSGLTASRRQHPTDDLASTIANARVDGELLSDVDTASY
YTIIATAGHDTTSATIAGGLEALLEHPDQLARLRENPGLMPLAVDEMIRW
VTPVKEFMRTATADTEIRGVPITEGESVLLSYPSGNRDEDIFTDPFTFDI
ARDPNKHLAFGFGVHFCLGAALARMEVNSFFSALLPRLESIEVDGNIERT
STIFVGGIKHLPIRYTLR
169630904YP_001704553.1 hypothetical protein MAB_3824 [Mycobacterium abscessus ATCC 19977]MSASPTYKIWQRLQNKPGGSALFSAAMMARVPYFASVVPHVHRMEPGYCE
VTAPKWYFVYNHIKTFHAIAACNLAEVAMGMLMEATTPSSHRWIPKAMNV
QYLGKATTSLRAIATLEGIDFASITEGTDVVVPISITDRDGKEVVKAEIT
TWVTPA
169630903YP_001704552.1 pyridoxamine 5'-phosphate oxidase [Mycobacterium abscessus ATCC 199MRWLDADGGRSFLRALPVLSGNAPPFDIASAPAEPLRLFIEWIEQAAQAG
VQEPHAMTISTVDNAGMPRARVLILKAIDQDGWHFAASSVSQKGRDLSAN
PAAALTFHWPEVVRQVRVVGAVVDDGDQVSAADFLGRPVGSRAMALTLRQ
SQPLVDPAEIDAEIEKAHRKLADDPELVPDEWVSYALRPAQIEFWQGSPD
RKHQRLSYQWVGDGWERTQLWP
169630902YP_001704551.1 hypothetical protein MAB_3822 [Mycobacterium abscessus ATCC 19977]MDWADAPARALVVRRPRPQRVKGTPQGTATGSRQPEQYALSSGCGQIPAV
APSGWREEPGDLRFREHVER
169630901YP_001704550.1 30S ribosomal protein S10 [Mycobacterium abscessus ATCC 19977]MAGQKIRIRLKAYDHEAIDASARKIVETVTRTGASVVGPVPLPTEKNVYC
VIRSPHKYKDSREHFEMRTHKRLIDILDPTPKTVDALMRIDLPASVDVNI
Q
169630900YP_001704549.1 50S ribosomal protein L3 [Mycobacterium abscessus ATCC 19977]MTQVFDDNNRVVPVTVVKAGPNVVTRIRTTEQDGYSAVQLAYGEISPRKV
TKPVTGQFAAAGINPRRHLAELRLDDEAAAAEYEVGQELTAEIFSDGAYV
DVTGTSKGKGFAGTMKRHGFRGQGASHGAQAVHRRPGSIGGCATPGRVFK
GTRMSGRMGSDRVTTQNLVVHKVDAENGVLLIKGAIPGRKGGLVVVRTAV
KRGEK
169630899YP_001704548.1 50S ribosomal protein L4 [Mycobacterium abscessus ATCC 19977]MKIAVKAPGGKTDGSIELPAELFDAPANIALLHQVVTAQLAAGRQGTHST
KTRGLVSGGGKKPYRQKGTGRARQGSTRAPQFTGGGIVHGPQPRDYSQRT
PKKMIAAALRGALSDRARNGRIHAVTELVAGQEPSTKSAKSFLGEITDRK
QLLVVLGRDDLASVKSVRNLPNVHVLAYDQLNTYDVLKADDVVFSVEALN
GFINAKKKEEVSA
169630898YP_001704547.1 50S ribosomal protein L23 [Mycobacterium abscessus ATCC 19977]MATIADPRDIILAPVISEKSYSLIEDNVYTFIVHPDSNKTQIKIAIEQIF
SVKVSSVNTANRQGKRKRTRTGFGQRKSTKRAIVTLAPGSKPIDLFGAPA
169630897YP_001704546.1 50S ribosomal protein L2 [Mycobacterium abscessus ATCC 19977]MAIRKYKPTTPGRRGSSVADFSEITRSTPEKSLIRPLHGTGGRNAHGRIT
TRHKGGGHKRAYRLIDFRRHDKDGVNAKVAHIEYDPNRTARIALLHFLDG
EKRYIIAPVGLSQGDVVESGANADIKPGNNLPLRNIPTGTTVHAVELRPG
GGAKLARSAGSGIQLLGKEGAYASLRMPSGEIRRVDVRCRATVGEVGNAE
QANINWGKAGRMRWKGKRPTVRGVVMNPVDHPHGGGEGKTSGGRHPVSPW
GKPEGRTRKPNKASDKLIVRRRRTGKKR
169630896YP_001704545.1 30S ribosomal protein S19 [Mycobacterium abscessus ATCC 19977]MPRSLKKGPFIDDHLLKKVDVQNEKNTKQVIKTWSRRSTIIPDFIGHTFA
VHDGRKHVPVFVTESMVGHKLGEFAPTRTFKGHIKDDRKSKRR
169630895YP_001704544.1 50S ribosomal protein L22 [Mycobacterium abscessus ATCC 19977]MTTTTEFPSATAKARFVRVSPTKARRVIDLVRGKSVNDAIDILRWAPQAA
SEPVAKVIASAAANAQNNDGLDPSTLVVSEIFADEGPTAKRIRPRAQGRA
FRIRKRTSHITVVVESRPKQEKGGKAGASKASSRAARAQGSKAAAAKKTE
SKGGTS
169630894YP_001704543.1 30S ribosomal protein S3 [Mycobacterium abscessus ATCC 19977]MGQKINPHGFRLGITTDWKSRWYADKQYADYVKEDVAIRRLLATGLERAG
IAKVEIERTRDRVRVDIHTARPGIVIGRRGTEADRIRADLEKLTGKQVQL
NILEVKNPEAEAQLVAQGVAEQLSNRVAFRRAMRKAIQSAMRQPNVKGIR
VQCSGRLGGAEMSRSEFYREGRVPLHTLRADIDYGLYEAKTTFGRIGVKV
WIYKGDIVGGKRELAAAGVEAGRGAPDRPRRERPAGTRPRRSGSSGTTAT
STEAGRAAAETPASDGASAPSAETTES
169630893YP_001704542.1 50S ribosomal protein L16 [Mycobacterium abscessus ATCC 19977]MLIPRKVKHRKQHHPKKKGTASGGTTVAFGDYGIQALGHAYITNRQIESA
RIAINRHIKRGGKVWINIFPDRPLTKKPAETRMGSGKGSPEWWVANVKPG
RVLFELSYPNEETARQALTRAIHKLPIKARIITREEQF
169630892YP_001704541.1 50S ribosomal protein L29 [Mycobacterium abscessus ATCC 19977]MTVGISAGELRESTEEELITKLRESKEELFNLRFQMATGQLANNRRLRAV
RQEIARIYTVMRERELGLAAGPDSEDSK
169630891YP_001704540.1 30S ribosomal protein S17 [Mycobacterium abscessus ATCC 19977]MSEKKTSAGAAPGPRHTPATEQPRGRRKTAIGYVVSDKMQKTIVVELESR
NRHSLYGKIIRTTSKVKAHDENGDAGVGDRVSLMETRPTSATKRWRLVEV
LEKAK
169630890YP_001704539.1 alpha/beta fold hydrolase [Mycobacterium abscessus ATCC 19977]MDVTYEGTKRELATDEGTLRYHEAGTAGEGEPLILLHGSGPGVTGWRNYR
GNLGVFAKHFHTYVLEFPGFGVSDAVPGHPVLTAGASVIRFMDGLGISSA
AVVGNSMGGVVGINLAIKHPDRITKLVTIGGVGPNIFSPSPSEGLRLLQE
FTDNPDRDKLIRWLNSMVWDPAVVTDELIEERWEAAINPDAHKTAQLMYG
SKAFAMQQQFLANADIPPYWAMMHKIKCPTLLTWGRDDRVSPPDMAIVPM
RLIPNAELHIFPNSGHWVMIEAKQAFEQTVVDFLRR
169630889YP_001704538.1 cutinase Cut4 [Mycobacterium abscessus ATCC 19977]MNRYVKRGSVGVSIFAVSAAAAVLANPSENSAIAAAAGCPDVDVSFARGT
NDSPGLGDVGKAFTDELTDRLAGKSVDIYAVNYPASFDWVRAGDGANDMS
YHVQEVARNCPNTQFVLGGFSQGAAVVDVLFGTNGTGLTFNNPLPTDLEK
RVAAIVLIGNPKNWQVAGMNLDLSIRDDQRSKIIDICNPGDGICDPNGGG
LGPHMQYKSDGSADKAADFVAGRLAAVAASSSAAAASSSTSTTASGVPAS
TSKSANPLSATTAPAPTSASPAPASSPSSSTPKPVAASTSRRVPAWMMPA
TDAPAAEVPAAVTSTIPAPDPARHGPLPGPGGQ
169630888YP_001704537.1 dicarboxylic acid transport integral membrane protein KgtP [MycobacMAVSAADTSTPSGRAQTRRAIWNTIRGSSGNLVEWYDVYVYTVFAMYFEK
QFFDDSDQNSTVYVYAIFAVTFITRPLGSWFFGRFADRNGRRAALTLSVS
LMAACSMVIALVPSRGSIGMAAPIVLILCRLVQGFATGGEYGTSATYMSE
AATRERRGFFSSFQYVTLVGGHVLAQFTLLIILTVFDTAQVHEFGWRIAF
ATGGVAAIVVYWLRRTMDESLSEEQLAAIKAGADTSSGSMRELLTRYRKP
LLLCFLITMGGTLAFYTYSVNAPAIVKAAYKDQAMTATWINLAGLIFLML
LQPVGGIISDKVGRKPLLLFFGFGGVVYTYVLITYLPQVHAPIVSFLLVA
VSYVLLTGYTSINALVKSELFPSHVRALGVGVGYALANSVFGGTAPLIYQ
ALKEHDQVPLFIGYVTVCIAISLVVYLFFLKNKSQTYLDREQGSAFNR
169630887YP_001704536.1 50S ribosomal protein L14 [Mycobacterium abscessus ATCC 19977]MIQQESRLKVADNTGAKEILCIRVLGGSSRRYAGIGDIIVATVKDAIPGG
TVKRGDVVKAVVVRTVKERRRPDGSYIKFDENAAVIIKADNDPRGTRIFG
PVGRELRDKKFMKIVSLAPEVL
169630886YP_001704535.1 50S ribosomal protein L24 [Mycobacterium abscessus ATCC 19977]MKVHKGDTVLVIAGKDKGAKGKVIAAYPERSRVLVEGVNRIKKHTPQSAN
ERGASSGGIVTQEAPIHVSNVMVIDSDGQPTRIGYRVDEETGKKVRISRR
NGKDI
169630885YP_001704534.1 50S ribosomal protein L5 [Mycobacterium abscessus ATCC 19977]MTTTENAQPRLKTRYREEIKTALNDEFKYANVMQIPGVVKVVVNMGVGDA
ARDAKLINGAVTDLALITGQKPEIRKARKSIAQFKLREGMPIGARVTLRG
DRMWEFLDRLVSIALPRIRDFRGLSPKQFDGKGNYTFGLTEQSMFHEIDV
DSIDRPRGMDITVVTSATTDDEGRALLRQLGFPFKEN
169630884YP_001704533.1 30S ribosomal protein S14P/S29E [Mycobacterium abscessus ATCC 19977MAKKALVNKAAKKPKFAVRAYTRCNRCGRPHAVFRKFGLCRICLREMAHA
GELPGIHKSSW
169630883YP_001704532.1 carboxylesterase [Mycobacterium abscessus ATCC 19977]MTRLLVAVLVVLAAAVSCSPTKAADPTVVTTRAGAVRGHIDDQVRVFAAI
PYAAPPVGPRRFAEPGPVTPWPDTRDATGPGVECPQPGQESNLPQTEDCL
LLTVTMPRHTQGKVPVLVWIHGGAFIAGNGVDYNARKLAAQGGIAVVTFN
YRLGTLGFLAAPGLSGGIGNYGLLDQEAALRWVRDNIAEFGGDPARVTIA
GQSAGGVSVCDLMVSPQASGLFRSAIMESAPCQAQAPVSSAVRDSTAYAA
EVGCPAGPDMARCLRALSVDALRDSPQFTGIGLPVSPVIGTPELPAAPLD
AFTSGLAASPVPVLIGSNANEATVFEAKQYQHRPVPRTAEEYQSVLESKY
GTRATELGRRYPLADFDGNVLGALAAIDTDNSYACPTFAMAEALARRAPV
YAYEFADPVAPVEQQYRDAPLPLGASHGSELGYLFDLSRTMNPESAALST
QMTRYWAQFVKTGNPNVEGQPEWPAYISGGAFQRLAPPAPRSEGGFASRH
QCGYWR
169630882YP_001704531.1 hypothetical protein MAB_3802c [Mycobacterium abscessus ATCC 19977]MPDREKTLLRHHVAAGAKGGSGSVVPVADAHAGQFAGTCILVAVQQNRVV
ILATNTARSCGELVLCPVLPGGIDFMRGSTSIPAADVRSGSVVIASAMTP
RRGRISMATAGIVRLIAEHTCPCVLRVPLRGARRRPCRAGWGTRISNL
169630881YP_001704530.1 hypothetical protein MAB_3801c [Mycobacterium abscessus ATCC 19977]MDTPMQVSQGRRGISKARVRATGVAALTALALVALPGVAGADPEVLQSND
QLGLRFEKSSTPQPEGATTTVTVRTGDGKVVQTISEPFKGWLGGAAVELL
DIDQDGRDDLLVQVDARVKDGKWAIWHAVGSNPKLSRVGVVDGHPESAGP
GLIKADTEQGTVFYVIKGNALAPAPAPAA
169630880YP_001704529.1 glutamate dehydrogenase [Mycobacterium abscessus ATCC 19977]MPEALHPVFQSRFETVLARNPGEAEFHQAVFEVMASLTPLVGKTPDYDRW
SILERICEPERQIIFRVPWIRDDGAVEINRGYRVEFNSALGPYKGGLRFH
PSVSLSIIKFLGFEQMFKNALTGLPIGGGKGGSDFDPKGRSDAEIMRFCQ
SFMTELYRHIGEYTDVPAGDIGVGQREIGYLFGQYKRVTNRYESGVLTGK
GLPWGGSQVRTEATGYGVVLFAQEMLATRAQSLDGKTVVVSGAGNVAIYA
VEKAQQLGARVIACSDSDGYIVDERGLNLELLKEIKEVRRGRLSEYVEEH
GGGARQVTDGNLWEVPCQVALPCATQNELDGKDARRLIENGVQLVAEGAN
MPCTPEAVKYFQDSGVLYAPGKASNAGGVATSALEMQQNASRDSWSFEQT
ETRLRSIMRSIHTTCIETADHYGDPGNYVTGANLAGYTRVADAMVALGVI
169630879YP_001704528.1 hypothetical protein MAB_3799c [Mycobacterium abscessus ATCC 19977]MRRCGAAALAAIGALTGAWAARADRPEPVPLYGAYDTYLDHARQTFEGRP
DPSAPSTQAASFTTTCTAQGCVAHWLRVAELSDNPHAPALFDYRWNGDRW
ESSADYPFHCGAGGTVTAARSDFLIPNGDGSFSGERTFTVGAPGCPGDGP
GTYWLPFTLTPTS
169630878YP_001704527.1 30S ribosomal protein S8 [Mycobacterium abscessus ATCC 19977]MTDPIADFLTRLRNANSAYHDEVTLPHSKIKANIAEILKREGYITDYRTE
DARVGKNLVVSLKYGPSRERSIAGLRRVSKPGLRVYAKSTNLPKVLGGLG
VAIISTSTGLLTDRQAARQGVGGEVLAYVW
169630877YP_001704526.1 50S ribosomal protein L6 [Mycobacterium abscessus ATCC 19977]MSRIGKQPVPVPAGVDVNIDGQNISVKGSKGTLELTVSEPISVSRNDDGA
IVVTRPDDERRNRSLHGLSRTLIANLVTGVTQGYTTKMEIFGVGYRVVAK
GSNLEFALGYSHPVLIEAPEGITFAVETPTKFSISGIDKQKVGQISANIR
RLRRPDPYKGKGIRYEGEQIRRKVGKTGK
169630876YP_001704525.1 50S ribosomal protein L18 [Mycobacterium abscessus ATCC 19977]MTMAQTKTEAKQHEPVGKNISETRRVARIRRHARLRKKVSGTDARPRLVV
NRSARHIHVQLVNDLTGTTLAAASSIEADVQAVDGDKKARSARVGQLIAE
RAKAAGVDTVVFDRGGYTYGGRIAALADAARENGLVF
169630875YP_001704524.1 30S ribosomal protein S5 [Mycobacterium abscessus ATCC 19977]MMAQRNSGAPDNAGGSNDGREGGRGRRDNRDDRRGGRDNAEKSNYLERVV
TINRVSKVVKGGRRFSFTALVIVGDGHGLVGVGYGKAKEVPAAIAKGVDE
ARKNFFRVPLIGGTITHPVQGEDSAGVVMLRPASAGTGVIAGGAARAVLE
CAGVHDILAKSLGSDNAINVVHATVAALKQLQRPEEVAARRGLPIEDVAP
AGMLRARAEFAAAAAQGGSHG
169630874YP_001704523.1 50S ribosomal protein L30 [Mycobacterium abscessus ATCC 19977]MADVKITQVRSTIGARWKQRESLKTLGLRKIRQTVVREDNAQTRGLLQVV
RHLVTVEDVK
169630873YP_001704522.1 50S ribosomal protein L15 [Mycobacterium abscessus ATCC 19977]MTIKLHHLRPAPGSKTERTRVGRGEGSKGKTAGRGTKGTKARKNVPVTFE
GGQMPIHMRLPKLKGFKNRFRTEYQVVNVADIERLFPEGGDVTIEALVAK
GAVRKNELVKVLGNGDLKVKVSVSANKFSDSAREKITAAGGSINEV
169630872YP_001704521.1 luciferase-like protein [Mycobacterium abscessus ATCC 19977]MRFSISIPQFDTGSFDGDGVRDYLARAEELGFAGGWTLEQTVGSSPIIAP
LELLAYAAACTTRLRLGVAVLVASQHDPLQLAAAVTAVDRLSHGRLDVGV
APGGGARNFAAFGVDKQTFIARFTEGLDLMKLAWSDEERITFRGRFRDVA
DLAFQPKPVQRPHPPIWFGGHAPAALARAVRFGDAFLGAGSSTTAAFAEE
VTTIHRELAIQGKDPARFTIGKRVYLMIDDDRDRAHTRVQTGLRRIYGEM
KGIDAVPVSGPPEEVAAGLRAVADAGAEMILLNPVGKDVAEDREQMERLA
AEVIPQLA
169630871YP_001704520.1 hypothetical protein MAB_3791 [Mycobacterium abscessus ATCC 19977]MKTRYAATFFAVGMALTACNHGGIHRTATSTSPAPSRLDSLPSCFSIKPQ
AIEPDPDPTLDCVLRSNDPAKLTFEALGTPPITIKVYEPNGIMRQSFTVP
VNKPERTAPLLADLDRDGRDELIVVSDVGSAGDTLDIWRAQQDSGRFVSA
GQMSGYPDFRITDERFTALYASTGAGSGRVSLYRFVDDKVVEVGSLFVQA
ADWPDPPDPARIWYTNGNTLCSFDYDDSPPGRAAARNQALTDAGIDPPSA
QDRFCQQTWVADVYRKR
169630870YP_001704519.1 hypothetical protein MAB_3790 [Mycobacterium abscessus ATCC 19977]MTRADKTTVRKAAHLAALLALTVAPAMSGCLDTSGSRELTPSQSTSSTAA
TPTRSYPALPPEYRGKFHPNHTDLGGRNNAELASLLPTAADFPGPGETRA
PDIASDDGSGLGMHGQTDGETRPPECLYAPFSKSFSRTPDGSDWNLYYAA
STYHEAEPPGNHITVTVNRERENADVFALTADWIKKCGQYDRAFPAFAKP
EVRNRHVTDTFGPGPTVDGVQTYVYTTASTDLDDTSADKQPSGVRGQRIV
LARVRSLVFEVAGTDQVDGGLLDQLLAITITNAKHAPPPPDQNAARLAGL
PTCDTIAPQPMNGQPDPALDCTIHTSDGSGVVFEVLGTPAGTIRVFNGNG
AQLQSIRVPNPIFQQRLPFLQDLDQDKREELLVVTATGNPAGDLMDVWRA
RPNSDQFDMTGTIFGVPRFWMTSDRFIGLFSRNGNDAGVAALFRFVDNKL
AVLALLDTERRVDNKPLDPKWRLNANVKCAMNLSDDPPGALGARMDALRA
AGVDQTNAEEHFCLQPWVATLYRQGTR
169630869YP_001704518.1 protease IV SppA [Mycobacterium abscessus ATCC 19977]MFAFTTPTDVHDLLAKVDTARHRGVPRDCILELDLLEVPPESVHLDPLGL
VLSGGSRPLSLRHTIAAIHRAIEDPRVAGLIARVQIPPAAAGAVQELRAA
IEAFSAVKPSLAWSETYPSTLAYYLASAFGEVWMQPSGTVGLIGFAAKGT
FLRGALDKAGVEAQFLTRGQYKSAANLFTEDGYTDAQREADGRLLESLSE
QVRDSVAVSRKLDPAEVDALADRAPLRRTDAVAGGLVDRIGYRDEAYARI
GELIGLQDDRDPPLLYLARYARATKPQVPSLSSLPGRPSRPAIGVVTLAG
PIVSGRSGPRLFPPGPASGGDVIAEALRDAVADDSVAAIVLRVDSPGGSV
NGSETIWREVVRAREAGKPVVVSMGSVAGSGGYYVAMSADAIIANPGTVT
GSIGVLTGKFITKGLKEKLGVGSDSLRTNANADAWSSNEPFTDEQRDLVE
AEIDMHYEDFVQRVADGRNLTVDAVKAVAQGRIWSGKDALEHGLVDELGG
FREAVAKAKQLADIGADDNVRIANFPSSPLSSLLRQRSSSQPAAAAVTDA
VLGRVAQLAVETVQRAQRTLGSAQAMMLGDYRF
169630868YP_001704517.1 hypothetical protein MAB_3788c [Mycobacterium abscessus ATCC 19977]MNTELTVFQKRVLAVLTGVGIAFGIYFLRDYLILIVVAGVAAYLFSPLYR
RLGKRFGSGIAATLTLLCALGAVVIPVGALVYVATLQITRMVDDVSSWVE
GTDMTALGQKAFDVVNSVLARIPFVHVQLTPDTLRQSIGSLTENVGHGLL
QVLQSTVGSVAAAVAACIIFLYVFVSLLVKQDKVLTLLRQLNPLGEEITD
LYLDKIGAMVRGTVKGQFVIAMAQGIAGAASVYVAGFRQGFFFFAILLTA
LSIIPLGGGIVTIPFGIGMILFGHPVGGLFVIAWHLLVVSNIDNVLRPFL
VPRGARLDPALMLLAVFSGIAAFGFWGIVLGPVLMIVIVTTIDVYLAVYK
GVPLEGGDADEPETPGRPWWKRWRSGATG
169630867YP_001704516.1 hypothetical protein MAB_3787 [Mycobacterium abscessus ATCC 19977]MARTDDDSWDLASSVGATATMVAAQRALASHVPNPLINDPYAEPLVRAVG
IEYFTKLASGAFDPEQMAGLVQLGITADGMANGMASRTWYYDTAFESSTA
AGVRQAVILASGLDTRAYRLTWPAGTTVYELDQPEVITFKTDTLAELGAS
PSAERRTVAIDLREDWPAALQAAGFDPEQPTVWSAEGLLIYLPPEAQDRL
FASITELSAPGSRLVCEQVPGLETADFSKARELTRQFAGETLDLDLESLV
YTQERQMAADWLAEHGWTVITEENDELYARLNLDPPNPLLRSIFPNIVYV
DATLG
169630866YP_001704515.1 hypothetical protein MAB_3786c [Mycobacterium abscessus ATCC 19977]MAESHVRSRAAATGGSVMKLHRHSVVLDARPYTIIRLRADAHVRFSTNNF
HETWHVISDEPGAKTLARLLWGLAYQRLPGTLVLIDGRHLDTNPFDAEPT
DPIVLLPSHLTVLTRQAARSLRRLSWTNPDGTVRWRTHGLDTRAAEFHEW
RDTPIGQREYPFIPEPTGWQTVARVGGLLVLAGGPQTLRQWAVHAELMRI
TAPWDTDYEYLADREGEIQIFRNYHREVRIARRARADVLDGPHPADRQQL
REAIWARAAQIRRQYLETADEAVLTGPESRTRGGTFGR
169630865YP_001704514.1 lipoprotein LppF [Mycobacterium abscessus ATCC 19977]MRATGWLVIVFSLVLAPVAWNAGAPAVQAAPGCRQLDSALPWYGDVRQRL
QAAIDANSTCTGTWKRSTKAVALFDWDNTEVKNDIADATLAWMLRHDKVL
QPADWHATSRHITEAAAAALRTACGTDTPAGRPLLTSANAACADEILAVR
EGKTHDEQEAFTGYNQRWSNGAYVWTVALTSGYTAGEVAGFAQAAKRENL
AAPVGATQRIGSTTVPGYVRVYPQIKDLIATLQAHGVSTWVISASSEVIA
KVWSPEIGIPTTQVIGVRSVYDANGRQTPHVQGCGGQPDGADTVITYVDG
KRCWANQVVFGVQGPAAFEPYDVNKRQILAAGDSTTDVTFVDDATAAHLV
INRNKTELMCRAYDNADGKWLITPMFIDPDPQRMDPYPCATDGRTNPDGS
TGPLLRSDGSVVPDQKDTVFSTGM
169630864YP_001704513.1 preprotein translocase subunit SecY [Mycobacterium abscessus ATCC 1MVLYRVGATLPSPGVNYANVKYCVEQVSSGDSAQIYSLINLFSGGALLQL
SVFAVGVMPYITASIIVQLLTVVIPRFEQLRKEGQSGQAKMTQYTRYLSV
ALALLQSTSIVALGASGNLLQGCDRKDEIVADQSIFALSVMVLVMTAGST
LVMWLGEMVTERGIGNGMSLLIFAGIAARIPAEGKTILDSRGGVTFAAVC
VAALLIVVGVVFVEQGQRRIPVQYAKRMVGRRMYGGTSTYLPLKVNQAGV
IPVIFASSLLYIPGLITQLVRSGGNKEKTGWWDRFVSTYLTDPSNYWYIA
IYFTLIVFFTFFYVSITFNPDERADEMNKFGGFIPGIRPGRATADYLRYV
LNRITWPGSIYLGVIAILPNLFLQIGSSGGAQNLPFGGTAVLIMIGVGLD
TVKQIESQLMQRNYEGFLK
169630863YP_001704512.1 adenylate kinase [Mycobacterium abscessus ATCC 19977]MRVVLLGPPGAGKGTQAQLISEKFGIPQISTGDLFRSNISEGTELGLQAK
QYLDAGDLVPSEVTNKMVEARLDEPDAAAGFILDGFPRTVDQADALAAME
EARGVTIDAVLEFRVPVEELVQRLLGRGRADDTEDIIRNRLNVYRDETAP
LLEYYQNVLQTIDAVGTVDEVFARTSQALGR
169630862YP_001704511.1 methionine aminopeptidase [Mycobacterium abscessus ATCC 19977]MGLFGRKKTVEQRTPGELDAMAAAGSIVGAALVAVRDAAKAGVSTLELDQ
VAESVIREAGAVPSFLGYHGFPASICSSVNDQVVHGIPSATAVLADGDLV
SIDCGAILDGWHGDSAWTFAVGTVIPSDEALSEATRLSMEAGIAAMIPGN
RLTDVSHAIELGTRAAEKQFDRAFGIVDGYGGHGIGRSMHLDPFLPNEGA
PGKGPLLAVGSVLAIEPMLTLGTTQTRVLADDWTVVTTDGSRAAHWEHTV
AVTEAGPRILTMRP
169630861YP_001704510.1 hypothetical protein MAB_3781 [Mycobacterium abscessus ATCC 19977]MTQPPAGPPPPDPGQPEFPPYPTPTSSGYPPVEPSPGAYPPIPPAAGPGA
EPYPPYPQANPAGYPPPPGYPPPASPYGAYPAAGAYPPVESARGTNGFAI
ASLILGIVPICAGIFGVVFGFISLNQIKRTGQNGRGMAIAGIVLGFIWMI
VLAVVVAVGAGNSAKRDESGHVTQSGDMDVTKLRVGDCVADLGEKSYYTT
TKAIPCAQPHKAEVYAVLPLSGSSLPSQSVLDEKGNEECGAELESYAPSA
FDDDSVQITYLYPTKRSWAQGDRAIACVATFDTQRTASIKGK
169630860YP_001704509.1 dTDP-4-dehydrorhamnose 3-5-epimerase RmlC [Mycobacterium abscessus MKIRELSVPGSFEITPVQHHDSRGVFLELFKGPALAEAIGHPFELQQANC
SVSAAGSLRGIHFADVPPGQAKYVTCLTGSVYDVVVDIRVGSPTFGAWDA
VLLDPRDRRAVYVPEGVGHGFLALEDDSTVVYLCSAGYAPGREHGIDPLD
PTVGIQWPTRRPDGTELSLLVSEKDGAAPSLLDARDSGLLPDAAEVQAFL
DGLSG
169630859YP_001704508.1 dTDP-glucose 4-6-dehydratase RmlB [Mycobacterium abscessus ATCC 199MRILVTGGAGFIGANFVHATVRERPDVSVTVLDALTYAGSSESLAPVAAA
VQLVQGDICDPDTVERLVADSDVVVHFAAETHNDNSLADPSPFLRSNIIG
TYTLLEAVRRHQVRLHHISTDEVFGDLELDDPNRFTETTPYNPSSPYSAT
KASADLLVRAWIRSFGISATISNCSNNYGPYQHVEKFIPRQITNILTGRR
PRLYGAGANVRDWIHVDDHNSAVWRIIEAGTIGRTYLIGADGERDNLSVL
HTILELMGKSSDDFDHVTDRAGHDLRYAIDPTPLRDELGWKPTHSDFTGG
LAATIDWYRRNEEWWRPIKDNVESQYAARGQ
169630858YP_001704507.1 hypothetical protein MAB_3778 [Mycobacterium abscessus ATCC 19977]MGESKLNRYGVWKGGPVTPEQARTIEDLGYGSVWVGGVFTADLAYVEPLL
AVTENLTVASGIVNIWTSPVDEIAAAFHRIEAAYPGRFLLGVGAGHPEAS
AEYRKPYDALVEYLDGLDAAGVPKERRVLAALGPKVLKLSADRTAGAHPY
LTTPEHTRQAREIIGPDALLVPEHKVVLSTDAPSAREIGRRTVDFYLTLS
NYVNNWKRLGFNDEDLTSPGSDAFIDAVVAHGTAAEIATRLNEHLDAGAD
QVLIQVLGDKGLVDTLTSLADALR
169630857YP_001704506.1 hypothetical protein MAB_3777 [Mycobacterium abscessus ATCC 19977]MSSLVIIVIIAIAALVLFVALPLIYVRNYVKVPPNEVAVFTGRGQPKVVR
GGARFKMPGIERVDIMSLEPFNVNINLQNALYNNGVPVNVEAVGLVRIGS
NDEAVQTAVQRFLTSDLSELQRQINEILAGSLRGITATMTVEDLNSNRDS
LARSVVEEAGGDLARIGMEVDVLKIAGISDRNGYLESLGQRRIAEVRRDA
TVGTAEAERDAQIQSAQARQAGAIAQAEADTAIATATQKRDVELARLRAQ
TEAENAQADQAGPLAQARAEKDVGIAREQAEAARVQARTEVEQRRTEQAQ
AALQADVIAPAEARRQADIAIAEGARQAAILKAQSDAEAERQKGAAEADA
RKAAADAFRVEQQAAADGAKAKLIAEADGTKAKLLADAEGIKAKLLAEAD
GKKEVAAALNAYTPEAARLLTLPDILNSVVQATEAASKPIGEIENLSIIG
GAGDAQDALGTLFGVSPQAVAKVIESLRVSGIDVPDLLKRTQQADAPASP
APAPAVHPEGWVQE
169630856YP_001704505.1 hypothetical protein MAB_3776 [Mycobacterium abscessus ATCC 19977]MDGLMVGYLAAFAVGGIAVLSALLLTDIGHGDGMPFLSLTSLSAALTGAG
AGGFAASALGVAALPTAIIAAVCAVALVSVLQLFLTYLRGQQANSHSGRA
SYIGRLGTVTLELPAGGGWGEVAFTDADGNRVRSRAITDEPAGLAKNAPV
YIADVDSEYLHVVSIPDASPDASAPSNQ
169630855YP_001704504.1 putative monooxygenase [Mycobacterium abscessus ATCC 19977]MAHLAAVSADARRDITDDAVVIVGGGPVGLLAATVLARQGIRVVVLEAAG
SKERQRHRNCATFVGHSTLRRYDRVAPGLGKRLRESALAVHGVQTFYQGR
PVFVMSSYAPSRIPGPWNPAAWGMSLSQRTIEDETLTEALELGVEYHPGT
AVTDISTDHTGARLMLASGERVRASYVIAADGTKSAIRQALRIGMSERPP
SPSCVVIDVEPHPDGTTVDLPVQIQYHHPDLGGRHAIRLPYPDGLRLDVQ
FLPKDEAPPTTEQVRSWVTALTRDQWYADHIRSVEVHQTIQGVAASYTDV
NRRVLLAGEAAHQFAPLGGRSLNSGVADAIVAAEAIAEALSEPSDLAAAW
LAINRSARERRRSGVRNRMLSVRAQRVLDGSDVSMRARRTMAAKSAPHVW
IAGAWLTAGLVRPTAIPHISRSGVTWS
169630854YP_001704503.1 translation initiation factor IF-1 [Mycobacterium abscessus ATCC 19MAKKDGAIEVEGRVVEPLPNAMFRIELENGHKVLAHISGKMRQHYIRILP
EDRVVVELSPYDLSRGRIVYRYK
169630853YP_001704502.1 50S ribosomal protein L36 [Mycobacterium abscessus ATCC 19977]MKVNPSVKPICDKCRVIRRHGRVMVICQDPRHKQRQG
169630852YP_001704501.1 30S ribosomal protein S13 [Mycobacterium abscessus ATCC 19977]MARLVGVDLPRDKRMEIALTYIYGIGRTRSKEILAATGISPEQRSKDLTD
DQVTQLREYIEATLKVEGDLRREVQADIRRKIEIGCYQGLRHRRGLPVRG
QRTKTNARTRKGPKRTIAGKKKAR
169630851YP_001704500.1 30S ribosomal protein S11 [Mycobacterium abscessus ATCC 19977]MAPKKPGAAGPKKAQKTRRREKKNVPHGAAHIKSTFNNTIVSITDPQGNV
ISWASSGHVGFKGSRKSTPFAAQLAAENAARKAQEHGVKKVDVFVKGPGS
GRETAIRSLQAAGLEVGAISDVTPQPHNGCRPPKRRRV
169630850YP_001704499.1 30S ribosomal protein S4 [Mycobacterium abscessus ATCC 19977]MARYTGPVTRKSRRLGVDLVGGSSAYEKRPYPPGQHGRARIKESEYRQQL
QEKQKARFTYGVMEKQFRRYYAEAVRSSGKTGEQLLQILESRLDNVVYRA
GLARTRRMARQLVSHGHFTVNNVKVDVPSYRVSQYDIIDIKPKSLNTLPF
EVARETAGERPIPGWLQVVGERQRILVHQLPERAQIDVPLAEQLIVEFYS
K
169630849YP_001704498.1 DNA-directed RNA polymerase subunit alpha [Mycobacterium abscessus MLISQRPTLSEETLAENRSRFVIEPLEPGFGYTLGNSLRRTLLSSIPGAA
VTSIRIDGVLHEFTTVPGVKEDVTDIILNLKSLVVSSEEDEPVTMYLRKQ
GPGAVTAGDIVPPAGVTVHNPDMHIATLNDKGKLEIELVVERGRGYVPAV
QNKASGAEIGRIPVDSIYSPVLKVTYNVEATRVEQRTDFDKLVLDVETKN
SISPRDALASAGKTLVELFGLARELNVEAEGIEIGPSPAEADHIASFALP
IEDLDLTVRSYNCLKREGVHTVGELVARTESDLLDIRNFGQKSIDEVKIK
LHQLGLSLKDSPTSFDPSEVAGYDVATGTWSDTGSYDFDGDQDFAETEQL
169630848YP_001704497.1 50S ribosomal proein L17 [Mycobacterium abscessus ATCC 19977]MPKPTKGARLGGSSSHQKAILANLATALFEHGRIKTTETKARVLRPYAEK
LITHAKKGDLHNRREVLKKIRDKDVVHALFEEIGPFYADRNGGYTRIIKV
ENRKGDNAPMAIIELVKEKTVTSEADRARRVASTKKAEAPAEEAKVEEVV
EVEADTADDAAAEVEGAADTADAAEDADKKD
169630847YP_001704496.1 tRNA pseudouridine synthase A [Mycobacterium abscessus ATCC 19977]MVTSHDQPAIPDGGLVRLRLDIAYDGTDFAGWATQVNQRTVAGVLGEAFT
TIVGDSVQLYAAGRTDAGVHATGQVAHLDVPVACLPGLRGRYRPAGAPEF
DRLVRRLSRFLPSDVRVLDISRAPAHFDARFSALRRHYEYRLSTASFGVL
PLARHDVVGWHRPLDVDAMNEASRNLLGLRDFAAFCRHREGATTIRELQR
FDWGVDGQRLTAYVSADAFCWSMVRSLVGAVLAVGEGRRPVQWCVDLLNK
ERRSSDFAAAPARGLTLVGVDYPPDDQMAARVMITRDVRIRPSG
169630846YP_001704495.1 hypothetical protein MAB_3767c [Mycobacterium abscessus ATCC 19977]MRNVRWIGAVAVAGAMCVAGCGGGSTTEIPPSIGSSSETRAVAPAKPVQN
LVLTAAELPPGLTVTPIEADEKQVILDQLTGSADEGATFTPAECRLPSMF
EPSAPVDASKLGVVVGEAGRGYFNEAVVAQRPAVAQLRTFLDTCKTVRET
HGGTSIETTYTVLDGVRSKADELVVVHEQVPGVLVKQDAYTAYASVAGHA
VWVRMRTLGGDAPDRPLFDQLVTASIDKVAAAR
169630845YP_001704494.1 cutinase cut3 [Mycobacterium abscessus ATCC 19977]MTTHQRGTRVGVVLSSFVVLTVLVLSAASVVGPVSAVPRASADPCSDVDV
SFARGRKEPVGLGRVGDEFVDSLTPRVQATGATMNVYPVNYDAGIFSAGG
GANDLSNHLQSVAASCPRTKLVIGGYSMGAEVIDTIIGVPNVGIGFNRPL
PPTVGDRIVAIATFGNATHRTGGPLSGIAGVFGSRAIDLCNQGDPICMAG
PNNSWDAHTSYERTGLPAEAAAFVASKLNRHGESEAE
169630844YP_001704493.1 cutinase cut3 [Mycobacterium abscessus ATCC 19977]MTTHSAVLPATSYVRRPGYLLAALLMFASLVAMSQPVPAAADPCAAVDVS
FARGRDEPVGLGRVGDAFVGALQNRVSNMNVYPVNYSAGLLSTGEGADDL
RNHLSEVASSCPNTKFVIGGYSMGATVVDDVAGNPPPDVASRIRGIATFG
NIDRRGGGMTGPLAGRWIDQCNPGDPVCQEGGRSWTAHTSYEQTNLPAQA
ASFVAGKL
169630843YP_001704492.1 epoxide hydrolase EphA [Mycobacterium abscessus ATCC 19977]MTVSQITHRQLSVNGIDMHIAEQGEGPAVVLCHGFPGLWYTWRHQLAALS
AAGYRAIAPDMRGYGRTTAPRDAAAYDRGTTVGDLVGLLDALELRKAVFC
GHDFGAHLVWDMPAWAADRVLALIQLSVPRTRRLPVKPSVGFNYLASQHF
THLEYFQEPGLAELELDAQPKAFLAALFHALSGANRYLDCWDHPARVNGK
RNGYLDVLPNPPALPWNWLSEPDLDYYAAEFARTGFTGGLNWYRAEDLVW
AQNEDLHDRPVEVPVAFIAGAADPVLEMLGRDPMTAMSDLVPGLRSALIV
EGAGHFVQMERPDVVNHAMVEFLDSLPGR
169630842YP_001704491.1 cutinase cut2 [Mycobacterium abscessus ATCC 19977]MTLQPNPRPASKLLTAAARAAVVSVAAIMLTTGLAVVIPATASAACPNVE
VSFARGRSQPPGLGNIGDAFVSALRNRVKNLSVYAVRYDANTDVGGGAND
LSAHLQQTANNCPDTKLVVGGYSLGAGVVDTALGVPGPVQIGNLFSFDNP
VPPEVGDHIRAIVTFGNIVNRFAPVQSLAGAYGDRVLDLCNDGDPVCMDG
NQDTWKSHTSYPPALINQAADFAAARVN
169630841YP_001704490.1 hypothetical protein MAB_3762 [Mycobacterium abscessus ATCC 19977]MNDKANFRAGVILALVSAATFGFSGPFAKSLMAAGWSLTAVVTARLATGA
AVMVVAACIAAPGWFSEARRHAKVVVLYGIIPVAGAQFCYFGAVRHMSVG
VAMLLEFLSPILVIAWTWMITRHRPHTRVLAGATLALSGMLLVLNIFSGG
RVEPVGIAWGLGAAVCAAYYFISSHRAGGKAEELQPITLATSGLLVGAVA
VGGFGLTGIMPLTFSTQDVHVAGWNTPVYVPILVLGVVTTAIAYITGIAA
ITRLRPSYASLIALTEVLCAVIAGWVLLGETIAPIQYAGAAVILAGLMLA
HRGSDTPGEPESSGAGLTASLPAGLKSHGDDSELSVTSVCDATTESTPSQ
169630840YP_001704489.1 hypothetical protein MAB_3761c [Mycobacterium abscessus ATCC 19977]MRSAAELINTGRNDRELLPDVAALPPLLDRYGWTGRRDGDDAELEAVKAL
RARLGDIWARINDEEYVVRQVNALLADTHASPWLTRHVEEPDWHLHMAAS
DAPLADRLGAETAMVFADLVRTGEQRRLKTCAAPDCDAVLVDLSRNRSRM
FCDTGNCGNRQHVAAYRERLRDEA
169630839YP_001704488.1 hypothetical protein MAB_3760 [Mycobacterium abscessus ATCC 19977]MTSSGAAPEQVRRATMPIQIMVISQLLVLAAVLISLLFGWPWWAALLIAI
VSLALVLGRWGGQTVRHWAVTGFKYLTGRTYRSSGSIADTPSGQDSWTGT
RWENGKLITVLEISATQRHPSVITPDHCATDSLVPLRVLRECMHQNDIEL
ESIDVISNGQRTAQGTVLRGGYDRLVGPLPAVAIRTVWVVLRFDPGANVD
AVFRRGGGRRGAERCAVIATARVRRALAAAHCASTILQAGQIHRISAEML
RQYAGAPMHEDWSGLTLIDSYNVAMGIDPWYITDATLTGLWARPTLETSV
TVRLRPAAKGRTSVGALVRWATDEQLPVRHSTGMTSLNGSQRDAFFAGLP
VGAIGLEYLTRSIEMSNEELDGIHLPTSGCGQLIGSDMSGRAIATRLSGQ
GVHTVVVRAELYVCQQVVLRAVAIGALVVVYTDRPHMWDVMVTSIGDANR
IQFASGPGFIDPRCTLAVVDGMQPTALPSNCTALHIISSEYDALPARPDV
IIDQPNGYGDHILLTAGGETIQVRLVTVSDELAYLGRPIQAFAQ
169630838YP_001704487.1 hypothetical protein MAB_3759c [Mycobacterium abscessus ATCC 19977]MARQPTTRLQVSGYRFLVRRMEHALVRRDVRMIHDPMRSQSSSLMVGIVL
ATVVVAGCAILAFFRPNMPLGDQPIVMGKDTGAVYVRIQDTLHPALNLAS
ARLISGNNENPKPVKDSELAKARRGPLVGIPGAPASIPGALTGDDTIWTV
CDVATPPPSSTVTTTVIAGKVTLENGNQEMPKDRYALVTVNSQMYLLYDG
KRAAVDLTNPAVTRALRLEGVTPRPISMNVLNAIPEVPAIAPPPIPDAGA
ASPITTAGVRVGSVIKMSRADSAEYYVVLAGGVQRINEVTADLIRFSDSQ
GAQEIVTVAPDVIAGHPSLNLLAVQTFPDRAGKIVDVPEKSVLCSSWKPG
QEKTQEHASTKLLMGSSLPLKTDQVPVVLAQADKEGPNLDTAYIPPARSA
FVRSTGLGGDTGRAESLYLILDTGVRFGIGNLEAAKALGLNVEPVPAPWP
IVGLLPPGPRLSKEDALVVHDGMPPDKTGLAINPSTSATQAPS
169630837YP_001704486.1 putative protease [Mycobacterium abscessus ATCC 19977]MSLGVARRIATAGAVVMLAMSSQLATGSMHVMATAHAFAPLPVDPSMLPG
PRPPAPIEPTEQKELCRFPGIDPKRDLNKVPTQQRGLDLPLVWQLSRGAG
QTVAVIDTGVARSPRLPPLIPGGDYVFEGGNGTQDCDAHGTIVAGIIAAA
PDPTGASAFSGIAPDVSLITIRQSSAKFAVKNKGGNDRDDPSKISGVGNV
DTLAMAVRTAADMGATVINISEVACASAKQFLDDRPLGAALQYAVDVKNV
VVVVAAGNVGDGQCKSQNPPPDPARPNTPDWDSVLETVSPAWYNDLVLTV
GSIGPDGQPSKFSLGGPWVDVSAPGEDIVSLDPNRDALTNAYMGDQGPVP
IQGTSFSAPVVSGVVALVRSRFPQLSAREVMDRIKNTAHRPPGGWDPYLG
FGVVDALAAVSDDLGTTSDLARANAAKKLVLPPAPPPPDPRPRRVALIGI
AVCAAFLAAALAMLAPVRRLRQSREHPDE
169630836YP_001704485.1 hypothetical protein MAB_3757 [Mycobacterium abscessus ATCC 19977]MTHAQSGAEQRSAVLELCRVSIQAERTQVDLALPTSVPLALLVGSIVDII
NQHVGVPELTSPEDAVETHWRLSRPGQPPLQMSSTLGELEVRDGDLLILT
RSDVAAPDPLFDDVFLAVSTFRTVSAHPWSRNAARILGASVCGLSALLGA
TALLRAGATNPGLLLPIIAVAIALVAMTAAVFANRVYDDSLASVMLSHCA
VGFSAVAGALFVPGKYGAPHAMLALMVAMVVSILAMRATGTGTTSLVAVA
SASFLGFAAALGYVLFEPPIYSLGAVLGSVGICAVALSPRVAMVLARLPL
PPVPTQGAPSRPEHSTAPIEAIEGLDGLDTEGDDVEDATALPPLPDLREK
ALRAHAVLTGLVCGTSAVTAVGAMLAALTFSGAGGHHPTGAHRLSGVVLA
GLIALAMMLRARSHADLAQTVAINLGGIAIPAAAFAFVAVAYPTAAVFTT
VLAAIAAGSAIALGFLVSARKYSPVARRTVEIIEYIALSLIVPIAVWVCG
VYSAVRGLNLP
169630835YP_001704484.1 putative FtsK/SpoIIE family protein [Mycobacterium abscessus ATCC 1MPGGEVNVQPPPEIPRPVPSPIIAKIMPLVMVVAMVGMIAFFVTSGSFGG
GAGGGMMRSPMFMLFPIMMMVSMVSMVSNSGGKGAKTSEINEDRKDYLRY
LEVVRKNVTDTGAAQRKALLWNNPDPSALWTLAGGRRMWERRPGDSDYCH
VRVGTGDQRLAAQLVAPEIGPVEELEPVASVALRRFVRTHSLVPELPIAL
NLRGFAAVTIDGSPEVARGMLRAMICQLAMFHGPDQFLVAAVVNRHAAPH
WDWLKWLPHSQHPSAFDGVGTSRLVYHSLGEVEESLASLITERERFSRTA
QPSPDRPQILIVVDSGTLIGSERLIVDHGIDSVTLVEIGTRVDPLAARRG
MQLELTERGLGAKGNVGSEVFAHPDHLTITEAMACARRLAPYRVLTGSGD
EVQIQTEVSTRWSDIVGIGDPGLLNPEVVWRNRVGRDRLRVPIGIAVDGT
PMELDIKEAAENGMGPHGLCIGATGSGKSEFLRTLTLGMIATHSPDALNL
VLVDFKGGATFLGLDRAQHVAAIITNLAEEANLVSRMKDALAGEMNRRQE
LLRAAGNFANVTEYERARAAGASLSPLPALFIIVDEFSELLSQHPDFAEL
FVAIGRLGRSLHVHLLLASQRLDEGRLRGLESHLSYRLCLKTFSANESRA
AIGVPDAYHLPNTPGSCYLKDDSGELTRFQTSYVSGPYVPYGPARRTVSS
GGGGAAPRLFTAAPVALQMRPAEVVEDDSPAVSEATGRSVIDTILDRVEG
HGNPAHEVWLPPLDDSPTLGDLIPRHGRAGFDAVGSLTVPIGIVDRPYEQ
RRDPYIVDLSAAAGNVAIVGAPQSGKSMAVRTLVTSLAVTHSPAQVQFYC
LDFGGGTLTSLAQLPHVGSVASRLESDLIRRTFAEMLTIVRSRENAFRAY
GIDSMAEYRRRKGAGDPQLANDPFGDVFFIIDGWSTVRQEFEALEPQVTA
LAAQGLGFGVHTVVTASRWAEIRPALKDQIGTRVELRLGDPLDSDFDRKL
AQLVPDGRPGRGITRDRRHMLIGLPRVDSISSNQDLGEAIAAAAASMRQR
SSVEAPQVRMLPHKIDYAALVPQAPQNDQPNLRILVGINESELAPTFLEF
GEQPHMMIFGDSECGKTALLRTMCREIVRTTTPQQAQLFIVDYRRTLLGV
VETEHLAKYAMSSNTLVDEVPALIELLKSRMPGPDVTQQELRDRSWWSGP
EIYILVDDYDLVALASGNPLLPLAEYLPHSKDIGLHVVIARRTSGASRAM
FEPMMARMKDLSCIGLQMSGNKDEGVLLGTVRPSEQPPGRGTLVMRSGGQ
QLIQVAWSEPQ
169630834YP_001704483.1 hypothetical protein MAB_3755c [Mycobacterium abscessus ATCC 19977]MILDRDPQTGARVAIEVTETAVRARTDEGIQEAGRADVRSAVAALDDDMA
LLPGRVVPSRALWAALFESLLTDRNAPVRLDSLVLIHPTTWGPARRTLLS
SAARMMAATLTVRSRAFALAERGVRADLSGRSLVVVEVSPKEVAVAVVGP
GSDGEPAATVRHLEDRSWETRSAADVARAVGCAVERVVRDERPGVAAILV
DSADKDMGEAIVDAIDRIGLTPGVSQVAVDSVFREMGQAARTSAFLDQGV
VEPVATRPVSAWTPGAPARSTPRLPRWWPPAAIGLAAAIVVTGVVLTVAS
TRSRQPAPAIATSLLVEGRVQLMVPAEWAVRRIPAGGAGSARVEVISPAD
PEAVVHVTQVRVKPAETLAATAETLRAAMEKEPQGAFSDFRADDRKMDRP
AVTYTEVREGHDIAWTVLLDGDLRIGVGCQFKKDSYADVRQACELAIHTA
HAVKSGS
169630833YP_001704482.1 hypothetical protein MAB_3754c [Mycobacterium abscessus ATCC 19977]MAVFQNDLALLDSTAKKIDGKYQEFTAMQSQLRDRVAVGTSTWQGQARHA
FDEAMARFDQEMGDIQKVLIGIHDTMESNKRRIQEMDESQTF
169630832YP_001704481.1 hypothetical protein MAB_3753c [Mycobacterium abscessus ATCC 19977]MSQITYNHGEIDALVADVKGIINKFQAGLEELQHDIQPLVQQAEGQEATA
YQEYQKAWHQSAEDLNQILTQLNAKVDQGNQDAQHTDQSAAGAWHH
169630831YP_001704480.1 50S ribosomal protein L13 [Mycobacterium abscessus ATCC 19977]MPTYTPKAGDVTRTWYVIDATDVVLGRLAVQAANLLRGKHKPTFAPHVDG
GDFVIIINAEKIALSGNKLTNKFAYRHSGFPGGLSKRSIGEQLEKFPTRT
VEKAIVGMLPKNKLGRQIERKLKVYAGAEHPHAAQQPIPFEIKQVAQ
169630830YP_001704479.1 30S ribosomal protein S9 [Mycobacterium abscessus ATCC 19977]MTDIEEQTPAEDAANTDNGDQEVAEVVVEESADDTVAAAAPRGPVVIDKP
IQTVGRRKEAVVRVRLVPGTGKFHLDGRSLEEYFPNKVHQQLIKAPLVSV
NRVDSVDIYAHLTGGGPSGQAGALRLAIARALIIVEPEDRPVLKKAGFLT
RDPRAIERKKYGLKKARKAPQYSKR
169630829YP_001704478.1 phosphoglucosamine mutase MrsA [Mycobacterium abscessus ATCC 19977]MGLFGTDGVRGVANADLTAELAMALGAAAARSLGRAHAVAVVGRDPRASG
EMLEAAVVAGIAAEGVDVLRVGVLPTPAVAYLTGAYGAAFGVMISASHNP
MPDNGIKIFGVGGHKLDDDAEAAIEAQLEALSIRPTGGGIGRVRDAVDAL
DRYLHHVENAGTHPLSGVTVVVDCAHGAASDAAPLAYRAAGAHVVDINAD
PDGLNINDGCGSTHLGPLQEAVRAHGAHLGLAHDGDADRCLAVDADGNVI
DGDAIMVVLAAAMAEAGELTANTLVTTVMSNQGLHIAMRAAGIDVKVTGV
GDRYVLEELRAGQFALGGEQSGHIVLPSLATTGDGIVTGLRLMSRMAQTG
KSLAELASAMRSLPQTLINVPVSNKHTVAQAPEVLAAVAAVESELAGNGR
ILLRPSGTEQLVRVMVEADEQSTAQRLAERVAQVVGAV
169630828YP_001704477.1 putative phosphodiesterase/alkaline phosphatase [Mycobacterium abscMTAFPRRTVLRAALLGLAAVPVAACGPALVTTRPRLTHGVASGFPRTDGA
VIWARSDRPAALIVETAATESFSDTRRFTGPLLTPDADGTGRIRLTGLPA
DSEVHYRVTLDADGALSEPATGVFRTAPATARDVRLIWSGDVAGQGFGIN
PDIGGMTVFRTMAERNPHFFIHSGDTVYADVPIPETLPLPDGRIWRNEIS
EAKSAVAQTLDQYRGQHAYNLTDANYRYFNAHVPQLVQWDDHEVINNWYP
GEVLDNDKYTEKRVDILARHGHRAFHEWQPLEAREAVDGRVYQRVSYGPL
LDVFLLDMRSYKDPNSPNRQQHGTILGARQAGWLINEMASSTAVWKVVAN
DLPLALVVPDGTTDFEAVANGDNDLPLGRETELAHILSQLKARKVRNVVW
LTADVHYTAAHEYSPARAAFTDFDPFWEFVSGPLNAGAGKESTLDGTFGP
RADFVHAAPPGKQSPLDGYQHFGQIDIDGGSGDLTVTLCDAAGAALYTRT
LARI
169630827YP_001704476.1 putative luciferase-like oxidoreductase [Mycobacterium abscessus ATMRIGTTLSYAGGFTEVVDELAELEKIGLDIAFVAEAYSYDAASQLGYLAA
KTSTVKLASGIFQLYTRTPTLLAMTAAGLDYVSGGRFVLGIGASGPQVIE
GFHGVKYDAPLGRTRETVEICRKVWRRERLEFEGKYFTVPLPPEQGTGLG
KALKLINHPVRDRIPVLIAALGPKNVALTAEIAEGWQPIFFLPEKANDVW
GAALAEGKAKRDPALGDLEVYAGPALAIGDDVEALYGFVKPSLALYIGGM
GAKGKNFYHNLATAYGFGKEADTIQELYLSGKKAEATDAVPDELVKNISL
IGPKSFVAERVAAFKEAGVTTLNVAPLAADAAGRIKHVEALRELL
169630826YP_001704475.1 hypothetical protein MAB_3747c [Mycobacterium abscessus ATCC 19977]MGKTRIDVAGVQGVAGEFDNIAGELQKAIEQLRGLSFGGASAGRWHTAKG
DDVRSGLREVVTHLEDWHRANTAIAEQLRATAQRYAERESKTAAKVTGVY
G
169630825YP_001704474.1 hypothetical protein MAB_3746c [Mycobacterium abscessus ATCC 19977]MANKWDIEALRGEGLQAIANSQNYVTAAIRGNGKSPVTITNPDLTANERQ
LFDWYDMDAGMDLNTLGGDLELFKNATATMKAAAERQHGQLQRLIGLWEG
KGSESANDFLKTHNSTADAVTDEFGKVSTGLDGLRNALWNIVDLKKQAST
MVDGLVTDRTHFDSAVATYKTGMGDKSQADETNATMIGPHVKNNIEGQLL
PAFKKAWSAGGGAYDTLINGLKQELPPDFKLPPGVFGPDYDTTDEPAKTT
KGKGKQDDKDGGETSGESGESGNSGVNSGAGGGTASGGMQGTATPASATG
NAGGQLSGAGQQQGAGQGQQGMDPSQMLSGMTGALTGALSSIGQAASGIV
SAITEGISSIPFDQMGQGLGDDQFDGRADEAADKKDEAAADGKKDPDAKM
AAAKDAAIEEARADSGATFATDGKPAPGIQLAGAGGLEATPTAAPGQTTP
GAPLGATPTGTIPPAAGGLSAAQPAGSSASLTPHPVQAQPPTVPQHPEPQ
SAAARQPSPLPSVGPTDASAQPQEAKTEAGETPCEIAADELPKAGR
169630824YP_001704473.1 hypothetical protein MAB_3745c [Mycobacterium abscessus ATCC 19977]MIDITEALAGIVADFESTLDQLRDEAEAARGEAVLGESELAKTAKPVDEF
RMPSQTYMSEADFDEDDVYRWQRWRR
169630823YP_001704472.1 hypothetical protein MAB_3744 [Mycobacterium abscessus ATCC 19977]MASTRTLFKALTRRGPHKVLRGDLAFAGVTGVVYTPEAGFNLPAVAFGHD
WLTGTDKYRATLEHLASWGIVAAAPDTEKGLVPSHLNLAADLATTLEIVT
RVRLGDGKISVHPSKLALVGHGLGASAAVFAATRTPALVDKKNRPVGAKA
VVTLFPSSTQPPVEASAVGLTIPGLVVTSAEDAHSLRSNAVALAQAWPGA
ELRYIAKAKAGGLPEHSWLRRFVGLGGASRTTQRNTRALLTGYLLSQLVG
DKRYRDFADAAAELPNTSLPAADGREISELDRVQSLLK
169630822YP_001704471.1 glucosamine--fructose-6-phosphate aminotransferase [Mycobacterium aMCGIVGYVGHRDALSVVLEALRRLEYRGYDSAGVALADGHGGLLVQRKAG
RLANLESAIAESGESFAATTGMGHTRWATHGAPTDRNAHPHQDATGKVAV
VHNGIIENFAVLRAELESAGVEFASDTDSEVAVHLVSRQFESGDTAGDFV
ASVQSVVRRLEGHFTLVFSHADDPGTIVAARRSTPLVVGIGDGEMFLGSD
VAAFIEYTRDAVELGQDQVVVITADGYRITDFEGNDDTGNARVFTIDWDL
SAAEKGGYEYFMLKEIAEQPAAVSDTLLGHFDLDRIVLDEQRLSDQELRD
IDKVFVVACGTAFHSGLLAKYAIEHWTRLPVEIELASEFRYRDPVLDRST
LVVAISQSGETADTLEAVRHAKEQKAKVLAVCNTNGSQIPRECDAVLYTR
AGPEIGVAATKTFLAQVTANYIVGLALAQARGTKYPDEVAREYHELEAMP
ELIERVISQMDPVADLARQYAQSSSILFLGRHVGYPVALEGALKLKELAY
MHAEGFAAGELKHGPIALIEEGLPVIVVMPSPKGMGLLHSKLLSNIREIQ
ARGARTIVIAEEGDETIRPYADHLIEIPAVSTLYQPLLSTIPMQVFAAAV
AQARGYDVDKPRNLAKSVTVE
169630821YP_001704470.1 hypothetical protein MAB_3742c [Mycobacterium abscessus ATCC 19977]MSPVAVPEHRVGKHWAVQKLGHFVDASGYARFVAAYRAGMARLPQIARSF
DVPTRLGSVRAYRFGACGGVPLLLLTGRGGSTPLWRANLTSLLSRRSVYC
IDLLGEPGMSVQDKPITGPQDHADWLEDVMAGLNLGAVHVVGLSIGGWAA
VNHAIRYPCRVRSLVLLDPALTFAPLTWKMVLVSLGSVIPGTPQAIRNRL
LSWSAGGAQVDESLPEAALISAAARDFRICLPSPKVFSDKQLRRLSMPVL
TVIAGRTIVHDARRAAQRARSAVPDNRVHVWPDASHALNGEFPGRISELT
HEFLDTVEAA
169630820YP_001704469.1 hypothetical protein MAB_3741c [Mycobacterium abscessus ATCC 19977]MRNYYSAQQIREAEAPLLAALPDGALMRRAAYGLAAVIADELSRRAGVVA
GRSVCGVVGSGDNGGDALWALTFLRRRGVSASAVLLNPERAHRAGLAAFR
KAGGRVVSVVPDDTDLVVDGVVGISGTGPLRPGAAAGIAEKITAEGIPVI
AVDIPSGVDVHTGAVDGPAFRAAVTVTFGGYKPVHALGDCGDVRLIDIGL
ELPESALREFDASDVAAAWPVPGPADDKYTQGVTGVLAGSSTYPGAAVLC
SGAAVAATSGMVRYAGTAAAEVVSHWPEVIATQTEEAAGRVQAWVIGPGY
GTAERQTRTLRRVLSTSLPVLVDADALTMLAEHPDLADLVASRPAATVLT
PHAGEFARLAGGPPGPDRVDAARSLAVRLKATVLLKGNVTVIARPDGTAY
VNRAHGSWAATAGSGDVLAGVIGALLSAGIAADKAAAMGAYVHARAAAAA
AADPGPGKAPISASRLLGHLRWAIAEIG
169630819YP_001704468.1 glutamate decarboxylase GadB [Mycobacterium abscessus ATCC 19977]MSKSRDQFRLSAHAGKINASAFSPAYTGRLSTAPVPALRLPDEPMDPQAA
YRFIHDELMLDGSSRLNLATFVTTWMDPEAEKLMAETFDKNMIDKDEYPA
TAAIESRCVAMVADLFHADNLSTEDPSSAVGVSTIGSSEAVMLAGLALKW
RWRTKIGGTDGTGWKGRTPNLVMGSNVQVVWEKFCRYFDVEPRYLPMAKG
RYVITPEQVLEVVDEDTIGVVGILGTTFTGELEPIAAICAALDKLAATPG
KPDVPVHVDAASGGFVVPFLHPELHWDFRLPRVVSINVSGHKYGLTYPGI
GFVVWRGKEHLPEDLVFRVNYLGGDMPTFTLNFSRPGNQVVGQYYNFLRL
GRAGYAQVMRCLSETARWFGDELGKSEHFEVITDGSAIPVVSFRLKGKRP
YTEFDISHSLRAFGWQVPAYTMPDDVTDIAVLRVVVREGFSGDLARALRD
DLNTVLKGLDELKPNGHFDEVQPFAH
169630818YP_001704467.1 alanine racemase [Mycobacterium abscessus ATCC 19977]MGPVSTTSTTTDGLPPSTGATTAQAVIDLGAIAHNVKLLREHAGTARLMT
VVKADGYGHGAVRVARAALAAGADELGVTSIAEALQIRAAGLDAPLLAWL
HAPGADYAAALHADVEVAVSSLGQLGELLAAARSTGRQAITSIKVDTGLN
RNGVPAGYTRDLFEALAKAQAEESIRLRGIMSHFAYADQPGHPTVDMQIG
RFNEALELARGFGLRYELAHLSNSAATLTRPDARYDMVRPGIAVYGINPL
GAAESATSNRGRTSFDLIPAMSLTCAVSSVKPVSAGEGVSYGHVWTAPRD
TNAALIGIGYADGVVRALGNRFEVAIGGRRYPNIGRVCMDQFVVDLGDND
AGVQAGDVATLFGPGTGGEPTAQDWAELLDTIAYEVVTGPRGRVVRTYRD
SRAVE
169630817YP_001704466.1 putative alpha/beta fold hydrolase [Mycobacterium abscessus ATCC 19MSNKSNAWLAGVAGLGAVVAVAGVGTARSIGRRRFDDPYRGENFDLLQTD
RGSIVTTDDGVPLAVREVGPSNAPLTVVFVHGFCLQMASFHFQRRELASR
WGDNVRMVFYDQRGHGRSGLPAPASCTVGQLGDDLESVLRVLVPRGNAVL
VGHSMGGMTVLAHARRHPEQYGRRIVGVGLIASAAEGLSHTAIGEGLRNP
ALRVLRTAVHYAPGPAHHGRGAIKSLVGPVLQAASYGGHRVSPTLVKFSE
RMIHQTPVTTIVDFLRALEQHDETAALPTIAPLPSLVICGDTDMLTPHTQ
SESMAARLAASGHNELILVRESGHLVQLEHPEIVNDGIDRLVRRSTPPLF
AAIKQRLRDRTGL
169630816YP_001704465.1 hypothetical protein MAB_3737c [Mycobacterium abscessus ATCC 19977]MIDESGSVALPTAQDTLEFGKRIGQGLAAGDVVVLSGPLGAGKTALTKGI
AQGMDVEGPVTSPSYVLARVHEARRPGAPALVHVDVYRLLEHQSADLLGE
LDSLDLDTDLDDSVVVVEWGEGLAERLSEHHLDIRLERAADSDERTATWH
WSRES
169630815YP_001704464.1 hypothetical protein MAB_3736c [Mycobacterium abscessus ATCC 19977]MTLILALDTATAAITAGLVRRAPDGSVQPLAERITMGAKGHAEALTPNIG
VACADAGVAVGDLGAIVVGCGPGPFTGLRVGMATAAAMGLALDIPVYPVC
TLDAIGHGTAGRVLVVTDARRREVYWAGYSDGVRVSGPAVDAPADVSLDG
YTQVAGSPDHTTLFDLPAVDRHYPSPSRLVQVAGWDEPPGALTPLYLRRP
DAKEPRR
169630814YP_001704463.1 ribosomal-protein-alanine acetyltransferase RimI [Mycobacterium absMTIELKPLRRRDARRCAELEAVLFEGDDPWPESAFLAELASSHIYYLAAR
DGHTLVGYGGISRLGRHAPEYEIHTIGVDPAYQKQGLGRRLLDALLAHAD
QDPGPVFLEVRTDNAAAIALYQGAGFETVGLRKRYYPGSGADAFTMKRPA
HGEVK
169630813YP_001704462.1 putative DNA-binding/iron metalloprotein/AP endonuclease [MycobacteMTVILAIESSCDETGVGIAELTPDGSVVLLADEVASSVEEHARFGGVVPE
IASRAHLEALGVTARRALDLAGVQRPDVVAATIGPGLAGALLVGVSAAKG
LALAWGVPFYGVNHLGGHIAADVYENGPLPECVALLVSGGHTSLLHVRSL
AEPIEELGATVDDAAGEAYDKVARLLGLGYPGGKVLDELAQQGDSSAVPF
PRGMTGPRDARHSFSFSGLKTAVARYLEKHGVEADFSPADVAAGFQEAVA
DVLTMKAVRAATDLGVSTLLIAGGVAANSRVRALAEQRCAETGLTLRVPP
LRLCTDNGAMIASFAAHLVAAGAQPSSLQAAADPGLPVVKGQVH
169630812YP_001704461.1 hypothetical protein MAB_3733c [Mycobacterium abscessus ATCC 19977]MSFADRLAITDLLYRYAELMDAGDFDGIGELLGRGSFGGEQGSVSGASAI
TKLFFTTTRRYRETGGTPRTRHLVLNPVVEVAGDGTASARSTFCVVQATE
QLPLQPIVVGRYRDTFGQDGHGWYFSSRRVDVEMVGDVSAHLLMDPGALS
G
169630811YP_001704460.1 co-chaperonin GroES [Mycobacterium abscessus ATCC 19977]MAVNIKPLEDKILVQANEAETTTASGLVIPDTAKEKPQEGTVVAVGPGRW
DEDGEKRIPLDVSEGDVVIYSKYGGTEIKYNGEEYLILSARDVLAVVSK
169630810YP_001704459.1 60 kDa chaperonin 1 (GroEL protein 1) [Mycobacterium abscessus ATCCMSKLIEFNETARRALEAGVNKLADAVKVTLGPRGRHVVLAKAFGGPAVTN
DGVTIARDIDLEDPFENLGAQLVKSVATKTNDVAGDGTTTATVLAQALVR
AGLRNVAAGANPIALGAGISRAADAVSERLLTVAAPVAGEHAIAQVATVS
SRDPEIGELVGEAMTKVGGDGVVSVEESSTINTELVITDGVQFDKGYLSQ
YFVTDFDDQKAVLEDALVLLHRDKISSLPDLLPLLELVAKEGKPLLIVAE
DVEGEPLSTLVVNAIRKTLKAVAVKAPFFGDRRKAFLEDLAIVTNAQVVN
PDVGLSLREVGIEVLGTARRVVVSKDETVIVDGGGSEDAIKARVAQLKAE
IETTDSDWDREKLQERLAKLAGGVAVIKVGAPTDTALKERKHRVEDAVSA
AKAAVEEGIVAGGGSALVQARSALDGLRAELKGDEAKGVDVFEAALSAPL
FWIATNAGLDGAVVVSKVAELDAGHGFNAATLEYGDLIADGVIDPVKVTR
SAVINAASAARMILTTETSIVDKPAEEADHGHGHHGHAH
169630809YP_001704458.1 hypothetical protein MAB_3730c [Mycobacterium abscessus ATCC 19977]MGLSVNPDDVDGFAKTVWHVGDKLAALRMDSVLLQGAGACEGTALMSGLR
AHAFEQQDHVTNHARRLDGLVDELKRTAEEFRRTESRSASRLDDTGKQL
169630808YP_001704457.1 hypothetical protein MAB_3729c [Mycobacterium abscessus ATCC 19977]MKISQVRGWHLSDLTDTATGLRNGAAQLDEHALTVINGMDGVSTNWEGEA
RDAYAVKVKDHGEEFFQRKQRWNNAAAVLDKGAQQMGLLRDELLKRVDDP
AVQQMFNITDDGGVTLKPEYQATLKSPKDVEAAQTRRAEFEHALRALLAT
ADVAGQQYDWQATNALRGEKDSDRPFAPQIPDHPTPPTFSKDNANKDGSG
PDQYGIDKPGFLDKAGLQATRAWAEGLVGSTRAAGQQYAPDLLQHFLDGS
GKPATVPVDNMLHDMSWFKQDSTAMAKANLDAAMRSMPPGYEGPVAFQSG
YGSVDGDPARPKAASNPDWFAALGSFSYQTSGVAMPNGNGTYDVSSQVNI
YDYYNFETTDQHPWPQPSDLNNLHRAGWAQNFETFGTSSPQRSTWP
169630807YP_001704456.1 hypothetical protein MAB_3728c [Mycobacterium abscessus ATCC 19977]MTARLIGILATCVLLLCGCGTGWTDHKEGNDPMSAKDALKVEVPASASSV
IAEIDPYRIQFLMPNDQWRDYASKYPLDQFEEVPYPTEYVVPAMCLPVAR
TGVKLTSWIAGDQIQYLDTGQRAHRSITVTPDCESGKAYVQWGLNTPQ
169630806YP_001704455.1 hypothetical protein MAB_3727c [Mycobacterium abscessus ATCC 19977]MSRLAALALAGVLLSGCEAHFSLGSSSPELAKAKLEAGLKDAITEKTGVT
LTSVSCDGPLKGEKGATQRCAVIDGEGKTIGVTVTATGVEGTKISFNWKV
DDQPASTST
169630805YP_001704454.1 WhiB family transcriptional regulator [Mycobacterium abscessus ATCCMPQPQQLPGPNADIWDWQMKGVCRGVDSSVFFHPDGERGRARAQREMKAK
EMCRACPVLVQCRAHALAVAEPYGIWGGLSESERELILRRGVRRTA
169630804YP_001704453.1 hypothetical protein MAB_3725c [Mycobacterium abscessus ATCC 19977]MVTSPASASITLLDAAFGASPATWPLPCASTPQDAWLRAIALGGAGRYAA
AHAELSAIPASRPGGLASLALSTRASLLRQLAWHTHARGFDGRALSLAGS
DAEARSDALVGLAADALGLARFPLAHALLEQAEPLSGRGDARWPWRLPLR
LAWVHAELAMVSGDGERALRYAHAAEELAQDVPSVRHQVKTTMVLAAALS
SVGDLDKSAVVAARGLRAASAHKLVPLRWALAAMLAGLPTPDEAGRRGED
LVAVRRECAAWIARAGGEWRLEVVD
169630803YP_001704452.1 RNA polymerase sigma factor SigD [Mycobacterium abscessus ATCC 1997MTSTESGLDDVVAAAVRGDRDALSEVLSAIRPVVVRYCRARVGTAERSGL
SADDVAQEVCLAVIAALPRYQDQGRPFLAFVYGIAAHKVADAHRAMARDK
SDPAENLPEQVDRHAGPEQEALNSESSRRMQALLEVLPEKQREILILRVV
VGLSAEETADAVGSSAGAVRVAQHRALQKLKAEMTRAGDYRG
169630802YP_001704451.1 hypothetical protein MAB_3723c [Mycobacterium abscessus ATCC 19977]MADGRGWFPGQGGWQENEGPEDLAALRRTNRMIDAIAADLPVATSDSDEY
AVAMMLAAWREDVGREPMPAKPTLGQARNALRDRGGRSRMLATTVGSAAA
VTLLFGGFGAAVYQSHPGDALYGLRTSLFGAPPAVRTDPVVLSAQTELAQ
VEKLISQGDWEEAQQQLGVAAARVNEVGDAQQKAELASRVQQAEVRIDAK
DPQATVPPEMVTETPRIMLSPPSIAPITSTTTTSTTSTTSASTTTSDSTS
ASTSTTETSGSASPSTSSSTSTSATASTSVTSVPTSTPTTVTITTTPPSS
AATITSTPASATETTTAPSVSTAPTTSVPGVTASTTVPPTASIVTVPTTP
EGVTIVTTRPGVVNTPVITAPTTIEAPVPITRTPDNPAPAYQAPVNSPGS
GNLHGYPGSGGNAGSGSDGPSRHMPAMTSVPVAPANPGSGSANQGSGSGS
HTDE
169630801YP_001704450.1 hypothetical protein MAB_3722 [Mycobacterium abscessus ATCC 19977]MRDHFPPGLPPDPFADDPHDPSAALDAIEPGQPLDPQERIAVEEDLADLA
VYEALLAHKGIRGLVVCCDECQQDHYHDWDMLRANLLQLLVDGTVRPHEP
AFDPEPEAYVTWDYCRGYADASLNEAATDRDGFR
169630800YP_001704449.1 inosine 5'-monophosphate dehydrogenase [Mycobacterium abscessus ATCMTIAAGSVHTGGDDPHKVAMLGLTFDDVLLLPAASDVLPAGADTSSQLTK
RIRLNVPLVSSAMDTVTEARMAIAMARAGGMGVLHRNLSVEDQAGQVETV
KRSEAGMVTNPVTCSPANTLAEVDALCARFRISGLPVVDAQGALVGIITN
RDMRFEADLSKPVAEVMTKAPLITAREGVTADAALGLLRRNKIEKLPIVD
GEGRLTGLITVKDFAKTEQHPNATKDSDGRLLVGAAVGVGEDAWTRAMSL
VDAGVDVLIVDTAHAHNRKVLDMVGKLKAEVGERVDVVGGNVATRSAAAA
LVEAGADAVKVGVGPGSICTTRVVAGVGAPQITAILEAATVCHPAGVPVI
ADGGMQYSGDIAKALAAGASTTMLGSLLAGTAESPGELIFVNGKQFKSYR
GMGSMGAMQGRGATKSYSKDRYFQDDVLSEDKLVPEGIEGRVPFRGPLST
VMHQLTGGLRAAMGYTGASSIEELQRAQFVQITAAGLKESHPHDITMTAE
APNYYVR
169630799YP_001704448.1 inosine 5-monophosphate dehydrogenase [Mycobacterium abscessus ATCCMRDLVEIGMGRTARRTYELDDVNIVPSRRTRSSQDVSTAWQLDAYRFEIP
VVAHPTDALVSPRFAIELGKAGGLGVINGEGLWGRHADVEARIAEVVEVA
QKEPEPSAAIRLLQQLHSAPIDPDLLAAAIAEVRGAGVTTAVRVSPQNAQ
LLTPHLIAAGIDLLVIHGTIVSAERVARDGEPLNLKTFISELDIPVVAGG
VIDHRTALHLMRTGAAGVIVGYGQTAGATTSSEVLGVSVAMATAIADAAA
ARREYLDETGGRYVHVLADGDIHTSGDLAKSIACGADAVVLGTPLAAAQE
AAGDGWFWPNAAAHPSLPRGALLQVAVGERPPLSEVLAGPSDDPFGTLNL
VGGLRRSMAKSGYCDLKEFQKVGLTVNS
169630798YP_001704447.1 putative cholesterol oxidase ChoD [Mycobacterium abscessus ATCC 199MSSPAAVPVKPEADTDFDVLIVGSGFGGSVTAMRLTEKGYRVGVLEAGRR
FADEEFAETSWDLRKFLWAPMFKCFGIQRIHLLSNCMILAGAGVGGGSLN
YANTLYVPPDPFFNDPQWKGITDWRAELSPHYEQAQRMLGVVKNPTFTDA
DRLIKEVADDMGAGDTFVATPVGVYFGPDGTKTPGVKVPDPYFGGAGPDR
VGCTECGSCMTGCRVGAKNTLVKNYLGLAESNGAQVIPLTTVTAVQQGAD
GVWRVSTKSTGRWVRKQRKTYTAKYVVLAAGTWGTQNLLFKMKDKGLLPK
LSQRLGVLTRTNSESIVGAGRLEYKDDLDLTHGVAITSSFHPTSDTHIEP
VRYGKGSNAMGLLQTLMTDGDGPKSRWRQLIENARADWRGTFRMFNVTQW
SERTVIALVMQHLDNSITTFTKKTLFWRRLDSKQGHGEPNPTWIPAGNEA
TRRLAAKIDGVAGGTWGELFNIPLTAHFLGGAVIGTSPENGVIDPYHRVY
GYPTMYVVDGASISANLGVNPSLSITAQAERAASLWPNKGETDLRPEQGL
PYQRMAPVPPVHPVVPADAPGALRRLPIEPVSSAS
169630797YP_001704446.1 GMP synthase [Mycobacterium abscessus ATCC 19977]MAQTEQHGDRPVLVIDFGAQYAQLIARRVREARVFSEVIPHSASVEEIKG
RNPRAIVLSGGPSSVYEEGAPQLDPGVFDLDVPVFGICYGFQAMAQVLGG
TVAHTGTSEYGRTELTVAGGDLHEGLPDVQPVWMSHGDAVTEAPQGFTVV
ASSEGAPVAAFENRERRLAGVQYHPEVLHSPHGQQVLSRFLHEFAGIESA
WTAANIAETLVEQVRTQIGEGRALCALSGGVDSAVAAALVQRAIGDRLTC
VFVDHGLLRSGERAQVEHDFVAATGATLVTVDASETFLGELAGVTDPEAK
RKIIGREFIRSFEGAVSDVVGDSRRDDTAGIQFLVQGTLYPDVVESGGGS
GTANIKSHHNVGGLPEDLTFTLVEPLRLLFKDEVRAVGRELGLPEEIVGR
QPFPGPGLAIRIVGEVTPDRLDTLRRADAIAREELTAAGQDRNIWQCPVV
LLADVRSVGVQGDGRTYGHPIVLRPVSSEDAMTADWTRLPYEVLERISTR
ITNEVPEVNRVVLDITSKPPGTIEWE
169630796YP_001704445.1 hypothetical protein MAB_3717 [Mycobacterium abscessus ATCC 19977]MSENTNEPVTNTDITGIAAEAADQTESAPETASEEKTRPSVVLALSGLVA
VLVGGWALTGEDFVALIHSDLLGWLAIAIAIAIGVALVAVPTRRGRS
169630795YP_001704444.1 hypothetical protein MAB_3716 [Mycobacterium abscessus ATCC 19977]MDTDTTTKRTPSSTLSDMWRTRPLRLPGHGKLAGIAAGIGYRYNVDPLLV
RVIFVVTTIFGGAGAIMYVACWLLMPTARYTTPYHESKVKMVFWIIVLLL
IGGPFIDPDRDPWGFVSAAVLLGGWYLLYQRQTEPPSAPPVATDQPPAPD
AQPDTTTAPVDVGKPETEPLSAPLPPPPPTWSPPGMSPFTWDLPDPTPLP
APPAKPKSRVAPVTIGAMLIVSALLVAVGLLGGSWVTPVVVAAAALVIVG
IGMLVGAWFRSGYSLLFLAVPLAGFVIVASSIGPLEVSLNIGDQSYRPTE
TSEIDDYYEVGIGTITLDLTGVTLTSDKTVNIDAGMGDIEVLIPSAMNVR
TRCEVSVGSFDCLPTPVGTGPVLTINATANVGSIEVRRV
169630794YP_001704443.1 putative two-component system sensor kinase [Mycobacterium abscessuMVAGVAGGLADHLDVPVFRVRLAFAVLGAASGMGIVAYGLLWMLMPPGDD
VAAVSATDRRRATGLLLLSLAALIILMSTVSGSAASLVFPTVLALTGLAV
VWREFDAQGPSLAVLGAPGRPSMLTLVRVVAGAALVFGGIAVVVLRNVDL
SSLRDSLVAIAATLVGAVLLTVPLWLRLWRALGIERAARIRTEERDEIAS
HLHDSVLQTLALIQKRTDNPSEVLRLARSQERELRSWLFSAGAASDSSLA
QELRAVAGEVEDTHTVAVSPVIVGDADLALEPETGRALVGATREALVNAA
KHSGQSDINLYAEVEPGQISVFVRDRGKGFDPEEVPQDRQGIARSIKARV
LRRGGQVQIKSEIGKGTEVRIIMPYKANDVDEKEQ
169630793YP_001704442.1 two-component LuxR family response regulator [Mycobacterium abscessMMLRVFLVDDHGVFRSGVRAELAGESDIEIVGEAGSVVEAVAGIRSSAPD
VVLLDVHMPSGGGVAVINGTIGPVCPVFLALSVSDAAEDVIAVIRAGARG
YVTKTISGSELADAVRRVAGGDAVFSPRLAGFVLDSFTGRSNAPEPALDP
ELDSLTPRELEVLRLLARGYTYREIAEDLVISVKTVETHASNVLRKTQQS
NRNALTRWAHTRQLD
169630792YP_001704441.1 hypothetical protein MAB_3713c [Mycobacterium abscessus ATCC 19977]MTAVAAADEALVNRADQLQKLRQQMAAISGKVGGDRSAAGHFPEALPDAQ
SLLPGSDALARSIGHVLRRGTVAVAGGARSLPLEVVASVTAAGGYAAIVG
MPEVSVLAAVERGADLSRLALIPRPGLSAVEVASVLMDGMDLVVLGLGGR
QVTSTSARAIVARAHSNGCTLLAVGGDWEGASVRLQAQITGYDGVSACGL
GRIRGVRTAVRVRGRGGREVCGSRGAIRSA
169630791YP_001704440.1 hypothetical protein MAB_3712c [Mycobacterium abscessus ATCC 19977]MWCPDWPAVAAAAMADLPATRPVAVTLANRVTACTAAARALGVRRGMRRR
ESQARCPQLHIAVADADRDARFFEPMIAAVDDLVPGAEILRPGLLALPVT
GAARYFGSEHAAAERLADAVSVAGAECQVGIADQMSTAVYAARHAALVPP
GGDAQFLAPLSVKELAAEPSLCHPQREDLVDLLWRMGIRTIGAFAELARA
DVASRFDDDAVQAHRHARAESQRPPSGHAVPAELGVELSCDPPIDRVDAA
AFAGRTLAVRLHERLSSAGVACSRLAIHAVTVDGQELSRVWRCAEPLTEE
ATADRVRWQLDGWLARRRCLDGPVALLRLEPVEVVTAEALQLTLWGAVGA
EERQRARRALTRVQDLLGEESVQVGVISGGRGPAERITLVPLGDELRPRA
DPSAPWPGKLPDPAPVVLSDEPVELLDVDGAPVTVTGRGMFSGEPARVRR
GNGRWELSWWAGPWPIDERWWEEREPTSVSVAARAQVLLESSGGGQALLL
HFRRQRWYVEGVYE
169630790YP_001704439.1 putative nucleoside hydrolase IunH [Mycobacterium abscessus ATCC 19MVPVFADVDTGVDDALGLIYLLASEDAEIVGIASTAGNVSVDHVCANNLG
LLELCKAPQIPVSKGVAEPLSAALRTAEDTHGPTGLGYALLPESTRTLTD
YDSAEAWVKAAHAYPGELVGLATGPLTNLALALRTEPELPKLLKRLVIMG
GSFDYPGNTTPVAEWNVVVDPGATAEVYAAWGAAGVQELPIVCGLNLTET
IAMTPEHLVRLADAAGATTTPLSVLDSPSSRSGASNSLLRFIEDAAHFYF
EFHMKQGEGFLAHMHDPFAAAVALDPSLVQTRSATVDVELTGDLTRAMTI
ADWKGQWGQRPNAQIAVETDPEVFFQRFIERVSVFARTVDDAR
169630789YP_001704438.1 short chain dehydrogenase [Mycobacterium abscessus ATCC 19977]MKYIVTGGTGFIGRRIVTRILETQPAAEVAILVRRESLSRFEKLAEQWDD
RVQPLVGDLTQPDLGLPAEGDPVTADHIVHCAAIYDITVDDKAQRAANVE
GTRSVIALAKRTGAILHHISSIAVAGSYEGEFTEDDFDVNQDLPTPYHQT
KFEAELLVRSEPGLRYRIYRPAVVVGDSRTGEMDKIDGPYYFFGVFAKLA
KLPSFTPMMLPRAGRSNIVPVDYVVDATVELMHQEGRDGQAFHLTNPEVT
YLRDIYSGIAAAAGLPPVRGSLPHAVATPFLRARGTLKVWRNMVVTQLGI
PPEVIDITEIMPTFISESTQEALRPSGIKVPPFGSYAGRLYQYWRRNLDP
ERYRRDDPAGPLVGRHVIITGASSGIGRAAAIAVARRGGTVFAVARDGEA
LDQLVAEIREDGGKAHAFPCDLTDYAAVDDTVKSILGQFGHVDYLVNNAG
RSIRRSVVNTVDRFHDYERVMAINYFGAVRLVLALLPHWRERKFGHVVNV
STAGVQTRNPKYASYIPTKAALDAFADVVATETVSDHITFTNIHMPLVKT
PMITPSHKLNVVRGLTPEHAAAMVVRGLIEKPTRIDHPMGTFADIGQYLT
PKLSRRVLHQMYLAYPDSKAARGLEPVDDRRDLSTSRRRPRAAKRVAAVS
RLRVPGPLMKAVRLIPGVHW
169630788YP_001704437.1 hypothetical protein MAB_3709c [Mycobacterium abscessus ATCC 19977]MSNIRVFTAARATGNLAWWVFVVAALVNRGLCPRGWDYGWTAYTPLTGGA
PRRYADYVPTQSVVGVVVWVAFAAVVVAAVVELAIVRRWIAVGTVVIPFA
SLGLIAYAFGEFDRTITWSPTGVLFFALVAVAIRQVWMRRFAPAVGVDQ
169630787YP_001704436.1 hypothetical protein MAB_3708c [Mycobacterium abscessus ATCC 19977]MIGVAPAPLAEFHVSRSAPVLWAVQYALAWVPVLLAVGAAWTVTSLPAHA
TTPLHHAVAISGLVCIACAVAWVVLRPLQRYRSYRWGVLDDTLVYVTSKT
LWHRSFWVIPLALVRTVELRQDPLARVLGLAAIRVRADQGELRFVGLEAG
VARQAVEWLFVRVDEVSVYR
169630786YP_001704435.1 hypothetical protein MAB_3707c [Mycobacterium abscessus ATCC 19977]MSRDKTFRMGRVVGSGAWWVYVVGMLTAGRPFGSGWRFMSVEDLELFGQG
LGSSRSPRYAEYLPAGLDGPMILAQLAGIVVIAAALAELAVVRRWIGLAT
VVVSCASLALVALATRPPLTMPALSPLAVAIGVLTVSALREIWMRRFASS
PKPPKRSAADRLNG
169630785YP_001704434.1 hypothetical protein MAB_3706 [Mycobacterium abscessus ATCC 19977]MTTSDSAFLGSVADNLAALPAVEAVTLGGSRAQGTHRPDSDWDLAIYYRG
DFDPEDLRQIGWEGDVSEIGAWGGGVFNGGAWLHIDGRDVDVHYRDLADV
KEQLARAEHGEFHIEPLMFHLAGIPSYLVVGELAINRVLHGILPCPDYPA
ALRESAPDVWEKRATLSLLYAEKNHAPHGRVTQCAGLLAVAAMEYAHAAL
AARGEWVTNEKGLLDRAGLSGVHTILSSLTDDPAALDRACAEVRKLGSAA
R
169630784YP_001704433.1 TetR family regulatory protein [Mycobacterium abscessus ATCC 19977]MPPDASATKKRLLDAAYAEFAEHGLAGARVDRIGAAAEANKRLLYVYYTN
KETLFDIVVAHSIQQMSEAVPFTPEDLPGYAGALFDHLIKHPEHLRLATW
AQLERPAAGPAETSAYAAKVAAIAQTGLSAGDVEPADILALTLGLTTAWL
GASPALRGLAASEPFSPERLATHRTALIAAVEALVSAAAR
169630783YP_001704432.1 hypothetical protein MAB_3704 [Mycobacterium abscessus ATCC 19977]MYADGARTLPIDQKHLTENPEKLMPHHGNYTPEKVTFPSHGVDIVGVVHR
PHGDGPFPAVVLLGPYSFEKEQAPIHYATRLADEGFLALAFDPRTVGESG
GTPRRLENPKMKNEDAVAAIDYLLTREDVDASRIFGAGVCQGGPEMLDIA
SYDNRIKAVASVTGYYRDHETDLFMIAAGVSENPFDPATAPTTAQLESLL
AARLERARDAKARYEQTGEVIYAPLVSPDLGDPVAGSDAGLPGPLVWSWY
GSWTLKGWENRYAIMSDLDHFDYSTAPGVATLEKPALVIHSDTCMNPAAA
RRHFESIPTTDKKLIWENGTNHFQYYDQPDIVDRTVGHIAEWFNSHLA
169630782YP_001704431.1 error-prone DNA polymerase [Mycobacterium abscessus ATCC 19977]MLDGRLNPHAPPGDGGDGPAWSRKRQPYEPPPRERGRSVVPYAELHAHSA
FSFLDGASLPEEMVQEAARLDLKALAITDHDGFYGVVRFAEAAKELGLPT
VFGAELSLGGQGNTEDSVHLLVLARGQEGYRRLSRQMAGAHLSGGTPKDR
KGKPRYDLDALTEAAGGHWHILTGCRKGHVRRALAGGGPVAAERALANLV
DRFGADRVSIELNRHGHPGEDERNAELAALARGFGVGVIATTAAHFATPE
SGRLAMAMAAVRARKSLDDAAGWLDPVGGAHLRSGDEMARLFSHYPEVVT
AAAELGEECAFDLRLIAPQLPPFDVPSGHTEDSWLRHLALEGAARRYGPR
AGAQKAYAQIERELEIIAQLNFPGYFLVVHDITQFCRRSDILCQGRGSAA
NSAVCYALGVTNVDPVDNGLLFERFLSPARDGPPDIDIDIESDEREQAIQ
YVYNKYGREYAAQVANVITYRGRMAVRDMAKALGFAQGQQDAWSKQMGHW
GGLADAAAVDGIPPQVIQLARQIKDFPRHMGIHSGGMVICDRPLADVVPV
EWARMENRSVLQWDKDDCAAVGLVKFDLLGLGMLSALHYCIDLVREHKGI
DVDLAHINLKEQAVYEMLARADSVGVFQVESRAQMATLPRLKPKCFYDLV
VEVALIRPGPIQGGSVHPYIRRYNKIDKDWQHDHPSMAAALDKTLGVPLF
QEQLMQLAVDVAGFSPAESDQLRRAMGSKRSPERMERLRNRFYEGMRNLH
GITGELADRIYEKLYAFANFGFPESHAQSFASLVFYSSWFKLHHPAAFCA
ALLRAQPMGFYSPQSLVADARRHGVTVHGPDVNASLSYATLENAGLEVRI
GLGAVRHIGDDLAQAIVEERKVRGPFVSLLDLTGRIQLTTAQVEALATGG
ALGCFDMSRREALWVAGAAAAQRPDRLPGVGVSSRIPALPEMGEVTRAAA
DVWATGVSPDSYPTQFLRARLDAMGVVPAKGLFGVPDGSRVLVAGAVTHR
QRPATAAGVTFINLEDETGMVNVVCSVGLWARYRKLAVTARALIIRGQVQ
NASGAVSVVADQLRPLDLQIRSTSRDFR
169630781YP_001704430.1 tRNA/rRNA methyltransferase SpoU [Mycobacterium abscessus ATCC 1997MFHILFHEPRIAPNTGNAIRMVAGTGCELHLVQPLFDLSEAKVRRAGLDY
HDMASVTVHENLSAAWKTLKPQRVYAFTAHASVTYTDIAYQPGDVLLFGP
EPTGLDAEVLADPHITEKVRIPLLPGRRSLNLSNAAAIAAYEAWRQHDFA
GSV
169630780YP_001704429.1 AraC family transcriptional regulator [Mycobacterium abscessus ATCCMRSPARYEGRTTADASWRAVSAAADVTLSGIAHGYTELRERAHRPVERSE
VAGVAPVLVVELDAPLLVADVADHASPRIWQAFVAGVSQGPSSTVHSGAQ
HCIEVRLTPLGLHRVSGLAMDAVSNRVVSLEELFGKKARYLPERLAAEPN
WVRRFDLLDSVFMRAAAEGPEADAEVEFAWHRLNRTGGTAGIGEILNEIG
WSRARLAQRFRSQVGLTPKAAARVLRFNRAMTLLNQPGHRSLSSIALACG
YFDQAHFNRDFRVLAGCSPRQWAALRHEDLMGYRIPADGEHLYKTGVDGG
PSVGTVL
169630779YP_001704428.1 hypothetical protein MAB_3700c [Mycobacterium abscessus ATCC 19977]MAGEPTYFEIGVPDALRAQKFYVRLFGWKPHAMGESGQAWLETEGARGGL
HNDDEDRRIDVFFGVADIDAAVMTVRELGGEAEDPGPEEPGFGRFTFCRD
DQGVRFGLHQPAHDTA
169630778YP_001704427.1 hypothetical protein MAB_3699c [Mycobacterium abscessus ATCC 19977]MAEHWTDREITAETFYDEDFRELHTERVVFTECDFSGANLTESLHVGSAF
RNCTFRRTSLWHSEFRQCSLLGSTFTDCRVRPSKFTETDFTLSSLAGLDL
REMDLSDCRFREANLVGADMRKANLHGADFTGARTQNLKLDGADLRGARI
DPTLWTTAALITAKVDLPQAIAFAAAHGLDVHGG
169630777YP_001704426.1 ABC transporter ATP-binding protein [Mycobacterium abscessus ATCC 1MTGREAPTLTVVFDGDERKFAPGHDIHIGRDIHADVRITHPLVSRIHLII
RFVDGKWIAEDQRSLNGIFVNGRQVGWVEVRDDTVINLGDPGGPRLTFAL
GGLGGETQLGIAPPTMRGYVSGAQQQAPYTGAQQHGTTGQPYHSTQQHYP
TGGYQSGPQTYGQPPSQQHPYGAAPSGPQTYGTSGPTRPRQQYPSEPTPV
PASYSNEPVEPFGTRAMRALGIGGAPKPTPGAITVGRAPDNTIVVNDVLA
SRHHALLLPTPGGLEIQDLHTINGTFVNGVQVEQSSLREGDTVTIGNVDL
VVQDGTLVKPTTATRVGGLEVQSIDFVVEGGKKLLDDISFSAGPGSLTAV
IGPSGAGKSTLARLIVGNTQPSAGKVSFEGHGVHAEYAVMRNRIGMVPQD
DVVHPQLTVSQALHYAAELRLPPDTTKEDREQVVSRVLEELEMTKHAETR
VDKLSGGQRKRASVAMELLTGPSLLILDEPTSGLDPALDRQVMSLMRQLA
DAGRVVVVVTHSLTYLSYCDQVLLLAPGGKTAYCGPPRSIGQEMGTTDWA
DIFANAAADPDGVHQAYLSRHPAANKPATAASPPGDLGKPPKTSLLRQVS
TVARRQGRLILADRGYFIFLALLPFVLAGLVLSVPGSAGFNVALPDNPNE
PGLLLALTNLGASFLGLALTIRDLIGERVIFRREQAVGLSATAYLLAKII
TYCGAAIVQSAIMTAVIVIVRGGPTQGAVLLGSANFELWVAVAATACAAT
VLGLVLSSLATSAEQVMPMLVIATMTQIVFSGGLIPVTGRAGLEQLSFLF
PSRWGFAATAATCDLRKLVPVGPQDELWNHDAGTWLFDMGILGLLSLVMA
GFVRWRIRLKG
169630776YP_001704425.1 putative epimerase/dehydratase [Mycobacterium abscessus ATCC 19977]MKIAIFGATGMVGSRIAAELRSRGHQVTGYSRRGSDSTRAGTLTDGALVA
TVAAGHDAVVSAIGPSRSGEPHSEFIEAITAAAANLHGTRLFVVGGAGTL
RVNGVRLVDSPEFPEPYRAEALAHAAALDTLEQTAQDVDWVYLSPAPLIE
PGKRTGSYRVAGDAPAGQSISAEDYAVAVADELEHPAHRRERFTVAN
169630775YP_001704424.1 putative transcriptional regulator [Mycobacterium abscessus ATCC 19MYPSSQPTDDWWGNLFDTQCPTRIVLDRIGDKWTVLVVAALADGPMRFTA
LRDRIGGVTGKVLTSTLRSMLRDGLVKRTAYATVPPKVEYQLTELGLSLR
EPIDQLRTWAERNVAHIVRNREAHDGDMPSTDTAIG
169630774YP_001704423.1 hypothetical protein MAB_3695 [Mycobacterium abscessus ATCC 19977]MMTAAAGRKPGTAETVVSWLLWVLVSATAGVVAFASIFPLAFSGAAPEQA
DAAAAVFVWALFTVCACVAAPIVMGVGHWRHWHIWYWPTLCALVLVRTLF
LLHNL
169630773YP_001704422.1 oxidoreductase [Mycobacterium abscessus ATCC 19977]MGSDAAGIPDVLAPARLGPITLRNRTIKAATFEAASPDAFVTDDLIEYHR
RPALGGVGMTTVAYCAVAPEGRTEYGQVWMREEAIPGLRRLTDAIHDTGA
AVSAQIGHAGPVANARSNGSPALSPIRFFNPLGMKFARRASASDIDGVIA
AHANAARLAIEAGFDAVEIHLGHGYFVSSFLSPLFNRRGDEYGGSLANRA
KVARAVVQAVRKVAGSRLAVTAKLTMTDGIRGGIPIEESLQTATWLQEDG
GLDALELTAGSSLVNPMYLFRGDVPIRELAKGFPKPMGWGVRLTGKKFFR
SYPYHDAFLLEDARRFRAELDIPLILLGGITGGESMDLAMAEGFEFVAMG
RALLADPDLVNRVAADRASHSRCTHCNQCMATIFSKTHCVLT
169630772YP_001704421.1 oxidoreductase [Mycobacterium abscessus ATCC 19977]MTSLNLSADEVLTTTRSVRKRLDFDKPVERAVVEECLNIAMQAPTGSNHQ
GWHWVIVEDAEKKKAIADIYREGWNKYAKGAGATYAEGDTRAERKAKVVD
SAGYLAENFERSPLFLIPCIEGRLDNLPVVGAASSWGSLLPAVWSFMLAA
RNRGLGSAWTTLHLMDDGEKRTADIVGIPFDKVTQGGLFPIAYTVGTDFR
LAKRQPLADVLHWDTW
169630771YP_001704420.1 bifunctional 5-10-methylene-tetrahydrofolate dehydrogenase/methenylMTATRLDGKATRDEIFVELATRAAALKAAGKTPGLGTILVGDDPGSHAYV
RGKHADCAKVGLNSIRRDLPADIDQATLCATIDELNANPDCTGYIVQLPL
PKHLDENEALERIDPDKDADGLHPTNLGRLVLGKEAPLPCTPRGIVYLLR
RYDVKLDGAHVVVIGRGVTVGRPLGLLLTRRSENATVTLCHTGTRDLAAL
TRQADIIVAAAGVPHMVTADMVKPGAAVVDVGVSRVDDKLTGDVAEDVWD
VAGYVSPNPGGVGPLTRAFLLTNVIERAERS
169630770YP_001704419.1 hypothetical protein MAB_3691c [Mycobacterium abscessus ATCC 19977]MTALQPGPRRLLPTALDAIQRFAREQWPILVVSAVFLAALGLVIADRWRR
GALVVGIAVGIAAALRLVLTDDTAGLLAVRSKTFDVGALGAVAAAMVYLA
LTIDPLGTG
169630769YP_001704418.1 hypothetical protein MAB_3690 [Mycobacterium abscessus ATCC 19977]MRTDRRLLAALFVTTTLLTPPLASCGSHGSSSNAKSESEPTSSSAPAERH
TRQFIPELGIYINTPHDWVSFADGVHNNKGMVTYQVRPKWESSELAQYVR
IRKLTPPDDDTAAPEVKRWLASSNADAVSDFVKTRKSKVTADKRDSWDGP
NLPGASASLELEKPPAAEGKPPVAATPKIYVAFVGQGDQRWQIATTNVTG
ANGEPSEQFLGEQADSIARSVQLLK
169630768YP_001704417.1 putative methyltransferase [Mycobacterium abscessus ATCC 19977]MPDAQAEPSLSFGSQAAAYERGRPSYPPEAIDWLLPPGAHDVLDLGAGTG
KLTTRLVERGLNVVAVDPLAEMLEVLSNSLPDTPALLGTAEEIPLPDNSV
DAVLVAQAWHWVDPERAIPEVARVLRPGGRLGLVWNVRDERLGWVSDLGH
IIGHENAADSADVGALPAPFTGQERHQVEWTNYLTPQALLDMVASRSYCI
TAPEAARKKTLQQVRELLATHPALAQSAGLALPYVTVSIRATLNR
169630767YP_001704416.1 homoserine O-acetyltransferase [Mycobacterium abscessus ATCC 19977]MTIEQQLPVPHIALPQGDEIAYVPIGSITLESGAVIDDVTIAVQSWGELS
PRRDNVVFVCHALTADSHVVGPAGPDHITGGWWEGIIGPGAAIDTDHWCA
VATNVLGGCRGTTGPTSLARDGKPWGSRFPEVSVRDQVNADVAALAQLGI
TEVAAVVGGSMGGARALEWAVMHPDAVRAALVLAVGARATGDQIGTQSTQ
IAAIQTDPDWQGGDYHGSGRSPGKGLNLARRIAHLTYRGEVELDTRFGND
PQVGPDGPEDPWADGRYAVQSYLEHQGNKFVRRFDAGSYVILTESLNRHD
VGRGRGGVEKALRGCPVPVVVGGITSDRLYPLRLQEELADLLPGCTGLRV
VESVHGHDAFLIEFDAVSELVRETLALAKATQAS
169630766YP_001704415.1 O-acetylhomoserine aminocarboxypropyltransferase [Mycobacterium absMTDIDPTTADSRSDKPRSAQWAFETKQIHAGQSADAATNARALPIYQTTS
YVFNDTAHAAALFGLSEEGNIYTRIGNPTQDVVEQRIAALEGGVAALLLA
SGQAAATLAIVNIAQAGDNIVSSPRLYGGTYNLLHYTLPRLGISTTFVED
PDDLESWRNAITPDTKALFAESISNPQNDILDIAGLSEIAHAAGIPLIVD
NTVATPYLIQPLAHGADVVVHSATKYLGGHGNAIGGVIIDGGTFDWTQGR
HPGFTTPDPSYHGVVFADLGAPAYALKARVQLLRDLGPAISPFNAFLIAQ
GLETLSLRVERHVANAQRVAEFLVAQPEVTRVNYAGLPTSPWYERAKALA
PKGAGAVLAFELDGGVEAATTFIDSLTLHSQVANIGDVRSLVIHPATTTH
GQLSPAEQVASGVTPGLVRLAVGIEGIDDILADLESGFTAVRRLKQPAAV
ASS
169630765YP_001704414.1 isocitrate dehydrogenase [Mycobacterium abscessus ATCC 19977]MSAQQPTIIYTLTDEAPLLATYSFLPIIRAFAGPAGIDVQTSDISVAARI
LSEFSEYLPEDQRVPDNLAELGRLTQLPETNIIKLPNISASVPQLLAAIK
ELQGKGYKLPEYPGDPKNEEETEIKARYTKCLGSAVNPILREGNSDRRAP
KAVKEYARKHPHSMGEWSQASRTHVATMKEGDFYHGEKSLTLDRDRTVKM
VLTTKSGDTVVLKPEVKLGKGDIIDSMFMSKKALCDFYEEQIEDAYKTGV
MLSLHVKATMMRVSHPIVFGHAVKIFYKDAFEKHQKLFDELGVNVNNGLS
DLYSKIEALPASQHEEIIRDLHACHEHRPELAMVDSAKGISNFHSPSDVI
VDASMPAMIRAGGKMYGADGKLKDTKAVNPESTFSRIYQEMINFVKTHGQ
FDPRTMGTVPNVGLMAQKAEEYGSHDKTFEIAEAGVADIVDIDTGEVLLT
QNVEEGDIWRMPVVTDAAIQDWVKLAVTRGRESGMNVVFWLDTERPHEVE
LRKKVKEYLQDHDTEGLKIQVVPQVWAMRYTLERLIRGKDTIAATGNILR
DYLTDLFPILELGTSAKMLSIVPLMAGGGLYETGAGGSAPKHVSQLVEEN
HLRWDSLGEFLALAVSLEDLGIKTGNARAKILATTLDAATGKLLENDKSP
SRKAGELDNRGSQFYLALYWAAELAAQTEDVELAELFAPLAKQLVENEDQ
IVAELAAVQGSPADIGGYYAPDPEKTNAVMRPSQTFNAALASVEV
169630764YP_001704413.1 hypothetical protein MAB_3685 [Mycobacterium abscessus ATCC 19977]MLEAILSKPSNRRAPIEMGEGEPVLLLHPFMLSQSVWETVAEQLADAGYE
VFAPTYPGHNGGGPMPKLPPFSQRSVDVYLDQIEQIMDQKGWETAHLVGN
SLGGWIALGLALRGRARSVTAIAPAGGWTKYSPLKAEIVVKFAAMLPWLA
FSRLLGRRAAGLPFAKFATARMLCGETEALSLPDFHSIFEDITHCPAYFA
SLTSILPAPGLENLDTISVPAQLVLCEKDEIVPPGRFGKLIGEGLPGNAR
RITLAGMGHVPMLEAPGQVTEVITDLIDPLVSAKRSAASDAG
169630763YP_001704412.1 putative exodeoxyribonuclease [Mycobacterium abscessus ATCC 19977]MSAQKITVTTINVNGIRAAVKERSAENRGLLPWLEQTSSDIVCLQEVRAE
EDQLREALAPALAAGWQVVSAASSVKGRSGVGILSRVPAASTRVALDADG
GEFDESGRYLEAEIGDLTVASIYLPTGEAGTARQEEKERFMAAVGARMAV
LAASGRDTVICGDWNIGHTERDIKAWKANQKKAGFLPEERAWVGSLLEAG
WVDSFRLLHPDVDGPYSWWSWRGKAFDNDAGWRIDYHLATADLGRRAHSA
RVERADAYALRWSDHAPVTVEYR
169630762YP_001704411.1 tryptophanyl-tRNA synthetase [Mycobacterium abscessus ATCC 19977]MTAETAARGRLFSGIQPTADSLHLGNVLGAVQQWVRLQHEYEALFCVVDL
HAITVAQDPEELRRRTRAVVAQYVALGVDPAKSAIFVQSHVPAHAELAWV
LGCLTGYGEAARMTQFKDKSAKQGNDATTVGLFTYPVLMAADILLYQTNV
VPVGDDQRQHLELTRDVAQRFNGRYGQTFVLPETFVPKNAARIYDLQDPT
VKMSKSASTPAGLINLLDEPAVSAKKVKSAQTDSDREIRFDRDAKPGVSN
LLSIQSALTGADIETLVDGYAGRGYGDLKKDTAEALIEFVTPVRDRTNEL
LSDTAALDDILASGAARARELAEKTLTEVYDRIGFVRPAR
169630761YP_001704410.1 hypothetical protein MAB_3682c [Mycobacterium abscessus ATCC 19977]MVAEDDKPGILDRYRARFPWFDHIMRMQERYGKVNGNFFAAGITYFTVFA
LFPLMMVAFAVMGFVLSRRPDTIAELRGRISGAISGEVGNQLINLMDTAI
ASRTSLGIAGLATAAWAGLGWMANVRAALSAMWEQPNDSENFVKGKLSDL
LALGSTFVALALTIAVTAVGDEKTILRILGWMGLHDVAIPSVLLKVVTIA
IATVLSWALFTWMIARLPRERLPFSSSVRAGLIAAIGFELFKQVASIYLS
VIMHGPAGSTFGPVLGIMVFAYITARLLLYATAWAATSDENRPLAHVPPP
EPVVITTRVETVERPSKLGVIAAFGAGVIGALGISWLGRGGD
169630760YP_001704409.1 penicillin-binding protein DacB1 [Mycobacterium abscessus ATCC 1997MTTWTPAPDRRPSPRTAVTRLAAATAAGLIVAVLPLCAPPLASAEPGFTP
PDTSGCPYKVVTPPAVDTSEVPKAGGDPPAPLPVPAKPIGGEMLGRCDVI
TPDGAGPVPNDISAESWLIADLNTGNVVAAKDPHARHRPASVIKVLVAME
AINNLNLNQAVVGTQEDANSEGTRVGVDVGGTYTVRQLLTGLLMNSGNDA
AHALAVQLGGMDETVAKINDMAQKLGARDTRAATPSGLDGPGMSTSAYDL
GLFYKYAFADPTFADLVSAPKATFPGHPAKPGERDDHPAYEMTNDNKLLY
NYPGALGGKTGYTDDAQQTFVGAAERDGRRLVVTMLRGTRLPIAPWEQAA
HLLDYGFSTPRDASIGKLVDPDPSLLTKPHADDTPSAQAAGLPAEAINSV
PVRVGVTIIGAMIVFGLILAARSLNRRQA
169630759YP_001704408.1 strictosidine synthase family protein [Mycobacterium abscessus ATCCMAKPSIDPVRWQPPGVRALSLEPQPLPRLSIVALPGHGPEDVVADAAGNI
WAGVADGRIFRISPDDTEGAAVTHVATTEHPPLGLHIARDGRVLICSRDK
LLALDPASGKIEPVVTKVDGPPLIFCSNVTESMDGTIYFSESTARFPFEQ
FMAAILEGRPTGRVFRRDPDGTVTTIATGLAFTNGVTITADGSALIIAET
VGRRVSRYALTGPAAGTLTPIVEEIPGMPDNISTGADGRIWITLASPRNA
LAEWLLPRSPAIRKVLWRLPDALLPGTDTDPWVIAVNPDTGDVLANITGK
SRDLRTVTGVVESGGRLWMGCIGSSAVGHISLADIASSSSGP
169630758YP_001704407.1 hypothetical protein MAB_3679c [Mycobacterium abscessus ATCC 19977]MLLDIGRAADAKRYVEEALAADPDNTALRILLVRCLIAADQERVALPVVD
RLVAESPEWDYLYRLRAIVLTGLGKSAEATRAARRAVALGAEDAWNYYQL
AVVLNNAAGRALSGSETKAKKQEAARKAAERAVALQPEEPAFHRIIGFLY
TEPEYRDIRERAWRKTLELDPEDTTAMTELARDEAMRSLRSSGLRTMRRA
LQIDPQRAPNVRLVVATALHRALLLPLVLTVPSGSTTIILAVDWLPETWW
SRALPVGFSAASLLLLTEALLRVRSSLRAMFARTVKLVGWFVGWIVVASA
LPILWLVTRHPAVMVGVALVLIPGVGLVAGLAWIGIKWVLKLCQGSLSDK
PGPRWDAYLDNQLGSMGNPPRKSQTPQQRKIRSRIWMIFIVGFVLVRAVA
CVASGAHHNPLPATNNSHVSAGDYARQLQIGRCAQATGDRVWSPITITDC
ADPRAVFRVATLSTPTCPNAAYYQYLSGGSAFSTPCLAKNLREAMCYQWP
GYGSGRTLDLSAKNVPCGDPRAHLKVEKRVDGQGPLVCPPSQTMETFPVP
APGVAYCLSDPNP
169630757YP_001704406.1 RNA polymerase sigma factor SigJ [Mycobacterium abscessus ATCC 1997MVVRAGDRTDEFEALRPRLQAVAYRLTGSVADAEDIVQDAWLRLYSTTAE
IEDLAAWLTTVVSRLGLDRLRSAVYRRETYVGEWLPEPVVTGLDGDDPLA
ALVASEDARFAAMVVLDRLAPDQRVAFVLHDGFSVPFKQIADILGISDAA
ARQLASRARRMVTATPEPVADAEHNEVVGELLEALMSGSVEAVVRLLHPD
VTMTGDSDGKAPTAVRVIHGPDKVARFLLGLMERYGPQMTQAINPALVNG
QFGMYLTETDTDPNFRPVLPRVSAFTVRDGRVLAVWDVSNPDKFSGTPLR
EA
169630756YP_001704405.1 transposase fusion protein [Mycobacterium abscessus ATCC 19977]MTTTSRIAPIAPPNASLLTRFMYRVTKRRYGQVPEPFTVIAHHRKLMVAA
AVHEQMLGSASQVLPTSVRELAVFWTARTVGCSWCVDFGSMLQRLDGLDV
DRLKAIDDYATSPLYTEDERVAIAYADAMTGNPHDITDEQVEDLRRRFGD
AGVIELTYQIGVENMRARTYAALGITEQGFNSGDACRVPWAASPDPMGT
169630755YP_001704404.1 succinate dehydrogenase iron-sulfur subunit [Mycobacterium abscessuMTAVIEKAEAGDPPLPPVPEGAVMVDLKIQRFNPEDPDAAGWQTFRVPCL
PTDRLLNLLLYVKGYLDGTLTFRRSCAHGVCGSDAMRINGVNRLACKVLM
RDLLPKNPKKTLTITIEPIRGLPVEKDLVVNMEPFFDAYRAVKPFMITSG
NQPTREYIQSQTDRARFDDTTKCILCACCTTSCPVFWSDGSYFGPAAIVN
AHRFIFDSRDEAAAERLDILNDVDGVWRCRTTFNCTDACPRGIEVTKAIQ
EVKRALMFAR
169630754YP_001704403.1 succinate dehydrogenase flavoprotein subunit [Mycobacterium abscessMGSPIIQEHRYDVVIIGAGGAGMRAAVEAGPRARTAVLTKLYPTRSHTGA
AQGGMCAALANVEEDNWEWHTFDTVKGGDYLADQDAVEIMCKEAIDAVLD
LEKMGMPFNRTPQGRIDQRRFGGHTRDHGKAPVRRACYAADRTGHMILQT
LYQNCVKHDVEFFNEFYALDIALTETPNGPVATGVVAYELATGDIHVFHA
KAIVFATGGSGRMYKTTSNAHTLTGDGLGIVFRKGLPLEDMEFHQFHPTG
LAGLGILISEAVRGEGGRLLNADGERFMERYAPTIVDLAPRDIVARSMVL
EVLEGRGAGPNKDYVYIDVRHLGADVLEAKLPDITEFARTYLGVDPVTEL
VPVYPTCHYVMGGIPTNIHGQVLRDNDNVVPGLYAAGECACVSVHGANRL
GTNSLLDINVFGRRAGIAAAEYAEAHDFIDLPENPATMVTEWVADVLSEH
GDERVADIRTELQQSMDNNAAVFRTEDTLKQALNDIHALKERYSRITVHD
KGKRYNSDLLEAIELGFLLELAEVTVVGALNRKESRGGHAREDYPNRDDT
NYMRHTMAYKQGAELLSDIRLDYKPVVQTRYEPMERKY
169630753YP_001704402.1 succinate dehydrogenase- hydrophobic membrane anchor protein SdhD [MTTPQTGSHTSVRASGRPAPVLERNYDRPAALDNPRAPRRGSGMPNFEKY
AWIFMRLSGVVLIFLALGHLFIMLMWDNGVYRLDFNFVAQRWASPFWQTW
DLLMLWLAQLHGGNGMRTIIADYTRKDSTRFWLNCLLALSIIFTVVLGTY
VLLTFNPNIG
169630752YP_001704401.1 succinate dehydrogenase (cytochrome b-556 subunit) SdhC [MycobacterMTTATPETASSGREGNRLKRSLYRGDPGMWSWVLHRITGATIFFFLFVHV
LDTALVRVSPESYNSVIETYKTPIVGLMELGLVAAVLYHALNGVRVILVD
FWSKGPRYQRLMLWIIGAVWFVVMVPAVTRILMHMAERFL
169630751YP_001704400.1 cytidine deaminase Cdd [Mycobacterium abscessus ATCC 19977]MKIEWNELRDKAYAVTKHAYAPYSKYPVGAAALVDDGRVISGCNVENVSY
GLGLCAECSVVCALFSSGGGRLMALSCVDSRGEPLMPCGRCRQLLLEHGG
PDLLIDHADGPRRLAQLLPDAFGPDDLDRGRI
169630750YP_001704399.1 thymidine phosphorylase [Mycobacterium abscessus ATCC 19977]MANTYAFDMPSIIATKRDGAELSPAAIDWLIGQYTSGDIGEEQVAALLMA
IYLRGMNGAETAAWTAAILASGERLDLSGLSRPTVDKHSTGGVGDKISLP
LVAVVAACGAAVPQLSGRGLGHTGGTLDKLESVAGIRVDLSNDQIRQQLS
DVGAVICAAGASLAPADRKLYALRDITGTVESIPLIAGSIMGKKLAEGTA
ALVLDVKVGAGAFMKSEQRARELASAMVDLGTAHGVATSALLTAMDTPLG
ATAGNAVEVQESLDVLAGGGPEDVVALTVTLAREMLAAAGIDGKDPAATL
TDGTAMDVFRTMIHAQGGDLAVPLPLGQCQETVLAPVGGVMRRIDAMPVG
IAAWRLGAGRSRPGEAVQHGAGVRIHRRPGEAVVAGEPLFTLYTDTQERL
PAALDALEGGWEIGAAPTATPLIIDRLPV
169630749YP_001704398.1 adenosine deaminase [Mycobacterium abscessus ATCC 19977]MTAELDLVSITQAPKALLHDHLDGGLRPGTVLDLARETGYENLPAQDETA
LASWFRTAADSGSLEQYLETFAHTVGVMQTASALHRVAAECVEDLAADGV
VYAEVRFAPELHIDAGLTLDDVMDAVLAGFADGERQASAAGKRIKVRTLV
TAMRHAARSREIAELAVKFRDRGAVGFDIAGAEAGYPPTRHLDAFEYMRN
ANSRFTIHAGEGFGLPSIHEAIAFCGADRLGHGVRIVDDIDIGPDGTAHL
GRLSSLLRDKRVPLELCPSSNVQTGAVESLADHPFDLLARLRFRVTVNTD
NRLMSDTTMSREMLRLVETFGYGWSDLQRFTINAMKSAFIPFDERLAIID
DVIKPGYAVLIG
169630748YP_001704397.1 hypothetical protein MAB_3669 [Mycobacterium abscessus ATCC 19977]MAADIVPIELGLTEGDVVTLWAPRWRDAGDEWEAFLGKDDDLYVFESVAD
LVAFVRTDNDNDLVDHPAWSTLASLSADELEPDDDNRYDLIGVPELVADK
PTEDAVDTLRATLAIVASIGAVCELAPINKLINGNPVLGTLSGGAESFTG
KDGLKRWNQIGTIVGKSWDSVIDAIDEIAATPDVDEELSAAADAELLAAA
ENAVDKDDDLEDDDELDLLDEDSDSDDESSDDAEDESDDAAEDDDTEDED
TADDDVVLGGDEDFWLEVGIDPIQMITNSGTFYTLRCYLNDEPIFLGRNG
RISVFGSERALARYLADEHDHDLADLSTYDDIRTAATDGSLRIDITDDNI
YVFTGLADDLEDGVDEVDRDQLELAVELLTDVAEYSEDDSVDAELDSDTP
LGKLVGHLLEPEKHDEPKGPFVDAAERWRTLERAMEARLRRE
169630747YP_001704396.1 hypothetical protein MAB_3668 [Mycobacterium abscessus ATCC 19977]MSRDWMLLETLGDEPTVIAIGSQARNLAPLESVLRRNRHRPLIEAAIADC
RRTGEVTAAFTPARDRVVHVHPISMDKANIHGVHVWFGPVDVDPPPRPLA
GACLGDLDTSLTTLTAEYFEVMGFDPQNRSERQAIAEGLAPVLPSPRNTE
LMAHVVNPELDSTFCGTCLAADHQGNTLQVHYAGRASKETDPAGAVARIN
RIICTRVENRPAEPRVGLAQQILEAVATPGVHRLLMNVDTFAVLKWIDEP
YPDLAWRYNPDRPETIHPDDEASARRMRDELRAGSTTGVLRVRAISGGWL
RLRASATKFALRDNAFAALVTLAPAPAVDAEA
169630746YP_001704395.1 hypothetical protein MAB_3667 [Mycobacterium abscessus ATCC 19977]MAREWLLLETLGDEPTVIASGSQPRNMVPLSTFLRRNRNLGLLRRVITAA
TKANKALTIGPPDSDSVIDVRPVAMPDGRVHGVWLWTGSTAPHTVPPAEG
GAVVLNADTGVLRISDGAALAMGIAADEPHDEISMPELYRYLSPNPGETD
VLGLIVTATEGMTYSATWPGVDSDGKPTLCHFASRLVLEPNGDGVPERLG
RAINLRVGQPAPPVPLLEQQVLEAASEPGAYRALVMIASRKLLKWIDPPA
PEWHWEFDPLGRAKVHPDDEANLNFMIDNSVFGATEAVIRFRCHDDSWES
LHCATQVVRLNENATVALITLRRR
169630745YP_001704394.1 hypothetical protein MAB_3666 [Mycobacterium abscessus ATCC 19977]MTEPDLTFFRALEQQYQETMTRARAGGHILNSAVEELKGLRGWARSAQGH
VEAEANGNGALTNLRLDDSVTKLSPKIVGQIVVATAAAAAGQAFDHRERV
LAQLLVDLKNPQP
169630744YP_001704393.1 hypothetical protein MAB_3665 [Mycobacterium abscessus ATCC 19977]MPRPEPRASIDMTNRARTLRVKVSEFGLPLEVHIEPDMLSRGASALAQEI
KNLCELGAARCGAARREELAESGIPDYLLDRIGLATPAQVADIELRQSEE
QMERRS
169630743YP_001704392.1 hypothetical protein MAB_3664 [Mycobacterium abscessus ATCC 19977]MVETSPISPSRLSEAVNTNYPDFSNNPFSSGLIGPAMDMAGTVGPGQFKE
GQDPSKMLESGMQVMQQVMQQGLQAGSSLIGSFAGAAAQALGQFAGMAGQ
ALSSMATRSGAMGANVGQASESTARATSLITEALQEFQHTSEALTPLLWV
PGVAAELAEAASRCTARVAEHTAQLEGELAGQAGELTGMAGADMGNPATP
ASGSVQPAMSAMQGGLQAGTQAMSGVASGVTQTMSSMGQGLGQIPQALTG
LLSGAGGGSGSASALAGGSGLNGIAAGALANPFGAGGGHASSTAGGTSSG
LGSANASAAKMLLDPRSMGKGVQLFLPDGSTSQAPNAAAAEAVRKALSQV
GVPYEWGGTKPGVGLDCSGLTQWAYGQSGVDIPRLAQEQGVGVKVDQGSV
MPGDLAVWDGHVAMVIGNGMMVEAGDPVQISPIRTTNAGQGFHGFYRPTS
169630742YP_001704391.1 hypothetical protein MAB_3663 [Mycobacterium abscessus ATCC 19977]MPEELSADTDLLRGVGGVQMGMGGTLAAVGTAVSIFPVAALAPVFGPIGA
HYLGAFAMTSAKQGLDVGQLAMNVTESGVTTNVASNGYDDADDNIGKNIS
ATVEGIEA
169630741YP_001704390.1 Uracil phosphoribosyltransferase [Mycobacterium abscessus ATCC 1997MHVHVVEHPLAAARLTTLRDARSDNAAFRTALRDLTLMLVYEATGSVPVE
SSTVRTPVAETTGYRLANPPLLVPVLRAGLGMVDQAHALIPEARVGFVGM
ARDEDTWQPTPYLESLPADLSAQPVFVLDPMLATGGSMVYTLELLHARGA
ADITMLCVVAAPQGVTAIQECAERFGPSTSVRLFTATIDEGLNDAAYIVP
GLGDAGDRQFGPR
169630740YP_001704389.1 phosphomannomutase PmmB [Mycobacterium abscessus ATCC 19977]MTVAAETIQEWIDHDPDPQTVAELRACSEDELAQRFSDPLVFGTAGLRGP
VRGGPNGMNLAVVLRTTYGLAKVLKDRCLGGSTVVVGRDARHGSEKFALG
AAEVLAAEGFTVVLLPRPLPTPVLAFAVRQVDAAAGIQITASHNPPADNG
YKVYWSGGAQIISPTDREIEAATAAAPFADQIPRTPVEPTGESLIDAYVQ
RAATVRRGAGNLRVVLTALHGVGGATAVATLNAAGITDIHLVDEQFQPNP
DFPTVEFPNPEERGASDAVLARAAEVDAALAIALDPDADRCAIGVPTTTG
WRMLSGDETGWLLGDYILSTQPDSSIPPVVASTVVSSRMLARIAASLGAR
HVETLTGFKWLVRAADSDLVYAYEEAIGHCVDPVAVRDKDGISAAVLACD
LVTHLRELGTSVEEKLENLAIRHGIHVTSQVSRRMDSLEDIEAMMTRLRQ
NIPAALSGFPITAEDLLERRGQQRTDAVVLSGEIGGSSIRLVLRPSGTEP
KVKCYIEVREPVITDPTVARIWAGVVVSELEAYARNI
169630739YP_001704388.1 purine nucleoside phosphorylase [Mycobacterium abscessus ATCC 19977MTDEAPARGRYPQPARRVDDADDRLAPDDAAALAAAEIATRTGVPAHRVA
VVLGSGWAPAAGELGTPATTIPMAELPAFSPPSAAGHGGSVLSVPIGGSD
ERMLILLGRIHAYEGHDLRHVVHPVRTACAAGARTIILTNAAGGLREDYA
VGQPVLISDHLNLTARSPLVGAQFVDLVDAYSPRLRALAREIDDNLTEGV
YAGLPGPHYETPAEIRMLRTLGADLVGMSTVQETIAARAAGAEVLGVSLV
TNLAAGMTGESLNHEEVLAAGRASATRMGQLLRAVIGRL
169630738YP_001704387.1 putative peptidase/amidohydrolase [Mycobacterium abscessus ATCC 199MPLTTGASSTAHAETASAVVDAAATDLVALSHDIHSEPELAFQEVRSALK
TQRLLAERGFEIVTGQGGMDTAFRATYGHGPLVIGVCAEYDALPGIGHAC
GHNIIAASAVGTGLGLAEVADALGLTVVVIGTPAEEFGGGKALLLKAGAF
DDVAAAVMLHPGPIDIAGARSLALTDVMVTYHGKESHAAVAPQLGINAAD
AVTVAQVSIGLLRQHLSPGQLIHGIVTEGGEAANIIPGRAAMQYTMRAVE
TASLRELEEKVYACFAAGAMATGCSHELVESSPPYLELTPDPWLVAVFRE
EMESFGRTPVPAEFEATVPLGSTDMGNVTQVLPGIHPVIGIDSGGAVIHQ
PDFEKAAREPGADRAVVEGAKMLARTVIRLAEDESERSRVLDRLARRTVK
V
169630737YP_001704386.1 putative peptidase/amidohydrolase [Mycobacterium abscessus ATCC 199MSESLSAVAEQWLAENTDALVRWRRHIHEHPELARQEHATTEYVAARLAE
AGLNPKVLPGGTGVTCDFGPEDGPRVALRADMDALPMQERTGAAYSSTVP
NVAHACGHDAHTAILLGAAMALNSAPSLPSGVRLIFQPAEEVMPGGAIDV
VAAGAMAGVTRIFALHCDPRLEVGKVAIRAGAITSAADTVEITLHSPGGH
TSRPHLTADLVYGLGTVITGLPGVLSRRIDPRAGTVMVWGAVNAGQAANA
IPQIGSLAGTVRTGSRDVWITLEDTVRDVIAGLLAPLRIDYTLNYRRGVP
PVINEAESTHIFVRAIQDIGLDALAETTQSGGGEDFSWYLEEVPGAMARL
GVWSGSGPQLDIHQPNFDIDERALGVGVRTLVNLVEQSAIQNPV
169630736YP_001704385.1 hypothetical protein MAB_3657 [Mycobacterium abscessus ATCC 19977]MPLYAAYGSNMHPEQMLQRAPHSPMAGTGWLHGWRLTFGGEDIGWEGALA
TVVQDPHSKVFVVLYDMTSADEKNLDRWEGSELGIHTKIRCRIDRESSDT
TTDPVLAWLYVVNAYEGGLPSARYLGVMADAAEIAGAPEDYVHGLRTRAS
RNIGPGTS
169630735YP_001704384.1 flavoprotein disulfide reductase [Mycobacterium abscessus ATCC 1997MATRIVIIGGGPAGYEAALVAAAHERSTTEVTVIDSDGIGGACVLFDCVP
SKTFIASTGVRTDLRRAPNLGFDIDVEHAKISLPQIHSRVKRLASEQSAD
IAERLRSAGVHLIAGRAELVDHVVGMAFHRVKATAPDGTSTILEADVVLI
ATGASPRVLPHARPDGERILTWRQLYDLDELPEHLIVVGSGVTGAEFVHA
YTELGVQVTVVASRDRVLPHEDEDAALVLEDTLAERGVTLVKNARADSVA
RTDTGVRVSMADGRVVDGSHVLMTVGSIPNTAGLGLERVGITLGPGGYLT
VDRVSRTSVAGIYAAGDCTGLLPLASVAAMQGRIAMYHALGDAVQPIRLK
TVAAAVFTRPEIAAVGVSQAAIDNGDVPARTVTLPLHTNPRAKMSGLRRG
FVKIFCRPATGVVIGGVVVAANASELILPIAIAVQNLLSVNDLAQTLSVY
PSLSGSVTEAARQLIAHDDLD
169630734YP_001704383.1 glycerol-3-phosphate dehydrogenase [Mycobacterium abscessus ATCC 19MSDATSPSGSSGPTYTFLGPEARSLNWERLGSEQFDVIVIGGGVVGAGSA
LDAATRGLKVALVEARDFASGTSSRSSKMFHGGLRYLEQLEFGLVQEALR
ERELSLSTLAPHLVKPLPFLFPLTSRWWERPYVAAGIFLYDQMGGAKSVP
AQKHLTRAGALRLAPGLKRNSLIGGIRYYDTVVDDARHTMTVARTAAHYG
AVVRASTQVVSLLREGDRVTGVLVRDTESGAETEVRGHVVINATGVWTDE
IQALSKTRGRFRVTASKGVHIVVPRDRIVSEVAIILRTEKSVLFVIPWGN
HWIIGTTDTEWNLDLAHPAATKVDIDYILDHVNTVLATPLTHNDIDGVYA
GLRPLLAGENDDTSKLSREHAVAVAAPGLVAIAGGKYTTYRVMASDAVDM
ASEFVPARVAPSITEKVPLLGADGYFALINQTEHVGETYGLHPYRVRHLL
DRYGSLIGEVLACAGTDHSLLQPITKAPMYLKVEARYAVAAEGALHLEDI
LARRMRIAIEYPHRGVDCAQEVAELVAPVLGWSAEDIVREVDTYRARVDA
EVRSQRQPDDASADALRVAAPEARSFIVEPVTETGTVLSPATK
169630733YP_001704382.1 pseudouridine synthase [Mycobacterium abscessus ATCC 19977]MRIRLHDGGRVVDELVARFGPAAVDQVDRGEVVDSAGMRVTAGTRLPAGA
VVYTYREPAEEISVPFAIDVLHWDENVLVVDKPHFLATMPRGRHVTETAL
VRLRKMLDLPELAPAHRLDRLTAGVLLFTVRRDARAAYHSLFAQRQVVKI
YEALAPVKPGLSLPLTVRSRIVKRRSILQAVEEPGPANAETRVELVDRHH
AVGRYRLTPSTGQTHQLRVHMNSMGVPILNDPLYPDVVEVPPDDFTRPLQ
LLARTLAFRDPLNGKDVRYESGRALGQ
169630732YP_001704381.1 pyridoxine 5-phosphate oxidase [Mycobacterium abscessus ATCC 19977]MINNHYHHLAFGPDAIERQRVNGSYVAYGTHLERPDDGPDELSARELRMI
ADATQFCLGTVTPTGWPYLQYRSGPAGFVRHLGGNTLRFVDLPGNNQFVT
LGNLSTDDRLAMFFVDYPRKQRLKVFGRGSVHEGERREIEVGVEAFDWNC
SRSIIPRYDQQYLSELGKAYQDKAAAREAELTAEIERLRARVAELEQRGP
VTALAPGRTRT
169630731YP_001704380.1 hypothetical protein MAB_3652 [Mycobacterium abscessus ATCC 19977]MNGPREEQTAALQVTRFDHIVINCRDVDITAAWYERVLGMSRETFGPAAR
TALTFGMQKINLRPIAATQDEWFTGVAAAAGSDDLCFITGAAPAQVRAHL
EACGVPIEQGPVTKIGALGEMTSHYCRDPDGNLIEIAVYP
169630730YP_001704379.1 ATP-dependent helicase Lhr [Mycobacterium abscessus ATCC 19977]MSSEPGPLARFSAPTREWFTESFPTPTRAQSGAWQSIANGDNTLVIAPTG
SGKTLAAFLWAIDTLVQEKEAEAAAESRRLRGSRVLYVSPLKALAVDVER
NLRAPLAGIARTAARMGLPEPAITIGVRSGDTPAQRRRTLISSPPDILIT
TPESLYLMLTSAARETLDTVRTVIVDEVHAVAGTKRGAHLALSLERLDER
LSQPAQRIGLSATVKPAAEVARFLSGRAPATVVAPASPKTFDLSVVVPVS
DMSAPESFPEPEASPDSTRGGATSLWPHVEQRIVDLIEAHRSSIVFANSR
RLAERLTARFNEIHAERLGLDLTPMPNPDVPGGPPAHIMGSGQTYGAAPL
LARAHHGSVSKEQRADIEDDLKTGRLKCVVATSSLELGIDMGAVDLVVQV
EAPPSVASGLQRIGRAGHQVGEVSRGVLFPKHRTDLLGCAVTVRRMLDGD
IETLQVPANPLDILAQHTVAACALESMDVEKWFDVVRRSAPFTSLPRSAF
DAVLDLLSGKYPSTDFAELRPRVVYDRDEGTLTGRPGAQRLAVTSGGAIP
DRGLFTVYMYAGAEGEKPSRVGELDEEMVYESRPGDVISLGATSWRITEI
THERVVVVPAFGQPGRLPFWRGDSVGRPAELGIALGQLTGELASARDAEF
DKRCAAMGFDDFATGNLRTLLTDQLRSTGAVPTDTTLIVERFRDELGDWR
IVLHCPYGLRVNGPLALAISDRLQQRYGVSESPTATDDGIVVRLPDTDDS
PPGADLFVFDAAEIESIVTREVGGSALFAARFRECAARALLLPRRTPGRR
SPLWQQRQRAAQLLDVARKHSDFPMVLEALRECLQDVYDISTLVRLMSGI
EQRRIRIVEVQTDTPSPFAAAQLFSYIGGFMYDEDRPLAERRAAALSLDT
NLLAELMGRVELRELLDPAVIDATERQLQHLAEERKARDAEALADLFRLL
GPLTAEEIAQRCAGPGAAWLDELVSARRVVGTSYGQRSWWAAVEDVARLR
DALGVPVPPGVPAAFTDAATDPLAELLSRYARTHGPFTTGEAAQRFGLGV
RVAADTLSAMAARGQLVRGEFTSDATDSEQWCDAEVLRILRRRSLAALRA
QVEPVSTSAFARFLPDWQYLDSNLRGIDGVATVIEQLAGVPIPASAWEPL
ILARRIRDYSPQMLDELLASGEAVWSGQGSISAQDGWIALHPSGVAPATL
AAAETVILDDAHRAILNCLTAGGGYFFRQFGSDATRAALWDLVWAGQVTG
DTFAPVRALLGTSTTSRTAHRNRRAPRLRAYTPITTAAPVDPAVAGRWSM
LPERLTGGTERSHIQAELLLGRYGVVTKGSVVAESVAGGFAWLYKVLSTF
EDNGRCRRGYFVESLGGAQFASPATVDRLREYLDPVDDARKPYRATVLAA
TDPANPYGAALVWPRATSESGHRPGRKAGALAVLVDGDLALYIERGGKSL
LSFVIDPTVLHAAALGTMELVRDGGLDGLVIERIDGRSVFDIGDSAVVAA
LMEAGFARTPRGLRIRR
169630729YP_001704378.1 TetR family transcriptional regulator [Mycobacterium abscessus ATCCMTDDSDAVRPSGASPRRRLTPEDRRAELLDFGTQLFGERHYDDVRMDEVA
EQAGVSRALLYRYFPDKRAFYTAVMQAEYDRLYDATISLDMDQTLSGFER
LRRTLLVYLHYQEEHPFAPVTVFRMIDSADPTVMAIEQQEYDKQTDRIMA
VVDHVAGDEMTPALVTDLKVVIRAWLAFNQELARQRALNPELDVDWLADT
SAHAMIDAVRRMPNIPQAVVDLMGAD
169630728YP_001704377.1 aldehyde dehydrogenase [Mycobacterium abscessus ATCC 19977]MTTTLPAPSPGVLPSADELRTRAQNALRWIGADVELNTEPPVGDQGVTVR
TPITGDTLFILTASSKDDVDTAIAEAAQAFSQWRTTPGPIRGALVARLGE
LLVEHKKDLAELVTIEAGKIVSEALGEVQEMIDICQFAVGLSRQLYGKTM
ASERAGHRLMESWHPLGVVGVISAFNFPVAVWSWNTAIALVCGDTVVWKP
SELTPLTAVACQALLDRAAADVGAPPQVSRLIQGGREVGEQLVDDPRIAL
VSATGSVRMGQQVGPRVAARFGRSLLELGGNNAAIVTPSADLDLAVRGIV
FSAAGTAGQRCTTLRRLIVHRSIADGLVERIVHAYGQLPVGSPFDEQTLI
GPLINDKAFRDMQDALETARAQGGTVVGGERRELGDGSFYVTPAVVRMPE
QSDVVHRETFAPILYVLDYDTLDEAIALNNAVPQGLSSAIFTLDMREAER
FLAADGSDCGIANVNIGTSGAEIGGAFGGEKETGGGRESGSDSWKAYMRR
VTNTVNYSTELPLAQGVHFG
169630727YP_001704376.1 hypothetical protein MAB_3648 [Mycobacterium abscessus ATCC 19977]MTALVQRWELRARFAGALSQMYGTEVPAYNTLVEVSTAVNQTYATTHPDA
ERLGSIQRVTAERHGAIRVGSPRELAAVADLFEAFGMYPVDFYDLRDAAS
PVPVVSTAFRPIDENELALNPFRVFTSMLATADRRFFDPDLRGRVENFVR
QRELFDPALLAHARLISAAGGSTPAQADDFIAEAVNAFALSSAPIDRAWY
DELSAVSPVAADIAGVARTHINHLTPRVLDIDDLYRRMTARGVTMIEAIQ
GPPRWHGPEVLLRQTSFRALAEPRCFRMSDGSVGSDTLRVRFGEVEARGI
ALTPAGRGRYDDAVAAIDTAQADPEQAASMWASYFPDTEAGLDEQGLAYF
RTEMAPGGQIVRSPIVYEDFLPRSAAGIFRSNLDGDGAYGDGADESVTAY
SKEWMSGAIGREIHDPYALYAAIAAQSDLTTGATR
169630726YP_001704375.1 transcriptional regulatory protein [Mycobacterium abscessus ATCC 19MTVDSERTPERPLDDVDRILVRELARDGRATLAHLAAKAGLSISAVQTRV
RRLEARGVLAGYAARVNPESVGQLLSAFVAITPLDPSQPDDAPARLEHID
AIESCYSVAGEESYVLLVRVPSPRALEELLQLIRTTANVRTRSTIILQTF
YDGRQLVP
169630725YP_001704374.1 L-lysine aminotransferase [Mycobacterium abscessus ATCC 19977]MTALIFPGFQAGPTHGDQATRPDPVTPDRVHDVLRRSILADGMDLVLDLE
RSHGAHLVDARDGTDYLDMFTFFASSALGMNHPMLAEDDEFRAELATAAI
NKPSNSDIYTVEMARFVDTFARVLGDPALPHLFFVDGGALAVENALKVAF
DWKSRWNEAHGIDASLGTKVLHLREAFHGRSGYTMSLTNTDPNKVARFPK
FDWPRIDAPYLRPGADIEALEASALAQARRAFAENPHDIACFIAEPIQGE
GGDHHFRPEFFHAMRALCHENDALFIFDEVQTGCGLTGTAWAFQQLGVIP
DVVAFGKKTQVCGVMAGGRVDEVDDNVFAVSSRINSTWGGNLVDMVRSRR
ILEVVEAQRLFANAMRMGEYLLERLQTLAVRHDAVGDVRGRGLMCAFSLP
TAEERDHLVQRLWADERVILLPSGENSVRFRPPLIVSAEEIDAAVAAVSR
VLALR
169630724YP_001704373.1 putative reductase [Mycobacterium abscessus ATCC 19977]MNTSTTPLRLAVICASTRDGRFGPTVANWIAQSARTHPAFDVGYIDLADY
PLPLHLSKRPGTQDTAQLARVTARLRIADAFLVVTPEYNHSFPAPLKNLI
DWHHSEWQAKPVGFTSYGGMSGGLRAIEQLRLVFAELHAVTTRDVVSFHG
VWSQFDEDGRLTDSRDAETAAKTMLDELAWWGAALRTAREHSPYAW
169630723YP_001704372.1 hypothetical protein MAB_3644 [Mycobacterium abscessus ATCC 19977]MEPIEINAGAWYLRALRADERMDDRPALTSLGVDDADYVTVRAADWDSDR
LYSWAVCEPTTAEMVAEVRLDPVTAEIESRARADYPGAGDAEQEAVAAVR
RFADAMLA
169630722YP_001704371.1 bifunctional protein acetyl-/propionyl-CoA carboxylase (alpha chainMPNHASSKISKVLVANRGEIAVRVIRAAKDAGLGSVAIYAEPDADAPHVH
LADEAFGIGGNTAAESYLDFGKILEAAEKSGANAIHPGYGFLSENADFAQ
AVIDAGLIWIGPSPQSIRDLGDKVTARHIAARAQAPLVPGTPDPVKDADE
VVAFAKEHGLPIAIKAAFGGGGRGMKVARTLEEVPELFESATREAVAAFG
RGECFVERYLDKPRHVEAQVIADQHGNVVVAGTRDCSLQRRFQKLVEEAP
APFLTDAQRKEIHESAKRICKEAGYYGAGTVEYLVGQDGLISFLEVNTRL
QVEHPVTEETAGVDLVLEQFKIANGEALQFTEDPEPRGHSIEFRINGEDA
GRNFLPAPGPVKVYDTPTGPGVRLDSGVQAGSVIGGQFDSMLAKLIVTGR
DRNEALARSRRALAEFNVEGLATVIPFHRAVVSDPAFIGDEDGFTVHTRW
IETEWNNTIEPFTAGGEAADEDEALPRQKLVVEVGGRRLEVSLPGDISLG
GGGGAANGVVRKKPKARKRGGHGGGAATGDSVTAPMQGTVVKVAVEEGQE
VEAGELIVVLEAMKMENPVTAHKAGTVTGLSVEAGAAITQGTVIAEIK
169630721YP_001704370.1 putative SufE-like protein [Mycobacterium abscessus ATCC 19977]MTLPAELAEIVADFKAVDGQDKLQLLLEFSSELPELPSHLEQAAMEPVPE
CQSPLFLDVDASDRTEVHLYFSAPAEAPTTRGFASILQQGLDGQSADAIL
AVPDDFYADLGLAALISPLRLRGMSAMLTRIKRRLS
169630720YP_001704369.1 putative thiosulfate sulfurtransferase [Mycobacterium abscessus ATCMTLPADPSPEFAAYAHPERLVSADWLSGHLGTPGLSIVESDEDVLLYDIG
HVPGAVKIDWHVDLNDSTVRDYIDGAQFAELMNRKGIRREDTVVIYGDKS
NWWAAYALWVFTLFGHPDVRLLDGGRDLWISEGRDTTLDVPSKHTEGYPV
VERNDAPIRAYADDVLAHLGHGPLIDVRSPAEYTGERTHMPDYPEEGALR
GGHIPTAVSIPWAKAAAEDSRFRRRGELDEIYGDVIAADGDIVAYCRIGE
RSSHTWFVLTHLLGVEGVRNYDGSWTEWGNRVRTPIVKGDKPGAVPTQ
169630719YP_001704368.1 hypothetical protein MAB_3640c [Mycobacterium abscessus ATCC 19977]MPDWTYHPLSPIVASVLGEHRTRVWAMKALALLVTRVGGSCWIPRVFDHA
PVPPQWQDRFGATVPPSIAREAIAVLPVQGAGVVEIAPVGIADVPQVCAA
AVGRRCRVTALAATPAAADAVAPYVDAVSFPGEAGVVRLSDPAIASAVRE
LADPATAVLATPTVLIEAGPGWFNRVIEAATPTTPPKALRDIGFDPRAWP
AWIWGALTGLGLVVAGIGAAAIALGPVLLWYDRDYLGQSVHDLHEVNQHL
IGFLQHDRLTMAGNMIGIGILYLGLAWGGIREGHRWARNALLISGTVSFL
TYFYFLVTGFLEPLHTLVVVALFPMLVLAVWRAPTQAHWPPVVEGPESQR
RRALWGQLLMIAVGGGLFVAGAVISTVGLTTVFVPTDLDFLGTGSSQLRS
ANQHLLPFIAHDRAGFGGALMGAGLAVLLISMWGWRRGERWVWWSLLLGC
AFGTVPVLAVHFSIGYTHFEHLLPVYVLVVVTVVALALSRAYLTTPLAQS
PRISR
169630718YP_001704367.1 putative luciferase-like protein [Mycobacterium abscessus ATCC 1997MARPVSILDLARVAPHETVAESFAASVEIARHAETLGFHRVWYAEHHNMR
SIASSATSVLIAHVATQTSTIRLGAGGIMLPNHSPLQIAEQFGTLETLHP
GRIDLGLGRAPGTDQVTLRALRHGPGDAEHFPQDVLELQAFLGDQSRVPG
VTATPGHGTQVPLYILGSSLFGAKLAAVLGLPYGFASHFAPPALQDAVAL
YRREFQPSQQLDAPYVLAGVNVIAADDEATARDQHQAALIERAKLFLHRS
GGPRLTDEEALAALESPAGRQIQSMTKYFAVGTADQVGAYLEDFAQLADA
DELIVVPNAPDRKLQLRSLEIVAEVSGLTLRG
169630717YP_001704366.1 hypothetical protein MAB_3638c [Mycobacterium abscessus ATCC 19977]MPFIPTAAELAGALADLLDDLQPELPSTSVHRARVGANIARILQRELTVP
APPTQDSSWDELVQSVRAELAIVKPGYDAWEGE
169630716YP_001704365.1 putative aminoglycoside phosphotransferase [Mycobacterium abscessusMSDLTEGLTRYLRDEFGKDFTVSGVVGVSAGARRRNVLLDATFGSETLEL
VATIVPAAVQQIPVSGEAGVRELARSNGVPVPRVRGICPDAAYVGAPFMI
SERIAGETVPRKVLRLVEARGIGDLVAGQLGSAMGRLHGIDPAMAPPDLP
GDLESEPAVVMLEQMREGVAALLPDRPVFQRALSWLTERMPGPPVRRSLV
HTDIRNGNVIVGEDGLRAVLDWEGTTRFGDPMRDVGWTALRMWRFGLDDR
EFGGFAGRDVFVRSYEESGGTFDPERFQWWKVLGTLWWGVGLAAQAKSYL
DGSVRDIVMAASGRRIPEIEWDLLMLTKPSEREGTR
169630715YP_001704364.1 acyl-CoA dehydrogenase [Mycobacterium abscessus ATCC 19977]MNFELPPELVDYLAELDGFIDREIVPLEQADDNIRFFDHRREDSRTDWER
GGLPNREWEALLGEARRRADVAGHFRYPFPAEFGGRDGSNLGMAVIREHL
ARRGLGLHCDLQNEHAIVGNNVGLLLMLEYGSDEQKAAWVEGLAGGTKVF
AFGITEPEHGSDATYMETRAVKDGPDWVINGEKTWNTGVHVADADLIFAR
TSGEPGDGRGITAFLVPADAPGFKVEEYLWTFNMPTDHAHVSLTDVRVPD
AAIFGGEGRGLGVVQHFFNENRIRQAASSLGAAQFCIDRSVAYAKERRPF
GKALASNQAIQFPLVELQTQCEMLRALIHKTAWSMDTYGPFSVSEQVSMC
NYVANRLCCEAADRAMQVHGGMGYSRHMPFEHIYRHHRRYRITEGAEEIQ
MRRVAGYMFGFMSQKAPKGV
169630714YP_001704363.1 putative gluconokinase [Mycobacterium abscessus ATCC 19977]MAQASPPVVVVMGVAGAGKTTVARLLAQRLDAPYAEGDDFHPEANIAKMA
AGIPLDDTDREPWLRRIAEWICEHGRAGTGGVVTCSALKRHYRDILRTGW
SDVFFLHLSGNRSLVGDRMSHRAGHFMPTSLLDSQFDILEPLQSDEKGVA
LDVGTEPEQLVAEALRQFGV
169630713YP_001704362.1 putative gluconate permease [Mycobacterium abscessus ATCC 19977]MNAGLVLLAEQANVAHTTSEVRLLAAVLLSIGAIILLITRLRLHPFLALL
LGSGTLAAAASVPFDKLLGSFVTGFGSTIAGVGLLIGLGAMLGRLLADSG
GANIVADAVLTRSSPRLLPWAVASIAAVLGLPLFFEVGVVLLIPIVLLVA
RRGNVPLLRVGIPALAGLSVLHGLVPPHPGPLVAVDALKADLGVTLAFGL
VAAVPTLIVAGPLYARIAERWVGPLDIPTATAPEAERTGPAPSVVAVLAT
ILLPVTLMLAKALSDVVIDNPKSLVQRIFDTIGTPLVALLAATLVAMVTL
GKASGLDRIGVAGIIEKSLGPIAGIVFIVGAGGGFKQTLIDVGVGDAVSS
WSEKWQIPALVLGWLIAVLIRLATGSATVATITAAGIVSPLAADMSTAHV
ALLVLAVGAGSLFFSHVNDAGFWLVKEYFGMSVGQTLKSWSVMETLISVV
GFAMVLLLSVVV
169630712YP_001704361.1 Maf-like protein [Mycobacterium abscessus ATCC 19977]MTATPGLRASGSTTFVLASASPARERILEQAGLNPVVIVSHVDEHLVMAT
QPSGTPPSRAVEVLASAKAFDVATALAGEVAADAVVLGCDSLLLLDGSLQ
GKPGTVKEARRRWELMAGRSAELLTGHCLVRVLDGKPVARVSETRSTTVR
FGTPSADDLEAYLATGEPLQVAGAFTLDGLGGWFIDGIDGDPSNVIGVSV
PLVGRLLNKLGVSASSLWIRHEKHVPPKPFHPDTPTVPALPPRMVPLSDS
LVMIGPTQQQEFKDAQGIPIPHMPSVNTSFQIACDNDSFDLGVHTNRGAC
LWTGDYLNTGDGIQLIPVDPARPSVALGGRTKPLALPENAQNGARLLPTG
SAQLAHRSFLFASCIPAPGCSTFVSADTTVYDVSEPGQTTYHPVGVMAGI
SQPSGVSAPGRRMLVAGNIGTGPWAPRLAWLTPPIDDPAFLDSSAWEKLG
QIKGGGDRENQLFALPAGGFGLLDANGSGDAHIGLKLFRTPQELVSEPMT
VLIRNDPSDPRADDPFISRDPHKLLQPYGPQVVNITMNPDGTQTLYFLVS
QWVTDPTRAYRTILYSIVLAPQYLSI
169630711YP_001704360.1 hypothetical protein MAB_3632 [Mycobacterium abscessus ATCC 19977]MTDETVAAEANPGGEGRVKAADIQVLSGNPTDEEIAALVAALSALASKAE
AAELKPRNLWAEPIDMLRYSPHSWQRVTLFERAKLARPRGTY
169630710YP_001704359.1 propionyl-CoA carboxylase beta chain 5 AccD5 [Mycobacterium abscessMTTTESDSHTAADAAAPQPDIHTTAGKLADLRRRNEEALHPVGEAAVDKI
HAKGKLTARERIFALLDEGSFVELDALARHRSTNFGLESKRPLGDGVVTG
FGTIDGRDVCIFSQDVSVFGGSLGEVYGEKIVKVMDLAIKTGRPLIGINE
GAGARIQEGVVSLGLYGQIFHRNVIASGVIPQISLIMGPAAGGHVYSPAL
TDFVVMVDQTSQMFITGPDVIKTVTGEDVTMEELGGAHTHMAKSGTAHYV
ASGEQDAFDYVRDILSYLPSNNASEPPRYPGPEPTDGAIEDHLTEEDLEL
DTLIPDSPNQPYDMHEVITRILDDDEFLEVQAGYAQNIIVGFGRIDGRSV
GIVANQPTQFAGCLDINASEKAARFIRTCDCFGIPIITLEDVPGFLPGTE
QEYNGIIRRGAKLLYAYGEATVPKITVITRKAYGGAYDVMGSKHMGADVN
VAWPTAQIAVMGASGAVGFVYRSQLAEAAKNGDDVDALRLQLQAEYEDTL
VNPYIAAERGYVDAVIPPSHTRGYIATSLRLLDRKIVRLPPKKHGNIPL
169630709YP_001704358.1 hypothetical protein MAB_3630c [Mycobacterium abscessus ATCC 19977]MDKQPALDADEVFTIVSHFDRLDVADAEAALRAAAELAGCPVGVRWSDAT
EPTVWLEREGPARATDELLLHRLRHLLNRLNRAVPAQGATSLRIDDPALI
ELLLSGEAKPEERARAARLLGLDATRELRVLATSSPGSATRLLAKALPGQ
SIRTATIGRVGAVLCQSARDTTSLSDHLNEVIVDEFPASAHSERGPWLGI
GASVAVLEASTSWNQAQRALRFASSTGFGRRAIAYERLSLLEVLADIPVE
RVREIDDVVRINQIASTAAGAAEVDTLEALCQYGTLRRTATELHLHHSTV
AARIQHVERSMGWDLDDPIDRFLATFALMLRRVSLSATELAGG
169630708YP_001704357.1 hypothetical protein MAB_3629c [Mycobacterium abscessus ATCC 19977]MAVIDTERTWEMVEKRLAATINERHRVVLGAVLRHMKLERDADLDGLIDT
LSANPNYHFWMDGQDFGPKGRDGVRTYYAGLVRERMSVMEFAMDRLLVDD
DCVVTEGFLKQIYPGAVAKSMGFAIEDLSADYLLVFRQLVLWPVDADGFI
EGEDSYHSGPVSITKLVPEELPQEYRDLKGASSAL
169630707YP_001704356.1 acyl-CoA synthetase [Mycobacterium abscessus ATCC 19977]MTAVSVPRAGVPRVDIAAMLLDRVGDSHLGLRTRDRDWTWDQVVDESAAR
GALARKLRADGPFHIGVLLDNVPDFVFWLGGAALAGATIVGINPTRGPAE
MAAEIRHTDCQLIVTDTAHLGRLQSLELGLSADRLLVIDSPEYLQRIAES
RCTAQASEGVGADSLLLLLFTSGTTGASKAVKCSQGRLAQIAHLATEKFG
HVRSDVDYCCMPLFHGNALMALWAPALANGATVCLTPTFSASRFLPDVRY
FGATFFTYVGKALGYLLATPERADDADNQLARGFGTEASPEDQAQFRRRF
GAELFEGYGSSEGGGAVVLDPAAPPGALGRPAHEGVVVVDPETLQDCAAA
VFDQHGRVLNADAAVGEIVDKQGRRGFEGYYNNDDADADRIRNGWYWTGD
LGYLDAAGFIYFAGRRGDWIRVDGENMSALTVERVLRRHPLVIAAGVYAV
PDPRSGDQVMASIEVAEPDSFDVDGFTQYLSAQEELGSKGIPRFLRISAN
LPVTGSNKVLKRELQEQRWHTDEPVFRWVGRGGPVFLRMSSDDKTALDAQ
FAVYGRQRLL
169630706YP_001704355.1 oxidoreductase [Mycobacterium abscessus ATCC 19977]MTDGAIREIDSGAPMTRFARGWHCLGLAETFLDGQPHGIEAFGTKLVVFA
DSHGDIKVLDGYCRHMGGDLSQGTVKDDTVACPFHDWRWGGDGRCTLVPY
AKRTPKLARTRSWPTLEVNGQLLVWHDPEGSAPPAELTPPTIEGYGEGKW
SPWQWNSILIEGSHCREIVDNNVDMAHFFYIHHAYPTYFKNVIEGQTASQ
FMESKPRPDYVPNPEKLWEGTGVRSEATYFGPAYMIDWIHNDLGPGFTVE
VALINCHYPVTHDSFVLQWGVAIQEMPDLPPDNARKLAAAMAKSFGDGFL
EDVEIWKNKTRIDNPLLTHEDGAVYQHRRWYEQFYVDLADVTSDMTERFE
LEVDTTHAHGVWVHEVEENLVEHAATASH
169630705YP_001704354.1 biotin--acetyl-CoA-carboxylase ligase [Mycobacterium abscessus ATCCMTSDRLTLTDSPGGHWRRIDVVEETGSTNADLVTRAAAGEDIDGVVLLAE
HQTAGRGRHGRSWGAPAHTQLSMSVGIGVGEVPPDRWGLVPLLAGVAIVD
AVAEVSGIQAGLKWPNDVLVDGRKLCGILAEVATPHQAIVLGLGLNATFA
QHELPDPNATSLTILGWADPDRDELARAVLRELGGRIEHWRAARGLDERL
LEDYRERSVTLGSRVRAELPGERELVGVAVGLGNDGQLRIEAADGTVTAV
TAGDITHLRPLGDQ
169630704YP_001704353.1 hypothetical protein MAB_3625c [Mycobacterium abscessus ATCC 19977]MGYPENVLADDEQVVLHRHPHWKRLIGPALVLILSTGIAAFVAAMVDNTD
WQSTAKNVVMIAIGVVWLVLVGWLSLWPFLNWLTTHFVITDRRVMFRHGL
LSRSGIDIPLARINSVEFRHGLVDRILRTGTLIIESASQDPLEFHEIPRV
EYVHSLLYHEVFDTLGSEEGDSRSTGRGRERPPAT
169630703YP_001704352.1 hypothetical protein MAB_3624c [Mycobacterium abscessus ATCC 19977]MVPLPAASVTETPLPIEDVGGDDGDDAGDDFRGEGLGLQDRQLEQIEDAR
VDDEGGGADDAELDQLMVSLGDRPDEPG
169630702YP_001704351.1 AraC family transcriptional regulator [Mycobacterium abscessus ATCCMNIRLVRFAALSGYVDVARASGLDPARMMREHGLDPAGLAQPDRRVAADA
VIALLEASADASGVDDFGLRLAERRRLSSLGPLSLALREQPTVRDVVAML
CRYESMYNESLRIRVVERDGIAAVRLALDAGGAAATQSTDLALAALAGVL
RTFLSNTWHPLRVNLRRPKPSAPAMHHRIFGPRIEFAQQLDEIVVYTSDL
DRRNDSFDPLLRQYSQAVLEPPERPGDTTTTDRVRDLIEVLLPLGRCSVE
QVAQGLGVDRRTVHRQLASEGTSFSALLDTIRLDLADHLVTSDRHSLTEI
SEMLAFSSPSNFSRWFRGHRAMSPRTWRNLRADAIAAHS
169630701YP_001704350.1 putative quinone oxidoreductase [Mycobacterium abscessus ATCC 19977MAYAVRIHETGGPEVLRGENVQVGAPGPGEVRIRHHAVGLNFADVYFRTG
VYPVALPAGMGVAGSGIIEAVGPGVSQFGPGDRVTYTGSPLGAYSTERVM
PAAHLIGLPDGISCDTAAAITMRGLTTAYLLRRIHPLRAGDTVLLHAAAG
GVGLLFLQWANLLGVNVIGTVSNEEKAEIARANGCAHVLIYPREDVPRRV
REITGGVGVPVVYDGIGKATYQSSLDSLSPRGLLVCFGTASGPIPSIDAM
QLAAKGSLFVTRPALADYIADPAERAELAGELFGHVGAGRIRVDIGRRYS
LEEAVTAHRDMESGAIIGQSIFAL
169630700YP_001704349.1 taurine dioxygenase [Mycobacterium abscessus ATCC 19977]MNGVAPLSKIRVQPLTCTIGAELFDVDLAEASRSDELFGEIRTLLLEHKV
LFLRDQNITRGEHVALARRFGPLEDHPVAGSDPDHPGLVRIYKEIDSAPE
HYENSYHCDATWRESPPMGAVLRCVETPPVGGDTIWVNMVEAYRRLPAAV
RDRIRDLRARHSIEASFGAAMSMRQRHELHERYPDAEHPVVRTHPETGEE
ILFVNSFTTHLVNYHRPENVRFGIDYAPGASELLQYLMRQATVPEFQVRW
RWTPNSVAIWDNRSTQHYAVQDYWPAVRKMERAGICGDIPFS
169630699YP_001704348.1 phosphoribosylaminoimidazole carboxylase ATPase subunit [MycobacterMSATPVVTMIGGGQLARMTHQASIALGQTLRVLAHAADEPAAQVTPDIVL
GSHTELDDLRRAAKDATVVTFDHEHVPTAFLETLQGEGVNVQPPPSALIY
AQDKTLMRRKLRDIGAPVPGFADIRAVSDVERFAAETGSHVVLKAVRGGY
DGRGVWITDTLDEARTVAAEQLAAGVELLAEERVDMRRELSAMVARSPFG
QGAAWPVVETVQREGICAVVIAPAPQLPEELALQAEQLALRIANELGVTG
CLAVELFETNDGRLLVNELAMRPHNSGHWSMDGARTGQFEQHLRAVLDYP
LGSTEPLAPVTVMANVLGAPQTPAMSLDERMHHLMGRIPEAKVHLYGKGE
RPGRKLGHVNIQGREDGSLADPGYVAEVRERAERAAHWLSHAVWTDGWEG
H
169630698YP_001704347.1 phosphoribosylaminoimidazole carboxylase PurE [Mycobacterium abscesMSARVGLIMGSDSDWSVMSDAANALAEFEIPFEVGVVSAHRTPGRMLQYA
QSAAGRGIEVIIAGAGGAAHLPGMVASATPLPVIGVPVPLARLDGLDSLL
SIVQMPAGVPVATVSIGGARNAGLLAARILGVADTALRDKVVAFQASMEA
TVLEKDEALRRRLLED
169630697YP_001704346.1 acyl-CoA dehydrogenase FadE [Mycobacterium abscessus ATCC 19977]MAGNPSFDLFKLGEEHDELRAAIRGLAEKEIAPHAKDVDEKARFPQEALD
ALVASGFNAVHVPEEYDGQGADSVAACIVIEEVARVCASSSLIPAVNKLG
TMGLILNGSDELKKQVLPAIASGEAMASYALSEREAGSDAASMRTRAKAD
GDDWIINGSKCWITNGGKSSWYTVMAVTDPEKKANGISAFMVHKDDEGFT
VGPLEHKLGIKGSPTAELYFENCRIPGDRIIGEPGTGFKTALQTLDHTRP
TIGAQALGIAQGALDQAIAYTKDRKQFGKSISDFQGVQFMLADMAMKVEA
ARLMVYTAAARAERGEKNLGFISSASKCFASDVAMEVTTDAVQLFGGAGY
TTDFPVERMMRDAKITQIYEGTNQIQRVVMSRALLTS
169630696YP_001704345.1 hypothetical protein MAB_3617 [Mycobacterium abscessus ATCC 19977]MHPSIRALFHGRGAIRAGELQEILSAKRISSLIRDGHLHRPWHGVYTLPN
PTVEIQLRALDLVADAHVPVCMGTAAASYGFDTERDGALHVINPVPGQLR
PRPNLVVHQRLGAPLRYVDGRLTTAPDWTAIEIARTLRPSRAIGTLDAAL
RSGHCSPGGLRHAARMQAGRRGIVHVRGLLTHADGRSESPMESETRLLFI
DSGVPAPELQATICDRYGTVWRVDFLWRSARLIGEYDSDEWHSGPAAMRK
DKLKTARLQECGWTVIPITVDDIRRHRDELVARINTHLRHHAA
169630695YP_001704344.1 hypothetical protein MAB_3615 [Mycobacterium abscessus ATCC 19977]MTTLTALLLGDVNNPSPRITYYDDATGERIELSTVTLANWAAKTANMLRD
EFGAGPGSTVAVRLPAHWQTAGVLLGIWWAGAELVFGDASTDVAFCTLGD
EPDANEVCVLSLDAFGRPVPDLPLGLTDYATAVRVHGDRFTPAGAGPAVD
GRPVDEVAAAARESAVAQGITGGDRVLSSGAWDSLEALISTLLAVLITGA
SLVQVANPDTAAQERRVASEKVTKTLP
169630694YP_001704343.1 hypothetical protein MAB_3614 [Mycobacterium abscessus ATCC 19977]MPGEGPAGEEWTDIVTDPHARRASGSSQAEPPRPLWRGIATLAAVAVMVI
TGAAWGKIGNIDPNIARFDLPGLFGNAGKPDDGAIDILMVGVDSRSDAHG
NPLSQEELSMLRAGDETATNTDTIILIRIPNNGKSATAISIPRDSYVTIP
DGSKGKINGVYGEAKENDRQKRVESGETLEAAERESVDAGRSALIQTVGR
LTGVTVDRYAEVSMLGFVLMTDALGGVNVCLNEAVYEPMSGADFPAGPQT
LDGPNALSFVRQRHDLPRGDLDRVVRQQVVMSSLAHSALSGGTLTNTTTL
GKLRDAITRTVVLSQGWDVMDFIQQLQKLSGGNVAFATIPILREDGWTED
GTQSVVKVDPDQVRSWVSGLLDQQAQGKTEEATYSKDQTTADVVNETQIN
GLAAAVSELLVGKGFTAGKVGNNESDHVGSSQVQAAQQDDVGAKAVAEAL
GLPVVEKQGIAEHTVRVVLSKDYQGPGSGRETTPAASETGSTEEDAPPPP
PSPIFTAANGPRCVN
169630693YP_001704342.1 dTDP-rhamnose modification protein RmlD [Mycobacterium abscessus ATMLVITGAGGQLGTHLIARAKLRDLPVRALTSSDWDITRDGTPDGVVAEGD
IVINCAAYTAVDAAEEDESRAYAVNAEGAERVARACRDVGARLIHISTDY
VFDGEFGDAGPRPYRPGDATAPQGVYARTKVAGELAVHGVLPSAQVVRTA
WVYTGVNGDFVGVMRRLAAGEGPVRVVTDQTGSPTYAVDLAEALLDLAAS
DVREPFLHAAGSGHVNRFEWAKAVFELVGADASRLQPCLSVDFPRPAPRP
AYTALDGDHWADAGLPRLRPWRDALAEALATN
169630692YP_001704341.1 putative dTDP-rhamnosyltransferase [Mycobacterium abscessus ATCC 19MLDPHRVSDSPAIGQVAVVTVTYSPGEHLHRFLRTLRHATDLPLRVILAD
NGSTDGAPEAAAEEPDVELLRTGGNVGYGKAANLGVAQVDPAAEWVVIAN
PDVQWGPGSIDAMLEVAQRWPAAGAVGPLIREPDGTVYPSARVVPTLTGG
ALHALLGSVWSTNPWTAAYRQDRMEPSERVVGWLSGSCLLLRRTAFDAIG
GFDPRYFMYMEDVDLGDRLARAGWQNVYAPSSEVVHAKGHAAGRDPARSL
GAHHDSVYIFQSDRHPHWWQAPLRWSIRGALAARSAIVVRAAIRANRRRD
KQGG
169630691YP_001704340.1 putative sugar-phosphate nucleotidyl transferase [Mycobacterium absMSGTVKADAVILVGGQGTRLRPLTLSAPKPMLPIAGFPFLTHVLSRVAAA
GIDHVVLGTSYKADVFESEFGDGSKLGLQITYVYEEEPLGTGGAIRNVLE
HLRYDTALIFNGDVLSGLDLKDLLAQHEQTQADLTLHLVRVGDPRAFGCV
PTDSDGKVTAFLEKTEDPPTDQINAGCYVFRRELIEQIPSGRPVSVEREV
FPGLLSSGAKVCGYVDTSYWRDMGTPEDFVRGSADLVRGIAPSPAIPEHP
GEALVHDGASVAPGALVIGGTVVGRGAEIGPGARLDGAVVFDGARIEAGA
VVERSIIGFGARIGPRALVRDGVIGDGADIGARCELLRGARVWPGITIPD
GGIRYSSDV
169630690YP_001704339.1 hypothetical protein MAB_3610c [Mycobacterium abscessus ATCC 19977]MLLALIGCSDRGDQKQQEQDLQRARDNFKKVELTIPDSYSLVAMTYFPDP
FVGQGWRSGAFESQTSPPAPILVRGNPIRTEPTPCERIPQRTDPDWLRAG
FTCDMANARYGVADSMYGISVFTGDLPSGKSQIFLRVEGH
169630689YP_001704338.1 hypothetical protein MAB_3609 [Mycobacterium abscessus ATCC 19977]MTARHPGEGHQMPSDLRESAIELLSSWQAPDAEQDSLRHSVLAFLDANPD
ACRRRSAAGHVTASALVVNHDGSQALLTLHPRVGKWLQLGGHCEEEDPTI
HAAALREATEESGIDDLLLEPNLLGIHVHPITCSLGVPTRHLDLQFLAHA
PEGAQIAVSDESLDLRWWPLDQIPEEDHSVVVLAQRARNRLR
169630688YP_001704337.1 F420-0--gamma-glutamyl ligase [Mycobacterium abscessus ATCC 19977]MTPPADSPAPEHGSAAPVQILPVTGLPEFRPGDDVAAAIAGAAPWLRDGD
VIVITSKIISKAEGRIVAAPTDPEARDTLRRKLIDSESIRVLARKGKTLI
TENTIGIVQAAAGIDASNVDTAELVLLPTDPDASAAAVRLALSQRLGVKV
AVVITDTMGRAWRNGQTDAAIGSAGIPVLYGYAGAKDKHGNELQVTEVAI
ADEISAAADLVKGKLTDVPVAVVRGLTLLDDGSAASDLLRSGPDDLFWLG
TNEALEQGRREAILVRRSIRQFADIPVDPDLLREAIGEALTAPAPHHTHP
VRFVWVRDLTTRRALLDALKQAWAADLTADGRSPESVQKRVARGQILYDA
PEIVIPFLVPDGAHDYPDDRRTAAERTMFTVAVGAAVQALLVALAARQVG
SCWIGSTIFAGDVVRKQLVVDSSWEPMGAIAIGYPHGYPEEGLDPRTPLP
PGQMLVEL
169630687YP_001704336.1 LPPG:FO 2-phospho-L-lactate transferase [Mycobacterium abscessus ATMFAAGVKRRTKIHTIYDRQNRRGALVACRVIAGALVSVNVKVTVLVGGVG
GARFLLGVQRLLGSDPSKHQINAVVNIGDDAWMHGVRICPDLDTCMYTLG
GAVDPERGWGHRGETWNAMEELAAYGAQPDWFSLGDRDLATHLIRSQMLR
AGYPLSAVTEALCNRWQPGVRLLPASDDRCETHVVITDPTDGEQRAIHFQ
QWWVQHRAQVPTHSFAFIGADEAKSGPGVAEAIGEADVVLLAPSNPVVSI
GAILAVGGVRGALRTTSAPVIGYSPIVSGKPLRGMADECLRVIGVEVSSQ
GVGEHFGARSQTGILDGWLVDEGDAAHIAGVQVRSVPLLMTDPDATAAMV
RAGLDLAGVTL
169630686YP_001704335.1 WhiB family transcriptional regulator [Mycobacterium abscessus ATCCMLFGRNEFGVHDELSSGVGTGAAGLSPARPHLTLVQNDFDALAAVADDQW
QEKALCAQTDPEAFFPEKGGSTREAKRICQGCEVKDECLEYALANDERFG
IWGGLSERERRRLKRGII
169630685YP_001704334.1 hypothetical protein MAB_3605 [Mycobacterium abscessus ATCC 19977]MSRDGRRGGSAGGPGSQGSRRGRDFRGPLLPPTVPGWRSRAERFDMAVLE
AYEPIERAWQSRLEGLDVAVDEIPRIQPKDPDSVQWPPEVIADGPIPLAR
LIPAGVDTRGNTTRARIVLFRKPIELRAKKSGDLSDLLHDLLVAQVATHL
GVEPSVIDPTITDEGD
169630684YP_001704333.1 hypothetical protein MAB_3604c [Mycobacterium abscessus ATCC 19977]MATLTFVYADSTAVVGPLATSSEPHSWDLCAQHASRITAPRGWELVRYNG
PLPSNPEDDDLVALADAVRETTGGVRVAAAGFSEPALDVSAPAPNVAPRP
VHPAPVGRRRGHLRVLPDPSE
169630683YP_001704332.1 phosphomannomutase/phosphoglucomutase [Mycobacterium abscessus ATCCMARSADAVHAVIKAYDVRGLLGEQIDESFVFDVGSSFARLIKAERDDSAD
SSRAPRVVVGRDMRDSSPSLAQAFTDGVTAQGVDVVQIGLASTDQLYFAS
GLLDCPGAMFTASHNPAAYNGIKLCRAGAKPVGKDTGLSVISGELIDGVP
GYDGPVGTVTERDVLAEYGDFLRSLVQLSGARPLRVAVDAGNGMAGHTTP
AVLGAIPSITLAPLYFELDGNFPNHEANPLDAENLRDLQAFVAAESADIG
LAFDGDADRCFVVDERGRAVSPSAVTALVARRELEREIGGTIIHNLITSR
AVPELVVEHGGTPVRSRVGHSFIKALMAETGAIFGGEHSAHYYFRDFWGA
DSGMLAALHVLAALSEQERPLSDLMSDYERYAASGEINFRVSNAGACIDE
VLKSFGTQIVSIDHLDGVTVDIGAGTWFNLRTSNTEPLLRLNVEARTDED
VAAVVARISDLVDRTEAAT
169630682YP_001704331.1 hypothetical protein MAB_3602c [Mycobacterium abscessus ATCC 19977]MNATIDLDDAEALLAADLDGSLQAASMAGSQVRAVGTAIAEGALEPLRSE
DRSRAVVWVSGRGTAATAGAILAGALSDTVSLPFVTATRAPVWVGPLDVM
VIAGDDAGDPALSAAVTLGTRRGARVVIAAPDEGPLADSGAGRAISLAPR
LRVPDTFSLAHHLAVGAAVLGVLDKSVAPDVMTIADEVDGEVSRNTVGRE
VFTNAAKAIAARLTSGPTVLCGDRSATLTLAGHAAATLLRLTQRTATACG
LAQALAAMRDALASKSSGESSLFHDEFIDGPRAEAPPRILALATDSDYQS
VAARIEGLDDAELVSTTDLGPVAARPSELAQLMMLSTRLEMASVYARLGG
GRSGL
169630681YP_001704330.1 mannose-6-phosphate isomerase ManA [Mycobacterium abscessus ATCC 19MNLLRGAIRTYAWGSRTAIAEFTGRPTPTPHPEAELWLGAHPADPAYLET
GGGAESLLEVVAADPTGQLGAASVAEFGDQLPFLLKVLAADEPLSLQAHP
SAQQAADGFAREEAAGVPLNSPVRNYRDRNHKPELVVALDRFEALAGFRD
PGDTVDLFRALDVEALTPYVNLLAGQSDADGLRALFTTWITLPQPSLDVL
VPAVLDGAVRYLSSDDVRFVGEARTLLELGERYPADAGVLASLLLNRLTL
EPGEGIYLPAGNLHAYLRGLAVEIMANSDNVLRGGLTPKHVDVPELLRVL
DFSPASEAHLHVETVTDGAQTRYRTPAREFALSRFDLAAGEPTQVGIKGP
RILLCTQGDVTLDGSGAGLKVRAGQSVWVPADGGSVTLTGRSDARVFMAT
VDADA
169630680YP_001704329.1 putative cation transporter [Mycobacterium abscessus ATCC 19977]MSAGGSKRAIIAALAANAGIAVAKFIGFAITGSSSMLAESVHSIADTSNQ
GLLLYGQRAASKEADRLHPFGYGRSRFFYSFVVALVLFTLGSVFALYEGY
HKIHAPEHLQSPIVAIAILGVAIALEGYSFRTAFVESKPLKGGASWWQFI
RNSRNPELPVVLLEDTGALLGLAFALFGVGMTIVTGDPVWDGIGTVAIGV
LLGIIAIVLMVEMKSLLIGEGATAIQEQAILDALAGTDDVERVIHCRTQY
LGPEELLVAAKIAITPSAELPRVAATIDAAERRVRAAVPIAQVIYLEPDL
DRSAANS
169630679YP_001704328.1 putative amino acid permease [Mycobacterium abscessus ATCC 19977]MPGSGLWRTKSVEQSIADTDEPETKLRRDLTWWDLTVFGVSVVIGAGIFT
VTASTAANVTGPAISLSFIMAAIGCGLAAMCYAEFASTIPVAGSAYTFSY
ATFGEFAAWILGWDLILEFSVGAATVAKGWSSYLSTVFGLSSGAVHLGAV
KIDWGALLIVSVLTVLLAVGTKLSSRVSLVITTIKVLVVLLVIIVGAFFI
KTANYTPFIPPAEAGSSSRQGLDQSLFSFVAGGSGSQYGWFGVLAGASIV
FFAFIGFDVVATTAEETRNPQKDVPRGIIASLVIVTVLYVAVTVVLSGMV
KYSDLRVADSHPNLSTAFHLNGVDWAAKVIAVGALAGLTTVVMVLMLGQI
RVIFAMCRDGLLPRELARTGSHGTPIRITLIVGFLVAVAASLTPIEGLEE
IVNVGTLFAFVLVSAGVIVLRRSRPDLPRSFRTPGVPWLPIVAIVACGWL
MLNLAVRTWLFALSWMVIGVIVYFAYSRKHSVLGLRVDVEQ
169630678YP_001704327.1 putative alkane-1-monooxygenase AlkB [Mycobacterium abscessus ATCC MTSNLETGPAQPAAQWRDRKRYMWLYGMIPPTAIFIATALVYAMNQLGWQ
QFSPVLFWIGPLLVYVILPLLDLNFGADGENAPDEVMEALENDKYYRYCT
YIFIPFQYASFFLGAYYFTATDLSWIGFDHGISWISKLGIAASIGVLGGV
GINTAHEMGHKKEELERWLSKITLAQTFYGHFYIEHNRGHHVRVATPEDP
ASSRFGETFWGFWPRSVWGALRSSWNLEATRMKRLNRFVLHPSNDVVNAW
LMSVVLFGVTIAIFGTAVIPYLIIQAIYGFTFLETVNYLEHYGLLRQKNG
ERYERCTPKHSWNSDHLVTNIFLYHLQRHSDHHANPTRRYQTLRSMDGAP
NLPSGYATMLTLAYFPPLWRKVMDHRVLDHYDGDITRVNIQPSKRAKILA
RYGVTEGAA
169630677YP_001704326.1 rubredoxin RubB [Mycobacterium abscessus ATCC 19977]MSDETCVDSEYKLYECMQCGFQYDEALGWPEDGIEPGTRWDDIPEDWSCP
DCGAAKADFVMVEIARP
169630676YP_001704325.1 TetR family transcriptional regulator [Mycobacterium abscessus ATCCMTDVLPGRDALTSASVPARLPGVTRPDALRAGGSSHRVPYAEAARALLRE
SVLDALGDLLRQRDWSAVTMSDVSRRAGVSRQTLYNEFGSRQGLAQGYAL
RLAHRLVDAVGDAIYAHVGDIHGALHSGFADFFAESAADPMVISLLTGEA
KPELMRIVTVDSALIVVPASARLTESFMNSWVAASQEDASILARSIVRLA
ISYVSMPPESDHDVALDMARLLSPFVETNALADKA
169630675YP_001704324.1 S-adenosyl-L-homocysteine hydrolase [Mycobacterium abscessus ATCC 1MTELVADVRNGIEYKVADLSEAEFGRKEIRLAEHEMPGLMALRREYAEVL
PLKGARISGSLHMTIQTAVLIETLVALGAEVRWASCNIFSTQDHAAAAVV
VGPNGTPEEPQGTPVFAWKGETLEEYWWAAEQMLTWPNEPANMILDDGGD
ATMLVLRGAQFEQAGVVPPADDNDSAEYKVFLNLLRERFETDKDKWTKIA
ESVQGVTEETTTGVLRLYQFAAAGELAFPAINVNDSVTKSKFDNKYGTRH
SLVDGINRGTDVLIGGKKVLICGYGDVGKGCAESLAGQGARVQVTEIDPI
NALQALMDGFDVVTVEQAIGDADIVVTATGNFDIILLEHMKAMKDQAILG
NIGHFDNEIDMAALEKSGAVRLNIKPQVDLWTFGDSGKSIIVLSEGRLLN
LGNATGHPSFVMSNSFSNQVIAQIELWTKNDEYDNEVYRLAKHLDEKVAR
IHVEALGGTLTKLTKDQAEYIGVDVEGPYKPEHYRY
169630674YP_001704323.1 thymidylate kinase [Mycobacterium abscessus ATCC 19977]MGQLIAIEGVDGAGKRTLTEKLIARGNSQGLSVATLDFPRYGRSVHADLA
AESLKGGHGDVVSSAYAMGLLFALDRRDARDELAGLTRSHDLVILDRWVA
SNAAYGAARLHQDGGGDMARWVHQLEYERFGLPHPDWQVFLDVSPELAQQ
RARQREQQESDRARDTYERDSDLQQRVSAAYADLAQRDWGGPWMITDGVE
PEALAAQLLRRA
169630673YP_001704322.1 Mg2+ transport P-type ATPase C MgtC [Mycobacterium abscessus ATCC 1MSHWDVVIRIALGFGLGCAIGIERQWRAKNAGLRTNALVCLGATLFVIMG
GYSFHGPGADPTRVAAQIVSGIGFLGAGVIMKQGATITGLNTAATMWATA
AVGALAGGGMYEVAVLGAAAIVLANLLLRPLGHLLDRQPAIGREAAPAAY
LFEVTTTDETEAHIRALTVQAVSRPEFALQSVRSYDVEDGKHVRVVAKLS
AEERNDSLLESAVSRLSMEPAVSSVRWHIDREEEVEASEW
169630672YP_001704321.1 putative medium-chain acyl-CoA ligase [Mycobacterium abscessus ATCCMFFDLSVRDFLDRAELVYPERVGVVDEPVQPAPSWGQLTYRQLAARARGQ
AAALDALGVGPGERVAIVSQNSARLLTSFFGVSGWGRILVPINFRLAPAE
IEYIVGHSGASVLVVDPEVRGLLDTVRATHNFVLGEDDAAVFGELDSPHA
VTPDPWSGSETGTATLNYTSGTTSRPKGVQLTHRNIWINAVVFGLHATLR
DDDVLLHTLPMFHCNGWGWPYAATGMGARHIVLRKVDGDEILRRVEQHGV
TVMCAAPTVVDSILDAAARWRGPIPGRDRVRIIVAGAPPPTRTIARVRTE
LGWEFIQIYGLTETAPLITMNRFRSEWAGLDVQEQARMLGRAGAPAIGVR
VSVAEDGEVLTQSNTNLDGYWDQPQATAEALAGNWFHTGDRGSVDDGYLT
ISDRKKDIIITGGENVTSIEVEDALISHPGVREAAVVGVPDEKWGELVTA
VVVVVTLDDPPSGADLIAHCRERLAGYKCPKRVEFVDSLPRTATGKVQKF
RLREQLARD
169630671YP_001704320.1 DNA-binding response regulator MtrA [Mycobacterium abscessus ATCC 1MRQRILVVDDDASLAEMLTIVLRGEGFETAVVSDGTQALTAVRELRPDLV
LLDLMLPGMNGIDVCRVLRSDSGVPIVMLTAKTDTVDVVLGLESGADDYI
MKPFKPKELVARIRARLRRNDDEPAELLNIAGIDIDVPAHKVTREGEQIS
LTPLEFDLLVALARKPRQVFTRDVLLEQVWGYRHPADTRLVNVHVQRLRA
KVEKDPENPTVVLTVRGVGYKAGPP
169630670YP_001704319.1 sensor histidine kinase MtrB [Mycobacterium abscessus ATCC 19977]MIFSSKRRIQRRSAPLVRGLKALSRAVGFTWRRSLQVRVVVSNLALSSLV
ILILGFVLTSQVTDRILESKIRVATEEMERARVIVSDDVGGEETRSLQSS
LELARNQLLNGSKGSEGGGAGAFDAVLLVPGDGPREATSAGPATQIPGPL
REFVKAGQVSYQYSTVHTESFSGKALVIGSPTTSKVTALELYLVFPLSNE
ESTISLVRGTIVTGGVVLLVLLAAAALLVARQVVLPVRSASRIAERFAEG
HLSERMPVRGVDDMARLAVSFNDMAESLSREITQLEEFGNLQRRFTSDVS
HELRTPLTTVRMAADLIYDNREELDPALQRSAELMVNELDRFETLLADLL
EISRHDAGVAELAVEQVDLRDTVKAVVASVQHLADELDTSVELDMPDKEI
IAEVDPRRVERILRNLVANAIDHSEHKPVTIRMAADIDSVAVTVRDRGVG
LRPGEEKLVFNRFWRADPSRKRHSGGTGLGLAISVEDARLHQGRLEAWGE
PGNGALFRLTVPLVRGHKVTTSPLPLNPTSRPSSAVRRAASRGAHPGEQE
TTPMRASGAKIERPRESAGGRAEDAS
169630669YP_001704318.1 lipoprotein LpqB [Mycobacterium abscessus ATCC 19977]MTCRKVAAVLAAVALIVPSCAGVPSSSSPQAIGTVQRPAPPGMPAPTPGM
EPETVLREFLKATADPSNRHRAARQFLTESGSRTWDDAGAAVLIESPVFA
DQRGVDRWTINVRANKLGTLSDIGVFETAQGDVQDPQFTLVKANGEWRID
SLPNGVLLDWGQFQSTYRRYTVYFADPAGRTVVPDPRYVAVNDPDLLATE
LVYKLLSGPRPELAGAVRNHLNGLRLRGPVTRVDGSRVDVGRGYGGVRVE
LEGDLTPDQRTRQFLAAQVIWTLSRAGIAGPYVLQVNGAPLDEQFAQGWS
TQNVASTDPGASEGAGVGLYGLLNGSMVTVDRDAAVPVRGSFGQVGNQVS
AALSRSGRQVASVVRVQAGDDPQMSLWVGANGANGSEAVGGKTLTRPSWA
LDDAVWTVIDGGRVVRIIQEATTSMVAVLPVEPSAVAEKYKGPITELALS
RDGTRAAMIIEGQVILATVVQTESGDYALTHPRRLGYGLGNSAVSLAWRT
GDDIAVARNDGSHPVANVNLDGVNSDLNDQNLLTPVSTVAASPAAIYIAD
ARGVLQLTGLGTPEERWVEVRPLMVPQAIPVLTG
169630668YP_001704317.1 putative acyl-CoA oxidase [Mycobacterium abscessus ATCC 19977]METRTAPADPEVLTSNLRVALDGRFGPIRDAAREYLNRADLLPDPSLTLE
QARARSLRIMRELVPHGLPHAGFRTEHGGTGDVGAAIVGIEMLGYADLSL
MVKAGVQWGLFGGAIENLGTATHHEQYVVPLINLDVLGCFGMTETGHGSN
VQALQTVATYDRTTGDFVLNSEGSLARKDYIGGAAEHATVSAVFAQLVTG
GPGEEATGRGVHCFVVPIRDADGNDLPGITTSDCGYKGGLAGVDNGRIVF
DNVRVPRANLLNRYADVAEDGTYSSPIENENKRFFTMLGTLIRGRVSVAA
TSGAAARKALTIASRYALVRKQFDTPDSDDEVIIADYLVHQRKLLPLIAR
SYALAFAQNELTEELHQVQTADEVDADRQRQLESAAAGLKAMTSWHAQHA
ITVCREACGGAGYLDANQLTILRRDIDVFTTFEGDNTVLTQLVAKELLSA
YAEDVRGLNAVGWTRFIAGMARDVILERSAARQVIQTILDSSDEDVEESD
LSNRGTQLRLLRNREDHLLRTAATRMQRAQSDDEDPFEVFNSAQDHILKV
GSAHTERVVLEAFIEAIDSCDSKSAQELLEKLCDLFVYSALEADLSWFLM
HRHVSTERAKAIRRGVNQLCEELRPHLGTLVDAFGIPEALLATEMIPDN
169630667YP_001704316.1 hypothetical protein MAB_3587c [Mycobacterium abscessus ATCC 19977]MGIASSTVDPALRTRAFARVIGPFVATVTTIIAVRAGDLGFLGDSFFRDP
MWSWLFGALLFFCGLMIIAFHQFWRGAAAVIISLFGWFLALRGLVLLAFP
GLMRAGVDASVPAVGPVRGFFLFMAVVGVYLTYVGWIRKR
169630666YP_001704315.1 TetR family transcriptional regulator [Mycobacterium abscessus ATCCMPRVVKHPELRRTELLDLAMTLFLERGYERVSLNDLIATSGMSKGAFYHY
FSSKEALVSALAARSADQAFEALRPVFEAQGRGALERLNSGLRAGYEVKM
ALGAPESIGAMASMMRPENQSLLRRISAIWEDRFRPVLTEVIAQGVAEGV
FDTFDPEGVGDMIQGLAATMGTAVQRIIAAPDAPARAQAIDAAVLRQRLY
GIATDRILGLPDGTVEVLDRDQIEALVAML
169630665YP_001704314.1 hypothetical protein MAB_3585c [Mycobacterium abscessus ATCC 19977]MLDLVLPLMCGGCGSPSVRWCDDCACAFSTQPAVVSTRVDPGVPVLSLGR
YAGVRRQAIVTMKERGRRDLAAPLGVVLARGVDQLLRWNLIERPVTLVPA
PTRWTAARGRGGDPVTAVAAVAARMPGVHIASLLRMKMGARDSVGLSAAA
RQHNVAGRIALRRTARPATELMLVDDVVTTGATVAESVRVLKSAGFRVAA
ALTLTHS
169630664YP_001704313.1 hypothetical protein MAB_3584 [Mycobacterium abscessus ATCC 19977]MFEFYIKEVKGLVVTFQTGQFVVHKDSEVIGDFYVSALDHDIGLGRPLPV
LKCNGCL
169630663YP_001704312.1 hypothetical protein MAB_3583c [Mycobacterium abscessus ATCC 19977]MEITARGRGPVVRGEACADTFHSALEAAVAKLESRLRRGRDRRKVHYGDK
TPVSLAEATAVLPADAFTPPVAVNGAHSHNGAEVDDGHGPGQIVRTKEHP
AKPMTVDDALYEMELVGHDFFLFHDQSSGRPSVVYRRHAYDYGLIRLGE
169630662YP_001704311.1 GntR family transcriptional regulator [Mycobacterium abscessus ATCCMRIRRHAAVADGIAEQIRTGALPAGTRLPTHRALAARHGIAVATASRVYR
DLTASGLVVGEPGRGTFVRDLSGFAGLEPARLSAGQRTADLSFNQPLSTG
QDDELRQALRGLAAEGDLTSLLYQQPPGGRSRDRAAIASYLLGRGIDVAP
HSVLITGGAQQGLDALLVALAEPRAVVAVDALTYPGIRMLATARHLDLAA
VRADTTGMDIDHLEWLCGQRPISMLYLIPTLHNPLGYILGASARQRIAAL
AARHDFHIIEDATYAFLEPAAPPPVQTVAPERTFYIGSMSKNLASGLRIG
YVVAPLARRPALIRSLRATSWGASSIASALTTRWLTDGTAAKLEKQRRED
ARQRQVIARAELAGLDYHAHPASYSGWLTLPEHARSDVIAHELAEHGIMV
TTADAFATTAHAPNALRLALATPELSELTAALRHIRTATT
169630661YP_001704310.1 hypothetical protein MAB_3581c [Mycobacterium abscessus ATCC 19977]MTIEFPCHMRYPTAISQLLDFEIVAAETGTASVRVETDPAKHGNQQGTVH
GGFLVELADAAIGTAHSTLMRPGETFTSIDIRAAFLRPVWADTLVATARP
AHVGRTITHYTCEVARGDGKAVASVTSTVMTLRGDRAAGR
169630660YP_001704309.1 preprotein translocase subunit SecA [Mycobacterium abscessus ATCC 1MLSKLLRLGEGRMVKRLKGVADYVNTLSDDIEKLSDAELQAKTGEFKGRL
EKGETLDDLMPEAFAVAREASWRVLSQRHFDVQVMGGAALHAGNIAEMKT
GEGKTLTCVLPAYLNALAGKGTHVVTVNDYLAKRDSEWMGRVHRFLGLDV
GVILSQMTPLERRDAYNADITYGTNNEFGFDYLRDNMTHSLDELVQRGHA
FAIVDEVDSILIDEARTPLIISGPADGASNWYTEFARIVPLMEKDTHYEV
DIRKRTIGVHELGVEFVEDQLGIDNLYEAANSPLVSYLNNAIKAKELFTR
DKDYIVREGEVLIVDEFTGRVLMGRRYNEGMHQAIEAKERVEIKAENQTL
ATITLQNYFRLYDKLAGMTGTAQTEAAELNEIYKLGVVSIPTNRPMVRKD
QSDLIYKTEEAKYIAVVDDVVERYEKGQPVLIGTTSVERSEYLSRQFTKR
RVPHNVLNAKYHEQEAAIIAEAGRRGAITVATNMAGRGTDIVLGGNPDFL
ADKHLREQGLDPVETPDEYQAAWDETLQKFKDAAETEAKEVQEAGGLYVL
GTERHESRRIDNQLRGRSGRQGDPGESRFYLSLQDELMRRFNGAALETIL
TRMNVPDDVPIEAKMVTNAIKSAQTQVEQQNFEVRKNVLKYDEVMNQQRK
VIYAERRRILDGEDLQPQIQEMITDTIAAYVDGATADGYHEDWDFDALWT
ALKTLYPVSLKPEELIASGEYGEADELSPEDLKAALLEDAKKAYKAREAE
IDGLAGEGSMRQLERNILLSVIDRKWREHLYEMDYLKEGIGLRAMAQRDP
LVEYQREGYDMFTAMLDGLKEESVGFLFNINVEVQQPDGAAVAPQEAPEG
LAEFASAAAQAAHGELRAKGLEESTPELTYSGPAEDGSAQSRHENGAASA
SGGGTRRERREAARNAGRTSKPAKSRRKR
169630659YP_001704308.1 putative acyl-CoA synthase/polyketide synthase [Mycobacterium absceMQTTYDFTDYFSTVTEWVARQPDQIALGYLEEGAGELTERAWTYAELVSH
ATAVAARLREDLEPGDRTLLLYPPGLPFVAAFLGCLAAGVVAVPAPLPDG
RDKAQHRLAGIIADAGTRVVLTESSVAPLIAGWADALPTPIALIATDAIP
VELGREFVPVRSAPSDTAFLQYTSGSTNAPKGVIVTHGNLVHNEQELGAR
IENDPSFSMLSWLPQFHDMGLIGMLLWPLFYGGTSRFLSPVTFIKHPIQW
IRAMSKYRATVGVAPNFAFDLVARRCTHEALEGVDLSCVRSLLNGSEPVQ
WASIERFTTLLAPFGLAEHAVTPVYGLAEATLFVTGDPHGTPVTTAVVDG
EALAENRLVVANEGAPRSRVLVASGRIGGIEVSVVGADGAPLPDGEIGEI
WLRGTSVAAGYWNLPELSAEIFGATPIGGTGGWLRTGDLGTLVDGNLFIT
GRTKDVIIVNGRNLYAHDIEAAARAAAPALARGVGAAFAVGTPERLVLVH
EIRPENLGDASLDDVLAAVRTAIFAEFATPLSDLVLVAKGEVARTTSGKI
RRTHMRASYEGGRITAFADPRLASAGGDVVR
169630658YP_001704307.1 acyl-CoA dehydrogenase [Mycobacterium abscessus ATCC 19977]MTTSITLVAPRRFDIVDTVEAALGDARDPDNPAGFAVLAAQDRDDTFPAD
AIAILDRLRVAEHYVPVADGGRLADYLEVSQLIRVLARRSVTLAVAHAKT
FLGAATAWIGARGEQRARLSELVRSGVPVSWGLTEREHGSDLLAGDVAVE
NGALSGAKWLINNATRGGAVVAIARTSVAGGPRGFDLVLVDKAALSARGA
APTYRHLPKELTHGIRGADISGIEFDGVPVDDTDVLSEPGRGLENVMKAL
QLTRTLCCSLSVGAAERGLHTAVSFAESRELYGRKLIELPQARRVLTDAL
ADHLLNEVTTCAAIRSIHTLPAELSLHAAAAKYWVPTRTEALLAALRSFV
GARAVLDSDDPTAPALSRIERDHRIVSLFDGNTVVNLTTLITQFPVIGRG
DLPADSAALVAAAPDADLSRLSLMSRSGSTLLRTLGDAVIQLDGHDLPDG
CRRTASALAAVARDIVRAAADAPRNPAETPNASFALAERLAAAIAGAAAV
HVYLAYAGTIDSPLWRDGLWLRLALPRALAGADPAAPPSGPDGDHDAAIA
ALESLNRSDAGFSVLANVLDDETGDRV
169630657YP_001704306.1 putative acyl-CoA dehydrogenase [Mycobacterium abscessus ATCC 19977MTTAISTTATDLDVALGDPFCPANPHGATAILAADERAERALATYQLLAD
LGLQRMFVPIELGGDLVDIPSLVRVLAPVFGRDMGLGLGFGVTTLMAALN
VWHSGDDRQRRRVADQVLTGAPLSVAYHELDHGNDMAANEVRAVATAGGY
RLSGRKEVINNASRASAAVVFARTSDRPGRSHSLFLADLDNVRRLDRFRT
TALRTAQLGGLDFHDHQVGVEDRIGAEGHGIEIALKSFQISRVVMAGAGL
GPVDVALHLAASFARQRVVYGRRVDQIPHARTNLAIAQSLLLAVEAAVTT
AAVGLHTSPQHAGAQAASVKYAAPLLLEYAMEHLAVVLGARFYLRTGPFA
LFGKHYRDLAPVGIGHAGSTSCLLALLPQVRHLLQPGTAAALPAPGAQLP
RLDFSELVLRSGAPDPIVSWTPAATPLTAPGAGDLIEEQARTLERLRGAA
ERIPASALGVTAPPAAFDLAEQFTKRFVVAAALAVRESDRTEFADAWVRI
AIAAVAAHRRGRAVVDPADVDVVVQRIDRHVAGSRSLLLDGHELPRSIPA
L
169630656YP_001704305.1 phosphopantetheine attachment site domain-containing protein [MycobMTAPALDDWLAGKIAGYLSITADQVDRDRSLADYGLDSVYALTLCGEIED
EFGLTVEPTLAWDYPTVDAMSGHLDSLLRAKA
169630655YP_001704304.1 polyketide synthase [Mycobacterium abscessus ATCC 19977]MEIDVTGIACRFPGADGVEAFWDMLLRGRNGTRVVPEDRWWADDFVSPAP
PYGTGKVNTRHGAFIDDPERFDHGFFGIAPSEAAATDIQQRLVLQAGYHA
LEDAGIDPQSLRGSTTGVFVGVMSSDWGALHLTDYAGMTPQRGVGNGYCM
LANRVSYALDLTGPSMSVDTACSSSLTAVHLAAGALRAGECDLAIVAGVN
LMLTPILSIFYTQAGLSAPDGRCRPFAKSGGGIGRGEGVGAVVLRRSEDR
PDDAPAPYATVRGSFVGQDGRSNGITAPTRRGQERVIAAALRSAGHTGAD
LHFVEAHGTGTTLGDLIETQALGATCGDRVGRAPLVVGSVKGNIGHTEGA
AGIAGFIKACLSMHHRTVPPSLFADDENPALDLAERNLKLAVSAEKLPRG
DLLAGVSSFGLGGTNVHVVIGSAPRVRRPIRRGGIGVLTVSGNDAAALRR
NLDRLVAGFDPTEHWPRYCYSTNQVKAGGTQRIALVTRDGADLAGEAEVA
LHRLARRNERARRRRPRIAFVYTGQGSQYREMGLALREQHSGFAEALAEA
DALLEPHFGGSVVRAIETGEDHLGRSLDDTVVAQPALFALQYALTTTFAA
HGVRPDVVLGHSVGEIAACAAAGVLDPAAAAALVVTRGALMGALPAGGTM
LAARLPAELADEFVSGPVALAAVNGPDSVTFSGPVERIAEVADQLNGRGV
HTRELVVSHAFHSPAMEPVGGELAAAAPLPAESAGAPIVISSVTGTAAEA
ADFTGDYWRAQLLGTVDFLGAARTLADMEPSHIIEIGPRSTLLSLLAAAD
LIPDSQRIAPVPGAAATGLDFADALAALWQWGLDIDWRPLYAEHDRVVGR
LPGYVFADEERFFASAATVGPLVHTQSVRTATAPVREVASVPPADDESQP
DVGVVHRAVIRVLADVGGHREDALHAAADLRDDLGFDSVQAMQFADRIVN
ELDMPRLDPVAIQDNLTTIADLTKLVAGTAGVAQPEHTGAGI
169630654YP_001704303.1 3-oxoacyl-[acyl-carrier-protein] synthase III [Mycobacterium abscesMSRTTYVLSTGTALPGPAIDNRSLCERIGAQPEWIDTFVGTRTRHFGINL
ATGEQTHSLADMATSAARQALSRADIDPSEIGFLVLGTATPDHLMPTSAN
LVADALGLEGIPTFQLQSGCSGAVAAFDVGSHLLTEERPLGLVIGADACY
KHLPLDRESSSAMPPSELVNFVLFGDGAGAAVLALDDTDAQLGITALVNR
FSGLGRDPGQQIEWFGLADRHLEQPGLNEDYKAIEHWVPLLSKDVLTDLL
ATAGLQREDLDYLLPPQLSGKMTQRVVKQMEIASNSREISVVADTGNNGN
ALPFLQIDALSREVQPGERAAVVAIESSKWIEGGMVLEGVA
169630653YP_001704302.1 HAD family phosphatase FbkH [Mycobacterium abscessus ATCC 19977]MSVDAVTVSRAVAFADVAESLVEAGDDAVARAGAALRRLDLDDVPAGTPT
ARVVVAGTSTLGPIRAPLQGALAARGVAATVELGDYGRIVPELLDPQSPL
GNADATIVVLLPDGSSVFERVAIPFTAESAEEAVNGFVDELLAAIQVFRS
HSSTPIVLPTLLLPPERSSMLLDLPARTRLAAAWARANQRLLEAGAEISG
VVAVDMYQLAAFAPAAATDPRMAAYARSRFTDPLLLSYSREIAALVAAQL
GRTSKCLVLDLDGTTWGGVLADAGPLGVISGDGRAGEAFADFQDTARQLS
SQGVLLAIASKNDDELVRQALTEHSGVRLGIDDFAVIVANWDPKPGNVAG
IAQALNIGVDSLVFVDDNASERGSVRAAHPQVRTVAADPDDPARTVPALL
RDGFFTTLRLTEDDRARPQRYRAEAERVSFRQTVDAVEDYLAGLQTEVTI
AAADGTDVDRLSQLTLRTNQYNLTTLRLDPAAVQAFLGRPEAIVKTIRCA
DRFGDHGLVGALFAEIHDGRLDIVNFAMSCRVLGRGVESAALHTVLAEGV
RRGARVASGTFIRTAKNGRAADFFRSSDFAVTGADETQEVGGHTTYLRDL
ATLPGPLPHLTVTVLRPEEEKP
169630652YP_001704301.1 hypothetical protein MAB_3572c [Mycobacterium abscessus ATCC 19977]MNENEFHAVVIDQTGLDIQVADLSTPLDEVSGWDSVYLLKLITALEQQTG
RAMPISAMLEATSLDAIRLAVPA
169630651YP_001704300.1 hypothetical protein MAB_3571c [Mycobacterium abscessus ATCC 19977]MNTTVVPVPPRRRHTLAFLRAIRPTAPVYLSTDVDVSILVQRRTAAPRRY
SYVTYMVAALGQALTKHPEANVAVGGSWLAPRIAQYGSVDVKLALDKTDG
GVRHVASAVIRDVASLDVEGIQAHVDRLRDTPAAELDELAGSRLLDRLPP
LLGTWAFGFATRLSRRSEVLGTVALSSLGHADVHAFHSDGGTAVTIGMGA
IAPRPVCVPDREGNHAVQARSVLPLSLTFDHRALDGAAAADLLTTLSDIL
RAGVTA
169630650YP_001704299.1 putative 4'-phosphopantetheinyl transferase [Mycobacterium abscessuMIGQLTVPTSESSIPQVAEGVFVARAEVADWMVEPVSHRCLTRLLDCDYP
RWRDARSEDFRARFAATRHFAKSVVARVADLPVEDIELRRCTSGRPSFVV
RGSGCSRVVDANLSHTRDSAVMAVSTRGPVGVDVEAQNRNLDDGDFARAI
CHDEELGEYERAQPSERQWLLLELWTWKEATTKALGTGLGTAFPLLRTDI
RRGTVTDDRDQTWRIHALSGGGYRVAIARRQED
169630649YP_001704298.1 hypothetical protein MAB_3569c [Mycobacterium abscessus ATCC 19977]MHELSERAELVRLHGRAQAIPSSEIDRILLSIDSLDDGPRGWATVWARAA
DVRLARGDHAGAMARLNLARFPFPSTAEGRRAHARCVAIAADIAAGQGIT
RLDLGDSAAWYRPAPDSADTPRLLVVCGGIVSIKEQWFSLFGLGRRLGLA
VLLTELPGVGEHDAAYGLDAPERFGALLDSAAARQPFQSAFAMALSFGGT
VALKAAARDTRIGGLLSVGPPIRHFFRDSTWWPRVPQTTKDALVATTRVD
EQALPQALAPFALEDSELAAINVPVTAVASLRDEILPTADPLLLRTAVPS
ARVVAYDDVHGSPHHLLDTRLLTLAALAEFSSSRRPLLAGAARLATQLRR
SERTLA
169630648YP_001704297.1 putative thioesterase [Mycobacterium abscessus ATCC 19977]MTRLLCFHHAGGAATAFRSWQNAAGPALDVVPVALPTTRPVTGRRIHRST
SELIDHLLAEYAEHLREPYVLYGHSMGGLLAYLMARRLVRNSAHPAPAAL
IVAASWSPRMRPSIDVDSLEDRELVQLLNAIGGVPADLVKRPEWLAPMLP
VIRDDLRMCGVYEHDHVDDVLNIPVHVIGAEGDRLVTPEQTAGWVDLGER
VSIEYHAGGHFFEADPLALRLRVFALAAVAAGEQNVRAVS
169630647YP_001704296.1 putative carboxymuconolactone decarboxylase [Mycobacterium abscessuMTAFPYPQLDEEKESEYELFPINLTRMMLHTQGQTVPYLHYALSFRHAKI
TAQLRERVIVRVGAVAGCEYQLVQHKSEALRTGTTPELLAGLTDPEHREF
GDESLTALVGYVDSLVAHVGAEESARDELRKHFPDNEVAEITLLASTYVL
CASFLKSLGVQPDDGPVDWSTVDAHITAGRL
169630646YP_001704295.1 putative cyclase [Mycobacterium abscessus ATCC 19977]MGDDLAVLESYIQRCSNWGRWGSQDQLGTVNLITQEKIREAATLVKVGKT
ISLTMAYDADGPQNGYLGRANPQLYQLTSGPGYLVGEQQQVETQTLTELR
KTSGEPTAGYYDDVLVMPTQSGTQWDALCHFFWRGKMYNGHRVADAGTGG
SRSNGVQNYTGRIITRGVFVDLAEYWGVETLDPGYPITTADLDDYLAAKK
LEIRSGDALIIRTGFMAARRGNWRDYAGGAAPGLSLHTAPWLRDHDIAAV
ATDTWGIEVLPNEIDVWQPLHVVSLVHTGLAFGEMFDLDGLSEDTKTDGV
YEFMFVASPLPLTGASGSPVSALAIK
169630645YP_001704294.1 TetR family transcriptional regulator [Mycobacterium abscessus ATCCMANRQTVQGVRTGGRSARVREAILDAAFGELIDRGYAELTMEAVASRAGV
NKTTIYRRWPTLEDLLVEALTTWSLEAIPIPETGSIESDLLSTGRELAAV
LNDGVGRQVAALVLTAGLRSAPLREATRRYFDHQVLRAAPVVRQAIDRGE
LPADCDVDMLLTTFRAPLFYRTITTGDPIDDALIIHATQITLTAARAGLL
SA
169630644YP_001704293.1 dipeptidyl aminopeptidase/ acylaminoacyl-peptidase-like protein [MyMRFIFETDESFSFETLRTVGYTAYGGADIGEVVTTAKRITPGDWESWYIE
WRALADRIAAIAAKCAAAGHAVSASTAYLRASNYYRTAEFFLRDDPGNDP
RVLDTSARAVETFRSAPEIQARWERVQIPYEGIQLEGYYLNASGDDRGPT
LLAHGGFDSTVEEMYFAVGEAARRYGWNCLIFEGPGQGAALRADKVTFRY
DWEAVVTPVLDFALGLPGVDPDRVALLGMSMGGYLAPRAAAFEPRLAACV
AYDSVFKLSAGMPKTHDDEHKLDSAQRVAAVGNLIAHRAEAPSSQRWVLS
NALWVFGVDSAQSLLDEVEKYDLSDVAHQISCPTLVCEAENDQFFHGQPS
MLYDALQCPKTYLKFTEAEGAGEHCHEGALLLFHQRMFDWLDDAVGA
169630643YP_001704292.1 MmpS family protein [Mycobacterium abscessus ATCC 19977]MSRRSVVRPILARAWMPLVSIVAVSVGAVAMWKVHDSSSPPPVFTVNGPQ
APDSFTQKRLTYQVFGTGSGAMLSYVDVYGHPHQADGADLPWSHTETTTL
TVVSGSISVQVRGGEVGCRILVNDVVRDEKFDDHHDADVTCRVKSV
169630642YP_001704291.1 MmpL family protein [Mycobacterium abscessus ATCC 19977]MSNHEMPTGPIPVRRPLVPRMVRVLAVPIIVFWAFLAVTTNTFVPQVEKV
AEELAGPMIPHYAPSQRAMLHIGEKFQESTSTSLTMVVLESQDRVLGDED
HRYYDELMQRFKDDSEHVQYVMDLWGKSITSAGAQSIDGKSTYVLLRLAG
DIGQMQANESVRAVRAIVDKQTPPAGLRVYVSGPAPLAGDTLDIANSSLN
NITIITIILIIVMLLLVYRSFSTLLLPLAGVLIEMLVTKGVIATLGHLGY
IELSSFAVNIVVSLTLGAGTDYGIFLLGRYHEARSTGQSREEAYYTAYRG
VAPVVIGSGLTIAGACYCLSFARLNYFHTMGPAVAIAMVLTIAAALTLVP
AVLTVGSLFGLFDPKAKAKAQLYRRIGASVVRWPVPIFVASSIIVMVGAV
FVPTYQVSYDDRAYQPAGAPANQGFAAADRHFSKSKLFTEMLMVESDHDM
RNSADFISLDRVAKSLVRLPGVSMVQSITRPLGRPLEHATLPYLFTTQGS
GNGQQLPFTKRQNGNTAQQAEIMGNTIVVLRDMIDLTQKLTDAMHATVVT
MEDMQQVTEAMDQYVSNLDDFMRPLRNYFYWEPHCFDIPACWAFRSLFDM
LDSVDKLAADIKDAVAQLEIVDKLLPQMVSQLKVMANDMEGIRALIINTY
GTSDLQSTLTTQTFDDMINVGLDFDKSRSDDFFYIPRQGFENEDVKTGMQ
LLMSPDGMAARFMITHEGNAMGPEGVEHVEQFPEAVGLALKETSLAGARV
YVGGAGSNDKDIKEYGASDLLIVAIAAFVLIFLIMMFLTRSLMAPFVIIG
TVAFSYSGAFGLSVLIWQHLIGLPLHWLVLPLTFIILVAVGSDYNLLLVA
RLKEETGAGLNTGLIRALGSTGAVVTSAGLVFAFTMLAMLASDLRTIGQV
GSTICIGLLLDTLIVRSFIVPSLVRLFGTWFWWPTRVFARPLRRQNVGAH
R
169630641YP_001704290.1 hypothetical protein MAB_3561c [Mycobacterium abscessus ATCC 19977]MADKGFRSPLTATECRSAPVISYATLTVLAAVVEVVLVVCVFVYVRRLQR
RHTTPISERIGSSAAVLTKLRKRRPMSQEEFDHARQVIADRGSLLVYSIP
AAIFTLGCFYVAGSLEQLHGATPSERTFLGVIPMITSTSLTLRLLKNMQL
KRRLKQSESAIPAQSRT
169630640YP_001704289.1 hypothetical protein MAB_3559c [Mycobacterium abscessus ATCC 19977]MPHGDDADQDSFADRLNRLFAERTSKTGVELSLSQFISDFRDQTGVTLSK
GYLSELRNGVAPDPRLDLVRAFSRYFNVDPSYFTVDSPARAEEIAARGEL
IDALQAAGATELGFRAAGLSASSMRHIAQIINSVRSLEGLPPID
169630639YP_001704288.1 hypothetical protein MAB_3558 [Mycobacterium abscessus ATCC 19977]MTASDDWHFIGYQTAALMFLAGGIWVLALVLRQRRKPGTSIILSSSLILG
FLFYQATALIFISRAAELVAIDHVFALITHLLGVLWSFSTILLALSWLNP
EYVRKNLWWLLASSMTACAILISTFVLLYPGPPGYNYIVNIADQPLGKIY
SSTYAISILAAKILVIVITVPQIRRVQNPMVRIGLVLVAGGSFLIALFAS
MRLTFGVLQSYLSPANLELLPLTAHVTGAIMYVMGIALVQLMVTAWMLLT
GIGNYWRLRPLCRAGVAEFPALGMVPTLQLRDYWSVERTNTQLLAVVVLL
LDVSVLLARASNQPSPHPQAEATLPTGDLRAAYRDDLKRMLGVASRYRTL
RRAQCPSDALRRSLVDGRQAFQ
169630638YP_001704287.1 hypothetical protein MAB_3557 [Mycobacterium abscessus ATCC 19977]MKSIQHRDVTEICDDLCLATISSGSSGESITLADIFTTVGARRGRPIESR
ATDFAGTEVFGLWLALPHADLVLYEQSTSVAHQAHIVLHELGHIVLEHRL
SPPTSGARSFEGEQCRLMLRQELLEPLEIQAETFAHVLAQRMRMQSPRPS
AGRSHPAARRISDTLTGGRLFDRL
169630637YP_001704286.1 alpha/beta fold hydrolase [Mycobacterium abscessus ATCC 19977]MGNTLTVQTALLDVEVRRHGNPENTDKLPVVLLHGWPDSVATWTHVIPAL
ASAGHQVYAPSVRGTGQTKFRYADTPRTGRLGDLLRDLFAVCDQLKLERF
HLVGHDWGARTAFACGIVAPHRIASLSAISAGWHPAGHGPALSSLQAQRF
WYQWLLNTPAGADLLRRERRELVELIWRDWSPNWKFSDQEFDDTFTSLQS
SDWLEVTLSYYRARWGWGPVIDDPFEKQIAQATAISVPSLVLHGDSDNCV
LPIASEGMNQHFPHGFSRLTTPGVGHFPQREDPLWVSGALLQWFKEWGNA
R
169630636YP_001704285.1 major facilitator transporter [Mycobacterium abscessus ATCC 19977]MTEQLRAQPLSMMGVVGASIGNFLVAFDASAINVALPTATEELHATVDVG
QWFLDGYTIPLCVFLLVSGAIGDRYGAVKVYRWSMLAFLAASVACAAADT
AGTLIVARIAQGVGASFVVPMTLAILTKGIPDPRRRSTMIGAWGVVGGIG
IASAPLLSGLITEYAGWRWLFLINVPICAFALRATRTIANIPADQPRRFN
PISQLLLCVFLTCIASVLIEGRRLGWSSVSTLAMAGIAVLSMAALWQVER
RSAEPTIPPALARNRSYLLIVCAGSFYQFASYGSLLVLALFLQVRHGLRA
DHAGYIMSICCVAWLLGNVLAVKVTPDNRRQAILAMAAVGCVGAVGTAAL
SLTEKIVPAMVPTSLIGVASGVLASSLSAAAMHVSPHTVSGVGSAVLNTS
RQSGMVIAIALLGGLSFDHQLLVPMLLVASAFAMVLVTTALAFRPNLFKQ
SSAQRLQSSACQFPSRG
169630635YP_001704284.1 ketopantoate reductase ApbA/PanE [Mycobacterium abscessus ATCC 1997MLVFGAGGVGLYFSAVLAQAGHHVTIVGRPATVTAAGQSDLQLTTSSGVL
AVSGIHVVADIAEARIDPTADLIIVAVKAWQVSAAATAIAPLVGAHTIVL
PLQNGIEAADDLANVIGPQHVLGCSCVVIAKRTKPWAVTCLGAHAHLEIG
PISDSFAGELTSLVAALHQAHISVTLSSDIRATLWRKFMLISSYGGVGVL
CRQPVGVTSTTPETAALIRDAMFEVLAVGQAHGVALSHQDVDSMMAVFHA
FDPLTTSSMHRDLLEGRPSELEHQSGAVLRYGRAVGVTTPIHWCIYASQL
PAEIAARKPTEHAP
169630634YP_001704283.1 2-isopropylmalate synthase [Mycobacterium abscessus ATCC 19977]MLTFPQGHTPRYRDFTIDAISDETMREGGERAPFGATDDQKIQLIRAITD
AGITDIDVGSGITEASFVRALLDAQQLESTIAPDATFSFNLTLKTWEPLC
EQLERELPSSYLSDIYVSIGMIEIDSENRLFERVAERLRSIGVGKLRSSL
LNAFSITVDEQKYEHLNTQIERCRQQGISLIRINDSVGTLVPDSTAVLAA
NLVRDNPDITFYLHGHNDRGLGTANSLTSVFHGFQMIEGGVAGVGNRSGL
AEIECIAAIFAENNIRVAAGTPDLDGLCRAARLSEDVFLTAPDPFRAVSG
FLTENENAGIVNVPDYLGVSRSVKYFLNRIGLFPTYVRQILSESEFDSST
VDDDSFIDQVYERLAAHMDALHLRKRTEFAHLSRAIQDFYTEMVRLDDVR
DCALEVLRDRGSAHAKVAS
169630633YP_001704282.1 hypothetical protein MAB_3552 [Mycobacterium abscessus ATCC 19977]MSHRYISRVADYEPAPVLASLPAACQAPRPARLHQSRTRPTGIERQTHLR
EQSPPPQAVAFADAAMRRVLEVMDRRRPIAQLRPLLGDGPLSAVLARSSR
VPATTAARLSKIRVRRCADDSAEIFGTFERGGRVRAFAGRIRAVRGNWLV
VALQLG
169630632YP_001704281.1 hypothetical protein MAB_3551c [Mycobacterium abscessus ATCC 19977]MGKAARIVVSRLSALDASFYSSEDSATPMHVGSLAIIRRPRGGFTYEELL
ALVESRLPQVPRYRQKVKEIGFGLARPVWLDDVDFDITYHIRRSALPSPG
SDGQLQDLVARLTSRPLDRSRPLWEMYLVEGLSKNRLAIYTKTHQALVDG
NSALSLGQVIFDRTARTPDFGEDIWVPEHEPSTSELVAGAVSEWLARPGA
RLEAVRNTVADVASLTGEIGELGERMVKVVRTAARGAAPRGPLNQRVSRS
RRFGVVSTKLADYRRVRAKYDCDVNDVVLATIAGALRNWLMSRGEPVTTA
STIRAMVPMSVYRDGDLDVGGEGAATTEVSPFLVDLPVGEGNTVVRLSQI
AHATESHSAAFSLVDVPNMAALSGFVPPTLHALAARVASTLPNRLFNLLV
TNVPGPQAPMYLGGARLAEIYPVPPLLRNQVLSIGLTSYNGTVYYGINAD
REAMPDADMLPLLITEALDELLEAAQ
169630631YP_001704280.1 hypothetical protein MAB_3550c [Mycobacterium abscessus ATCC 19977]MPMQVYIPVTLSMLRGLVADGELWPVNGTAFAVTPALREAYSAGDEDELS
EVAMREAALASLRLLATEDGDDGLPARRAVLVADAEEAKLRPDLDDAVVR
LPGAIPMSAVVAAHIDLAQAEPDVVRAAGVIDAADLGDEDAELVVGDAQD
HDLAWYATQELPFLLDLL
169630630YP_001704279.1 putative oxidoreductase [Mycobacterium abscessus ATCC 19977]MKLASWLDASAPGAPKSRHAAVNILRGLASRITTPLLPDDYLSLANPLWS
ARELRGRVVSVRKETSDSATLEIKPGWGFHFDYHPGQYVGIGVLIDGRWR
WRSYSLTSAPAMSGSREERRALHAGGSARTITITVKAMPEGFLSTHLVNG
LEPGTIVRLAAPQGNFVLDDPAPPAILFLTAGSGITPIMSMLRTLVRRSA
AAGLPLPDVVHLHSAPTAGDVMFAGELAAFSEAHPSYHYRLRTTKTQGRL
DFSSLAAEVPDWARRQTWACGPEGMLDDAQRTWADAGLAELLHLERFAVS
RAAPHGQGGLVTFARSGKQRAADAATSLMEAGEEAGVQMPFGCRMGICQT
CVVSLVQGHARDLRTGAEYEPGTRIQTCVSAASGDCVLDV
169630629YP_001704278.1 putative fatty acid desaturase [Mycobacterium abscessus ATCC 19977]MAISDIQEFAHLTEADVEALGHELDAIRRDVEESLGAADARYIRRTIAAQ
RTLELTGRILLAASKKRSAWWAGAVTLGVAKIVENMEIGHNVMHGQWDWM
NDPEIHSSSWEWDMVDPAEHWKQTHNYIHHKYTNVLGMDDDVGYGLLRVT
RDKKWKPFNLGNLLYNTLLMLLFEWGVGTQHLELGKVAQGRADKEEFRVK
RQAALTKMGKQVAKDYVAFPALSALSPAGSYRKTVTANLLANVIRNIWSN
AVIFCGHFPDGAEKFTKQDLENETQGQWYLRQMLGSANFDAGPAMAFMSG
NLCHQIEHHLFPDLPSNRLSAVSVRVRELCDKYDLPYTSGPFLVQYAKAW
RTIAKLSLPDKYLTYTADNAQETRSVKMFDELEPHERRGLKSAFAAVRAR
RKARHKV
169630628YP_001704277.1 hypothetical protein MAB_3547 [Mycobacterium abscessus ATCC 19977]MSPREYDESDARIRPGRRSRPRTKIRPDHADAAPAMVVTVDRGRWGCVLH
DDPAQQVTAMRARELGRTPIVVGDTVSLVGDLSGRPDTLARIVRLEERRT
VLRRTADDTDPFERIFVANADQLLIVVAVADPPPRTGLVERALIAAYAGG
LTPILALTKTDLADPDSFAAQFADLNIRVIGAGRDEPLAPIIEVLTGRLT
ALLGHSGVGKSTLVNRLVPEAGRATGEVTGVGKGRHTSTQSVALPLYPSG
WVIDTPGIRSFGLAHIRPDDVLAAFSDLSEAIEDCPRGCQHLGPPADPEC
ALDELEGASAKRVTAVRQLLSVLTTA
169630627YP_001704276.1 3-phosphoshikimate 1-carboxyvinyltransferase [Mycobacterium abscessMTSGLWQAPTIDGSICATITMPGSKSQTNRALVLAALAAREGGTSTVSGA
LRSRDTDLMIRALRSLGFDIIGDGTDLTVSPGAGDDDASTVDCGLAGTVL
RFLPPVAALRHAPTVFDGDEQARARPIAPLLDALRSTGVGIDGQHLPFTV
TGTGQVQGGEVGVDASGSSQFVSGLLLSGAAFSAGLTAMNTADVLPSGPH
VVMTVTMLREAGIAVDDSVPGRWRIDPQPIPAHQWVIEPDLSNALAFIAP
ALATGGTVRITGWPRQSTQPARQIEDVVRQFAQTVSLTDTHLEVTGQSGY
GGVDLDLSEVGELTPTVAALSALAESGAVSTLRGIAHLRGHETDRLKALA
HEINALGGRCEETQDGLRIVATDLRGGVWGSYADHRMATAGALVGLKVPG
VSVDDIATTSKTLPDFPGMWADMIAQSERAS
169630626YP_001704275.1 hypothetical protein MAB_3545c [Mycobacterium abscessus ATCC 19977]MCGRYAVTIDPALLAAEIDAVDETATSAVQSPTIPNYNVAPTDPVLAVVA
RHHQPGDVPTRRIRAMRWGLVPNWATARQDGRPESKGAPLINARAETLTT
AATFRAAAQSKRCLVPMDGWYEWRKQEGAKTAFYMNAGEGKRLFAAGLWS
VWKPAKGAVPLLSCTIVTTDAVGPLREIHDRMPLMLGADSWDSWLDPDRE
LDPGLLRAPGSAAGIETRRVSSLVNSVANNGPELLVPDDGAAAVGEQITL
L
169630625YP_001704274.1 hypothetical protein MAB_3544 [Mycobacterium abscessus ATCC 19977]MGSKAVKAATPAVAALIAGGAEYELLPYEHRAGEHAFGEEAVRALAGSGL
VPEQIFKTLLISLDRGSDLAVAVIPVPATLSLKAAAAALGRAKATMADPA
AAERSSGYVVGGISPLGQRKQLPTVIDASALTWERILCSAGKRGLQMALA
PEDLVRLTGAVTAPVIAG
169630624YP_001704273.1 RNA polymerase sigma-E factor [Mycobacterium abscessus ATCC 19977]MACLERPMSVPIRMVGVATERTAVTSMDSAAELPGLVHVETEAERVARFE
RDALPLLDQLYGAALRMTRNPADAEDLVQETMVKAYAGFGTFKEGTNLKA
WLYRILTNTYINIYRKKQRQPAEYPTEEITDWQLAANAEHTSTGLRSAEI
EALDGLPDDEIKEALNKLPEEFRMAVYYADVEGFPYKEIAEIMDTPIGTV
MSRLHRGRRQLRDLLSEVAKDRGFLRNNELAEGRA
169630623YP_001704272.1 hypothetical protein MAB_3542c [Mycobacterium abscessus ATCC 19977]MTDGELKKSVDKSGNCEVSGCAEVIAEVWTLLDGECSPESSARLRHHLEE
CPGCLQHYGIEEQIKTLVARKCGGEKAPDGLRERLKLKISQTTVIQQRAE
NS
169630622YP_001704271.1 putative acetyl-CoA carboxylase biotin carboxyl carrier protein subMAEEVHAEIVASVLEVLVKKGDAIAEGDTIVLLESMKMEIPVLAEVAGTI
GDVSVSVGDVIQAGDLIAVIDD
169630621YP_001704270.1 two component sensor kinase [Mycobacterium abscessus ATCC 19977]MSTLGDLLAEHTMLPGDAVDHLHAVVAEWQLLADLSFADYLMWVHRDDDA
FVCVAQCRPNTAPTIIDNDAVGTIAKIADVPLVEAAFASGAIERESDSDL
TEHASELNVEAVPVRCGDRTVAVLTHQTALASRLKKGTLERAYLECAGDL
LLMLTEGTFPNVADQAMSRSSPRVGDGFIRLDVSGGVKYASPNALSAYHR
MGLASDLQGHNLMDVTKPLISDPFEGQELAAHIRDVLAGGPSMRMEVDAG
GAAVLIRTLPLIARGASEGALLLTRDVTEVKRRDRALLSKDATIREIHHR
VKNNLQTVAALLRLQARRTPNDEAREALFESVRRVSSIALVHDALSMSVD
EEVNLDEVIDRIMPIMTDVATVDTKVRVSREGALGVLDSDRATPLIMVIT
ELVQNAIEHAFDEGAQGQVVIRAERSARWLDVVVHDDGRGLPEGFSVETS
DRLGLQIVRTLVSAEIDGSLDMRSDPEGGTNAVLRVPLGRRARLMA
169630620YP_001704269.1 WhiB family transcriptional regulator [Mycobacterium abscessus ATCCMDWRHKAVCRDEDPELFFPVGNSGPALAQIADAKLVCNRCPVTTECLTWA
LESGQDAGVWGGLSEDERRALKRRNARARARSAV
169630619YP_001704268.1 hypothetical protein MAB_3538 [Mycobacterium abscessus ATCC 19977]MRAVLIVNPNATSTTAAGRDLLAHALESRVHLQVLHTDHRGHASELARRA
ADEGAAVIVVHGGDGTVSEVVNGLLGQPGHPAPGPLPAVAVVPGGSANVF
ARTLGISADPAQATNQVVDLLDEHRREQRRWRRISLGHCGERWFIFNAGM
GLDGEVVAAMEAHRNKGKQVTAGRYVARSVLAFFRAARRQPTLTVELPGH
EPQAGIHFAFISNSNPWTYANERAIWTNPGTGFESGLGIFASKSMNVVAN
LGLVRHMVGTPRADRPAAKHLLREDDIPWVRVRASAPIATQVDGDFLGLR
SDLTFTAVPDVLDVVAPAKPAGKQS
169630618YP_001704267.1 hypothetical protein MAB_3537c [Mycobacterium abscessus ATCC 19977]MTTTAPNTVRRAGMIVAGEGAVGLVIALVLVVRAASGADQHVVNGYGTAA
WFSVFGTAVLAAGLALISGRRWGRGIAVMMQLLLLPVAWYAAVGSHQLAL
GVPLAIVAVAALVLLFSPTAQMWAGGDEAGADESD
169630617YP_001704266.1 putative acetyltransferase [Mycobacterium abscessus ATCC 19977]MTNTLIRRATEADIPAIVGLIEDLAEYEHARDECLITEEQLHQALFGSHP
ALFAHVAESGGVVCGTAVWFLNFSTWTGHHGIYLEDLYVRPEQRGAGLGK
ALLSALAAECVANGYTRLDWAVLDWNTPSIKFYDSLGAHPQSDWITYRLQ
GPALAELASDRSD
169630616YP_001704265.1 isochorismate synthase EntC [Mycobacterium abscessus ATCC 19977]MTATDSPARPHFVMSRAADALYAYGRDATYDDVFTAAEALRTGRHHMLVG
ALPFDTSRPVALTAPVTVQRGLPQEFYGAMPNTQVTQQVPAPSEHLRRVT
EAVEVLRSDAGLAKVVLARVLELRAESPVDPLVLTHRLIRNDPDANSFCV
DLSPAGNRFRGHTMVGCSPELLVERRGDMVICHPFAGSAPRSSDPSQDRR
TGEDLAGSHKNRHEHSVVIDQLREDLASLCVDVQVPPEPTLSRTAALWHL
STSISARLRQSSTTALDLALALHPTPAVCGTPTEAAADLISRIEGDRGFY
AGAIGWCDRNGDGRWAVTIRCAELSADGTAIRAYAGGGLVAESDPQDELS
ETTVKFRTVLAALGAKID
169630615YP_001704264.1 acid phosphatase [Mycobacterium abscessus ATCC 19977]MSALLNRMLLLRHGETEWSKIGRHTGRTDLDLTEIGRAQAVAAREVLKDL
DLNDPLVLSSPRRRALQTAELAGLTVDTVDEQLAEWDYGDYEGLTTPQIR
ENDPGWLVWTHGCPGGESVAQVQARADLVITKIAAELTQRDVLLVGHGHF
SRALMTRWIDLPLEEGTRLGMATASIAIGGHEHGQRQVAALGLTGYQHPV
PSS
169630614YP_001704263.1 putative cobyrinic acid a-c-diamide synthase [Mycobacterium abscessMTRVLAVANQKGGVAKTTTVASLGAALAQAGKKVLLVDLDPQGCLTFSLG
QDPDRLGISVHEVLLGQADIKEALLTTTEDLTLLPANIDLAGAEAMLLMR
AGREYALKRALESLGDQFDVVIIDCPPSLGVLTLNGLTAADSVMVPLQCE
TLAHRGVGQFLRTVTDVQQITNPRLTLLGALPTLYDSRTTHSRDVLLDVA
DRYQLPVLAPPIPRTVRFAEASASGASVLAGRKNKGALAYRELAQSLVKH
WKSGKAMPTFTPPVD
169630613YP_001704262.1 hypothetical protein MAB_3532 [Mycobacterium abscessus ATCC 19977]MIAPERRTRADIIAAAVIAVVVAVTGTTIWWTSDARATVSRPAAGDIKRP
MSATRVPDSVRELWSTASAATKGPVIASGAVVSADGHDVVAHDPATGAQL
WSYARRNLDLCGAIGFIDDAVAVYRDARGCGQVTMIDGQTGRRGALRSSA
NDSKVSLSTDGTYVLALGSTRLELWRSDMVRTLEYGRVVAPLNANSQPRV
DCTLKSGAVGASVLAVLETCPQDPTLRLTLQKPTPKDNDKPEELYSAVLP
GVERGSAAKVLAVADTRSAVYLPGTRNELVVFDDRGMRVGATVLPGEIAQ
TNAAAQAGDVITWWTGSQVLVLSASDLSYRFVLPTTTKPLGPGTNMAGEL
LIPVEGGIDVFNMTTGEFRKSIVVQRNTADEKSPVISAVVGNTLVEQRGS
RIFALG
169630612YP_001704261.1 ATP-dependent DEAD-box RNA helicase [Mycobacterium abscessus ATCC 1MSHIEHTFAQLGVRKEIARALREAGIEHPFAIQELTLPLALAGSDLIGQA
RTGMGKTYAFGVPLLHRIATGVEDRPLNGTPRALVVVPTRELCIQVYEDL
TKASKYLSAGDRDFTVVSIYGGRPYEPQIEALRAGADVVVGTPGRLLDLA
QQGHLQLGGLAMLVLDEADEMLDLGFLPDIERILALAPSADAGRQSMLFS
ATMPDPIITLARTFMNRPTHIRAEDPQASSVHDSTEQFVYRAHALDKIEL
VSRILQADGRGATMIFTRTKRTAQKVSDELAERGFAVGAVHGDLGQIARE
KALTSFRSGQINVLVATDVAARGIDIDDVTHVINYQCPEDDKTYVHRIGR
TGRAGRTGIAVTLVDWDDIARWQLIDKALGLGVPEPDETYSTSPHLFTEL
NIPADVTGSIGEKFSGGPKRREPRGERAEGEKPKRTRTRRRTRAGQPTDE
SAAEAPAPEAATADGDQQAPARRRRRRRRPNATAATTASA
169630611YP_001704260.1 hypothetical protein MAB_3530c [Mycobacterium abscessus ATCC 19977]MTEPDSLRASGSSTDLDPPGVNQLFAVIAYGEVAAFYRLTDESRMAPDLA
SKIAIASMAASQMRHYEVLRDAMEAKGIDVLAAMEPYVKTLENYHSLTLP
RTWLEAMVKAYIGDSLAADFYGEVVDSLSGESAAVLKSVLGTTGHSEFVI
AQVRDAVKENSQQRNRLTLWGRRLLGEAITQAQHVLARHDELAELVMSGG
AGLGNLNEFFERLQSAHAERMAVLGLG
169630610YP_001704259.1 hypothetical protein MAB_3529 [Mycobacterium abscessus ATCC 19977]MVGYRGDSRYSSDYEPYDDPYNSETAPQSTEYSGLDEDFEYRPPGSNENW
KWVASIAGAVFAIAVIATAVVLSGGNDKPPAAAVTTPVPALTPVTTTTAP
PPPPSATSPAKPSTTTVTSTPAQETPTAEPSTEAPPPEPPPSNPMLPPEG
QRPITPAAFAYYVTGNQTPGDLLTITYTDGNGMTRTVLGASLPWTMIVTP
SPGITGGSITATSFASQVNCSITNSENQMLAVQNSNSIIARCAK
169630609YP_001704258.1 hypothetical protein MAB_3528c [Mycobacterium abscessus ATCC 19977]MEIKIGVTDSPRELVISSDQAPADVEKVVTAALSKESDVLNLTDQKGRKY
LIAAARIAYVEIGVADARRVGFSS
169630608YP_001704257.1 TetR family transcriptional regulator [Mycobacterium abscessus ATCCMRDLAKLAGRRGTVNSTVATQDSTQGNTRRGGRLPRDERRGQLVGSASEI
FVDRGYHAAGMDEIADRAGVSKPVLYQHFPSKLELYLAVLHKHADNLVSS
VRQALRTTTDNRQRLRAAVMAFFDFVEHDSQGYRLIFENDLVGVPQVSER
VEGAISACTDAVFDLVSHDSGLDPHHARMVAVGLVGISQVSARYWLDNEK
PISKDDAVNATVGFAWGGLSHVPLQPHG
169630607YP_001704256.1 hypothetical protein MAB_3526c [Mycobacterium abscessus ATCC 19977]MSRLPVQESSERYEPLRAQRDPLAEGSGRIRSDRRDRDRWRKQTWLGRFI
STYGWRAYAIPLLVALTVFVGYQTVTQREHVHGGADGPNEPVADPPSIGA
LGDAIIGAPPKGLTQFDASLPDGVLPEGEPFTAQGARTWHIVPGTTPQVG
QGAAKVFSYTIEVEDGIDTMGFGGDEAFARMATQTLASQKSWTHNPQFAF
VRIDAGTPDFRISLTSPDTVREGCGYEIQLESSCYNPRYGENGEQRVFIN
EARWVRGAVPFQGDITSYRQYVINHEVGHAIGYRSHEPCEQDQQLAPVMM
QQTFSTSNDVAAKFDPDSIKPDGKTCRTNPWPYPIP
169630606YP_001704255.1 molybdenum cofactor biosynthesis protein MoeB1 [Mycobacterium absceMPTLPPLVRPAAELTREEVARYSRHLIIPDLGVDGQKRLKNAKVLVIGAG
GLGSPTLLYLAAAGVGTIGIVEFDVVDESNLQRQIIHGQSDIGRSKAQSA
RDSVLEINPLVEVRLHELRLDPENAVELFAQYDLILDGTDNFATRYLVND
AAVLAHKPYVWGSIYRFEGQVSVFWEDAPDGLGLNYRDLYPEPPPPGMVP
SCAEGGVLGILCASIASVMGTEAIKLITGIGDSLLGRLMVYDALDMTYRT
IKIRKDPATPKITELIDYEAFCGVISDEASAAVADSTITPRELRELLDTD
KKVALIDVREPVEWDIVHIDGAELVPKSTLESGDGLAKLPQDRQAVLYCK
TGIRSAEALVAVKKAGFSDAVHLQGGIAAWAKQVDPDMVMY
169630605YP_001704254.1 hypothetical protein MAB_3524c [Mycobacterium abscessus ATCC 19977]MTVDRPPEHVLATYGLSGVKPVQLGPTWEGGWRCGEVVLSLVADHARAAW
SAKVRDTLFVDGVRLARPVRSTDGRYVVSGWRADTFVAGAPEPRHDEVVS
LSVRLHEATSKLERPRFLTQPPVAPWADVDVFIAADRAAWEDRPLQSWPS
AARVSPGSPDGQRSIDLINQLASLRRPTKSPPQLVHGDLYGTVLFAGAAA
PGITDITPYWRPASWAAGVAVVDALSWGDADDGLIERWATLPEWPQMLLR
ALIFRLAVHALHPRSSAQSFPGLARTAALVRLTL
169630604YP_001704253.1 integral membrane nitrite extrusion protein NarK3 [Mycobacterium abMANNTATAPIARRGRWIENWDPEDVVAWDNGGAKIARRNLIWSVVAEHVG
FSVWSIWSVMVLFMPQNVYHIDAAGKFFLVAMPTLVGAVLRLPYTFATAW
FGGRNWTVFSALVLAVPTALTLYFMAHPETSYTTFMIVAAVAGFGGGNFA
SSMTNINAFYPQRFKGWALGLNAGGGNIGVPVIQVIGLLVIATVGNRSPH
WVAAIYLVLIAFAAVGAALFMDNLADQKTDGRSLIDVMKYRDSWIIAFLY
IGTFGSFIGFSFAFGQVLQLNFLAGLAHSGVTPAQAAAQASLHAAQIAFI
GPLLGSLARPFGGWLSDRTGGGKISLYAFIAMIFGAGILVAAGTISDRGA
GAPSGSIMTAYVIGFIILFVVSGIGNGSVYKMIPSVFAAKARSAGLDETW
SRTMSGALIGVAGAIGALGGVAINLVLRASYLSAAKSATMAFWVFLVFYV
ICAAVTWYAYVRRPMTVSVPAISSSKNEVAV
169630603YP_001704252.1 nitrite reductase [Mycobacterium abscessus ATCC 19977]MNKKVVVIGHGMVGHRFVQVLRERDATDQWQVTVLGEEADAAYDRVALSS
YIDSWDRDTLALTGNDYAEDPMVTLHLGDPVVGIDRTNQTVSTAAGTVLD
YDALVMATGSYPFVPPVPGGDAEGCFVYRTMDDLDAIKATADKSPGSAGV
VIGGGLLGLEAANALRLMGLAPHVVELNPRLMHLQVDEGGGALLTRLVTD
LGLTVHTSVSTQAIEKAADGTLSVQLSDGSTIDASVLVFSAGIRPRDELA
RECGLELAERGGIFTDLGCQTSDLHIYAIGEVAAIEGRCYGLVAPGYTTA
EIVADRLLGGSAQFPGADLSTKLKLLGVDVASFGDAHATADGALEVVFND
ATKGTYAKLVVSDDARTLLGGILVGDASAYGTLRPMLGRELPADPASLIA
PSGAEIGVGALPDDAQICSCNAVTKGAICAAICEGATDVPALKSATCAGT
SCGSCIPMLKQILAAQGVEQSKALCEHFEQSRAELFQVVQATGIRTFSEL
IAKHGKGTGCDICKPTVASILASTSSDHILEGEQAGLQDTNDHFLANMQK
NGTYSVVPRLPGGEVTPEKLIVIGEIARDFGLYTKITGGQRIDLFGARVE
QLPLIWKRLIDAGMESGHAYGKSLRTVKSCVGSTWCRYGVQDSVAMAVEL
ELRYRGLRSPHKLKMGVSGCARECAEARGKDVGVIATENGWNLYVGGNGG
ATPAHAKLLAGDLDSETLIRYIDRYLMFYIRTADRLQRTAPWQEAIEGGL
DHIRAVVCEDSLGIADELEAAMARHVQGYQDEWAAVLADPDKLRRFVSFV
NAPDQPDSTIAFDESGPRKVPVLLGTPGFRAAAEAAT
169630602YP_001704251.1 nitrite reductase [Mycobacterium abscessus ATCC 19977]MDSLTPGRGAAVLLADDVQAALFLMPSGELYAVGNIDPFGQAAVMSRGLT
GDRGGEPTVASPLLKQVFSLIDGRCLDDASRRLPVFEVRVINGNVEIGML
RSRHRNAVAA
169630601YP_001704250.1 bifunctional uroporphyrinogen-III synthetase/response regulator domMPRNEPERRLDGFTIGVTAARRSEELIALLERRGAAVVHAAAIRIIPLAD
DAELRDATELVIANPPDLTVATTGIGFRGWIEAADEWGVADGLKSALESG
RLVARGPKATGAIRQAGLREEWSPASESSAEVLDRLLEEGVEGRRIAVQL
HGAATEWEPIADLCEALTIAGAQVIRVPVYRWEPPEDQRPMDRLISMAIN
AELDGISFTSAPAVASMLGRAKATGRLDELLAALRARVAPLCVGPVTAAP
LEVLGVPTTQPERARLGALARHIADELTRRAPRFHAGGHIVSVRSCGIAV
DGETRQISPAGMALMKRLMVRPGQVVSREDLLAALPGGGDDTHAVETAMT
RLRAALGAPKVIQTVVKRGYRLAIDPTTIGECHG
169630600YP_001704249.1 hypothetical protein MAB_3519c [Mycobacterium abscessus ATCC 19977]MAEFVLVAHGTRSAAGVENIAALAEAVSRRVGSVRTAFVDVLGPTPSEVL
STIDGPAVLLPAFLASGYHVHHDIPEHVALSGHPQVAITQTLGPDPVLAS
VLAGRLRAAGWRRGDAVVLAAAGSSDARARHEVHTAASLLARHTGPVRVG
YIATGEPRVADVVREARATGRRVFIASYLLAQGLFQQRLAECGADGVAQP
LGVHPQIVDLLVQRFASVTAASGELEAVADVA
169630599YP_001704248.1 DNA-methyltransferase [Mycobacterium abscessus ATCC 19977]MAAVTEEQVELVRSLVASIPAGRVATYGDIADAAGLASARIVGWIMRTDS
ADLPWHRVIGASGRPAPHIRTRQLELLRAEGVLAVDGRIALRDVRHGF
169630598YP_001704247.1 alpha/beta fold hydrolase LipV [Mycobacterium abscessus ATCC 19977]MTPTLNIHRYGPVEPARLLALHGLTGHGRRWAPLFDEYLADVPVLAPDLL
GHGRSPATAPWSLEAHADAVAAELDTAETGPIVVVGHSFGGAIALHLAAR
RPDLVKSLVLLDPAIGLDGDWMRQIADQMVTYPDYTDRAEAKSDKVAGAW
SDVPDHVIEAELDEHLIQLSNGRCGWRMNLPAAVTAWSELARDIVLPVNV
IRTTLLLATRTSPPYVLPKLLDALQATLGSQFELIDIDCDHMVSQSRPAE
TAAAIRSHLE
169630597YP_001704246.1 ATP-dependent DNA helicase [Mycobacterium abscessus ATCC 19977]MSAPPPSSRYWDGAAACLLDPDRTGRFVVVGGSGTGKTSLLVDIVAAHTA
AGVNPASVLVLTGSNRASAELRNRISAAVFERCAGVAIREPMVRTVHSYA
FAVLAAHAACQGNPPPRLITAAEQDSIVRELLCGNAEDNSGSWPASLRPA
LATAGFATGVRDLMARCTERGVDARELRAIGRRHNRPEWIAVAGLAREYE
EVMLLRSAVGMAAPQATVPALGAAELVGSALETFAVEPGMLAAERDRIEL
LLVDDAQHLDPQAALLVRLLAERAGFCVIAGDPNQTVFGFRGADTQLLQV
SADSRTTMIELDGSHRCAAPIAELANSVARRLPGSSPARVIHGVENGPAA
VRLAAVPTETAEASLVVDLLRRSHLIDGVPWSRMAVIVRSVPRSGAALCR
ALQSAGVPVHAESYDGPVASVPAVHALLLAVSAAQGGVTHEDAVTLATGP
LGRVDPVALRRLRRQLLRAEEAAGGERGSAELLRAVLVEADETHLAALTD
IQAAPLRRVRAVIGAAREATASGASVLDVLWAAWTRSGLQRRWDGLSQRG
GPLGAQADRDLDAVSSLFDLASEHVARTPGIGVTGLIDHIRSLALVGQRT
TRLEPDAVAIVSAHAAVGREWDVVAIPGVQEGLWPNTAVRGGVLRTQELM
DVLAGIEHAAHVDGSAVALAEERRLLLLAVGRAARRVLITAVENENADMG
GGPAMASRFLTELMAAHPEWVISEYRPGAAQSRVLTAANLVGELRAVVTA
PVEAVTDARRRAAARQLARLAAAGVPGADPESWYGLGDVSDERPLWLAED
GPVRVSPSNVETLMACPLRWMLERHGGTDLTDPRRALGTLVHELVGVHAE
DSDAMCRALDKAWESMPFESQWYARNELRRHHELLEAFTTWRASTRGELT
EVGREIGVDGVLSRAGQPQVRLVGRIDRLERDAEGRPVVIDIKTGKSPAT
KDDAQQHAQLAAYQVAAAEGLIEGEPAGAPGGGRLVYIAKPNLDDGATQR
HQDPLTPAAQDAWRESIHNAAASTQGPIFVARVNDGCGHCPLRTCCPAQT
DGQAVCQS
169630596YP_001704245.1 ATP-dependent DNA helicase [Mycobacterium abscessus ATCC 19977]MNAYSPAELSRVLGLFEPTDEQAAVIGAPPGPMVVIAGAGAGKTETMAAR
VVWLVANGYATPGQVLGLTFTRKAAAQLLRRVRSRLARLAGSGILAPVAA
DEPDPVIATYHAYAGTLLREHGLLLPMEPNARLLTETQLWQLAFRLVCDF
DGDLDTEKTPGAVTAQVLALAGQLSEHLVNTTDLLSSHDELERLILTLPP
GPRQREGGPSAWLLRLIETQRERTQLMAIVEQLIALMRTRGVLDFGAQMA
LSARLAADHPIVGQTQRERYRVVLLDEYQDTGHAQRILLSSLFGRGVDPD
LALTAVGDPIQSIYGWRGASATNLPRFTTDFPLPDGSPAPTRELRTSWRN
PPEALHLANSVSEEARRRSVAVRPLLPRPDAASGRIACALLGDIAAEREW
VATQLAAVYEQAHREGNRPPSSAVLVRRNSDAAPMAEALAAQGVPAEVVG
LTGLLGLPEVADTVAMLRLVADPTAGPAALRVLTGPRWRLGAHDLVVLWR
RATGFGRGGAPAVGPDVGEEADIPCLADAISDPGTPDEYSPEGWKRLTAL
RRELSALRARLGMPLTDLIAEVQRVLALDVELVAGRRGEGLDQLRAFTDV
AAGFAESADQSDPVGVVSAFLQYLDAAWEIEKGLAPVEVAASPGRVQILT
VHSAKGLEWDVVAVPHLSAGVFPSGVAAPTWLTSATELPPLVRGDRASQG
DQFGVPQLDTEGITNRKQLADAIARHKDSLATRRIDEERRLLYVAVTRCA
EQLFVSGHHWGQTGLKPKGPSDFLVELRDVIESAAAEGVPCGTVERWAPE
PPAGERNPMLDQTVEAQWPADPLAGRRDDIEAGARLVRAALADGAALTME
DDDDTDGWEADVDALLREREQGHRRPEMTLPQHLSVTSLVELRQDPQALA
RRLARPRPTRPDLDARRGTAFHSWVQRHYGSVRLIDFEDLPGDGYGSFED
AEDLAALQSAFLESEWADRTPVEVEVPFEISVAGIVVRGRIDAVFGPDSA
EDTWTVVDWKTGHEPAGDEMKAAALQLAVYRRAWASLREIDPARVRAVFH
YVRSGRTVAPTELPDLPHAEELAELTRD
169630595YP_001704244.1 transmembrane cation transporter [Mycobacterium abscessus ATCC 1997MAGKLRQRFRGIDQALTAQPDHALVGVLRIPENAASPWRAIGKRILIAVG
TLFAAVLVVYADRSGYRDVASTPEESDPLSFLDCFYYATVSLSTTGYGDI
TPYTEGARLVNILVITPLRLLFLIVLVGTTVEALTERSRQALKIQRWRAR
VRNHTVVVGYGTKGKTAVQAMLSDGAAPSEIVVVDEDQMALDAAAAADLV
TVRGSATKSDVLRLAGVQNAKSIIVAANRDDTSVLVTLTARELAPNAKIV
AAIREAENVHLLRQSGADSVVVSSETAGRLLGIATTTPRVVEMIEDLLTP
EAGFAIAEREVERSEVGGSPRHLSDIVLGVVRDGILHRVDAPEVDSIEAT
DRLLYVRNAGA
169630594YP_001704243.1 NADH pyrophosphatase [Mycobacterium abscessus ATCC 19977]MTFRLRNIPLLSRVGLDRADELRSNPEELAKGWAEAGLITLDVRGRVNIV
DGQVVIEDAARIGDQPPEHAVFLGRIPGGRHVWAVRADLDEDSAPLLDLR
RSGQLFDDTSAALLATAMAMLAWHDNAGYSPVDGSPTIPAKGGWVRVNSA
TGQEEFPRTDPAIICLVHDGGDRAVLGRQKFWPERMFSLLAGFVEAGESL
EACVAREVAEEVGLTVTDVQYLGSQPWPFPRSIMLGFHAIGDPSQPFAFN
DGEIAEADWFTRAEVRSALEAGDWTTASDSRLMLPGSISIAREIVESWAY
AGEEPPAGRP
169630593YP_001704242.1 putative glutaredoxin-like protein [Mycobacterium abscessus ATCC 19MTLNANVTTASDTGLIMYSTTWCGYCRRLETQLKAAGIDYTKVDIEQDPA
AAEYVSGVNGGNQTVPTVKFPDGSALTNPSLAQVKAKLGL
169630592YP_001704241.1 DNA helicase II [Mycobacterium abscessus ATCC 19977]MARSLLDGLDDEQRAAVTAPRGPVCVLAGAGTGKTRTITHRIAYLVASGH
VAAGQILAVTFTQRAAGEMRGRLRDLGVGSAQAVTFHAAGLRQLRYFWPQ
LVGDTRWELIDSKFTLVAQAANRAKVSTTTDTVRDLAGEIEWAKASLISP
ETYPAAAAKFGRDAPVPAEQVAKVYAGYEKLKARPDGSTLLDFDDLLLHT
AAAIENSAAVAEEFRDRYRCFVVDEYQDVTPLQQRVLDAWLGPRDDVTVV
GDANQTIYSFTGATPQYLLGFSRRFPDATVVRLERDYRSTPQVVSLANRL
ISAAQGRVAGSKLQLIGQRPQGPAPRFSEHDDEAAEAKSVAKSIAALIES
GTPASEVAVLYRINAQSEVYEEALTEAGIPFQVRGGEGFFTRQEVRQALV
ALQRAAGREDAGMPVPEQVREILEPLGLSQEEPHGTQARERWESLRALVE
LADEECARQPELDLPGLVRELRVRAEARHPPTVQGVTLASLHAAKGLEWD
AVFLVGLADGTLPISHALSRAGDIEPVEEERRLLYVGITRARVHLNLSWA
LSRAAGGRKSRKHSRFLNGIAPTAQLPASATPRRRGGGARCRVCNAALST
PAAVLLRRCESCPSDIDEELLVALKDWRLKTAKEMKVPAFVVFTDNTLIA
IAELLPGDDAALVAIPGIGARKLEQYGPDVLRLVRARSS
169630591YP_001704240.1 putative dienelactone hydrolase [Mycobacterium abscessus ATCC 19977MADDDLRDFEAGTFTHEGETKIVLRKGSGPAVIVIAEMPGISPRVADFAR
KVADIGCTAVMPHLFGNPGQSVDPKADGWLRTSTYMASSMFRGCVSREFT
VLATGKTSSVINWLRALAQNEHERNGGPGVGAIGMCFTGGYALAMAADDR
LLAPVLSQPSLPFGLSKKARYNIDISPEDLSKVKHRCQHEGLKVIGMRFT
TDKLVPAERFQFLRDELGDAFIAIELPGESARPGSPMPPHSVVTEHLIDE
PGQPTRAALDQVLDLFRSRLLTSV
169630590YP_001704239.1 hypothetical protein MAB_3509c [Mycobacterium abscessus ATCC 19977]MNTPTNYGDTLWRDAHGAFVVLPIAPPSLQTRAAAKPAVAAVLMAGSASA
IKHRAAVAAANVASVNRGYI
169630589YP_001704238.1 putative transcriptional regulator [Mycobacterium abscessus ATCC 19MMTVEVEARRLALPCHVADADLWFAESPADLERAKALCADCPIRSQCLAA
ALDRAEPWGVWGGEILEQGTIVARKRPRGRPRKNPLPDADTAAA
169630588YP_001704237.1 ABC transporter ATP-binding protein [Mycobacterium abscessus ATCC 1MADIRRGGLSRMTKLASLPAGMAGRAVLGVGKRLTGTSADEVNAELLEKA
ADELFKVLGELKGGAMKVGQALSVMEAAIPPQFADPFREALVKLQSEAPP
LPTPKVHRVLDAQLGTKWRERFQSFDDTPVASASIGQVHKGVWKDGREVA
VKIQYPGADDALRADLKLIQRMTPLAKQIAPKADIDRLVAEISDRIEAEL
DYRLEASNQRAFAKVFASDPKFFVPAVVASAPKVIIAEWMEGRRISKIIA
EGTREERDSAGALMLEFTVKSPESVGLVHADPHPGNFMLLPDGRFGIIDF
GAVSEHPGGIPPEFGEVLCWARDEQWDQVIRLIKQLGFMPPDVQLSGDQV
MDYIRPLWPYVDPLRAGEFHFTREWFQQAAVASTDLLDEGFADRFKLARQ
MTVPPGYVMLLRTLGGMIGVLVQLDAHVNYAAIAEQWMPGFFPPNSTSA
169630587YP_001704236.1 short chain dehydrogenase [Mycobacterium abscessus ATCC 19977]MSKKILITGASSGFGRGAAIELARRGHQVVATAETWPQVRTLRADAAEAG
VDLEVIKLNLLDEIDIAHAAGYDPDVLVLNAGVMESGSIIDIPLARVRES
FDINVFGHIQLAQGIVPKMVARKSGKVVWTSSMGGILVIPFVGVYCATKH
AIEAIAGSMKAELEPHGVKVATVNPGLFGTGFNDTGAESHVQWYDPERAV
VPMPSFGDTLADQFDPQEMIDAMVEIIPADEHLYRTMRPLATIDVAKGWQ
ETEWTQNA
169630586YP_001704235.1 hypothetical protein MAB_3505c [Mycobacterium abscessus ATCC 19977]MPDITLEHANQLVARGLAAAEKAGMKAVFAILDSGANLVAFARMDGAWLA
SNELAIAKARTSVMFQAPTEGLAAPLQLGQPALHFDHIHAGGLLLVGGGV
PLFDQAGALIGGLGASGGSPEQDAELARLASA
169630585YP_001704234.1 ABC transporter ATP-binding protein [Mycobacterium abscessus ATCC 1MAEIRRGRAARAAKLASLPAGIAGRAALGVGKRLTGKSKDEVNAEMMEKA
AEQLFQVLGELKGAAMKLGQALSVFEAAIPPAFAEPFREALTKLQSDAPP
LPADKVHRVLDAQLGTKWRERFQSFDDKPVASASIGQVHRAVWSDGRVVA
VKVQYPGADEAVRSDLKTMQRLSSLFKQIVPGADVKSIIDELIERTEEEL
DYRIEATNQRAFAKAFKGDPEFYVSPVVASAPKVVISEWMQGRKLSEIIG
SGTEDERNECGRLLLKFTVSSPYRCGLLHADTHPGNFMLLPDGRLGVMDF
GACATHEGGFPPNLGPIWRLERDGMWDELIPLMRAEGFIPPHTEVSPEEI
DEYLKPFIDPLKSDEFHFTRKWMQRVAAKSSDVRGAQFQTGRHLDLPPVY
LMMFRVLGSLSGILAQLDATIPYARIIGDWVPGFREDEDRMPVAPGGIRS
169630584YP_001704233.1 ABC transporter ATP-binding protein [Mycobacterium abscessus ATCC 1MALTLPEIDEAPLFVNFITSGHDVRMAEIRRGRAARAAKLASLPAGIAGR
AALGVGKRLAGKSKDEVNAELVEKAAEQLFQVLGELKGAAMKIGQMLSVM
EAAIPPEFGEPYREALTKLQSDAPPLPADKVHRVLDAQLGTKWRERFQSF
DDKPVASASIGQVHKAVWKDGRVVAVKVQYPGADEAVRSDLKTIQRLSSL
FKQVAPGADIKGIVDELIERTEEELDYRIEATNQRAFAKAFKGDPEFYVP
SVIASSPKVIITEWLQGRKLSEIIASGTEEERSRCAHLLLEFSISSPYRC
GLLHADTHPGNFMLLEDGRFGVMDFGACASHEGGLPAGFGPILRLARDEK
WEELTEVLRSEGFIPPSATSVSHEEVNSYLEPYIEPLNYDTFHFSRKWLQ
RLTAKATDFRSEEFLESFKTSRQMNLPPNYLMFFRVLGGLIGIAAQLDAP
VDYAAIIDKWVPGFHEDSKAPAAT
169630583YP_001704232.1 hypothetical protein MAB_3502 [Mycobacterium abscessus ATCC 19977]MPQWVMSSEPTFTLDPARPVLPRPDDGIQIGWTPRHAVVVHTGSAAPTHA
VRQLLSSLSDELSWEQIVNLRCAKDFRDPDDIRSLLEELVAAGAVIRRIR
PTNPASPVIRLVGRGPLSDALAEALRHTSARIQHTTHSVHGKSWQHVDLA
VLADDLIADTRLLRMLADAEVPHLSVRARDGTGLIGPMVLPGITSCLECA
DRHRHDRDEQWPAVAAQLTGTVGVAAPATVLGTVAVALAQIDRVLSAMRG
QPPGPLATLNATLELDLATHALTARHWTAHPLCPCGAYFAGN
169630582YP_001704231.1 hypothetical protein MAB_3501 [Mycobacterium abscessus ATCC 19977]MADLPFGFAAGDDPDRERGDAGRGSSGSGSSGADPFGFGSGGFNPADLGQ
IFTQLGQMFSGAAAGAASGQPAGPVNYDIARQLASSSIGFVAPITASTTS
AITDAVHLADTWLDGATSLPAGATRTAAWTATDWVDNTLENWKRLVDPVA
EQISGMWAANLPEEAQSMAGPLLGMMTQMGGMAFGSQLGQALGQLSREVL
TSTDIGLPLGPKGTAALMPAAIETFSEGLEQSKGEIMTFLAAREAAHHRL
FSGVGWLTIRLMDTVEQYAKGISIDMSAIEEAARGFNPAAMGDPSEMEQI
LSQGIFEPKTTPQQEQALERLETLLALVEGWVQTVVTDALGERIPATAAL
SETLRRRRATGGPAEQTFATLVGLELRPRKLREAADLWRRLTDAVGVDKR
DAVWAHPDLMPDASDLDNPAAFIDRIIGGDTDAVDDPIAQIQKLDPGTPP
TED
169630581YP_001704230.1 hypothetical protein MAB_3500 [Mycobacterium abscessus ATCC 19977]MNEQAPVLLYDGVCALCNGAVKKILRDDKVGSMRFAALDSEYGTQVIDRH
PELAGVDSFVIVDNPGGPDERTHIRSDAVLRVIDYLGGARRASLIGRLVP
RPIRDSLYRLVARTRYRVFGRYDTCPVPPPEVRARFLA
169630580YP_001704229.1 hypothetical protein MAB_3499c [Mycobacterium abscessus ATCC 19977]MNRRVATLLVALIPIVVFGLLMSVITVPFVSLGPGPTFNTLGQVEGKEVV
DIKGTKVDPVSGHLNMTTVSQRDGLTLADALRLWASGSEQLVPRDVVYPP
DRSKDQVDKENDLEFKKSEESAEFAALGYLKYPAAVTVLTISDDGPSKGK
LQQNDAITAVNGHPVATLDEFTGQLKLTKPGDEVMLDYKRKNAPNGTVKI
TLGKNGDRDYGFLGVGVVQAPWAPFTIDFNLANIGGPSAGLMFSLAVIDK
LTPGELDGGKFVAGTGTIDAEGKVGPIGGITHKMFAAKDAGATVFLVPAA
NCAEAKTDGGQGLTLVKVGTLTEAVDGLNALNRGEQPPSC
169630579YP_001704228.1 hypothetical protein MAB_3498c [Mycobacterium abscessus ATCC 19977]MGMRPNGALPRLTRRSRRLVAASLVIVVLLLIGPRLVDTYINWLWFGELG
FRGVFTTVLLTRLALFLIVGTLVAAVVFAGFGLAYRARPVFVPAKGPGDA
LAQYRALILSRVRLFLIGVPILIGVLAGVVAQSYWMPVQLFLEGGDFGIK
DPQFGLDLGFFAFDLPFYRFVLTYLFIAASIALIVNGLVHYIFGGIRLSG
RSGTLSRPARIQLITFAGILVLLKVAAYWLDRYELLSHTRAGKPFTGAGY
TDINAVLPAKLILLAIAVICAVAVFSALVLKDLRIPAIGLALLLLSSLVV
GAGWPLIVEQFSVKPNAAQKESEYIARSIKATRDAYGLTDDVVTYRDYSG
TASSPAGSQQLAKQVAADRSTIANIRVLDPNIISPAFTQLQQGKNFYAFP
DALSIDRYQDKNGSLRDYVVAARELDPAKLRDNQRDWINRHTVYTHGNGF
IAAPANTVRGVADKPDENGGYPEFLVNAVDDNGKVLSDGPAPLAQPRVYY
GPIIASDTNDYAIVGKNGNDREYDYENNAGTKNSTYTGSGGVPVGGALAR
TVFGLKYAERNFLFSNVIGDNSKILFNRDPSRRVEAVAPWLTVDSGTYPA
IVDKRLVWIVDGYTTLDNYPYSQQTSLSEATFDSQVGRTGGALPNQQVSY
IRNSVKATVDAYDGTVTLYQQDEKDPVLKAWMKIFPGTVKPKADISDDLK
RHLRYPEDLFKVQRTLLARYHVNDPVTFFSTSDFWQVPDDPNAPTGSQPP
YYIVAKDITKNDNSASFQLTSALNRFQRDFLAAYVSASSDPETYGKITVL
TVPGTVQGPKLVNNAITTDNQVSSHVGIIKNQNILKWGNLLTLPVANGGL
LFVEPLYASPGQGDQSSYPRLIRVGMYYNGKVGYATTVRDALDMVFGPGA
GATATAPAVEPGAMPPAPPGGQNVPVVPPVTPPPTGSAELSSAKAAALQE
VQRAIGEVKEAQKSGDFARYGQALKGLDDAMTKFTQAR
169630578YP_001704227.1 hypothetical protein MAB_3497 [Mycobacterium abscessus ATCC 19977]MEAEDITYLGASSGGARPMSLVDPSRFAPWHCPPPLFRNVELGRVEVSSG
RLAIRDVYDRDHPQVVLNVAPGNYRVWSTELDLRTNPRGPLFRPAYLSIQ
LSDAPPRRIDFPEDLYGTPAPPYGIGVSTDLGMILLHDAEALSPHEFEAL
DRSWERAWESDRDYSDVYTASGATVITCKTVIDKARHPIVASYDAKNQPV
GIHVDFGVLGASQAALRNSRGRLRRWGAAAGRLLRRK
169630577YP_001704226.1 hypothetical protein MAB_3496 [Mycobacterium abscessus ATCC 19977]MSTQSAFARLLIFAFLGVTAAVGVDLMDGTNIQGGKEPAVTYSADPWDDE
VEFLTGNDAMNIYTPDSRQINGQPQNIGGARNSNGIGKSCNNPGVRCR
169630576YP_001704225.1 hypothetical protein MAB_3495 [Mycobacterium abscessus ATCC 19977]MSSIPGFVTYTGIALAALGVSTFGAPLAAAEDPPNCTPADLLGVTSGVAA
SESVYLHTHPEVNDFFNGFKGKSRSEIRSAIDGYMAANPDVKADLDGIRQ
PVTDFKERCGVAVSPIN
169630575YP_001704224.1 hypothetical protein MAB_3494c [Mycobacterium abscessus ATCC 19977]MQKRSIDAVIRQLFERADNGHNAADTVVGGHERILRQTVIALREGAELGE
HESPGEATIYVIRGSVRLVAGAEHWDGRAGDLIEIPDARHSLQALTDSAV
LLTVAKRRG
169630574YP_001704223.1 hypothetical protein MAB_3493 [Mycobacterium abscessus ATCC 19977]MALTATLMTACTAAVGATAFGASLAITPQPPDTVLYVISSDRPITAITWR
DSLGHMRDQPVDGAQRTWTWTFTSDVANPPYFVSAQSAGATVTCRLIVNG
KVKVEDTTTGHASTATCHG
169630573YP_001704222.1 hypothetical protein MAB_3492c [Mycobacterium abscessus ATCC 19977]MERVKSAGSVCTVRALALCRRLGDDLFMGLISLPTAVLSDADIADALSRA
VRVINPVLTVLAQSDPFGLKERTYELGAGEGVVDKALDALACALNTATTP
GTKAWDKLDTRGKTHWWVQRVGAVNTVFVAFPGIFGALAARLPVQDLLGF
SNQAIVLVAIARELGINDHREQVRLLAKVLCNRTLGDEALVGADDQAPET
PRNWSPFALARTLWHLAGILRAIGDELEKRPQPKPIFRYLGMLPAVGSVA
GYIGEYGALRRAASAGERSIAQSRPVRT
169630572YP_001704221.1 putative ATP-dependent Clp protease [Mycobacterium abscessus ATCC 1MFHLFNERSRQVIVIAQEEARERQHNYLGAEHLLLGLVGEGTGLGARLLA
TAGVRFENGARVIQQLVPLGQEPPAEKMSFTPGAQRTLELAVTASESRRH
TEICTGHLLLGLVDAADPTIIQIWERLSVDVLDLWDNVRAHLDENLGD
169630571YP_001704220.1 hypothetical protein MAB_3490c [Mycobacterium abscessus ATCC 19977]MTALKVLAGTGFAAVALLAGCSGVVNLGGDTKCKDFIAAEEQKQNDAVSK
MVKDERGRDASNLEISATRTAVTMYCKTLGNDNSKIREAPHI
169630570YP_001704219.1 acyl-CoA synthetase [Mycobacterium abscessus ATCC 19977]MFFTGVGSCETLIESTEAGPDPEYVVLSAKVKARVRLILSNTKESLAIEG
VDNDGLISVRLFEERSAQTRVRITVLRAASVLPAGIKKPSAAVNQWLMDG
LDRIDDYLSGAPTSTVSNSGDNGNLQVSIAKLMVSVGVVRIPRPDRGLRQ
LSSLARWGFTLQGGYAAAAARAPKQLAIADDAGQLTFEQLDRRAEGLATG
LMRAGITETSKIGLLARNNIAMVECLIAFGMLGVDVMLLNNALAATQIQI
AVARNGLTKVFVDDDLDELVRYVPWEVELVSTGRRSAINGRRGLDDFVVA
DKPGVLPPTRPGHQVVQTSGTSGTPKGALRPTPRGFAVIAAMLSRMPMKM
NETMLISAPIFHAWGLGCLQISTPLRATVILQEKFDPEECLRAIATRKVT
TMIAVPVMLQRIVDLPAKVRQKYDTSSLRLVACSGSPLNASLVQRFTEAF
GEVLYNFYGSTEVSWATIADPEDLAIAPTTVGRPPLGTTIAILDADRRPV
PRGVTGRIFVGNEMLFEGYVADPSPASVNGLLDTGDLGHLDADGRLYIDG
RDDEMIISGGENVFPRPVEDALAFLPQVSDVAVVGTSDDSFGQRLSAFVV
LNKDAGLDGDMVRAFIKNRLSKFHVPRDVYFVEALPRTSTGKVIKRLLLA
DCERDGVRPQ
169630569YP_001704218.1 hypothetical protein MAB_3488 [Mycobacterium abscessus ATCC 19977]MWVRSGLLTRLVLASCALVPLGAGVPVANADESTCAAIDQMSKVVDDPAN
NGPVVTEALMYLRADNPAYSGLDRQVEVISEARDMWGRNNDAVRANLDGV
TEPGARQQLTAYADGLSGAYDLAGAWLAATPEVRSSPEIIDRGGAVGGLL
FDGTNNFHVLANICNGGRR
169630568YP_001704217.1 acyl-CoA dehydrogenase [Mycobacterium abscessus ATCC 19977]MAINLELPKKLQAIVEKGHQGAAELVRPISRKYDLAEHAYPVELETLETL
FAGVTAAGTFAFAGAEAFRAEENTAKQNVNGANMSALLNALEMSWGDVGL
LLTVPYQGLGNAAVSSVTSKEDGDRFGKIWAAMAITEPGFGSDSAAVSTT
AKLDGDEYVINGEKIFVTAGSRATHIVVWATLDKTKGRPAIKSFLVPREH
PGVTIERLEEKLGIKASDTAVIRFDNARIPKDYILSDPEINTEKGFGGVM
STFDNTRPIVAAMAVGVSRASLEELRKILEDAGIEISYDRPAHAQHAAAA
EFLRMEADWESSYLLTLRSAWQADNNVPNSMEASMAKAKAGRVGSDITLK
AVEMAGTTGYSERTLLEKWGRDSKILDIFEGTQQIQQLVVARRLLGLSSA
ELK
169630567YP_001704216.1 acyl-CoA dehydrogenase [Mycobacterium abscessus ATCC 19977]MTNTLTPRDEKKAAKSKSLAKHETGVGLQKHKRGAIDILIAVLTPIAGSE
LLDKYNLRGAFNKGIFESTKGLFTTLGVANRTFKKVTGSKGGPKRLDKAN
ADYFDLNPEDEQKMIADTVKEFAVEVIRPAAYESDKNKTYPADLLGKVAE
LGVTAINIPEDFDGIASQRSTVTNSLVAEALSYGDMGLALPILAPSGVAS
ALTNWGSADQQATYLKEFAGENVPQASVVIAEPQALFDPFSLKTTATRTP
SGFRLNGTKSLVPAAAQAELFIVAANYNGRPTLFIVESGTEGITVEEDPS
MGIRGAALGRLNLNNVAVPAANILGEEEGSDTALANYSEAVALARLGWAS
LAVGTGQAVLDYVIPYVKQREAFGEPIARRQAVAFMCANIAIELDGLRLV
TLRGASRAEQGLPFVREAALARKLATDKGMQIGLDGVQLLGGHGFTKEHP
VERWYRNLRAIGVAEGVVVL
169630566YP_001704215.1 monophosphatase [Mycobacterium abscessus ATCC 19977]MTPTVSLREDRRLALELADAADEITTSRFGALDLRVDTKPDLTPVTDADT
SVETVLRSLLHRSRPADSVLGEEYGGEATFTGRQWVIDPIDGTKNFARGV
PIWATLIALLQDGVPVVGVVSAPALSRRWWAAEGLGAHSRVGSEEERSIH
VSAVDQLSSASLSFSSLSGWADRGKRDRFIDLTDEIWRVRGFGDFFSYCL
VAEGAVDIAAEPEVSLWDLAPLDILVREAGGRFTNLAGEPGPHGGSAVAT
NGLLHEEVLKALS
169630565YP_001704214.1 hypothetical protein MAB_3484c [Mycobacterium abscessus ATCC 19977]MWEFLVLLLIGGSLALLIMQMRRGRQAQPGMNAVQGTLLVTGVSPRPEGV
TGEQLVTITGALNGPTVAEYITYRQIVRDVNDWPRIGDLIPVLYPPKNPD
RWNILLAPLPGPTPPQYPSGPPPMENIDPSPPPPPPPPGPVEGPPSTGDP
AKKHEPPPRYYEPPPL
169630564YP_001704213.1 hypothetical protein MAB_3483 [Mycobacterium abscessus ATCC 19977]MTEHAVVIAGGGPTGLMLAGELALAGADVAIVERRTTHELDGSRAAGMTS
RTLEVLDQRGILDRFTPQGFSAPVAHFSALLLDMTDQPTRHTFGLALLQY
RIERTLSEWVGEHGVPIYRGREVTGFTSSDDAVRVELSDGSTLRAQYLVG
CDGGRSLTRKIAGIDFPGWDPSTSCLVADVQMTEEPEWGIHRQGALHSIF
KFEEDGPVRVLVTEAQLGRREEPTLRDLSEALLSARGTDYGIHSPTWISR
FTDVTRQAATYRKGRVLLAGDAAHVHFPIGGQGLNTGMQDAVNLGWKLAQ
VVNGTSPENLLDTYHAERHPVAARVLHNTMAQTALIRPGERVDALRDIMS
DLLTLDMPRRRIAAMMSGLDIHYDLGPGHPLLGRRMPDLEVRTAQGPRCV
FTLLREGRGVLLNLGTPITGASGWSHRVDVVEAEYLDAEGTFELPVIGMV
EAPHAVLIRPDGYVAWVGNGTTAGLNGALQRWFGPPRYSGGGS
169630563YP_001704212.1 NADPH-ferredoxin reductase FprA [Mycobacterium abscessus ATCC 19977MRAVHVAIVGAGPSGFFAAGSLLKHTDFDVHVDMLEMLPTPWGLVRSGVA
PDHPKIKSVSAVFEKTAAHPRFRFFGNIEVGAKITAEELASRYDAVIYAV
GAQSDKPLGIPGDQLSGCIAAVDVVGWYNANPTYQKVSVDLSGERAVVVG
NGNVALDVARILGMDPESLHTTDIADRALDSLDHNAIREVVIIGRRGPLQ
ATFTPLELREMGELPGVDVVVDPEDLADITDEQLAAAPKPTRTNIETLRK
FSERPHTEGHRRVVFRFRTSPIELHSDSAGVGVVESITVGRNKLVEEDGY
VVAHDTGERQTLPTHLVVRAIGYRGVPVPGLPFDSRRGVILNEAGRIQGR
DNEYVVGWIKRGPVGVIGTNKSDSQETVDTLLADLATAELRDAPDVAALE
EWLLGHEPHIVSQSDWLTIDSHERATGEPQGRPRVKLETVPDLLAATGRH
GEP
169630562YP_001704211.1 acyl-CoA dehydrogenase FadE [Mycobacterium abscessus ATCC 19977]MSQDTNAAPKTELLHPTADDFAEFDGETRRLLKATVDWFEERGKTRLLQD
YVDKVFYQDFLDFAGREKLFATFLTPAADGAGNTEKRWDTARVAKLSEIL
GFYGLNYWYPWQVTVLGLGPVWQSANTDPRKRAADLLDGGAVAAFGLSEQ
AHGADIYSSDLVLTPVDSSEGGGYKASGRKYYIGNGNCARIVSVFGRVQG
RDGLDQYVFFLADSEHPNYRVIKNVVPSQMYVAEFELDEYPVSEDDILHV
GADAFSAALNTVNIGKFNLCFGGIGLSTHAFYESITHAHNRILYGNPVTK
FDHVRREFVDAYARLLAMKLFSERAVDYFRTASADDRRYLLFNPVTKMKA
TTEAEKVLALLADVMSAKAFEAESYTTAARIDVAGLPKLEGTVAVNLALI
LKFMPAYLHDAQDLPVPGVQLQPGDDEFLFDQGPASGLGKVRFHDWRKPF
ADNADIPNVAAFTQRAEALATLVANERDAIKNAGLDLQLSIGELFTLVVY
GGLILEQAQLRGTDSALIDQIFEFLNRDFSVYAVDLLGKREATASQRQWA
KAVISEPVFNSERFDEIWNRVEALSGAYEMRA
169630561YP_001704210.1 putative short chain dehydrogenase/reductase [Mycobacterium abscessMYSFGKQLAALPRSQYGPWAVIAAGDTDTATAFARHIAANGINIVLAAHG
GRADAYTLTMTAGVSVRTTSPDVFNGELAAATDDIEVGLLVCITDEDAGG
SRFGESDLNRLRTLYLTHRFGQRIASRGEGAVIMVKSLAAQSISNSSLTG
NADSAFTTGIHDGLHQQGVEVVLLDDFVPHRPAMDADDLSLMALARLGRR
RHRHCSHENELTTPPPVLRAN
169630560YP_001704209.1 IclR family regulatory protein [Mycobacterium abscessus ATCC 19977]MTKPAPAVVRAAQILDHLAGRPTLPLSMTEIAEAVGVNPASTLAILQALT
EAGYIVRHPRHKTYSIGPAMLITGHAARMRFEVADVVNAEVQRLASQFGT
ACTASMIAGEDVAVIASHGRSPTGASYQVGQRIRLSAPAGLVFMAWAPDD
GVRRWLLRATPVITDELWDGMQAMLADIRRQGYFASVQSDRVDKFYMQLG
DTAAHGTVHERLDTIQSMLATLLARMGEPIDFSEPRRIGFLGAPVFDGNG
EVSVMLSVLGTPNRLTEAEVAHAGNQLRFCADHITSITHGRQGSGT
169630559YP_001704208.1 peptide chain release factor 2 [Mycobacterium abscessus ATCC 19977]MDLDCQADIADLDTTLTTVERVLDVDGLRARIKTLEEAAADPNLWDDQAR
GQQVTSQLSHAQGELRRVEELRSRLDDLPVLYELAEESEDNSVVAEADAE
RVKLREDIEAMEVRTLLSGEYDEREAVVTIRSGAGGVDAADWAEMLMRMY
IRWAEAHKYPVEVFDTSYAEEAGIKSATFAVHAPFAYGTLSVEQGTHRLV
RISPFDNQSRRQTSFADVEVLPVVETTDHIDIPEGDLRVDVYRSSGPGGQ
SVNTTDSAVRLTHIPTGIVVTCQNEKSQLQNKVAAMRVLQARLLERKRQE
ERAEMDALKGDGGSSWGTQMRSYVLQPYQMVKDLRTEYEVGNPAAVLDGD
IDGFIEAGIRWRNRRDD
169630558YP_001704207.1 mechanosensitive ion channel MscS [Mycobacterium abscessus ATCC 199MIRAAEFSAGGLRLAERWNSFWSSQIGRWLLDNGLQIVIAILGAMILVRF
INWGAQKITRRLDRSFTQSDALVRSEASKHRQALASVISWIIVVLVVVLT
TVHVVGVLGISVGGLAGPAAVLGGALGFGAQRVVQDLLSGFFLITEKQYG
FGDLVELYVQGQTTESRGTVEEVTLRVTKLRSGDGEVITIPNGLIVKAVN
LSKDWARAVVDIPVPTSVDLARVNDVLYDVCQQALVDRDLSQLLLDAPSL
MGVESIEVDRVNVRMVARTLPGKQFEVGRRLRAKVIAALAKAGVALVGDS
RPTVRTMSSSGSGELKREGKREDAKRDEVKREEEGVDTKPQPIVQAEELT
169630557YP_001704206.1 hypothetical protein MAB_3476c [Mycobacterium abscessus ATCC 19977]MSEPRHEPFWEMALSRAKKLRKKIRFRTSTVVLVLAFIATSWLYDITRPE
PAPPQPPPGYTWVPKPSVTTTTQQPVPTTTRRRTTTTPPTTTTTTTEQTN
TIVTTFPTLTPSGTAPTPPTTTTPAPPGIVPPWLVPPQLPQLPPMPGAPP
PPGQNPAP
169630556YP_001704205.1 putative cell division ATP-binding protein FtsE [Mycobacterium abscMISLDKVTKLYKSSARPALDNVSLEIDKGEFVFLIGPSGSGKSTFMRLLL
AEELPTKGDVQVSKFHVNKLRGREIPHLRQTIGCVFQDFRLLQQKTVYEN
VAFALEVIGKQTDIINRVVPEVLEMVNLTGKASRLPSELSGGEQQRVGIA
RAFVNRPLVLLADEPTGNLDPETSEDIMALLERINRTGTTVLMATHDHHI
VDSMRQRVIELELGKLIRDEQRGVYGVDR
169630555YP_001704204.1 cell division protein FtsX-like protein [Mycobacterium abscessus ATMRFGFLFNEVVTGLRRNVTMTVAMIITTAIAIGLFGGGLLVISLAKNSKA
IYLDRVETQIFLTEDLSATDTTCSSDICKGLRDEIEKRSDIKSVRFVNRE
DAYADAGRRLPQFQDLMKDVSKDAFPASFIVKLKDPEKHADFDEAFVGKP
GVRGVLNQKDLIDRLFAVLDSLRDAAFMIALIQAVGAVLLIANMVQVAAY
TRRTEVGIMRLVGATRWYTQLPFLLEAVIAALAGVALAVIGLIIARVTIL
NGALQQFIQANLVAPITYGDVFLAAIQMAALGILLAGVTAYVTLRLYVRR
169630554YP_001704203.1 SsrA-binding protein [Mycobacterium abscessus ATCC 19977]MSKKPADGRKVIATNRKARHNYSIIDVYEAGVQLVGTEVKTLREGKASLV
DAFATVDDGEVWLRGVHIPQYDHGTWTNHAPLRNRKLLLHRAQIDMLVGK
TRDGNLTLVPLSLYFLDGKVKVELALARGKQAHDKRQDIAKRDASREITR
ELGRRAKGM
169630553YP_001704202.1 hypothetical protein MAB_3472 [Mycobacterium abscessus ATCC 19977]MRMLLITCVAVAAGATTFAGQAAADPPPPNLDGYTAVEATAFETYSAYAT
SGVQFLTPDGLHCRITANSRATGVDGACWGKLPGVSGDENLATVSLTTST
ASLTHMPDLGQQEIVARPDASPAGPAAIDPSMYRPLSPGQKITYGLKATD
KVITCAVGEQRETTCILPNNFTGDGPHGFVLSPTGSRAF
169630552YP_001704201.1 succinic semialdehyde dehydrogenase [Mycobacterium abscessus ATCC 1MPIATINPATGETIKTFTAASDAEIDAAIGRAHDRFRQYRTTSFSDRAAW
ALSTADLLEAEADDVAALMTLEMGKTLASAKAEVLKCAKGFRFYAENAEA
MLAPEPADASAVNASQAYAQYQPLGVVLAVMPWNFPLWQAVRFAAPALMA
GNVGLLKHASNVPQSALYLADVIARGGFPEGCFQTLLVPSSAVERILRDP
RVAAATLTGSEPAGRSVAAIAGDEVKPTVLELGGSDPFIVMPSADLEQAV
STAVTARVQNNGQSCIAAKRFIAHRDIYDDFLSRFVEKMAALRVGDPTDP
ATDVGPLATEQGRDEVDKQVQQAVAAGASIRCGGTRPDGPGWYYPPTVIT
DITKNMPIFGEEVFGPVASVYRATDIEEAIEVANATSFGLGANAWTRETA
EQQRFINELDAGQVFINGMTVSYPEVPFGGIKRSGYGRELSAHGIREFCN
IKTVWIA
169630551YP_001704200.1 acetolactate synthase [Mycobacterium abscessus ATCC 19977]MVFGIPGEENIRFIQALAASDIRYILTRHEQGAAFMAEMYGRVTGRAGVV
SATLGPGAINLQLGVADASTNSTPLVAIAAQVGQDRAYKESHQYVDLVAM
FRPITRWADGVPTARAIPEMFRKAFKLAETERPAAVFLAVPENIDADGAN
YELNPLPRNVVHPEAPMAGQVQRAVDILRRAHRPVLLAGHGAARGGATAA
LIRFSEELGVPVANTFHGKGAMPDDHPNSMGTVGFMRRDYANFGFEHADV
IVAVGYELQEFDPVRINPHGDKQIIHLHRFPAEVDAHYSVSVGIIGDISA
SVNALTDALAGHRFDCAAAPGSALLAEEFTRGQQDSRFPMAPQRIVADIR
AALGRSDVVLVDTGATKMWMARLYPTYEPNTCLVSNGLSTMGFALPGALG
VKLARPDTKVLAVAGDGAFLMNSQEIETAVRERIPLVVLIWEDGGYGLIE
WKMDLELGEHHHVSFTNPDIVSYAESFGAKGYRITAADQLLPTLQAALDD
GGVSLIACPVDYSENLRLTDRLGQLDATL
169630550YP_001704199.1 MutT/NUDIX family protein [Mycobacterium abscessus ATCC 19977]MSTSETMPTIRVSAVVLRDDRGAVLTVRKRGSTRFMLPGGKPDRGENAAQ
TAVREVCEELSVHLEPSALRPLGVFRAAAANEPGFEVESTVFEHPSVTVS
QPAAEIEELRWQSLDEPYPTDLAPLLAEHVLPILSGNRPRP
169630549YP_001704198.1 MerR family transcriptional regulator [Mycobacterium abscessus ATCCMVPEDVLYPSGSPVPRLEGPRPPELPAPEKGVYGISVAAELSGAATQSLR
LWERHGLLAPSRTEGGTRRYSPEDLIRIRRITTLVAAGVNIAGIAFILEL
EDDNTALRAAVYDQQRRHSDTDR
169630548YP_001704197.1 heat shock protein [Mycobacterium abscessus ATCC 19977]MLMRTDPFRDLDRFTQQVLGTAARPALMPMDAWRDGNEFIVEFDLPGISG
ESLDLDIEHNVVTVRAERAPVDPGREMLASERARGVFSRQLVLGDNLDTE
KIAADYRNGVLRLRIPVAEKAKPRKIVVDRPADAVVIEGENDSARGKISA
169630547YP_001704196.1 hypothetical protein MAB_3466c [Mycobacterium abscessus ATCC 19977]MAIPEGRPREPMTSSQTERSPIEQPAIDELADVLSEAYGTDFGSSRRSS
169630546YP_001704195.1 putative sulfate transporter/antisigma-factor [Mycobacterium abscesMESDPRRGISFSLVPYASSTGRFTTQWHRDQVVAIAACGDLDATNAGCFV
EYALRHIDEKHALVLDLRKLEFLGTEGFLALKTVWSYAHQRAIDCTVLPS
AAVDRLLEIGDPECTVSTADSLREVLNRLALPPTSNSDNYESAMGPPRLA
G
169630545YP_001704194.1 hypothetical protein MAB_3464 [Mycobacterium abscessus ATCC 19977]MSKSTLGLSAAACTSVALLCAAPAVAGPKSPQTPSELGAEFQSQGYKVQY
ERIGNCALDSGSVVGTRIGPAVWADTTTQTKAGGGVGDGAGTRGGVTWSH
DIDHQIAYITVACKRPAK
169630544YP_001704193.1 O-methyltransferase family protein [Mycobacterium abscessus ATCC 19MTATLHEPKFAAIIDRLFRNAANDPIPTDRDTFHKKSVEERIELFENIYV
PVAPDAGRLLYSLVRAIKPRTIVEYGLSYGISTLHSAAAVRDNGFGRIIT
TEMNTAKIAASRATFAEAGVSDLITILEGDARETLKTIDSPIDFLLLDGW
PDLDLTILNIVEDKLAPGALVIADNVGFESSKPYLEYVRNPENGYVSVAS
PIGECMELSTSCKK
169630543YP_001704192.1 TetR family transcriptional regulator [Mycobacterium abscessus ATCCMNETVGPGEVDTPRRHFGNRHGRSEAAREAVLHAADDLLVARGYAGVTME
GIAKAAGVAKQTVYRWWSSKVDVLMDVFLEDAACQLDPPDLGGLEADLRH
HLSATAQFLAADDAGAVFRALIGQSQHDGQLADDFRGRYLREQQARDQIP
IARAVARGELPADVDVAHVAEQLVAPLYYRVIVTGETVDAAFVDRIVEDF
LRRRE
169630542YP_001704191.1 hypothetical protein MAB_3461c [Mycobacterium abscessus ATCC 19977]MTETDPHDFHANVMSEIRETGRASGFFAQFDMLILHTVGAKSGQPRQNPM
AYQPGGEGGEFYVFASNNGRDTSSAWYYNALAHPDRVEVEIGDDRFRVSV
RDVVGQERDRIYARQAGKFENFAEYERKTTRVIPVLGLTRVD
169630541YP_001704190.1 hypothetical protein MAB_3460c [Mycobacterium abscessus ATCC 19977]MVVGAVAAFVMAITGFGWAGYNTAVGQIITSHVLPGVLTPVGQDQNILLM
GLDSRLDQNGQPLPQDMYDALHAGDETSGGYNANVLIVVHIPGNGGPISA
VSIPRDDYVNLVGCPGSVCKGKVKQAYGFAYQQALDAQANGSADAAGAKD
LTAREQAAREAGRKAQIDTVSEFLGVQIDHFVEVTLAAFFQIAKTVQPIA
VCLNHDTIDEFSGANFHEGVQQIDASQAMAFVRQRRDENDGSFTDMDRTR
RQQAFLVSLLAAVRQGGAMSNPAAIRNILNVAHENVAIDSGLNIVDFAAR
ASELTKRPTSFYTLPISDFGADSNGSDVNIVDLPTIRQIVHDRFSSDPVP
EAPSAAAASAPPALSTPVVLNVVNATSRDGLAAAVEDAFTARGFTRGRAS
TAETQSTESSIMYGEDAQEGAQALADQLHLPMTESGAVAPGTVQLTVGSQ
FPVDNYIAHHSGGAKGGSSGEADPADKMTAVAATGTGVQAPAPTDLSQLT
ANGIPCVK
169630540YP_001704189.1 putative cytidine/deoxycytidylate deaminase [Mycobacterium abscessuMDDNDIQHLRRCVELATEALDAGDEPFGSLLTGPDGAVLAEDRNRVGAGD
PTRHPEFELARWSVRNLSPTDRALSTVYTSGEHCPMCSAAHAWVGLGRIV
YASSSAQLTQWLTELGAPPSPVASLSINEVAPGVQTDGPAPDLAEDVRAL
HVRFLGDA
169630539YP_001704188.1 LysR family transcriptional regulator [Mycobacterium abscessus ATCCMALPPGTPDLGVLDLLVSVAETGSLGAAARQHGISQPAASMRIRALERRL
RLVLLERGPTGSRLTDAGLAVVGYASPVLAAAHEFVTGVAALHSDQAPRL
VVAASRTIADHRIPLWLTALRARHADVAVSLEVGNTQQVCELVRAGGASL
GFIEGPHAPTGLGGEVLGADELVIVVGPGHKWAHRRKPVTLRELAITPLL
MREPGSGTRDTVWEVLSEVCQPATPAAELGSAAAIKAAAATGLAPAVLSR
LIAGPELSAGTLVEVKPADGTVFTRQFRAVWRPGAPPTGAARALVDIAAL
VD
169630538YP_001704187.1 hypothetical protein MAB_3457 [Mycobacterium abscessus ATCC 19977]MGRQIRHERASAQHLGAPMRLSTAYPAHMRKLRRGSDLRRSHPTATRTSS
VNPRALTYEAAGATSPCESIWSAAPAGLRRFEQTISIGHGADLWDAAAHA
VANWEVKQRSGFRVHPQKTVSEGAEFVISFGWGPLAVHEPVRIVAVVDTD
TRRGFAYGTLPGHPVSGEEAFIVHRDADGAVFLTLRSLTRPAPSGLWRRI
FPVLLLAQKAFRRRYLRSLLP
169630537YP_001704186.1 HxlR family transcriptional regulator [Mycobacterium abscessus ATCCMDFTTMRNCSISNALDVIGERWTLVALREIMLGNRRFETIVRNTGASRDI
LATRLRKLVDAGVLEKRRYEDRPPRYEYLLTQSGQALRPVLFALMEWGDK
FVTKGPPPSIWEHQCGSVLHIQPTCESCGEAVTFDDLTPRRLGRVR
169630536YP_001704185.1 putative acyl-CoA thiolase [Mycobacterium abscessus ATCC 19977]MRDAVIIDAVRTPVGKGKPGGSLSGVHPVDLHAHAIRELVERAGIDPALI
DDVISGAVGQVGEQSSNTARWAALAAGLPETVPAVTVDRQCGSSQQAIHF
AAQGVIAGAYDVVIASGIESMSRVPMGSQSLGKDFFGSEVARRYPEGLVP
QGISAELIAAKWNLSREQLDTFAAESHRRAAQAWSEGRFARDVVPIKAPD
VNGDLVEVSTDESVRPSTTVEVLAGLKPAFRNELWQQRFPGLDWKVTAGN
SSPINDGASAVLITSSETAHRLGLTPRARVHSVAVVGDDPLYMLTGIIPA
TAKVLDRAGLSLADIDAFEVNEAFASVVLAWQAETGADLSKVNVNGGATA
IGHPLGASGGRLMTTLVSVLEQGGGRYGLQTMCEAGGLANATILERL
169630535YP_001704184.1 hypothetical protein MAB_3454 [Mycobacterium abscessus ATCC 19977]MSTRRRISVVLMTSAVIGSSVAVDVAPVAYADPCAGPAAGLQPPTPVPDD
GIPGQAPPIGRRPAGANDKAPLPELGKLPLAILKQVLPQQSAKKKPGWAQ
ELARPALPNPPEPGSPNNLQDQQAAAVAPAPPAPAVGPAADAAVSPTTSV
VGWVTGVDTGANTLQKFSISGTDLGIMWDNGDNAGRQVLMAFGDTYGYCG
MKSQQWRYNTLLRTQDKSLSRGLAVAEGSTTNPYAGSPQSRPGYSKQIIP
PIKWAAQERGIIPTAAISVGRTQYMNYMSIKSWDSAGEWTTNYSATAVSN
DNGQNWKTFPQSIRPASPDAISQVPFTPGNENFQQAAYVKGNDGYIYIFG
TPSGRSGSGFVSRALPGNLPDAAKHEFWNTDRGTWVPGDPNAATPILSGP
VGEMSAQYNTYLKKYLVMYGDKSGDVLLSTSPAPQGPWSPPQIIVTESQM
PGGPYAPYLHPWTTGKELYFNLSLWSAYNVMLMRTTLP
169630534YP_001704183.1 carboxylesterase LipT [Mycobacterium abscessus ATCC 19977]MASGSKTPTVRVTTPNGIVEGFVRGGVRRFRSIPYARPPIGLLRLRAPQP
ALPWEGVRDCTEFGAAAPQRRRYRVLGPGRVQRASEDCLTVNVVTPDRPS
NEPLPVMFFIYGGGYLLGSSATPLYDGAALARRGCVYVSVNYRVGALGAL
DLSSLSDRDHTIDGNLFLRDVVLALQWVHDNIGTFGGDPGNVTIFGESAG
AHCVETLMATPAAAGLFHRAICQSTASGMAVPADSAAMYAQKFAQILGAT
TQSAAETVLRSSPAELGAALNMLIADIVTNMPGGSFAIGPCIDGHYLPRH
PIEAMEHGEAHRVPLIVGHNADEAKLFTRVLKMMPLSESALEGMLARGGP
GHRDRIVAAYPGYPERSARVKLAGDMNFSTAAWQMAEAHHRYAPVYFYRY
DYAPGALRIAGMGATHATELLAVFDSYRGAMGTVMAGALGRRDAVRVSND
VQRRWLAFARSGVPGDGWPTYGPPDRAVMVFDHATRVELDPEAARRAAWE
GFSLTL
169630533YP_001704182.1 carboxylesterase LipT [Mycobacterium abscessus ATCC 19977]MAKKPIRINTVNGTVEGFTRGGVHRFRGIPYAEPPVGPLRLRAPRPALPW
TGVRTCRAWGAASIQQHRYAIILPGKPQKLSEDCLTLNVVAPEGPVSGPL
PVMFFIHGGGYFLGSSATPLYDGASLARRGCVYVSVNYRLGGLGCVDLSS
LSDDKHTIDSNLYLRDLVLALQWVHDNIGAFGGDPNNVTIFGESAGSHAV
NTLLAVPSAAGLFHRAICQSTASGLVVSAEDAAVNARQFAKYLGASDSNA
AATVLAAKPKDLVKALFRLIGSAKHVPGLSLRIGPSIDGDVLPQDPIEAM
ERGESHRVPLIIGYNAEEATLFTKVLKILPITPEALEHSLSKGGPDFVRR
IIEGYDGYPSQQALLQLAGDLAFGSAAWRVAEAHGRYAPTYFYRYDYTTR
ALRRYGLGPTHAIELLAVFGTYRTVAGPFLAGRADRAVARSVSDEMQRRW
LAFAHTGVPGDGWPAHTVPDRQVLIIDNPSRLEADPDADRRPLWQDVTSI
V
169630532YP_001704181.1 hypothetical protein MAB_3451c [Mycobacterium abscessus ATCC 19977]MIIVTSNDIPGYKIAAVFGEVFGLTVRSRHIGSNLAASFKSIAGGELKGI
TQLLHESRREALARLAAEAEARGANAVVAFRFETTEYANTGVEVCAYGTA
VGIQPIQ
169630531YP_001704180.1 phosphoglucomutase [Mycobacterium abscessus ATCC 19977]MSNARAGQPAQPEDLIDIAHVVTAYYAIEPDPANVAQQVAFGTSGHRGSS
LDAAFNEAHIVATTAAIVEYRNAQGISGPLFIGRDTHALSEPAWTSALEV
LVANNVVVAIDSRDRYTPTPAVSHAILRHNRGNPAGRADGIVVTPSHNPP
RDGGFKYNPPHGGPADTDATGAIAARANEILRDGWRSVKRVPLAQALKSV
RRYDFQQAYVDDLINVVDLDAIKGAGIRIGADPLGGASVDYWAAIADRWS
LELTVVNPLVDATWRFMTLDHDGKIRMDCSSPDAMASLVASRDKYQIATG
NDADSDRHGIVTPDAGLMNPNHYLAVAIDYLFSHRGGWAAQTAVGKTLVS
SSIIDRVVAGLGRTLIEVPVGFKWFVNGLIDGTIGFGGEESAGASFLRRD
GSVWTTDKDGIIAALLASEILAVTGVTPSQRYVQLTEKYGAPTYARVDAP
ASREQKAVLSKLAPEQVSVTELAGEPIVAKLTNAPGNGAPIGGLKVVTEN
AWFAARPSGTEDVYKIYAESFLGAEHLNQVQDAAREVVSAVIG
169630530YP_001704179.1 putative transporter [Mycobacterium abscessus ATCC 19977]MSSCREGNADNATVKPRLPWEIWVLVVASLVIALGFGVVAPALPQYARSF
GVSVTAATAVVSSFAAFRLVFAPVAGALVQRLGERWVYMSGLLIVAASTG
ICAFVHSYWQLLVFRSVGGVGSTMFTVSAAALLVRIAPEEIRGRAQGLYG
SSFLLGMVAGPALGSAVVGLSLSAPFIIYAAALVIVVMLVYFGLRRSTLL
DVADEHHGTPVRLTSALRHRTFLAALMSNFSAGWAIFGIRGALLPLLVVE
ALHQRPGAAGLVFAAFAAGDVSTAFLAGSWSDDIGRKPLVVAGLVVCGST
VVAMGFVSSLPVLVVLSLIGGIGAGLYASPQQAAVADVVGSRGRAGTALA
TFQMTSDIGLVVGPVVAGAIAEHTSYGWAFVVGGAMPLIAAVAWVFAPET
LGRLASPQVRSMQEVAEDVGGPER
169630529YP_001704178.1 putative acetyltransferase [Mycobacterium abscessus ATCC 19977]MLGRVFDPRNNALNAWRLVLATSVILWHTWPLTGHEIPPRPITQLLSQVG
VDGFFAVSGFLITSSWMRNPQPRSYFTSRALRILPGLWVCVFITAFVIAP
LGVLIQRGSVSELMKSGAPAAYVLNNGLMNVLFYPGIAGTPKNIPWPGVW
NGSLWTLAFETGCYIVVALLGISSLLKHRWTIPTAFVLTLTATAVFGFPA
FAMSTIPQMIARFAVMFAAGALIYQYQDKIPAKWSLVALSLGLLLLSGLL
PNYRVLGAIPLAYLVIASGALLKRLNLRNDLSYGVYIYAFPIQQLLVIMG
LATLRVFPFFIVATLVTLPLAAMSWFVVEKRALALKKRLRVKAGAG
169630528YP_001704177.1 putative lipase/esterase [Mycobacterium abscessus ATCC 19977]MNLIQEGEAMPQHRRLTYGDHPSQYVDILEPDEPAAALVHVIHGGFWREA
LSAELTAPIARDLCTDGFLVANIEYRRVGGGGGWPETFEDVKAAIAAVRQ
AEPDLVRSLAVGHSAGGHLSLLALAAGLADFAVALAPVSDVDRALRENLG
GGAAAEFLGVAGSSPREVRTASPIGNLGHRRQHVLIHGLRDVNVPVEHSQ
HYVSAARASGTPVDYFEFANLDHFDLIDPSSSAWRVAKQWIRYQLI
169630527YP_001704176.1 WhiB family transcriptional regulator [Mycobacterium abscessus ATCCMEDARIAGTTALVQDLAWQLRGACRNANHDLFYANDDERPIERRLREQHA
RDVCRSCAVATRCLAYALEIEEPHGMWGGMSEAERHRIRLRVTARSSIGQ
169630526YP_001704175.1 hypothetical protein MAB_3445c [Mycobacterium abscessus ATCC 19977]MPWLAFHSNYSLPVSVAVMQVDSDACGGEYGGWATHGWWNLNPGESKTAI
WTKYDAAYYYAKASNGAWWGDVNGPRVYVNPYYRFDSCLLIGTSTWDVVK
MRRVGVGSFLFNTHTVNLNP
169630525YP_001704174.1 hypothetical protein MAB_3444c [Mycobacterium abscessus ATCC 19977]MNPTTRRAAARPRYILFAVLVLACVLCAPPAASADTVQITPANERRLQEL
VAERNRLAAQNPAQLSAAISALFLHVPYGANTLVGSASVPEQLVVELTRV
DCFTYADYVEALKRSSDRAGFLAQLTQIRYRGGDVSFTQRRHFFTDWAAD
APVNATDVTASLGAPTEQVTKMLNLKDAGDSYLPGLPPRSRTVFYLPSAL
VSNGVIANLRDGDYLGAYATASGLDVTHVGIFLHTPSGPVLRNASSLRAN
NQVVDTPLREYLDTVPGIVVLRPIR
169630524YP_001704173.1 hypothetical protein MAB_3443 [Mycobacterium abscessus ATCC 19977]MVLIPNIESQSHFFTPAALAVNEQPPSSIADQRFIFQTNGVAIVNMPGQT
TVDWSRDQALISPNMGDAFKAITTRHNIPIPTGTFPWFQVDSVIPFATLS
SIFDRHQAIDAGFAVDRWSFRTRTGTGPQPGQTFRSLFDGLLVDLAVRDN
DAVIHRISYHITVQGRVRFVTGLT
169630523YP_001704172.1 hypothetical protein MAB_3442 [Mycobacterium abscessus ATCC 19977]MIEVLPDAPEGVVGFRVSGRLTGNELREFTSTIKEALNGDELRIVEVIAS
DYEGFGPGGLAEDLKLGLGMLFQHHSAFKKIAVVTDKEWVAHTLHALAWM
VPGEISLFGLDELDRAKVWAAS
169630522YP_001704171.1 NAD-dependent deacetylase [Mycobacterium abscessus ATCC 19977]MTEVPDELIAAASKARSVTVLTGAGMSAESGLPTFRDAQTGLWSKYDPMT
LATPESWQEDPGLVWAWYQNRRIQLLAVQPNDGHRALAQWGSHRDIRIVT
QNVDDLHERAGSSNVTHVHGSLLKSHCDTCRSDFEATVSAPEAERVAPPE
CGCGGKVRPSIVWFGEMLPEVEFGHAVAHSQNCDLMLLIGTSGIVYPAAG
LPQLALSRGATVVEINPQETDLSDRADLVWRSTAATALPALLQALAPF
169630521YP_001704170.1 putative short-chain dehydrogenase/reductase [Mycobacterium abscessMFGTDVRFDGRVAIVTGAGGGLGREYALLLASRGAKVVVNDIGSSDELLG
GGSSDAPANSVVAEIQALGGDAIADTNTVATGAGGRAIVGTALSAWGRVD
IVINNAGIVGPIKTFAELTDEDVDTVFGVQLLGPFNVLRPAWKAMVDQGY
GRILNISSGSIFGQGEACTYPTAKAGMVGMTTNLGLAGPAYGIKVNALLP
VGFTRMVENMPEPALSWLRDTFPAALVAPVAAYLVSEDVPCSGLSFSAGG
GRFARVFLGEARGVTSSQLTIEEVRDRFEAAMEIEGAATMANVGDELRLY
AAALTGR
169630520YP_001704169.1 putative pyrimidine dimer DNA glycosylase [Mycobacterium abscessus MRLWSLHPGNLDARGLVACWRETLLAQKVLQGRTRGYRNHPQLERFKSLD
RPLAGIGAYLVGLVDEADRRGYRFNRALIDIPATVSEPLIDVHRGQLAYE
RWLLDTKLAQRDPDLLATSNPRRLRPHPIFRPVRGNIEDWEKVLPTYQA
169630519YP_001704168.1 putative short-chain dehydrogenase/reductase [Mycobacterium abscessMSTYPDRPVAGSRIVITGATNGIGKEIARALVRRGALLTLLARDPAKASA
TVRELAAENGAITAPEYIQADLADLDSVRAAAHEIATTHPRIDTLVNNAG
IHSLSGRTSADGFDLMTATNHLGPFLLTNLLLEPIVAAERARIVITASEA
HRSWPRIDLERFAEARRYNAIRSEIRYGQSKLMNILFTQELSRRLDGTGV
TANCFCPGMVSTGLVRDSRVLTAVAGLASRTPFVRRPDQGARMGLRLVLD
EDLATTTGQFFTSTPGLGQLPAVRIRSDQKAQEELWRRSGELVSL
169630518YP_001704167.1 TetR family transcriptional regulator [Mycobacterium abscessus ATCCMSKRLSRTESQELTRAKLIESATRLYLENGYVATSTDQVAEAAGFSRGAL
YSNFRSKEDLALAVLDAHTEEQFQEIAAVAADLPPERFTRFETWLTKSMG
DRRWALFKSEVALSARANPELRQQLAARDQLARQALSVLLGHVEAESGNP
LPAAPETLARAILALAKGIAIEGLVDDEVSPDWIIDLVKKGLPQ
169630517YP_001704166.1 hypothetical protein MAB_3436 [Mycobacterium abscessus ATCC 19977]MGGGSMRTVATICVVAGLLAGCSTPAAEEGPSTPPGTTVPTVVPGVMPNL
AGLQWSDVKPLLRKLGRVNVTTKEVPVNDAEQKSRIVSQDPAAGAHLEPG
AKIVLTFGT
169630516YP_001704165.1 long-chain-fatty-acid--CoA ligase [Mycobacterium abscessus ATCC 199MYPGAHAAQFPDKPAVVMAGSGATLTYGELDRQSRRLARHWYDSGLRKGD
HVALLSDNVPEVFVVYWAALRSGLYITSVNHHLAPAEVSYIVNDSGSSAL
VVAAGVREQAEAILDDTPAVTLRLAFGGDVRGYDSYEDALDGASDEPLPA
QPAGSDMLYSSGTTGRPKGIKVPLTDRQVDEPNPFAMLFAHLYGFNAETV
YLSPAPIYHAAPLRFCGFVQSMGGTAVVMERFEAEEALAAIEKYRITHSQ
WVPTMFVRMLKLPKEIRDRYDVSSLKVAVHAAAPCPVEVKQSMIDWWGPI
LYEYYSSTEGNGVTFIDCATWLKRPGSVGSAALGVLHICDETGAELPAGE
AGLVYFEREELPFSYHNDDEKTRSACHPAHDTWTTTGDIGYVDEDGFLYL
TDRKAFMIISGGVNIYPQEIENALALHPAVLDVAVIGVPDAEMGESVKAV
VQPADSSAAPRELAAELTDFLRERIARYKVPRSFDFTDTLPRTPTGKLAK
GLLRQKYWEGAQ
169630515YP_001704164.1 hypothetical protein MAB_3434c [Mycobacterium abscessus ATCC 19977]MTDEHSGAAASADARPSTSLIARISIDWWATIIAGVIALLAVANVLPKIP
W
169630514YP_001704163.1 hypothetical protein MAB_3433c [Mycobacterium abscessus ATCC 19977]MTSKAEAHTADEAFENPEESFTSPRPLDYVPGILLLIGVGLLGKYAQIWW
KDLAKAQHWTVPDIEYVLWAIVIGLLITNTVGLHRIFRPGVQTYEFWLKI
GIVALGARFVLGDVLKLGGTSLVQILVDMTVAGAIILLAAKWFGLSGKLG
SLLAIGTSICGVSAIIAAKGAIRARNSDVSYAIASILALGAVALFTLPAI
GHGLGLSDYEFGLWAGLAVDNTAETVATGRLYSEHAGDIATVVKSTRNAL
IGFVVLGFALYWAARGEAETLAPGIKAKAAFVWDKFPKFVLGFLAVSTIV
TLGWLTKGQVNNLVNVSKWAFLLTFAGVGLNTNFREIARSGWPPLVVAVI
GLVVVAAVSLGLVLLTSRVFGWGAHV
169630513YP_001704162.1 cytosine permease [Mycobacterium abscessus ATCC 19977]MTIKAAATVDIDVISADAPESPASEYENEPVPPHSRRSLLSVAAVWLGFP
MILTCAVFGGLIVYSLGFWRGMLAIALGNAVLTAYVGALSYLAGKTGKNF
GLTAIETFGRGGYRVVCGFLATVVIGWFAFQTGLTGSVLATCAGWDARWT
ALAAGVGYVAVTLVGIRALSAIGLIAAPLYLLLGITAIVLALRDSTISDA
VEYRGGAGVAAMSMGAAVTLVVACFIDSGTMTADFTRWSRNGRQGFWASV
AAFPIGNCAAMVVGGVIVALGAARSPATDGGNFLGTLIDTGGWLVPVSIV
FVFVNLGSVCTHCLYNGAVGWSQLTGHTMRLLAVLLGAAGVLLAVLGVWS
HFEQWLTLLGVVVPPIGTVLILDQLVLPRFGIAVRDAAIRWESFGAWAAG
AASALAAHLWAPQLSDALTGIATAALVYLAAARGARRGVPA
169630512YP_001704161.1 isochorismatase hydrolase [Mycobacterium abscessus ATCC 19977]MTGQVDAQPYPWPFDGPVDPGRTAVLCIDWQVDFCGRGGYVDTMGYDLSL
TRAGLEPTARVLAAARAVGMTIIHTREGHRPDLSDLPANKRWRSARIGAE
IGVAGPCGRILVKGEPGWEIVPEVAPLPGEPIIDKPGKGAFYATDLDLVL
RTRGIRYIVLTGITTDVCVHTTMREANDRGFECLILSDCTGATDAGNHAA
ALKMVTMQGGVFGAVADSNQLLGAL
169630511YP_001704160.1 hypothetical protein MAB_3430c [Mycobacterium abscessus ATCC 19977]MNCQEVREQLSAWVDGEQASVARKRLDEHVLSCASCREWLGRARGLDRQF
AYARSAPTRDLTGQILAAAAVEPLTPMARYAHWARHNINRCALVLIGLLQ
LGVAGMQVAGIDFGMVSAHHHGAMTGAHLMNESTAWVVALGVAMVIAGVR
PAAAAGMATVLGAFALVLTGYVINDAVNDQVTLARIISHLPVLLGLIFAL
LVLRDYRAGRTPPNQHRAVFLDEVAAGERHLRSADNSAA
169630510YP_001704159.1 hypothetical protein MAB_3429 [Mycobacterium abscessus ATCC 19977]MTYTEDRPDARESQPDTVWGRFAPIVLRLHFYAGLLVGPFLLIAALTGLA
YALVGQVDAAVYRHELKVDSVGPQQLPLSQQVSVATAAQPSGTVTSIRPP
ANPDDTTRVVLAVPDVPEDYSRTVFVDPYSGEIRGTLTTYGEWLPVRAWF
DELHRNLHLGAIGRNYSELAASWLWVVALGGLFLWIGYRRRTGRLRRIAV
PDRDATPRRRRLTWHGAVGVWIVVGLLALSVTGLTWSRYAGTNIGDLTQA
IRPGLSTELDPASATPMTGHEHHGAAATSRGEPLAGINTVLQTVRDAGLR
GPLWMTPPPAPNTAWLVSERKRSIPTQLDAITVNPSSGEITGRSNFSEWS
LLQKSTEWAIDGHMGVLFGIPNQILVALVVIGLITVITRGYLMWWRRRPT
KSGRWPVPPRRGGLLALKPLELAILAVVVVGVGWFMPLLGISLAAFLAID
LAGGLVASRRGTAASGG
169630509YP_001704158.1 RNA polymerase sigma-C factor [Mycobacterium abscessus ATCC 19977]MATGTDDEQLLELALSAGRGDQSALESLVKATQGDVWRFVAYLADSGVAD
DLTQETYLRALGALPRFAGRSTVRTWLLSIARRVVADHIRHLKSRPRIAH
GADLEEASLRRPTHRFEELVELKSLLAALDDDRREALVLTQVVGLSYAET
ADVCGCAIGTIRSRVARARDELIGWAEPENLTG
169630508YP_001704157.1 hypothetical protein MAB_3427 [Mycobacterium abscessus ATCC 19977]MPQKVVIAGGHGQIAAHLIRLLAARGDTAVALIRNPDHAADVEAWGGLPL
VLDLESTDADDVAGALAGADAAVFAAGAGPGSGPARKDTVDRAAAVLLAT
AAEQAQVHRFIQISAFGAGEPAPTEGDESWIAYVIAKTAAEEDLRTRDRL
DWTILRPGLLTDTAPTGSVTLSASKIERGSVPRADVAAVVAELLGAPNTV
HEILFLTEGTAPIASAVAGL
169630507YP_001704156.1 putative short chain dehydrogenase/reductase [Mycobacterium abscessMVDIPHTIDPVQPYRPQEQPLRGKVAVITGASANMGAALARTLAQDGAQV
VVHYRSDSKAQQAERVVRQIQESGSDAVSFQADLSVPENCTKLADAAFEA
FGRWDILINTAGMIVRKPLADITEDEYDGVFNANAKTVFFMMREAARRMA
DNGRILSFVTTMVGALAPTYSAYAGSKAPVEHFTKALAKEVGGRGITANC
IAPGPLQTSFFYPAESDENIAWLESMSINGQIGRGDDILPVARLLVLPES
GWTTAQTIFVNGGIISTIN
169630506YP_001704155.1 putative cobalamin synthesis protein [Mycobacterium abscessus ATCC MIPVTIVSGFLGAGKTTLLNNLLRNTLGVRIGVVVNDFGAINIDAMLVAG
QVDSTMTMSNGCLCCTADDDELGGMLSALAGRDIDAIVIEASGLAEPLPL
VRMVLAATAEDRRIGYGGLVTVVDTAQYEDVAVRHPEIAQHLDLADLVVL
NKIDLADAGDRTHLRAVVKERNPRASIVETTGADVDPRLLFDKKERPEPV
GQLSLEDLIREDHSHEHHAHHHYETVEFATEQPLHPRRLIEFLDSQPAGV
YRIKGLVRLGDRTLAVHTVGDHISFDKVGRASDFSSGASLVLIGTHLDGD
TITERLRTLIDDPPDPDRERSMLVLGKYLR
169630505YP_001704154.1 hypothetical protein MAB_3424c [Mycobacterium abscessus ATCC 19977]MHSDTTISPQIDPFTARFGVPLPRGLREEAGDMSWASFCQTYERSGGALR
LGQWSQTGGTYQATLTIGECIESATVSACGPMAALTAMLSEHGIPMETLS
FHQLRDGDQTCTFIRGTNGLGTAWAMGRAPDATTSSLKAVTACANRLAR
169630504YP_001704153.1 cytochrome P450 [Mycobacterium abscessus ATCC 19977]MATISSTDYLIDQAKRRLPTMNTLPGMGYIENYLNNREWPMTELAAPPPG
SGLKPVMGDQGLPMLGHMVEMFRGGIDWVLNMYQERGPVSWTQTPIGKIV
AALGPDATQAVFSNANKDFSQQGWVPVIGPFFNRGLMLLDFQEHREHRLI
MQQAFLRSRLAGYVEQIDAVASEIVAQWPTNDNRFLFYPAIKELTLDVAS
VVFMGNEPHAQHERLEKVNKAFVATTRAGGAIFRFGLPPFKWWQGLQGRK
LLEEYFAERVGIARQKTEGADMLTALCHAETDEGDAFTDTDIVNHMIFLM
MAAHDTTTSTTTTMAYYLAANPEWQERVRDESDRLGDGPLDIDSLEKLES
LDLVMNEALRLVTPLPFNIRSTVRDTDLLGFHIPAGTMINIWPGMNHRLP
ELWTEPDKFDPDRFSEPRNEHKRHRYAFSPFGGGAHKCIGMVFGQLEIKA
VMHRLLRRYRFELAHPHYQPKWDYAGMPLPIDGMPIILRPLH
169630503YP_001704152.1 TetR family transcriptional regulator [Mycobacterium abscessus ATCCMVSPARSGTQTRGDRQRDAIMTAVAELIAENHSFADLSVSAISERAGVGR
SGFYFYFDSKYSVLAQMVGDAFAELDELTHYFAPRGEEETPEQFAHRMVG
SAAASFAHNDPLMKACQEARITDPTIAGLLDDLTDVVIEKILKIAETEVK
ERGAQPISDDLPALVRSLVALTASTVSGDSSFVGRNTDPARAIATVETLW
RVSLLGR
169630502YP_001704151.1 hypothetical protein MAB_3421 [Mycobacterium abscessus ATCC 19977]MATVACSGNSPSRTEAPDSGRYPATAAPTYTQTPAAPLRDSLQQAPQYGP
PTESKRDIVKTGSMTITVPNPSEAADKAAGLTEAANGRVESRSEDAGSRA
DRAQTSIVLRIPAAKLDGVLRDLKELGKVKSADTKSDDVTSQRVDLDARI
AALQTSVDRLLGIMRDSKDTDALIKAESELSKRQAELDSLRAQRNQLGEQ
VAYSSITVTFRAEEVGLPPTPPKYQGFFGEIERGWDGLVAAANSVLLLFG
LLLPWLGALAVLGGLGYGIRHAVLRRRSGPTQSPPQKAHTP
169630501YP_001704150.1 short chain dehydrogenase [Mycobacterium abscessus ATCC 19977]MAYEFTGKRCFVTGAASGIGRATALRLGREGAELFLTDRAADGLESVVEE
IKAAGGKVSAYRALDISDHEAVAAFASDILATHPSMDVLLNIAGISVWGS
VDRLSHQQWRSVVDINLMGPIHVIESFVPAMIKARKGGQIVNVSSAAGIV
ALPWHAAYSASKYGLRGVSEVLRFDLARYKIGVTVVVPGAVNTPLVRTVD
IAGVDRENENVARWIGRFVGHAVSPEKVADRILYGIRHNRYLVYTSVDIR
ALYLFKRTLWWPYSVAMRVANYAFTNALRPGFQKTGSASSPRDS
169630500YP_001704149.1 NAD synthetase [Mycobacterium abscessus ATCC 19977]MSSLREEIRSALDVSPTIDPAAEVSRRVGFLKDYLRASSTKGFVLGISGG
QDSALAGRLCQLAAQESRLEGVAAEFIAVRLPYGVQADEEDAQVALRFID
PDRTIVINIKETSDAATKAVAEALGETPTDFVRGNIKARERMVVQYAAAG
QHRLLVVGTDHAAEAVTGFFTKFGDGGVDVTPLTGLTKRQGAQILSHLGA
PDSISHKVPTADLEDDRPALPDEVALGVTYAQIDDYLEGKAVTVEAADRI
ERWYLQTRHKRAQPVTPFDGWWR
169630499YP_001704148.1 TetR family transcriptional regulator [Mycobacterium abscessus ATCCMVRFIPSGYYQSVMPGQEIPLLSVDLAQNPVRERAIATRNRALLLDAARQ
LLDEVGPDGMSMDAVAHAAGVGKGTLFRRFGSRTGLLLALLDHEEHIEQQ
AFMFGPPPLGPDAPPLTRLIAFGRARLAFLERHLDLARATTADTDAWHNA
PPTLLVRAHIRALLAQLECTGDLDAQTHALMSIIDPGYVYFATNSNGQSV
AQLGDAWEDLVHKLCAR
169630498YP_001704147.1 NADPH-dependent FMN reductase [Mycobacterium abscessus ATCC 19977]MAEKVAEKNVLAIVGSLRKASVNRQLAEAAAEHAPAGVSVTIYEGLADLP
HYNEDIDGEGAPAAAEALRAAVADADAVLLVSPENNGTISSSLKNAIDWL
SRPFGSSVFKGKPTVVIGTSAGRYGGIWAIDETRKAAGIATANVLEDVKL
AVPSSAFDGKHPREHAETVAELTKALDALTTA
169630497YP_001704146.1 membrane transporter [Mycobacterium abscessus ATCC 19977]MTSSPAEPRQMADGQVSPRRVFMASAVGSAIEFYDFYIYGTAAALVFPAV
FFPNLSHSLALFASIATFSTAFLARPIGAALFGHYGDRFSRKGTLVVTLI
TMGLATMAVGLVPGAATIGAAAPTAIVILRLVQGLAVGGEWSGAALLSAE
YSPSQNRGRAATAVPIGTSTGLLLSSLVFLIVSLTIGEDSPAFLSWGWRV
PFIASGLLVAVGLYIRLQIAETPQFVEAKAHHQLVKSPLRHVITESPRTL
VLTSGTMLIIFTLSFMTNTYFPGFARSELHFSRAAILAAGALGAVVLMVS
ATAGGILSDRLGRRTVILSSMTLTLPWTLLVTPLLTSGPFWAYLAAMALT
YVLFGLAFGPMASFLPESYPVGTRYSGTGVAFNVAGVFGGAIPPLIAGPL
QNTLGSWAVGLMLLVICAISVASISGMRETWAGSAR
169630496YP_001704145.1 glutaredoxin-like protein NrdH [Mycobacterium abscessus ATCC 19977]MSITVYTKPACVQCNATYKALDKQGIEYNVVDITEVPEARDYVMALGYLQ
APVVVAGDDHWSGFRPDRIKALAGAVAVSA
169630495YP_001704144.1 protein NrdI [Mycobacterium abscessus ATCC 19977]MAHLVYFSSVSENTHRFVQKLARASEARGEGPCPAIRIPLRGDIEVDTPY
VLIVPTYGGGHPVPGKAGGYVPKQVVKFLNNENNRSLIRGVIAAGNTNFG
AEYCYAGKVISAKCDVPYLYRFELMGTAEDVEQVLDGLDEFWKDTPWRQP
RQLQNQ
169630494YP_001704143.1 ribonucleotide-diphosphate reductase subunit alpha [Mycobacterium aMTAAHGSAHGELDYHALNAMLNLYDAEGKIQFDKDAAAARQYFLQHVNQN
TVFFHNQDEKLDYLIEKEYYEREVLDQYSRNFVKSLLDRAYAKKFRFPTF
LGAFKYYTSYTLKTFDGKRYLERFEDRVVMVALTLAAGDLQLAEKLVDEI
IDGRFQPATPTFLNSGKKQRGEPVSCFLLRIEDNMESIGRSINSALQLSK
RGGGVALLLTNIREHGAPIKNIENQSSGVIPIMKLLEDSFSYANQLGARQ
GAGAVYLHAHHPDIYRFLDTKRENADEKIRIKTLSLGVVIPDITFELAKK
NEDMYLFSPYDVERTYGVPFADINVTEKYYEMVDNGQIRKTKIKAREFFQ
TLAELQFESGYPYIMYEDTVNRANPIEGKITHSNLCSEILQVSTPSLFND
DLSYAKVGKDISCNLGSLNIAKTMDSPDFAQTIEVAIRALTAVSDQTHIW
SVPSIEQGNNDSHAIGLGQMNLHGYLARERIFYGSEEGVDFTNIYFYTVL
YHALRASNRIAIERGTKFGGFDRSKYASGEFFDKYTDQVWEPKTEKVRQL
FADAGIRIPTQDDWLRLKESVQQHGIYNQNLQAVPPTGSISYINHSTSSI
HPVASKIEIRKEGKIGRAYYPAPYLTNDNLEYYQDAYEIGYEKIIDTYAA
ATQHVDQGLSLTLFFKDTASTRDVNKAQIYAWRKGIKTLYYIRLRQMALE
GTEVEGCVSCML
169630493YP_001704142.1 hypothetical protein MAB_3412 [Mycobacterium abscessus ATCC 19977]MTTTDDRSDLSAYWRLKFDFYDRYGTRFTPDAVAAAQARPLATKMRSVIN
LPALFFGPIYFVAKGMWRKAITLTLFNVALGVVLYLAFPPLGFSGLTSNG
ALYMILAGPAYYRHRVVGSRSWNPLDGIGWRFNHEMREAGKQRRK
169630492YP_001704141.1 hypothetical protein MAB_3411 [Mycobacterium abscessus ATCC 19977]MEHRIFRTPVASVYPHYLSKVERKGRTQAELDEVIRWLTGFDETTLRRRL
TDGATFAEFFSDASLNPDASLITGVVCGVKVQEVDDPLMRKIRYLDKLVD
ELARGKPLEKVLRGSQHQS
169630491YP_001704140.1 hypothetical protein MAB_3410 [Mycobacterium abscessus ATCC 19977]MSRPNAQSMKPATAAKKLDVYLQATPAEFQENAITRAELAALQEDPPQWL
KDLRKNGPHPKNLVAAKLGVSISGLSRGGVEEALTTEQINQLLEEKPEWL
IAERESYQNVLREERRLKALHADKARKD
169630490YP_001704139.1 LysR family transcriptional regulator [Mycobacterium abscessus ATCCMTSPSLTLGYVPGGTPAKWARIWTQRHPDVSLQLRAVTAAEAADVVRDGA
VDIALLRPPAETSGLALIPLYEETTVAVIPTDHLLSAVDVITAADLDGEP
TLLPLDDVLAWADAPGIPVGHRPETTADAIELVAAGLGALIVPQSLARLH
HRKDLTYRPIADAPTCPVALAFPDGQQPPLVEEFIGIVRGRKPDSSRGKA
GSAPKRTAREKTLAKQAARAAAGKVARDPGRPKRGRR
169630489YP_001704138.1 hypothetical protein MAB_3408c [Mycobacterium abscessus ATCC 19977]MTPDEWLEALRKGIAAVAATPPEYLTQDAPSCPGWTARDLVAHLGGVHRW
AVGVIVGQKVPYTDLDPEAPAGEDVLEWYTERADKLIATLASSDLDAPTK
SPFGERPVRFWFRRQAQEVAVHRWDIGHAYRGWDVDPLDAALATDGIGEW
SEVFTPRRIGRDGGTPEELRGVRILLKADDAAGSWLLRADADSIGIVDDD
GAPDATITASTSDLLLALWHRVPLSRLAVDGDAAHVERVLDLVRI
169630488YP_001704137.1 hypothetical protein MAB_3407 [Mycobacterium abscessus ATCC 19977]MWSIRRREMVLATGLSTVAGFLDAIGFVHLGGYFLSFMSGNTTRMAASTA
TLNWESAYKAAGLIGMFFIGVMIGAIASRVSGEHERIAVLAVASTTVAAA
AITQESGAGVAALLVTSLAMGAMNSVFQRSGEVQVGLTYITGTVVKAGQR
LVDAFFGGPRWVWLRYITLWAGLTVGAVLGAATYHRIGLDALWVGLVLLV
VSTVSTWVARRVSSPVSNSD
169630487YP_001704136.1 geranylgeranyl reductase [Mycobacterium abscessus ATCC 19977]MSEKHYDIAVVGGGPAGSSAAWQAARTGARVVLVDKAEFPRDKPCGDGLT
ARAVSYLQKMGLAQEVAQFHRVDGVRVDSGSIWELTFPKRPGMPDHGHVV
RRPELDTLLLKHAESAGVEVRQSTEAVGPVGDGDLVKGVEVKTANGSRET
ISADAVIVADGAYSPFKRAMNIDSEYKGYSAIAIRAEMTANREDSNMLDI
DLRIHHKQDALPGYGWVFPLGGGRINIGIGYVNSYRRWQDVNAAQVLDTY
MNKLPKEWELPNLAELRKNKGVRAWRLPMGFTAWPPWRPGVLFAGDSLGA
GKPASGAGISKALESGLAAGECAVAALQNAGPQDFINYEQRMNEAWGKEY
KRGRLMHRAIGNPWLCAQGIKLIDNDLFRDRMLKVLYKRAQGPGHKTSH
169630486YP_001704135.1 short chain dehydrogenase [Mycobacterium abscessus ATCC 19977]MDKITGKNIAITGAARGIGYATATALLRRGARVVIGDRDVEALGSAVEGL
KEEGNVDAHPLDVTDPASFKRFLEAASAGGPIDVLVNNAGVMPIGPFLST
SDRAIRSMLEVNLYGVINGCQLALPEMVARRRGQVVNIASVAGLMAVPGM
AVYNASKFGVVGLSRALSDEFAPQGVQVSAVLPTFTNTELIAGTDSTGAQ
KPVEPEDIAAAVVRIIEKPRVQVTVPKPLGAVTTIVNSLPTGVRRFMSKK
TGTDRVFLDFDTSARTAYENRAGSSLGVTKPDGE
169630485YP_001704134.1 ribonucleotide-diphosphate reductase subunit beta [Mycobacterium abMSEKLKLVSRVSAINWNRVPDEKDAEVWDRLTGNFWLPEKVPVSNDIQSW
NTLTDHEKQLTMRVFTGLTLLDTIQGTVGAVSLIPDAITPHEEAVYTNIA
FMESVHAKSYSSIFSTLCSTREIDDAFRWSEENPNLQRKAEIVMEYYRGD
EPLKRKVASTLLESFLFYSGFYLPMYWSSRAKLTNTADMIRLIIRDEAVH
GYYIGYKFQRGLERVDEAKRAEIKEYTYDLLYELYENETDYTEDLYDEVG
LTEDVKKFLRYNANKALMNLGYEALFPREETDVNPAILSALSPNADENHD
FFSGSGSSYVIGKAVNTEDEDWDF
169630484YP_001704133.1 hypothetical protein MAB_3403c [Mycobacterium abscessus ATCC 19977]MTSTSIIGSILSWLSAGYPEGVPPTDRFPLLALLRRTLTEEQVQEVVAKL
TDPESSAQIDGVVSKDEIEKFIADVTKDEPTAQDISRVASRLAAGGWPLA
GVDSTALNA
169630483YP_001704132.1 hypothetical protein MAB_3402 [Mycobacterium abscessus ATCC 19977]MKNSVALGMCFSAALLCAATASTGCAAAAPPSGFPDISGLPAVDSRQYFS
VKVYRFATPEGVLCESAGWNPYFQWTCVGPRGAGAAQLDLGTYARNNGTP
ATVSESQSNPDVSRVPVLPANHQVRIAAPVHNNDGVQTILTCATPAAKTT
ACLVDDLHGTHGFVLSPERNWAF
169630482YP_001704131.1 putative monooxygenase [Mycobacterium abscessus ATCC 19977]MTRVIRFNAFDMNCVAHQSPGLWRHPDDQSWRYKDLSYWTNLATLLERGR
FDGLFIADVLGTYDIYGASDEAAIRQAAQIPVADPLLLVSAMALVTEHLG
FGVTTGTGFEHPYPFARRLSTLDHLTGGRVGWNVVTGYLPAAARNMGQTD
QPAHDARYDHADEYLEVLYKLWEGSWEDDAVVRDAARGVFTDPDKVHHIG
HEGTHFTVPGVHLVEPSPQRTPVIYQAGSSPRGVRFAAENAEAVFTAAPT
KELLRQTVTTIRRELELAGRDPYSAKIFNLTTVVTGENSEAAHAKHAELL
GYGSAEGALVFMSGWMGVDLARYGLDEPIGNVDSNAILSAVAAFQAATAD
GREWKVRDIAEWGEIGGMGPRIVGSGTEVADTLQEWVEETDVDGFNLAYA
ITPGTFEDFIEYVVPVLTERGAYQSSYTPGTLRHKLLGHGDRLPEEHRGA
KYRIGGPLSTIIDRPSTVPSSSGSTAPAPTPGR
169630481YP_001704130.1 NADP-dependent alcohol dehydrogenase C [Mycobacterium abscessus ATCMVTVSAYAATSGKDPLVPTTIERREVGPHDVFIDIKFAGICHSDIHTVRD
EWGRANYPIVPGHEIAGVITEVGSEVTKFKPGDHAGVGCFVNSCRECPSC
LAGLEQFCERGMVGTYGAKDRDGTQTQGGYSQAIVVDENYVLRIPDSLPL
DAAAPLLCAGITTFSPLRHWNAGPGKRVAVVGLGGLGHMAVKLGKAMGAE
VTVLSQSLKKMEDGLRLGASHYYATADPDTFKSLRNSFDLILNTVSSNLD
MGKYLGLLGVDGTLVELGLPENPIEVPGFPLLTNRRSISGSLIGGIPETQ
EMLDFCAKHGIGSEIEVIDASYINEAYERVVASDVRYRFVIDTQTL
169630480YP_001704129.1 ABC transporter ATP-binding protein [Mycobacterium abscessus ATCC 1MKTATDWGTELWRSLVWIGWVWPLTAAIFVTIAFLIIQFTQWGRQFWRIT
GQYFTTRAGRGGLVLLGLVLLSVVVNVRLSVVFTYYYNDMSASIQYIVQA
LARDGQGMPEAKAFFWLNIRRFCLLAGINIAVVVTDFYLLQAFIIRWRVW
LTERITVDWLSKRAFYRSRFIDNTIDNPDQRIQADINNFVAMSSAPEQLQ
SSSLHLAFGAVNACISLPSFTIILWNLSGPLNIFGYEMPRALVFLTYIYV
IVTTLIAFRIGRPLIRRFFLNERLNAMFRYALVRLRDTSESVAFYRGERA
ESKQLKSRFDAIIANFWQLVYRSMGFTGWNFAVSQTAAVFNSVLQVPRLI
AGQITYGDVSQSASAVGQLQTSLSFFRNAYDNFAAYRATVMRLDGLLTAD
SQSRELPMLEPGDQEDGVTLNNIYVRKPNGDSLIDDLNLDLAAGDALLIK
GQSGSGKTTLLRSLAGLWPYTDGDWARPGGDHETMFISQLPYLPLGNLRD
ALSYPAESGSFSDEELLQTLEKVSLAHLADRLDEEADWIKVLSPGEQQRV
AFARILLIKPKAVFMDESTSSLDEGLEFSLYRLLRSELPGCTLVSVGHRS
TIDQHHNQKLQLDAEGRWSLSPL
169630479YP_001704128.1 hypothetical protein MAB_3398 [Mycobacterium abscessus ATCC 19977]MKKIQKPKPPTGFQRLLWRLPITLFRAHLGFLVTKRIMLLTHTGRASGRP
RQAALEVVEHGDDGSIVAASGFGRAADWYKNVRKTPEVTIQVGGRAHRAR
AAELSTDEGGDLMAHYAMRRPRSAKQLSRLMGFEVDGSADDFREVGRAIP
FVRFTPMP
169630478YP_001704127.1 hypothetical protein MAB_3397 [Mycobacterium abscessus ATCC 19977]MTNLADRPNSARGDRRRTQLVRAGVELLSEGGWPAVTTRAVAARAGTNPG
LIHYHFGGLPGLHCAVARETCELVISPLVATFLDAPDTRAALHAMRDALP
QAASDDNAMHLAVELIAGATRDADLGAALGTKLKEVRAEIADHVRLRHPD
WPRRRAAGMATLIVAFMDGLVLHHTVDPNIETAEAFSLLESLLDEE
169630477YP_001704126.1 hypothetical protein MAB_3396 [Mycobacterium abscessus ATCC 19977]MTDRRRHRLVAPALMLVSGTSMYIGAAAGVSLFRWLDPASVAWLRICGAA
LVFLAIARPGRAAWQGRAFWWASSFGVITALMNMSFYLAIDRLPLGTAVA
IEFLGPIGVAAMGSRSLREGFSVLAALVGVLLIADVQLAAEPAGMAFALL
AALFWAGYIVVGKRVALQGKPADSLAIGFTVAMVVTSPVLAYGIAGAHGG
IPIPRILALGLLMGVLSNVIPYGLDQVILRRAGQSYFAVLLALLPLSATA
IGVLVMHQIPSTPELLGILAIVVAVAARRDAPPGGNLAI
169630476YP_001704125.1 putative transcriptional regulator TetR [Mycobacterium abscessus ATMAPERKHASDAILDAARSLLLDGGPRAATIAAIAGASGAPPGTLNHRFGN
RAAIMSATWLRAVERFHEHALRALHSAGDPVETAVALSLSVPAFARAYPE
DARLLLSLRSADILGAEANSTLDEMNAPLFTAMRDLTRAIYQRGDARSRD
RLLRAVVDLPYAAVRRHMPTLPGWLEEDLAAAVRALLASR
169630475YP_001704124.1 hypothetical protein MAB_3394c [Mycobacterium abscessus ATCC 19977]MEHLSYIDEHAIRIDAPRVRVWDGLRRYVDGFLQSSERSALGTLLGARPR
AGFAIAGVVPGRQLSLAGQHHFSRYELIFELGDTHDGGTQLRAQTYADFP
GLRGRIYRTLVIGTRGHVLATNHILRSVKRRTTG
169630474YP_001704123.1 hypothetical protein MAB_3393 [Mycobacterium abscessus ATCC 19977]MIQERIDIAVAARPETVLEVLKDVESVDRWLRPHLPAWPPVTSNMTVVES
FEDGSPRLVRTVSSTLGISDDSLTEYQWYPDGCQLTLLESKTLRHNVSRF
TVIPDEPESRLTAEIALDLKIRLPGLLERQLKKTQVGFVKSFQRALAAES
ARRECRS
169630473YP_001704122.1 hypothetical protein MAB_3392 [Mycobacterium abscessus ATCC 19977]MSDNRFPENRWGNPDSTLSRLAAKFAATKPGSWVIRKLTPLDRAVMQRTG
SRYTVLGPLGLSTLLLTTTGRKSGRPRVSPLLYLHDGDRIALVGSNFGQE
KHPAWTANLLADPRAKVTLAGQTIEVLATPLEGPERDDYYRRFESMLEVY
SAYKGRTGREIRVFTLERIN
169630472YP_001704121.1 hypothetical protein MAB_3391 [Mycobacterium abscessus ATCC 19977]MYHVLQLTYTQPIDVVDGVRPAHLEWLDAEIAAGNILISGRNEAGTGGVL
ITGDISAENAQALIAADPYTAAGVAEYTRTGFNAGRKADIIP
169630471YP_001704120.1 FeIII-dicitrate-binding periplasmic lipoprotein [Mycobacterium abscMQTARLWGAAAISAALVTATVSGCTEKPTNETPSTLATSTTKIASAGVLG
NARKPDESCAKDAAAVDPSAPREVRHAQGETEVPEDAKRIVVLDAGAIDT
LCALGLQDRIVGVALADQAAAPPSYLGTTVHNLPSIGPMASPDLAKIGAA
KPDLILSSAGEQNSYLDLSAIAPTVIVSGHDLAEHVRLVGKATRRTADTD
KLWTGFVDAAKKVGRENDAAHFQASIVQFTDQTVRVYGANNFPASVLATV
GLDRPATQRFTDTPFIEIGTEDFSAAEGDIIYVSFTSSSAKDRAARIFGS
KPWMALGATRDNRVFAVNNEVWQTGDGIVAGRGILDDLQWVNAPIN
169630470YP_001704119.1 cytochrome c oxidase polypeptide I [Mycobacterium abscessus ATCC 19MTAEAPPIGGLQASRPFPPRMGARGTLIYRLITTTDHKLIGIMYLVACFA
FFLIGGLMALFMRAELAVPGLQFLSNEQFNQLFTMHGTVMLLFYATPIVF
GFANVVLPLQIGAPDVAFPRLNAFSFWLFLFGALIGIAGFITPGGAADFG
WTAYTPLTDAIHSPGAGADLWIMGLAVGGLGTILGAVNMITTVVCMRAPG
MTMFRMPIFTWNILVTSVLVLLAFPLLTAALFGLAADRHLGAHVFDPANG
GVLLWQHLFWFFGHPEVYIIALPFFGIVSEIFPVFSRKPIFGYTTLIYAT
LGIAALSIAVWAHHMYATGAVLLPFFSFMTFLIAVPTGIKFFNWIGTMWK
GQLTFETPMIFSVGFLVTFLFGGLTGVLLAMPPVDFHVTDSYFVIAHFHY
VLFGTIVFATYAGIYFWFPKMTGRLLDERLGKFHFWLTFIGFHSTFLVQH
WLGNQGMPRRYADYLPTDGFTFLNSFSTVGAFILGASTLPFLWNVFKSYR
YGEVVTVDDPWGYGNSLEWATSCPPPRHNFSELPRIRSERPAFELHYPHM
SERMRAEAHVGGGH
169630469YP_001704118.1 phosphoserine phosphatase [Mycobacterium abscessus ATCC 19977]MNNRVTVLVTVTGADKPGVTSVLMGVLSRHGVDLLNVEQVVIRGKLTLGV
LVKAQGRSDAVEALQDELEEAMHTLGFDVDVEFGGDSSVIKDPSTHTIVV
LGRPVTARAFGAVARELAALGINIDLIRGIADYPVTGLELRVTVPQNRLT
DVDLHTAMAQVATDEPVDIAVEHSSLDRRAKRLIVFDVDSTLIQGEVIEM
LADRAGAREQVAAITEAAMRGELDFAQSLHQRVATLAGLPESVLEDVADE
LVLTPGARTTIRTLRRLGYSCGVVSGGFRQVIDPLAHELALDFVAANVLE
IVDGKLTGRVIGEVVDRPGKAKALRQFAYEAGVPLAQTVAVGDGANDIDM
LSAAGLGVAFNAKPALRKVADASVSQPYLDVVLFILGITRAEIEAADAVD
GGVRRVDIPDD
169630468YP_001704117.1 GntR family regulatory protein [Mycobacterium abscessus ATCC 19977]MPDRVVTAETLARHLGQWRTAGSAGPAYGALADAIRLLVIDGRLPLGVRI
PSERALASALHVSRTTVTTAYAELRESGYLRGRQGARSTTALPGPDRTGS
ATTGLMSPMVDLQNAATAAPAAAVLEAYQAALTTLPTHLRGIGHELVGIP
ELRPRIAEHFSRRGLPTTEDQIMVTCGAQQAIALLLGAFVEPGDRVLVEQ
PTYHGALDAISQRGARPVPVPMHTHERDSGWDMTGMETTIRQTAPNLAYL
VLDNHNPTGLTMPLGQRKALADIISQTRTRTVVDESLVGVWHQNHTPAPM
AALVSRPELVVTIGSMSKSFWGGMRVGWIRADRTTIARLAAVRSAMDTGT
PILEQLAAAELLERAEEVEAAQRETLRARRALVVSELHRRLPEWELQEAD
GGLCIWARLPAPMSTALAAAAARLGVRIAAGPRFGVGGSLERFVRLPFTQ
HDDQLLRGVELLAQAWHTVTGALPLADSTMVG
169630467YP_001704116.1 hypothetical protein MAB_3386c [Mycobacterium abscessus ATCC 19977]MSGKWIGWSARGTALMVGLYLYGFSMALMVRAGLGLDPWDVFHQGLAMRT
GMSIGLASAVTGVVVLLMWIPLRNKPGVGTIANIIVIAIAVDTALAWLPE
SPAMPVRVSFLLSGVVLNAIASVLYVGAGLGAGPRDGLTTGLVHRTGRSV
RLIRTIIEVLAVGTGWLLGGNVGAGTLLYAFGIGPLIQLVLRLVPRRLLA
VSGWGPVLSTQRNAESRSTPLDSAQDVAV
169630466YP_001704115.1 hypothetical protein MAB_3385 [Mycobacterium abscessus ATCC 19977]MTNDFDPDPYLETVQSIGLANHRLIAQLDAEASQIQQRAADGEDRSWIWD
DLKVWRRRVDAFQSQLRRDTTALGRLIDANRRIKGSDQTADIGTSKLDYS
PDSNRNTLHPFKDSRSQEEFVSRLNRVFAVLHSPGRGPYSNSEFLVFMRT
GGTVVSAPYLSQLRNGQRGRPSLQALESIAHAFRIDVRYFIDSGYADELE
SDLSALELAHNPAAAELTSKLLELPEPVRDQLLADAESFDRRNQTATS
169630465YP_001704114.1 ABC transporter ATP-binding protein [Mycobacterium abscessus ATCC 1MSEMTRYRAPADRSRGGIRHDDPVAEIDPDLLLDFRDVLLRRNRKVLVGP
VTWSVELDERWVVLGPNGAGKTSLLRIAAAMEHPTSGYAAILGERLGRVD
VAELKSRIGLSSAALAQRIPDNEVVRDLVVSAGYAVLGRWREEYEEIDTA
RAVDMLETLGAEHLSDRTYGTLSEGERKRVLIARALMTDPELLLLDEPAA
GLDLGGREELVARLGELAADPDAPAMVLVTHHVEEIPPGFSHALLLSEGG
IVAQGLLADVMTSENLSRAFGQSIVVEMIDGRYFARRARARAAHRAQ
169630464YP_001704113.1 hypothetical protein MAB_3383c [Mycobacterium abscessus ATCC 19977]MTAATPPEPKPAATVVLIRDGAVGVEAFLMRRDNAMAFAGGMTVFPGGGV
DSRDMHADVPWLGPDVDWWAQQFGVTPELASALVCAAARETFEECGVLFA
GTSENSIVEDAAVYHQARKDLSDKTLSFAEFLQREGLQLRADLLRPWANW
ITPEAEPRRYDTFFFVAALPAGQDADGNNTEAVASGWQTPAAAIAAFTER
RSFLLPPTWSQLDAVSSAGASVAEVLGVARSIAPIMPILTEQDGRWFVQF
DDVDRYEAARQGAVEIPEVTGPELS
169630463YP_001704112.1 enoyl-CoA hydratase/isomerase [Mycobacterium abscessus ATCC 19977]MIEPEFVSVRTAPEHPGIGTIALSRPPTNTFTRQMYRELAQAAAEVNARA
DIRVVIVYGGHEIFCAGDDLAELSELSADEMARSAGDRQAALTAVAELAK
PTIAAITGYALGSGLELALTADWRIAGDNVKVGSPEILVGMIPGGGGTVR
LARVVGLSRAKEMVFSGRFVGADEARGAGLIDQVVAPDDVYTEAASWARR
FVDGPPLALAAAKEAIDHGFDGPLAAGLDKERELFCQVFATQDRADGVTA
QLEIGPGTARFRGA
169630462YP_001704111.1 hypothetical protein MAB_3381c [Mycobacterium abscessus ATCC 19977]MTEITGLDGQPTTKATAEQVAAAFEDNKLAQILYHDWEAETYDEKWSISY
DQRCIDYARGRFDAIVPVEDQRELPYDRALELGCGTGFFLLNLMQAGVAR
RGSVTDLSPGMVKVATRTGQELGLDVDGRVADAERIPYDDNTFDLVVGHA
VLHHIPDVELSLREVLRVLKPGGRFVFAGEPTTVGNLYARALADLTWKAT
VQAMKLPGLESWRRPQEELDENSRAAALEWVVDLHTFDPADLEKMAANAG
AVAVRTASEEFTAAMLGWPVRTFESTVPPGKLGWGWAKFAFNGWKALSWV
DENVWRHVVPKGWYYNVMITGIKPS
169630461YP_001704110.1 hypothetical protein MAB_3380c [Mycobacterium abscessus ATCC 19977]MFDLSDVAYLSSEAGAADLARASTYTFSAGTLVADTAALRNEFGDHAAVL
AQTVQLRRKAAAKLGRVDHWLFTDDALQQATPAAVARHRAARLAGLVVHD
VTCSVGAELAALDGVAAAVIGSDIDPVRTAMARNNIGEHVLVCRADALAP
SSRAQVVIADPGRRAGGRRRFDPSAYSPPLDAVLRSYADRDLVVKCAPGL
DFADLREQTGFDGEIEVVSLDGGVREACLWSAGLAGARRRATVLATIGTG
YQLTDADPDDCAVAGAGEWIIDPDGAVVRAGLVRQYAARHGLWQLDARIA
YLSGDCVPAGVQGYRVLDSLPYSEKRLRQALAARDCGAVEITVRGVDLDP
ALLRTRLKLRGSVPLSVVITRIGSGAKAFVCAARSPGGTRTPDPRSA
169630460YP_001704109.1 hypothetical protein MAB_3379 [Mycobacterium abscessus ATCC 19977]MLSRARVLASIALAALLTITGCSGDDSWINIKAAPGWSASYADAHNSSYT
ATEGARELTLEWSRNTKGQIRSAAAIGIDNFIAVSADTPSGCTLMEWEDN
RAARQRWCTRMITGSPWSGPLADGYNNLYVGQPGAVVSFPPTQWIRWRKP
VIGAPTTPKIVEPGRLLIVTHLGQILIFDAQRGEVVGTPMDLLEGVDPAD
PRRGLEDCEPARPKCPISASPAYDPATGTIVTTLWQPDKPVPVLLGITYD
ADGKVTLKHKWASKIIDEGVIGSPVMSNDGETVYINDRKGSLHAMHTFDG
SQKWSLPLGFNATTPPSVAPDGTIIAGTGDKATLVGIKDSGAKGEIAWRR
DDLVPLSTSSQAAGNVGYAVVRDGDKGLALVVFNTPDGATINRYPLPDAT
GFPVGISIGPDQRVIVTLSEGLVYGFRPET
169630459YP_001704108.1 hypothetical protein MAB_3378c [Mycobacterium abscessus ATCC 19977]MTTMWGAPLHKRWRGQRLRDPLQAKFLTRDSLRWVIANKAYTPWYLVRYW
RLLKFKLANPHIVTRGMLFLGKNVEIHCTPELARMEIGRWVHIGDGNSLR
AHEGSLRLGDKVVFGKDNVVNAYIDIEFGDSALMADWCYVCDFDHRMEDI
TYPIKDQGIVKSPVRIGPDTWIAAKVTILRDTIVGRGCVLGAHAVVKGVI
PDYSIAVGAPAKVVKNRKVAWDASGAQRAQLAEALADIERKKAAANSPE
169630458YP_001704107.1 hypothetical protein MAB_3377 [Mycobacterium abscessus ATCC 19977]MPTARVAATVTNQFTFEYISKNPQWVGEQIEVYESSGGVEGTTLEGLPVV
ILYTIGAKSGQIRKAPLMRVEHDGVYLAVGSIGGAPKNPAWVANLRANPV
FELRDGEDVQTVRAEEITNEAERAAWWERAVAAFPPYAEYTTRTTRVFPL
FTLTPVS
169630457YP_001704106.1 hypothetical protein MAB_3376 [Mycobacterium abscessus ATCC 19977]MSTRHGSATVVLPSDTTILITRSFDAPAALIFRALTEPELVTRWWGFEDA
QWEVCEIDLRVGGTWRYVVRQPCESEPDREVAFHGEYRELDPPHRLVSTE
VFEGVPEGEAVVSTTLDEVDGVTTMRVLVQHTCKEHRDGHVESGMEVGMQ
VSYNRIEDLLRDLG
169630456YP_001704105.1 ArsR family transcriptional regulator [Mycobacterium abscessus ATCCMARTPTTADAFNAIAEASRRDLLSAIGTDEVTVNELVSRTRMSQPQVSKH
LSVLRAVDLVRARSHGRHRFYRVNGAALRPVHDWVAAFERAWNERLDRLD
MLLTELKEEKS
169630455YP_001704104.1 hypothetical protein MAB_3374c [Mycobacterium abscessus ATCC 19977]MDRPIKTRRIKFRYQPGSLERHFVQGDLVSSHMMAMLSAVFPEGEEFFIR
SVRRYSDQITDPELKKQVAGFIGQEMTHGREHRELNERLQEMGYPTAFVE
RLARRIFNFQTRNYPPIYTLAVTAALEHYTAVLAETLLTDQRALDMLGEG
EVRRMLLWHAFEEAEHRSVTFDVYRAVGGSERLRIWVMRRTTIAFIYTTF
FETLISLMRDKAAYNPVRLVKSIAALRHLPFLSRTVRRRIGEYNRPGFHP
NDSDNTELIEKWHAELFGENGQLAGHLH
169630454YP_001704103.1 hypothetical protein MAB_3373c [Mycobacterium abscessus ATCC 19977]MQRDIKTRRIRFRYPAGAMRRHYVQDDLGMSHVVSVLSGAFPEGEAFMIR
SVRAVAGQITDPELKKQVAGFVGQEAAHSREHRALNERLQEMGYPTAFVD
RATRKVLAARTRYSSPRYCIAMTAALEHYTAILAETLLSDERAQQMLGQG
EVRSMLLWHALEESEHRTVAFEVYQAIGGTNRMRVFAMWFTTFGFFTLAA
CASLASLLRDRDFYNPRITYRSAVRLFGSPFFSRAVFRRLLSYSRKDFHP
DDVDNSELIAKWNAELFGEQGQIADHLH
169630453YP_001704102.1 TetR family transcriptional regulator [Mycobacterium abscessus ATCCMAILAFGEGFDIMSSSRLQPRKQPRQDRAEATRRRILEAAAHVFADFGYA
AGTTNRIAERAEISIGSLYQYFPNKDAILVELMTAHTHRGFALIHQHLAA
GLPDTIEDTVRVFVGSAIANHRDSPRLHRVLFEEAPRPPEFLAMLHRSED
AVIAAAEAVLAAHPEVRVTETDTAARMVVATIESLVHRLIAGPRPIDPQL
FEDQLVDMLTRYLTG
169630452YP_001704101.1 hypothetical protein MAB_3371c [Mycobacterium abscessus ATCC 19977]MKTVYLETELPTDADRVWNAMQYAGTFLYLCRGLFGIPALSGRTEPLRVG
EAGTAWLWGLHLIPLYRHTIHVVEVDADNRTVRTNESGGILRTWNHTLHV
EPIGRGRCRYSDSIDIDAGMFSAAAAGGAAAIFRYRQRRWHRLVNKQLLP
EGPAYTRQ
169630451YP_001704100.1 branched chain amino acid ABC transporter [Mycobacterium abscessus MPELAYIAAALSSAVAITFALRALPFAARSAIKNNELAINLGRWMPLGAT
VILAVYCLSTIDFTAPAHGTGPILGAAVTVGMHLWRRNAVLSIVVGTAAC
LLVTNLT
169630450YP_001704099.1 putative integral membrane amino acid transport protein [MycobacterMSQEVLSPRSPRGDELLKAARHAGVVWAGLFALGIGLGVVVTAHGLPWWL
APLISGVLFAGSVEFILIGMLSAGASVPAIALTTFLVNSRHLFYGLSFPL
DRIGSRIGKSYSMFALCDEAYALITALDEQALSSRRILWTQFGLHLSWVA
GATAGGLAGASFLSGLKGLDFVLIAMFLVLTIDTYRSRPDRRGAALAVTA
ALVALVLVPGAMVLVAMCGYTVTLVARHYVTRVPHARPQASHA
169630449YP_001704098.1 AsnC family transcriptional regulator [Mycobacterium abscessus ATCCMDKLDRAIIDQLQDHGRLTNQELADRVGLTPAPCLRRVRRLEAEGVITGY
TALVNPAALGRDFEVIIYADLVAKDLATVASFEERLVAMDEVAELRRMFG
IPDYFIRVQTADLAAYEQWLSVKLMGDPAIARVDSRLTMKLLKSRR
169630448YP_001704097.1 putative fatty-acid-CoA ligase [Mycobacterium abscessus ATCC 19977]MTAGAAARVAKLFESDPQFRAAMPDPAVMDSLLAPGLRLSQVLHALLSGY
AERPVMGFRSRESVVDTATGRTVDRLLPAFETITYGQLLEDISAILAEWQ
HGDIPMGAGDFIATIGFSSPDYVTLDLATLMNGSVSIPLQHNTSVAQLRM
MLEETSPRLVAASADCLDLAVEAAVGLTDLRRVVVFDYRAETDDHREKLA
TARERLHAAGMDVVVEPLAEVIGRGRDLPEPVLYTAGDDQRTALIMYTSG
STGAPKGAMFTEWTVTRFWSSGAAPNRDTPIINVNFLPLNHLAGRVGLLT
AFIPGGTCYFVPESDLSTLFEDWQLARPTHMGVVPRVVDMLFQHYQTRVD
ALMAGGTDVDTADRLAKTELREDVLGGRVVAGMLATAPLSPEMKAFLESS
LDFHLLDLYGLTEVGGVFRDGKISRPPVLDYKLVDVPELGYYTTDKPHPR
GELLVKSATATPGYYKRPDVTAEVFDADGYYRTGDVMAEVAPDQLVYVDR
RNNVIKLAQGEFVAVANLETVYVGAPLVRQIFVYGNSERAYLLAVVVPTE
EALRAHPDPVELKNSIRESLQRTARSNHLHSYELPADFIIETTPFTIESG
MLAAVGKPIRPKMIEHYGDRLEQLYVDLAEARVQELRQLRDTAQQRPVLD
TVTEAAQALLGMSADAVRPDHHFIDLGGDSLSALTFSNLLRDLFDVEVPV
GVITGPAADLRKLAAYIQHEREHSTATAASVHGLDTTVISATELTLDKFI
DAETLHNASQLDVPAGAVATVLLTGANGYLGRFLCLEWLQRLSQTGGQLI
CLVRGDNADQALARLVAAYGDTDRTLLEEFHTLARRHLRVIAADIAQPRF
GVDDATWEQLARDVDKIVHPAALVNHVLPYNQLFGPNVFGTAEVIRLALT
TRIKPVTYLSTMAVAMTVPDFDEDGDIRTVSPTRHIDPGYANGYANSKWA
GEVLLREAHDICGLPVSVFRSDMILTHRRYSGQLNVTDAFTRMLLSLVLT
GIAPRSFYQGDGSGARPRAHYEGLPVDFVTEAITSLGLSSSEGFRSYDVM
NPHDDGISVDTFVDWLMEDGHSIDIIDNYDEWLSRFETALRGLPDEQRRA
SVLPLLDAYRIPGNPRRAAATPNHVFRKAVQENNIGGDGADIPQIDRALI
AKYIADLRAHRLL
169630447YP_001704096.1 glycosyltransferase [Mycobacterium abscessus ATCC 19977]MRILMVSWEYPPVVIGGLGRHVHHLSTELAAAGHDVVVLTRRPSGTDPSS
HPTSDEISEGVRVVAAAEDPHDFDFGTDMMAWTLAMGHAMVRAGLALGLK
GSGDWRPDVVHAHDWLVAHPAIALAEHFDVPLVSTLHATEAGRHSGWVSG
RISRQVHSVEWWLARESDSLITCSASMLDEVTQLFGPELPQVHVIRNGID
VTRWVFAPRPPADGTPPVLLFVGRLEYEKGIHDAIAALPKIRRAHPGTVL
AVAGDGTQQDWLLEQARKYKVVKSVQFLGTLDHSELLHWLHHADAILLPS
HYEPFGIVALEAAAAGTPLVTSTVGGLGEAVIDGETGMSFAPRDVAGIAE
AVTRTLDDPAAAAERAVAARARLTADFDWATVADETAQVYLAAKRREREP
LGRSVIVERPLPDR
169630446YP_001704095.1 hypothetical protein MAB_3365 [Mycobacterium abscessus ATCC 19977]MTPSKKPVPGLFTMVLHTHLPWLANHGRWPVGEEWLYQSWSAAYLPLFKV
LRTLAAEGRENLLTLGITPVVAAQLDDPHCLTGLHSWLANWQLRAFEAST
ISSTDAEPGTASSPEMLRAFGVREYQTATAALDEFDTYWRHGGSGPLRNL
IDAKAIELLGGPLAHPFQPLLHPRLREFALREGLADAAQRFGHAPTGIWA
PECAYAPGMEEGYAAAGVKHFMVDGPSLQGDTSLGRTVGDSDVVAFGRDL
AVSYRVWSPKSGYPGHAAYRDFHTYDHDTGLKPARVTGRNVPSESKAPYD
PERANAAIDIHVRDFVDTVRQRLVDESSRIGRPAHVIAAFDTELYGHWWY
EGPTWLERVLRALPEAGIQVGTLEQAREQGYVGEPFDLPASSWGSGKDWH
VWNGEKVADLVQLNTEVVDTALTAVDKALNEQPAPHTRNRVADQILREAL
LTVSSDWPFMVSKDSAADYARYRAHLHAHATREIAGALASGRHDVASRLA
DGWNRADGLFGALDARRLPR
169630445YP_001704094.1 hypothetical protein MAB_3364 [Mycobacterium abscessus ATCC 19977]MNSHLTDPHPADPLRTSGPSAEDPDATLALTGERTVPGIAEENYWFRRHE
VVYERLSSLCAGRRVLEAGSGEGYGADMLAQVAQHVIGLDYDESAIAHVK
ARYPRVDMRAGNLADLPLADGSVDVVVNFQVIEHLWDQGQFIRECARVLR
PGGSLLISTPNRITFSPGRDTPLNPFHTRELNGAELTELLEENGFSLESM
NGVFHGPRLRELDAKYGGSIIDAQIERAVAGAPWPQELLADITGLTTEDF
EIVDAGERDIDASLDLVAIAVIP
169630444YP_001704093.1 electron transfer flavoprotein subunit beta FixA [Mycobacterium absMTNIAVLIKQVPDTWSERKLTDGDFTLDREAADAVLDEINERAVEEALLI
KEREGGDSVVTVVSAGPEKATEAIRKALSMGADKAVHLLDPGLHGSDAIQ
TGWALARALGQVEGVELVIAGNEATDGRSGAIPAIIAEYLGLPQLTHLRK
LTVEGGVVKGERETDEGVFEVEATLPAIVSVTEKINEPRFPSFKGIMAAK
KKEVAVLTLAEIGVEADEVGVANAGSTVLSSTPKAAKTAGEKITDEGEGG
TKVAEFLVAQKII
169630443YP_001704092.1 electron transfer flavoprotein subunit alpha FixB [Mycobacterium abMAEVLVLVEHSEGALKKVSAELITAARVLGEPSAVVAGPAGTAAPLIDGL
KEAGAAKIYVAESDVVDSYLVTPKVDILAALAETASPAGILIAATTEGKE
VAGRLAARLGSGLLTDVVEVREGGKALHSIFGGAFTVEAQANGDAPVITV
RPGAVEAAPAAGAGEQVAVEVPAPAENATKVTSRQPVVGGDRPELTEASI
VVSGGRGVGSADKFSVVEALADSLGAAVGASRAAVDSGYYPGQFQVGQTG
KTVSPQLYIALGISGAIQHRAGMQTSKTIVAVNKDEEAPIFEIADFGVVG
DLFNVAPQLTDAVKARKG
169630442YP_001704091.1 LuxR family transcriptional regulator [Mycobacterium abscessus ATCCMLRGQAGVGKTALLRYVLGKASGQLIAQASGIQSEMELAFAGLQQFCAPL
TKYSGAIPDPQREALTIAFGTRSGPPPDRFLIGLAVLSLLAAAAEHQPVL
CVIDDAQWLDRVSLQTLAFVTRRLGSEPVAMLFAVRDGTDSELAGLPELT
VHGLRAADAGTLLDSVIPGLLDERVRDRIVAETQGNPLALLELPRDMTAE
ELAGGFGWPDGGRLAGQIEQTFLRRVQQLPAHTQTLLLAAATDPLGDVTL
LARAAQQLGIPMHAIAPAEAADLVELSTRVRFRHPLVRSAVYISANPLER
RRIHGVLAGATDPGADPDRRAWHRAHAAAGTDEAIAWELEQSAGRAQAKG
GVLAAAAFLQRATELTADPAARGRRALAAAQSKYDAAAFDAARELLGVAD
MTPLDPLARARATRLRAKIAFAESRVGAFGSVTVSEAAIGLVEAARCLEN
LDDNLARETYLDAVGAAMYGGRLCPRGGAVEVAEPARLAPAGAQPARPSD
LLLDGLARRITHGAAASAQTLGEALTLIRCEADRPANTSWMEQAFPIALE
SATHEVWDDDMWHHLATRAVHIAREVGALSLLPAALIYRAGMHVHAGELD
AAAELVQEADAISAATGHAPIRYHSLILAAWRGSEPTAIRLIDEAMRDGA
ARGEGRLLGAMGYAAGVLNNSLGRYELAFMAARRACEHEDLGLYSWCLIE
LIEAAVRCGEHDTAVKAFGQLEERALAAQSDWSQGMVARSRALITVGHDA
EPHYREAIQRLTNTRISAHLARAHLIYGEWLRRCNRRSDARTELTAAHGS
FVNMGTAAFAERAERELRATGAKVRKRSASSEKALTAQEAQIARMAGQGL
TNQEIAAQLFISSHTVEWHLRKVFAKRGITSRRQLRSGR
169630441YP_001704090.1 hypothetical protein MAB_3360c [Mycobacterium abscessus ATCC 19977]MKITVVGATGQIGSRVVSLLIADGHDVVAASLSSGANVLTGEGLVDALTG
SAVVIDVVNSPSFEDGPVMDFFTASARNLVDAAKATGVGHYVALSIVGAD
GLPESGYMRAKVAQEKIIVGSGLPYTIVRATQFQEFAEAITDTLVVGDEV
RVPDARIQLIAVDDVSTQVAHAAAAAPRNGIINIGGPEKFSFADMAGAVL
AARGDDRPVVVDSGATYFGTPVDDFSLVTGDDGVLTQTRFADWMARR
169630440YP_001704089.1 hypothetical protein MAB_3359c [Mycobacterium abscessus ATCC 19977]MSTASVLIAADQSMPEVAGKTGEAALGPRYTLLLSNDSADIDAVQRLRYD
VFSSEPGFQLASTPEAFEGRDADRFDEHCDHLLVREDVSGDVVGCYRMLP
PPGAIAAGGLYSATEFDISGLDSLRPQLVEMGRAVVRGDHRNGAVVLLMW
AGILAYLDRCDYTYVTGCVSVPMQDSPEQAPGSQVRAVRDFVMKRHAAAP
QYTVRPYNPVVVGGMGLDDIAPPAKVQVPALMRGYLRLGAKVLGEPAHDP
DFGVADFMALLNKNEADVRYLKRLRSVGAASEIGATTVPSESE
169630439YP_001704088.1 putative acyltransferase [Mycobacterium abscessus ATCC 19977]MAPEYAHAWLPKATCDESCMRANLIDEPGRFTRTFRTTSRIAMAITLLTL
APLLGIPLPGRVRWQRGYCRLMLRCLGVRISVSGGPIRDIRGSLVVAGHV
SWVDVFAIGAVLPGSFVARADLIDWPGLGVIARMMRVIPIERGNLRTLPR
VVGTVAARLRAGQTVVAFPEGTTWCGRAYGSFRPAMFQAAVDAQRPVQPL
RLTYHHLNGELSTVPAYVGEDTLMASIRRLTATRMTVAHIRVAGLQLPGE
SRRDLAARCETAVRAGDQIPQVHSHHHPEHPERPEPIAA
169630438YP_001704087.1 putative aminotransferase/cysteine desulfurase [Mycobacterium absceMSRSVYLDHAATTPMRPDAIEAMAATMAQTGNAASLHGAGRDARRRVEES
RESIAAALGARPSEVIFTAGGTESDNLAVKGIYWARRGADARRRRIIASA
VEHHAVLDAVQWLADHEGAAVTWLPVDQAGTVTPGALRAALAEHDDVALI
TVMWANNEVGTINPIYELSSIAAEFDVPMHSDAIGAVGQLDVDFALSGLS
AISVAAHKFGGPMGVGALLLRREIACVPLLHGGGHERDIRSGTPDTAAIV
AMSTALVAAVAERCESAAAMAGLRDSLIDQVLTQIEGATLNGAPGSGRLP
GNAHFTFAGCEGDSLLMLLDANGIECSTGSACTAGVARPSHVLIEMGIDP
EVARGSLRFTFGHTSVPSDVDRALEALHAAVPRARAAALASAGGRS
169630437YP_001704086.1 tRNA-specific 2-thiouridylase MnmA [Mycobacterium abscessus ATCC 19MKILAAMSGGVDSSVAAARMVDAGHEVVGVHLALSAAPGTLRTGSRGCCS
KEDAADARRVADMLGIPFYVWDFADRFKEDVIDDFVEAYAEGRTPNPCVK
CNEKIKFAALADRAVALGFDAVATGHYARLQDGRLRRAVDADKDQSYVLG
VLTPEQLRRAMFPVGDSPKPDIRAEAEQRGLLVANKPDSHDICFIPSGDT
QAFLGARIGVRRGNVVDADGSVLATHAGVHEFTIGQRKGLGLVGPAADGR
PRYVTSIDAETATVRVGTVEDLEIWEFGGEPVVWTSGRVPGQPIECQVQV
RAHGSVVDAIVEPGAERIHVRLRTALRGVAPGQTVVLYRPDAEGDEVLGS
AVITRD
169630436YP_001704085.1 putative secreted hydrolase [Mycobacterium abscessus ATCC 19977]MRALRTLSTMIGLAAVVAATAAVPPIASAEPAAGAQLVAIGDSFMAAGSN
AAAITGPVGTACNQATDNVAHLVASSFPQMTFADYSCVGALTTDVYAPST
RGPQNVGLSPATKVAIVSIGGNDAGFEQIATDCLFALSCPPEKKAQFSAN
VASVGPKLTGAYAAIRQAAPNARVFTVGYLPILPPDAKGCLVGLINTQET
INFLNGLQRQLNDTIVAESSKAGFTPVIPATSSDHSVCAADFQRYVSMTG
AGAGDEGIPMHPTAPGRQYVAERVAIAMRSAGVQGT
169630435YP_001704084.1 acyl-[acyl-carrier protein] desaturase DesA1 [Mycobacterium abscessMAQKEFTDLELLHELEPVVEENTHRHLGVFKEWNPHDYIPWSDGKNYKAL
GGQDWDPEQCKLSEVARVAMVTNLLTEDNLPAYHREIAMNFTMDGPWGTW
VNRWTAEENRHSIAIRDYLVVTRSVDPVELEKLRMEQMTRGFSPGQNRQG
GDELFAESLFDSVAYVSFQELATRVSHRNTGVACAEPIAQELLKHISNDE
NLHMIFYRNMVEAGLEIAPNQAVKSIHKVLDNFTMPGYTIPGFRRNAVTI
ATGGVYDPQLHLAEVVQPVLRKWRIFERDDINGEGEWYREDLDRIITDLK
KTASDFDEVKAKYLERQAKRAERQAAKV
169630434YP_001704083.1 putative xanthine/uracil/vitamin C permease family protein [MycobacMTALLDRFFRITERQSTLGREIRGGVVTFFAMAYIVVLNPLIIGGEPGRA
HNVDVLGHVLPVGQVAAVTALAAGVMSILFGFVANYPFALAAGLGINSLL
AVSFAPQMTWPEAMGLVIVDGLIIVALGISGFRTAVFHAIPDELKAAIAA
GIGCFIAFIGFVDAGFVRRVPDAANTTVPVGLGIDNSVATIPTLIFAAGV
LLMGILVVRKVRGGLLIGIVAMTVVSMIAQALCGRGAQPTDAKGWNLTVP
DWPSSAGGMPDLSLLGQVDLFGAFTRVGVLSATVLVFALVLSNFFDAMGT
MTGLGKEAGLADEHGTLPGIGRALTVEGVGAVIGGVSSSSSNTVYVESAS
GIAEGARTGLANVVTGLLFLAAMFFTPLYSVVPLEAAAPALVVVGAMMIG
QLRSVDLTRFDYALPCFLTVVTMPFTYSIANGIGVGFISWVVLALARGRF
RSVHPLLYVVAMLFVIYFAKGPIEDLLAHGA
169630433YP_001704082.1 putative methionine synthase- vitamin-B12 independent [MycobacteriuMAPNVLSVSMWAKGTGLGSWPGQQARDATEIVVAELPLPHLVELPARGVG
ADLIGRAGALLVDIAIDVSPTGYRTTARPGAVVRRARGFLDEDMDALEEE
WERGGHRGSERAVKVQGPGPVTLAAELELPNGHRAITDPGAVRDVAASLA
EGLAQHRATLSRRLGVPVMVQIDEPSLPAALDGRLSGTSMFSPVHPVDVP
TATALLDQCAEAVGGELLVHCCASDPPWELLREANIRAIAIDVAHLADAH
ALDGLASVLDTGKAVVLGVIPAQAPSTPISSDVLATRTAALADKLGFGRA
MLRDRVGVSAGCGLAGTDLQWARKATELTRKVSDLIDADPDAL
169630432YP_001704081.1 putative nitroreductase [Mycobacterium abscessus ATCC 19977]MDVYQAIATRRDVRAEFTGQVVDDATLMKLLQAAHRAPSVGNSQPWDFVV
IREPGMLDDFAAHVALQRQRFADSLPEGRRNTFDPIKIEGIRESGTGVVV
TYDHGRGGPHILGRHTISDAGLFSAVLAIQNLWLAAVTEGIGVGWVSFYE
EQFLAELIDAPAHIRPIAWLCVGPVREFAERPDLERFGWRTGRPLEDAVH
WGRYRA
169630431YP_001704080.1 enoyl-CoA hydratase [Mycobacterium abscessus ATCC 19977]MADSLHASGSSVSDSLRASGSSVSDSLHASGSSADGWKAFTVETTGHIAQ
VTLIGPGKGNAMGPDFWRELPLIFTELDADPEVRAVVLAAAGRHFSYGLD
LPAMAGTFMPLMAEKALAKPRTDFLDEIRRLQASVTAVADCRKPVIAAIQ
GWCIGGGVDLIAAADIRYASSEAKFSVREAKVAIVADIGSLHRLPPIIGD
GHLRELAFTGKDIDAARAEKIGLVNDVFDTPEATLAAAHATAAEIAANPP
LVVQGVKDVLGRERENVVADGLKYVSTWNAAFLPSEDLQEAIGAVFEKRE
PDFKGR
169630430YP_001704079.1 hypothetical protein MAB_3349 [Mycobacterium abscessus ATCC 19977]MRPFLWIATIVAVLCVLPAVNPAPVHAEPPLVYPGMLIYQGSLSCTLGYV
DPALRVGITAGHCFNGDGIIRNGDGAAVGHKVLAHDNRPPEGPVYENEYT
IDYEAISIDDGLPVNDVLANGQRLERDDTVIPDVGMPVCRTGFTTGDACG
SVTRIGNGWFRFNGPVIAKGDSGGPVYTHVGDRTVLVGIIRGFMTSQSGD
DVQSWAMSWPSVIKQLREDRKGLLPA
169630429YP_001704078.1 hypothetical protein MAB_3348 [Mycobacterium abscessus ATCC 19977]MTSVGDKGRRTGPWGRLTAYAAAVAALSGIGLANPIAAHADPLIYPGMEI
IQRPPGKESLSCTLGFVDPAARVGVTAGHCGGNGPVFTSDGVRIGQLAVA
QSNIKPEGPLARDDYRIDYEGIAFDDGVPINNVLPNGLRLGVDPAVVPRD
GLPVCRVGITTGEACGAIAGFGNGWFLVDGVPAEHGDSGSAVYTVTSPGN
AAIVGIVSARFTANQTRRESTVALSWPTVQQQIRNDIAASRRPEIASPVA
SNPQPPPPAINPQAPPMVLPPAPSDDRPSGPARMVVP
169630428YP_001704077.1 hypothetical protein MAB_3347 [Mycobacterium abscessus ATCC 19977]MFGIAGRFPLAAAPAAVLVAAALIWTVPTAIAHADAPLVYPGMRINQGTQ
SCTLGFVDPGARIGLTAGHCALDSDGPVYDDSGNRVGTADIAHFEPTPQD
KSFAEQPPIDYEGIAFYEGIPINNVLPNGLVLESNPKIVPAIGMPVCRSG
VTTGEACGVILETTDSLLVIDGLPADHGDSGSPVYAITEPGRAAIVGITT
EVLTSKSTGQRATMAISWRAIWRQIKSDIDRVGHADMPPDPPRNAREPAG
DVPAEPPTSDV
169630427YP_001704076.1 hypothetical protein MAB_3346 [Mycobacterium abscessus ATCC 19977]MGTHPIMFTEDDPGLAELRRLALALPEAAEQISWGRPVFKAGKIFAMFGG
NAKGATKGTMIAHPYSVLVKVDDSERLALVQDERFYYPAYMGPYGWLGLD
FAIAEVDWDEVAELLDASYRLIASKRLIKLLDQRPPGGPDR
169630426YP_001704075.1 NAD-dependent DNA ligase LigA [Mycobacterium abscessus ATCC 19977]MDSDIQRQWGELAEEVRGHQFRYYVKDAPVISDGQFDELLRRLTALEEQY
PELRTPDSPTQLVGGAGFVTEFRSVDHLERMLSLDNAFSSDELTAWDARV
RGDIGQEPEYLCELKIDGVALSLVYENGVLVRGATRGDGRSGEDVTLNAR
TIEDVPERLAKSEKYPIPALLEVRGEVFFRLEDFEALNASLVEESKPPFA
NPRNSAAGSLRQKNPAITARRRLRMICHGLGRAEGFSPESLHDAYLALGE
WGLPVSTHTTKVRGIAKVQERVNYWAEHRHDVEHEIDGVVVKVDTVALQR
RLGSTSRAPRWAIAYKYPPEEATTELLDIRVSVGRTGRVTPFAYMTPVKV
AGSTVSLATLHNASEVKRKGVLIGDTVVIRKAGDVIPEVLGPVADLRNGN
EREFVMPTACPECGTTLAHEKEGDADIRCPNSRSCPAQLRERVFHVAGRG
AFDIEALGYEAAIALLAAGVIEDEGDLFGLTADDLLRTDLFKTKSGALSA
NGARLLDNLDKAKQQPLWRVLVALSIRHVGPTAARALATEFGDLEAIEGA
SVEQLAAVEGVGATIAAAVVDWFSVDWHRAIVDKWRAAGVRTADERDDSI
PRNLEGLSIVVTGSLPGFSRDEAKEAIIARGGKSASSVSKKTAFVVVGDS
PGSKYDKAVELGVTILDEDGFRALLADGPPA
169630425YP_001704074.1 glycosyl transferase [Mycobacterium abscessus ATCC 19977]MSRTRERLILAAILLTITVVYLWDISQNGWSNAFYAAAVQSGSESWKAWF
FGSFDPQNYVTVDKPAGGLWLMGLSARLFGFSSASMLIPQAILAIASAAL
IRAAVRRQAGPGAGLLAAALFALIPVVSVMFRHSNPDAPMVFGMVLAAYF
TTRAIDSKRSRSAAGWLALAGAGIGFAFLCKTLEGLLVAPALLLAYLVSA
KWPWKTTLLHILGAGVALLASSGWWMAAVALTPAASRPYVDNSTDNSEWT
LAVGYNGLDRLLGGDSQGMGGGRGSGPGFSGTPGIFRLFQDTQADHIAWL
LPTAFIALILGVIIAGKTPQTGGWLGRARAVTTNPAGAGLVLWGTWMVSN
YVILSYMAKQFHPYYTSAMAPAIAGCVAIGTVLLWRHRSERIGTFGLSAL
TLSATVMAFVLLRRIPTWQPWLRWVLLIGGLVVAIALTLGVLERNSRLRY
AIATLALAVSLGGSIAFTLANVTTPKLGGLSTSGPAIAEDDKFGGQSPEP
LDPALAALIKDSGARWPVATTNTRTAAPIQLDTDAPVMAIGGFSGRDNPI
TLQQFIDYTQDGTVQFYAESVKDKDKDKDQPPKDDEPKRVADEIQKWVEN
HFSSKDYGDLRVFDLSIPPKS
169630424YP_001704073.1 hypothetical protein MAB_3343 [Mycobacterium abscessus ATCC 19977]MPSYLLRLQLADRPGSLGSVAVALGTVGADILSLDVVERGPGYAIDDLVI
DLPPGSMPDSLITAAEALNGVHVHSIRPHTGLLEAHRELELIDRVAAAAA
SARLEVLAQEAPHVLRANWCTVVRQDGTGFIRVAGSAGAPETQATSAPWL
PLSRAQVLETTAEWVPQLWKDMDTTLAAAPLGSGDTAVVLGRPGGPEFRP
SEVARLGYLAGIVATLVR
169630423YP_001704072.1 glutamyl-tRNA(Gln) amidotransferase subunit C [Mycobacterium abscesMSAISRDEVAHLARLARLALTDAELDGYAGQLDAILGHVSQISAVSTDEL
DEVDATSSPLDAVNVTRPDVIAECLTPEEALAAAPRVAEGRFAVPQILGE
EE
169630422YP_001704071.1 aspartyl/glutamyl-tRNA amidotransferase subunit A [Mycobacterium abMTDLIRQDAAALAALIHSGEVSSVEVTRAHLDQIASTDETYRAFLHVAGE
QALAAAKDVDDAIAAGSVPSGLAGVPLALKDVFTTRDMPTTCGSKILENW
VPPYDATVTARLRGAGIPILGKTNMDEFAMGSSTENSAYGPTRNPWDVER
VPGGSGGGSAAALAAFQAPLAIGTDTGGSIRQPAALTATVGVKPTYGTVS
RFGLVACASSLDQGGPCARTVLDTALLHQVIAGHDPRDSTSVDEPVPDVV
AAARAGASGDLKGVRVGVVTQLRGDGYQPGVMASFDAAVEQLTALGADVV
EVSCPHFEYALPAYYLILPSEVSSNLARFDAMRYGMRVGDDGTHSAEEVM
ALTRAAGFGPEVKRRIMIGTYALSAGYYDAYYGRAQKVRTLIKRDLERAY
EQVDVLVTPATPTTAFRLGEKVDDPLAMYQFDLCTLPLNLAGHCGMSVPS
GLSADDGLPVGLQIMAPALADDRLYRVGAAYETARGALPAAL
169630421YP_001704070.1 sensor histidine kinase [Mycobacterium abscessus ATCC 19977]MTRPRYGIGLRLLVVNSLVVLAGIATTSVVAAIVGPPMFRRLMDQQVSPG
AGNDHPYERAFRDATAMSIGFAVAVSALAALTLSWYLSHRVHRSATALSQ
AASAVADGNYDIRVPPPRLGKEFDAVAAAFNKMAQRLGAVDEARRQMLAD
LAHEIRTPVAVLEAYMEAVEDGVQQLDQQTVATLRDQTRRLTRFSIDVNA
LSVAESRTTSIDARSVSPADLVTTAVAAFAPRYQTKGVILTSHADDGLPD
VWADPERMGQVLSNLLDNALRHTGPGGQVTVTATATGTGATIAVADTGDG
VPAEHLDRLFDRFYRADAARDRQHGGAGIGLSIAKALVEAHEGRIEAHSA
GHAAGTTFTVSLPRPSDHPEKAPGQRPG
169630420YP_001704069.1 putative sensory transduction protein [Mycobacterium abscessus ATCCMDGSSRTAAAGPVPDYRALVVDDEVPLAEVVASYLKRESFEVHLAHDGRR
ALDLAREVDPDVVILDIGLPGVDGIEVCRQLRVFSDAYVVMLTARDTEVD
TIVGLSVGADDYVTKPFSPREVVARVRAMLRRPRRAPESPAAVTPELSPP
RVFGALRINVDGREVHVGERPVTLTRTEFDVLAALSSRPGIVLSRKQLLD
TVWGDTWVGNDNIVDVHVGHLRQKLGDSPSQPRYVMTVRGVGYRMGTGS
169630419YP_001704068.1 hypothetical protein MAB_3338c [Mycobacterium abscessus ATCC 19977]MKRFAFTAITASAFAVAAMGLAGTAAASTSTGGGNAGDTVTNLQKQGYSV
QLNGSVSAPLSQCTVTDVHGVSAPPAGQSSAMSSTTVYVDVSCPDLNN
169630418YP_001704067.1 hypothetical protein MAB_3337c [Mycobacterium abscessus ATCC 19977]MEIIAALMIAAYPWYPRVTAAGSAMAVVLFTGTLSFLFATPGFFGDAWRR
SAPSRD
169630417YP_001704066.1 carboxylesterase LipT [Mycobacterium abscessus ATCC 19977]MASAPLRVVTNNGEVEGFVRRGMRRFRGIPYAEPPVGPLRLRAPRPAQPW
EGVRRCKRFGAAPYQPKIFTPQKQRSEDCLTLNVVAPEQLPDGPLPVMFY
IYGGGYFLGSSSSPPYEGSILARRGCVYVSANYRVGAFGAFDLSSLSDDR
HVIESNLYLRDLVLALQWVRENIAAFGGDPENVTIFGESAGGSGVETLMA
TPAAAGLFHKAIIQSTASGLAADADSVAYDARRFAEILGATSDNAAATVL
NASPRQLLRAQRKLIAEGGFPFGPSVDGNYLPKKPVESIEGGEAHRVPLI
IGSNADEAKLFTKAIKVMPLSEAEQLEILGRGGPGYQERITAAYVGYPSM
QARLRLAGDMFFTSSVWRIAQAHQHFAPVYVYQFDYAPWPVRAAGLEGSH
ATELLAVFGNYRGPAGPILTGSFTHRDASRVVDDVQQRWVAFARNGVPSG
DWPPYRGPDWPVLVFDRELRVEQNLGGDRRTVWDGFRLSIPSRIPRAS
169630416YP_001704065.1 6-phosphofructokinase [Mycobacterium abscessus ATCC 19977]MRIGVLTGGGDCPGLNAVIRAVVRTCANRYNSQVVGFQDGWRGLLENRRI
HLHNDDRNDRLLTKGGTVLGTARTNPDRLRAGLDQIKQTLDDNGIDVLIP
IGGEGTLTAASWLADENVPVVGVPKTIDNDIDCTDVTFGFDTALTIATEA
IDRLHSTAESHQRVMLVEVMGRHAGWIALHAGLASGAHMTLIPEVPFDVD
EVCRLIKGRFQRGDSHFICVVAEGAKPAEGSMELRDGGIDEFGHQRFTGV
AQQLGVEIEKRINKEVRTTVLGHVQRGGTPTPFDRVLATRFGVNAADAAH
AGEFGVMVSLRGQDIGRVPLAEATRQLKLVPKNRYEDAAAFFG
169630415YP_001704064.1 aspartyl/glutamyl-tRNA amidotransferase subunit B [Mycobacterium abMTELLDYDDVLTRYEPVLGMEVHVELSTATKMFCGCPTTFGAEPNTQICP
VCLGLPGSLPVVNEKAVESAIRIGLALNCEIAPWGRFARKNYFYPDQPKN
YQISQYDEPIAFNGYLDVPLEDGTTWRVHIERAHMEEDTGKLTHIGSETG
RISGATESLLDYNRAGVPLVEIVTKPIEGTGQRAPEIARAYVTALRDLLR
ALDVSDVRMDHGSMRCDANVSLMPTGAGEFGTRTETKNVNSLKSVEVAVR
YEMRRQAAVLDAGEDVIQETRHFLEQDGSTSAGRRKETAEDYRYFPEPDL
EPVAPSAELIEKLRGTLPELPWLRLGRIQQEWGVSDEVMRDLINNGAVEL
VQATVAEGASSEDARSWWGNYLVQQANSREVELADLPITPTQVAAVVALI
KDGKLSNKLARQVVDGVLAGEGEPEQVMKDRGLVVVRDDSVIQAAVDEAL
AANPDVAQKIRDGKVAAAGAIVGAVMKATKGQADAALVKDLVLKACGQA
169630414YP_001704063.1 lipoprotein LppZ [Mycobacterium abscessus ATCC 19977]MLIRSSPATGPTNEPSGRKLLVGSMAALAAAVTLLSGCVRFDPTQDQPFT
EVPRRGVAQTTTTPPPPLPGKPFPKQCPAEGVMQGCLEATSGLIMGSDGK
TALVAERATGVIKEIATSAEPKIKTTIPVDPSGDGGLSDIVLSPSYQQDR
LMYAYISTPTDNRVVRVADGDVPKDILTGIPKGPTGNAGSLAFTSPTTLV
VQTGTGGNAGAANDPNSLAGKVIRIEQPTTVGQTPPTTAMSGLGDGGAMC
VDAANGALYVTDRAPAGDRLQKLTKDGKISTVWTWPDKPGVAGCAALDSS
VMVNLVFNQTTVVVRQNPETGAVTGDPEVLRQKEQHGHVRALKLSADGNV
WGGSINKDFGTATDTEDVVFPLFPKGGGFPRANDDLD
169630413YP_001704062.1 hypothetical protein MAB_3332c [Mycobacterium abscessus ATCC 19977]MTGHSDDPQVWRKPPELVDPEDDVPSATYGGDFETTAIPQYQAERLTSSH
NVKEVGPLYDPAPLPYAEPATTQISAEAVHARHAAPWGTQDPAGDRRGTQ
DLGLLLLRVGVGAVLIAHGLRKVFGWWGGTGLSGFEATLGDRGFKYADIL
TYVGVTAELGAGVLLVLGLLTPLAGAAALAFTVNVLLSDMVSDKANRYAI
FWPEGHEFELLMIVAIVAVILVGPGRYGFDAGRGWARRPFIGSFAAVVLG
FGGAAAIWVFLNGTNPLA
169630412YP_001704061.1 putative amino acid permease [Mycobacterium abscessus ATCC 19977]MSSDIPVESKGLKGGALGLLSSVVVGLASTAPAYSLAATLGLIVASGGAL
LAGVKAPAIVLISFIPMYLIAVAYQELNKAEPDCGTTFTWASRTFGPIVG
WLGGWGIIAADVICLANLAQVAGAYSFTFVGDLGWSAASGLADSVLWSTV
AGVIWIVIMTYICYRGIEVSARLQYWLLTVEVVVLIAFAVVALIKVYTHN
AESYSLLPSLSWFWPGGMDFGTVIAPAVLTTIFIYWGWDTAVACNEESDD
PGRTPGRAAVISTFLLLATYALVSVAAVAFAGVGTEGVGLGNQENAADVF
KAIGPELFGDSFVGHLGMLLLSASILTSASACTQTTILPTARTTLSMGVY
KALPDSFASIHRTYLTPSTSTIAMGAISIVFYVLFTAISTNLLTALIGSV
GLMIAFYYGLTGFACAWFYRKRLTTSFRDLMMRGVMPLAGGATLTVVFIY
GLIQYAKPNWLIDDDGNNVTVFGVGAVAVVGVGALVLGVVLMMLWRVAAP
PFFQGQTLPRRSADLVLAPAAATTHFGLPDAVEAQQTVIAGDLSNLPEGE
VAVNPQTGEEFTKD
169630411YP_001704060.1 putative salicylate hydroxylase [Mycobacterium abscessus ATCC 19977MRVAIIGAGIGGLTAAAALRANDIDVIVYEKAHELREVGAGVVIANNGLR
ALDEVGLGDRVRAVGTQIRRTLWHTWQGESVPVPPAWPAVSPDRPVTSLP
VHRGELQHALLGALPAGTVQLGRPCQDIVETADEVRIIFADGSEERADVA
VGADGIHSAVQRVVADPVELSSDGIMAYRGLIPVERLDGVIDLNSMQMWL
GPGRSFLIYPVSRGRLLNVVAFTPSNLDAEESWTAPGDVAELSAEFAGWD
QPVQRVAGAMTETFRWGLYDRKPLNRWTTDRIALLGDAAHPMTPHLGQGA
NMSIEDAVVLATVLAGASATEVPRRLSLYESLRRDRTSRVQRNARQSGRV
YRSVDLTAQQQAAQLTEILADNWIPDYDAAATAGTALATL
169630410YP_001704059.1 MarR family transcriptional regulator [Mycobacterium abscessus ATCCMPRQSSGDSAREIEELVAATDALYFAMRRGRTSPAGTQAGMSRSQLELLA
PLLDQESMSVSRLAGTAGVAVPTATRALKQLEERGVVARTRSSSDDRLVL
VGLTSGGRARVIKAQSAFRARQQEVFEELSVADRRAMTDSLTRLAALIND
NMDARA
169630409YP_001704058.1 gamma-aminobutyraldehyde dehydrogenase [Mycobacterium abscessus ATCMSVPSSWINGRPVATHGDTHRVINPATGEAVADLKLATTADVDAAVAAAR
AAGPAWASSTPVDRSSVLAKLAAVLSANADTLVADEVAQTGKPVRLASEF
DVPGSIDNVEFFAGAARHLEGKATAEYSADHTSSIRREAAGVVATITPWN
YPLQMAVWKVLPALAAGCTVVIKPSELTPLTTLTLARLAAEAGLPEGVLN
VVTGRGDDVGYALASHPDVDLVTFTGSTAVGRKVMAAAAVHGHRTQLELG
GKAPFVVFDDADMDAAIAGAVAGAIINSGQDCTAATRALVARDLYDDFVA
GVGEVMSKVVVGDPLDPDTDIGPLISAAHRAKVSSIVDRAPAQGGRIVTG
ATAPDLPGSFYRPTLIADVAETSEVYRDEIFGPVLTVRPFTDDDDALRQA
NDTAYGLAASAWTRDVYRAQRASREIRAGCVWINDHIPIISEMPHGGFGA
SGFGKDMSDYSLEEYLTVKHVMSDITGTADKDWHRTIFAKR
169630408YP_001704057.1 AsnC family transcriptional regulator [Mycobacterium abscessus ATCCMANKTRRLLRVADPSNGSAAFPLDEVSKAIVEELQQDGRRPYATIGKSVG
LSEAAVRQRVQRMIDAGVMQIVAVTDPMQLGFKRQAMIGIRCSGDTTEVA
DRLSELEAVDYVVLTAGTFDAIVEVVCEDDDDLLDLLNKQIRAVPGVTST
ETLVYLKLVKQQYNWGTR
169630407YP_001704056.1 hypothetical protein MAB_3326c [Mycobacterium abscessus ATCC 19977]MTSVDVVQDLSGDLHAKSSRHLWGHFARHGAGIAPPIITRGEGVRIWDDR
GKSYIDGLSGLFVVQAGHGRAELAQAAARQAEKLAYFPLWSYATEPAIEL
ADRLAGYAPGDLNRVFFTTGGGEAVESAWKLAKQFFKLTGKPGKHKVISR
AIAYHGTPQGALAITGLPAFKAPFEPLTPGGFRAPNTNFYRAPEPYAHDS
KAFGQYCADRIAEAIEFEGPDTVAAVFLEPVQNAGGCFPPPPGYFERVRE
ICDEYDVLLVSDEVICAFGRIGSMFACEDFGYQPDIVTCAKGMTSGYSPI
GAMIATDRLFEPFNDGKTTFPHGYTFGGHPVSAAVALANLDIFEREGLND
RVRENAPVFRATLEKLYDLPIVGDVRGEGYFYGIELVKDKAAKTTFSDEE
SERLLRGFLSAALWDAGLYCRADDRGDPVIQLAPPLISGPREFEAIEQIL
RGVLTEAWARL
169630406YP_001704055.1 saccharopine dehydrogenase [Mycobacterium abscessus ATCC 19977]MRILIVGAGGVGSAAAFIAARRDFFEALVIADYDIARAQAVVDRLGDSRF
MAARIDASCADDVTALCREHRITHALNAVDPRFVMSVFDGCFAAGVTYLD
MAMSLSHRHPDKPYELPGVMLGDEQFAATEKWKAAGLLALVGIGVEPGLS
DVFARYAADHLFSEIDELGTRDGSNLEVRGYRFAPSFSIWTTIEECLNPP
LIWERGKGFFTTEPFSEPEVFDFPGGIGPVECVNVEHEEVVLMPRWVNAR
RVTFKYGLGAEFINVLRTLHLVGLDSTAPVSVHANGGTAAVSPRDVVAAC
LPDPAGLGHLMRGATCAGLWVTGTGKDGRPREVYLHHVVDNEWTMARDGA
QCVVWQTAVNPVVALELLAEGVWSGAGVLGPEAFDSLPFLDRLNTFGAPW
GIQERAVAA
169630405YP_001704054.1 hypothetical protein MAB_3324 [Mycobacterium abscessus ATCC 19977]MAEAKRTVIRTSPMAHFVTGFLALGMLSFVLALPILAPLLLIPIGLSYAI
ARYRTAVNAESAQIRTLTSTKTVPWSQIEGLTFDKHAWAQAKLTDGSTIR
FPGVTFSTLPILSAASNGRVPNPYEGVRRD
169630404YP_001704053.1 acetolactate synthase 1 catalytic subunit [Mycobacterium abscessus MSAPAKPKPASASGRAPGTAPEPNTVAPQRVTGAQSVVRSLEELGVEVIF
GIPGGAVLPVYDPLYDSTKVRHVLVRHEQGAGHAASGYAHANGKVGVMMA
TSGPGATNLVTPLADAQMDSIPVVAITGQVGRGLIGTDAFQEADISGITM
PITKHNFLVSNAEDIPKVIAEAFYIAQSGRPGAVLVDIPKDILQAQTTFS
WPPQIYLPGYKPVTKPHGKQVREAVRLIAAAKRPVLYVGGGVIRADASPE
LKELAELTGIPVVTTLMARGAFPDSHELHMGMPGMHGTVGAVAALQRSDL
LITLGARFDDRVTGQLDSFAPEAKVIHADIDPAEIGKNRHADVPIVGDVK
NVIIELIEAIRADRAAGTVADPLSEWWEYLSDVRKTYPLGYDAQHDGSLG
PEFVIETLGKIAGPDAVYVAGVGQHQMWAAQFIKYENPRTWLNSGGLGTM
GFAVPAAMGAKMARPEAEVWAIDGDGCFQMTNQELATCAIEGVPIKVALI
NNGNLGMVRQWQTLFYEERYSQTDLATHSRRIPDFVKLAEALGCVGLRCE
REEDVAKVIEEARAINDRPVVIDFIVGADAQVWPMVAAGTSNDEIQAARG
IRPLFDDDELVADE
169630403YP_001704052.1 acetolactate synthase 3 regulatory subunit [Mycobacterium abscessusMTSTHTLSVLVEDRPGVLARVAALFSRRGFNIASLAVGPTELKDVSRMTI
VVTVDDFPLEQVTKQLNKLINVIKIVEQDEDNSVARELMLVKVRADATVR
AQVIEVVNLFRAKVVDVSPESVTIEATGTQSKLDALLRMLDPYGIREIVQ
SGVVALSRGPRSIAAAK
169630402YP_001704051.1 ketol-acid reductoisomerase [Mycobacterium abscessus ATCC 19977]MFYDDDADLTLIQGRKVGVIGYGSQGHAHSLSLRDSGVQVKVGLREGSKS
REKVTEQGLEVDTPEEVAKWADVIMILAPDTAQAEIFKNEIEPHLKDGDA
LFFGHGLNIHFGLIKPPANVTVAMVAPKGPGHLVRRQFVDGKGVPALIAV
HQDPKGEGQALALSYAKGIGGTRAGVIKTDFKEETETDLFGEQAVLCGGT
EELVKTGFDVMVEAGYAPEMAYFEVLHELKLIVDLMYEGGIARMNYSVSD
TAEFGGYLSGPRVIDAGTKDRMRQILKEIQDGTFVKRLVANVEGGNKELE
GLRKENAEHPIEVTGKKLRDLMSWVDRPITETA
169630401YP_001704050.1 hypothetical protein MAB_3320c [Mycobacterium abscessus ATCC 19977]MTTSRPSTVVSRLAAPAVVAGAAAAGCAAVWFGDPTTPGGVLPVCPLKAL
TGLDCPGCGGLRMAYSLMHGDVLGALRYNAVGLVAAGFLAACFVAWTASR
WRGESGWNPPWLRGRTPAIIAVVFVAWFVIRLIPVAPFTALRV
169630400YP_001704049.1 hypothetical protein MAB_3319 [Mycobacterium abscessus ATCC 19977]MPSTAAHATTPRSAGMPPRGDAKARIWRRGEGATPAGQRTGPDGHPDFGY
FGPDSVTWRVFLHPSVAPMIVLVTALLEGSHEGLQAVEINHDPVFTKSKR
NQVDFDDTVKRIQRTAGVPIPIIFGDTASADALAAHLRHYHRNMKGIIPG
TDRPYDAQGPALVLFAHVTIMHAALRIYENTPAPGRLIPRRLPKAERDQF
FAEVKTFAELMGADPDTVPVTSDEVAAYYESIESEYRMVKGFVPGGARFA
LSVIRNARGFGGLTAAAVAAITLVTAVPSVAVVPPKVRRHLGIPRIADPV
LAMLLRVAQPAFVPFTLEPLAREISRLFIGDDGITLGENARELMERSA
169630399YP_001704048.1 putative regulatory protein [Mycobacterium abscessus ATCC 19977]MLRLIFTANDLALTRFLPMPAPLLEMKFATRALRRGIRTPWGERWRCHAL
AAFPIATAPGRAVVSHFSWSLSPTVLGDDFDEGMQSIEKLDRRQAQAELA
VFGRGPTEGAGAPHYLRHAIAGDREATRALGRMTKDAYRAVLEPYWPEIQ
ANHQIELVRQGRAMARHGVRAALGMIIPGARWNGDCLEIDSPQRHTIALR
GRGMVLTPSIFWAGPPLVGELDEQPVVLAYPAPIDLTLTIGTESDPLAAI
LGSTRAAVLRLLAEQHTTGDIARNLGISPASASEHTSALRHARLVRSRRD
GKAVIHDATALGMDLIDANRR
169630398YP_001704047.1 peptide synthetase NRP [Mycobacterium abscessus ATCC 19977]MSVDPSRTLSSLDLLDDDEHAQLATWGNQAVLKECPDTMPSIPAVFARQV
ECTPEALALTFDGQSMTYRELDEAANRLSHLLVGAGAGPGQFVALLFPRS
TEAIVAILAVLKSGAAYLPIDPALPTTRIEFMLTDAAPVAAVTTAVLAHR
LHGLGVPVLDVDDPAVCTQPCTAPPMPSPEDLAHLIYTSGTTGVPKGVAV
TQRNVVQLFDRLDIGVELAPGQVWTQFHSYAFDFSVWEIWGALLHGGRLV
VVPDSVARTPEDFHDLLMGERVTVMSQTPSAAGVLSPDGLEATALVIGAE
PCPPELVDRWAPGRVMVNVYGPTETTMWACKSAPLSAGSEGHGVPIGSPV
AHAASFVLDRWLRPVPDGVIGELYLAGAGVGSGYWRRTALTGARFVACPF
GMPGDRMYRTGDLVSWGADGQLQYLGRADEQIKIRGYRIELGEIQAALVR
LDGVRQAAVIVREDRPGDKRIVGYITGGADPVGARAALAEQLPAYMVPVA
VVALQTLPVTVNGKLDKQGLPAPEYSGVDFRAPSTPVEEALAGIYAQVLG
VDRVGADDSFFDLGGDSILAMQVAGRARAAGVLCRPRDIFVEQTVARLSR
VVTLAENEIRNVDDGIGPVAPTPIMHWLHSVPGPVERFNQTVVLQAPAGA
AEADIVVLLQALLDHHGTLRLHAENNDGGWSLRVPEKGAVDARACIRTVE
ALSDEAVEAACSRLDPGAGAMLSALWAPAEGKLALVIHHLAVDGVSWRIL
LEDLNVAWAQRRSGLDVALSGAGTSFARWASLLREQALSAGVVESADVWR
SVSAVPPALPVVRPGVDTYAVAGTLSVALDADVTRMLLGEVPAAFHAGVQ
DVLLIAFALAWNEFLGAGGAPIGIDLEGHGRAEELAADIDLSRTVGWFTA
KYPAALSVGDLSWAQVSGGDSALGLVVKSVKEQLRGLPDPLSYGLLRYLN
PEVALPHSDSAIGFNYLGRLGAGATEASEDIWTISHEGLSWTSASSTVPM
PMAHTVELNAGILESSVESGPRLQAVWTWAPSLVDAIQVQRLSRLWFEAL
VGICTHVRTGGGGLTPSDILPARLTQGELDELTKCLRVADVLPLTPVQQG
LLFHSAIAARADSAAAGTALADIYAVQLNLTMTGAVDPRRLYNAMHAVVK
RHPNLVARFCTRFGEPVQVIPADPMICWQQTEFESTEELERFCAAERVAA
CDLAGKSTFRSALVRTGGDKHRFILTFHHVVIDGWSLPILLREIFAIYFG
QALAPAPSYRGFVSWLAQQDREAARAAWRKALEGFEAPTLVAPRSVPGSR
GVASYRISAETTRALGDLARSQHTTVSTVLRAAWAQLLMVQTGAHDVAFG
TVVSGRPALLTGADSVVGLLINTVPVRARATATTTVADLLRDMQSIHNDL
LEHEHLALNEIHHLAGHDRLFDTLFLYENYPVDVSTFMGTHELGITEFTS
REYNHYPLSVMALPGHELGIRIEYDTDAFDVADIGALVQRLRRILGAMTA
APARRVLSIDVLEVAERGRLDSWGNRAVLACATAASSSIPEVFARQVDRA
PQAVALTFQGRSMTYRELDHAANRLAQLLASRGAGPGESIALMVPRSDDA
IVALLAVLKTGAAYLPIDPAVPVARLEFMLADAAPIAVATTAELRQRLAG
SSIPVLVIDEHVVDEPAAVSLQAPRPDDIAYTIYTSGTTGTPKGVAVTHR
NVTQLLETLPVGLPAGPGQVWSQWHSMVFDVSVWEVWGALLHGARLMVVP
EAVAGSPQHLHDLLVTEKVSVLHQTPSAIGMLDWDGVDDMAVVVAGEPCP
PEVVDRWAPGRLMLNAYGPTEATIYAAISMPLSPKTSPVPIGSPVRGGAT
FVLDGWLRPVPPGVVGELYLAGSGVGVGYVHRSGLTGSRFVACPFGRPGV
RMYRTGDLARYSEDGQLQYLGRTDEQVKIRGYRIELDEIRSALAELDGVE
HAAVIVREDRPGDKRLVGYVTGTADPTMLRTLLGERLPQYMVPAAVVAVD
AIPLTINGKLDKRSLPAPVYHDAARYREPVSPVERTIADIYAHTLGLERI
GVEDSFFDVGGDSISAMRVVAAINTALDVDLEVWTIFDAPSVRSLSARLN
GAVSASPIAESSRTSCASVHGRGVTQVMATDLTLDKFVDVTALIANRSRR
HPRGDVREILLTGATGFLGRHLVLHWLREMEHAGGTLTCLVRGSSHEEAR
SRLEKSFDSGDPGLMALFRRLAADRLKVVAGDKGEPHLGLEPQTWEHLAE
SVDLVVDSAAFVNSVLPYEELFRPNVVGTAELIRLALTAKLKPYTFVSTS
DVGRQVDRSKFTEVADIREISPSRVLDAGYANGYANSKWAAEVLLREAHD
MFGLPVAVFRSSMVMADTSYAGQLNMADTISRMVLSIMATGVAPESFYQL
DMHGNRQRAHFDGLPVEFVAEAIATLGSQATDGFETYHVMNPHDDGVGID
QFVDWLVEAGHPIERVGNFGVWLQRFEAGLRALPNPQRQNSVLQMLMVLK
QHGQLRAPAPTCGSYAPADRFQAAVRRAKIGSDQDIPHISAPIILKYVTD
LQMLGLL
169630397YP_001704046.1 cytochrome P450 [Mycobacterium abscessus ATCC 19977]MTTANPVTPRIPWDSRDPYVYLEDLRAHGDVVLDENAGTWVVLGYQPARE
VLGGSGWSSDPLASPQLRAQAPEFLDSSGFGRNMLFADEPDHTELRGTVR
DVFTPGFIAGLREGVHTIASHVVEYPSTGEYFDFMADIALPLPIAIIGEW
LGLDDSSAAVLRQESPAIIQMLGAFADVDTVMAGTAAGVTLATELLPLAA
DRRAHPGDDLLSLIASNTDLPLEDVVTTALIIAIAGHETTANLLGASMVR
LLTPRPDGTRLADDIDPDDPTVITELLRLDGPVLATARVATRAHTLAGNT
IEGGQTVLIAIAAANRDPQVFVDPAVFRRDRTSPPLAFGYGTHHCLGSAL
ARLETTLVLREVLARQPVITGPVSWRDTPAIRGPRSIPMRFQT
169630396YP_001704045.1 putative ABC transporter ATP-binding protein [Mycobacterium abscessMSDRHIPRGRIRRTMPLAGFTARAAGGRLVAGLREKAGDTGAINRFHERT
AERYTELLGHSKGVLMKAGQIFSVADIASHGYAQLTPYQNALTRLQADAP
PMHPLLARQALEEDLGRPVEDLFSAFCDDPIAAASIGQVHRATLHDGRQV
AVKIQYPGVAQAIRHDLSNAELMATFLRFATGIAGPKPQLDHRQMADEVA
ARISEELDYRHEAANIQAFAALYDGHPFIRIPEVISGASGNRVLTMTYLD
GLDWTAAQQADQDLKNVWVEAIWRFSTGSFRHANLFHADPHPGNYRFGLD
GSVGFVDFGCIKVVPEPLRYRLVRMIRAAADERREDLRQLMVDAGYFAAD
SPLSSQDVFDWLGSTVQDIRAPQPVTFTREVSTSATRSLLNFQTLHQMSI
PSDLVFLARINLNISALSATLNATGHTRALLDDLDGVGEPVSPLGRQHIA
WVRDRGLPFGLDRHDHC
169630395YP_001704044.1 hypothetical protein MAB_3314 [Mycobacterium abscessus ATCC 19977]MAEEPVPRGRIRRTMPLAGFTARAAGGRLVAGLREKAGDTGAVDRFHHRT
AERYTELLGHSKGVLMKAGQIFSSIDMNGADGGISPYEQALTRLQTQSPP
MAPALARSVLESELRVPTSQAYASFTDDPISAASIGQVHRATLHDGRDVV
VKIQYPGVAQAIQDDLANTELVTTFLRVTFALLDRRYAIDLPATARDISA
QIKEELDYKQEAENISAFHRLFAGHPFIRVPQAVPELSTRRVLTMTYVDG
IDWTEAQQADQELKNTWAEALWRFSLAPLQHACAFYTDLHPGNYRFGLDG
SLGIVDFGSVKNLRESHRLAWIRMVAASIQQRPADLHSTMKEAGFLAAHS
SMSADEALRWMNEINADATLPQPVTYTPQLIDRNLTALDSSLSRRISLPP
ELIYLVRFPLGVRSAMSKLGATVSSRSAAADMIGIAEPDTALGIRHVAWV
KERGLPFGLDPREQSEVGARL
169630394YP_001704043.1 TetR family transcriptional regulator [Mycobacterium abscessus ATCCMGEISTKERLVTEAMRLFGEQGYKATSVAQIEKAAGLTPGSGGLYHHFKS
KEALLEAGIDRQLDRRRAMRDIRALFGGLGDLRNELTMMGRYVLAVLDEE
SQLLQIASSVPSGRPARLDHAYAALFDGLYGELSDWVQGWAPDISKQDAE
SIGVLGVNALLGKRATSAVFRGAARDIADEDYVVEWTALLAMRIESLR
169630393YP_001704042.1 TetR family transcriptional regulator [Mycobacterium abscessus ATCCMNGKTAVQRHRKLTEKGQATRARILEQAAELIHTKGVAATNNEQLRRVTG
ISGSQLNHYFPTKESLVMAVIEWQTEQVMRFYGSEQFAGFDTIEALRSWV
DYYVTHESAYRDGCTLGSLASQIIKSDLQVHDELARAFDQWRNIFRDGLR
RMQSLGRLSATADPTQLADLLLSAFQGGMLLTQVQRDVTPLKNALHAAID
HVQTFAE
169630392YP_001704041.1 hypothetical protein MAB_3311c [Mycobacterium abscessus ATCC 19977]MSRLTTPASEDITAEAESALGTVGRQFGFVPNMFAMLASNPAVLDVVMSL
QGSLGRVLDAKTRHTIALAVSEANGCDYCLAVHSYVSAELGGMSSDDIDL
ARSGSSIDPKRAAVARFAQRVVETRGKVGDSDLAAVRGAGYADSQILAIV
TVAVQTLLTNYINNVNQTVIDIPAAGTAA
169630391YP_001704040.1 oxygen-insensitive NAD(P)H nitroreductase [Mycobacterium abscessus MNLDNLMSKHLTRYFDSSKTIPAESLQQLLRFLRTVPSSVNVQASRYYVL
GTPEGKERLAGNLGERFLDNGGKIRDASHVLVFTTRADVPDSHLEEVFGK
EKADGRFPDPAKQSRWESMTRDFLNLRTYGYKDLTHWMEKQTYLALGMTM
MAAAELGFDATPLEGFDPATVDEAFKIRETGYTTTVLLALGYPDAANTYN
NPISRLDHDRLFTFA
169630390YP_001704039.1 hypothetical protein MAB_3309c [Mycobacterium abscessus ATCC 19977]MSTRTDALSVVCQNNAPVVRALAHIVARYGLAIVIGWIGIFKFCSYEALN
IQPLVANSPFMGWLYGVFSVQTFSSILGVVEIVTAVLLVVKPWYPRVSLA
GSALAIVLFVSTLSFLITTPGVGEASAGGFPFLSMTGQFLIKDIVLLGVS
ILTLADAMEAITHHAASTQART
169630389YP_001704038.1 LysR family transcriptional regulator [Mycobacterium abscessus ATCCMELRQLEHFVAVAGEMSFSRAVQRAHVVQSALSTSVGKLEKELGVELFDR
TRQQIRLTPAGELFHTHATRVIQAARYAKDSIGNFRGELTGTVDLGALIT
FGPLDVPKMLGQFHREYPLVQIRLRQSQSGSNAYLSAIADGTLDLALVSA
PDRFPAGIQMRLLCQEPMMFVCRPDHRLAQRRHVTVTELVDEHLIGFPPQ
FSLRRIVEDAFTAAGVTAFTPHEVALEYAIAASLVHHGLGTIFMPASEAA
QFPHLRALAVRPAIIWKIYLASAEQSQLGPASAQLAEHLVASAHAQTNSP
KT
169630388YP_001704037.1 putative zinc-binding oxidoreductase [Mycobacterium abscessus ATCC MKAIVAEQGAKGAGLSLTAVPYPHAAENDVIVQVHAAGFTPGELDWPGTW
ADRSGRSRGPSIPGHEVSGIVVELGYGTTGLTVGQRVFGITDWTRNGALA
QYVAVEARNLAPLSADVDHTVAAALPVSGLTAWQGLFLHGHIVAGQSVLI
HGAAGAVGSVAVQLAHEAGAHVIGTGRGGQRDQVLGLKADDFVDLTTDTL
EDIGQVDVVFDVIGGEILDRSAQLVRAGGALITIAEPPRVIPEGARAVFF
VVEADRRQLTILENKLRDGRIRQNIGSVIPLEDALSAFDIDRKTPGKTIV
QIAAV
169630387YP_001704036.1 hypothetical protein MAB_3306c [Mycobacterium abscessus ATCC 19977]MHKIDRIRLVEVALRVSLAAAFLSAVADRFGWWEPFGQGTWGNMASFAAY
VNQMIPFVSGWPLTVIAWASTAAEVILGILLLIGWKPSLVGAVSCLLLIT
FGIAMALSLGAEVPLSYSVFTAASAAAAYAIRSAPPHTRGTRGVV
169630386YP_001704035.1 hypothetical protein MAB_3305c [Mycobacterium abscessus ATCC 19977]MAVMISRRGWLVASAVALSGQAIPACSAPKSAHKAEGGASVVEFAGKLPD
SAELRRRCRVVALLDALVEGRALARDDIGTVYQPNWRSGDDLVKYQNGGG
DEWSIVFSATDGVFLRGFDHESDLSTYNEDDYWPGLVGDLPERFRSDLKN
PDLYGYYDGAPQMTVCVWRGPADVAWRHGNPERTQWGYHGDGGEHLFDPL
IDWHASKELDWLYPAQGHVVPESAVQQVMDRKPLTDELIRAFHPNPDITA
LRAVATQIGY
169630385YP_001704034.1 D-3-phosphoglycerate dehydrogenase [Mycobacterium abscessus ATCC 19MLIADKLAPSTVEALGDGVEVRWVDGPDRPALLAAVPEADALLVRSATTV
DAEVLAAGTKLKIVARAGVGLDNVDVKAATARGVLVVNAPTSNIHSAAEH
AVTLLLATARQIPAADASLKAHTWKRSSFNGTEIFGKTVGVVGLGRIGQL
FAQRLAAFGTHIVAYDPYVSAARAAQLGIELLTLDELLGRADFISVHLPK
TPETAGLIGKEALAKTKPGVIIVNAARGGLIDEAALADAIRSGHVRGAGL
DVFSTEPCTDSPLFELDQVVVTPHLGASTSEAQDRAGTDVAASVQLALAG
EFVPDAVNVGGGVVSEEVAPWLEVVRKLGVLIGAVSEQLPTSLSVDVRGE
LASEDVAVLKLSALRGLFSSVIEDQVTFVNAPSIAEERGVSAEITTATES
PNHRSVVDVRAVYADGSVINVAGTLSGPQLVQKIVQINGRNFDLRAEGVN
LVINYADVPGALGKIGTVLGGAEVNIQAAQLSQDASGAAATIILRIDRTA
PDAVLDEIRAAVGATTLELVDLS
169630384YP_001704033.1 3-isopropylmalate dehydrogenase [Mycobacterium abscessus ATCC 19977MTKLAIIAGDGIGPEVIGEAVKVLDAVLPGVDKTEYDLGARRYLATGELM
PDSVLDELRGHDAILLGAIGDPAVPSGVLERGLLLNTRFALDHHINLRPA
KLYPGVTGPLAGNPAIDLVVVREGTEGPYTGNGGAIRVDTPHEVATEVSL
NTRFGVERVVRNAFERAEARSKNLTLVHKNNVLKYAGTLWTRTVNEVAAE
YPDVQVSYQHIDAATIHMVTDPGRFDVIVTDNLFGDIITDLTAAVTGGIG
LAASGNIDGSGKNPSMFEPVHGSAPDIAGQGIADPTAAIVSVSLLLDHLG
ETEAAARVERAVEQHLATRGEEKLSTSATGDRIASFL
169630383YP_001704032.1 major facilitator transporter [Mycobacterium abscessus ATCC 19977]MVTMVHVDEVGTARRWAMLAIALGSTAGANVFINGVAFLIPALHAERGLD
LANAGLLSAMPSFGMVLTLIAWGALIDKFGERIALVSGLALTAVAAFAAA
ESPSLTVTGAFLLLGGAAAAACNSASGRVVVGWFPPHQRGTVMGIRQMAQ
PLGVAAGALVIPRIAEGHGVATALLFPAIVCAVSSAVCLVGIIDPPRPPR
SEAPEEHLANPYRGSRVLWLIHGVSVLLVVPQVVVWTFTLVWLVTDRGWS
IGAASVMVTVAQLVGALGRVAAGMWSDRWGSRMRPIRAIAAAASATMALL
AVTNQLDWSVSVVVMLVASVITVSDNGLAYTSIAEIAGPFWSGRALGAQN
TGQLLAAAVAPPIFGAIAAAAGFSAAFAVCALFPLAAVGLVPVKLERPAP
169630382YP_001704031.1 hypothetical protein MAB_3301 [Mycobacterium abscessus ATCC 19977]MGSKMASNWQKLPNPPQLREFPFNVFARFLPGRDIRATAEQRESFRRFAH
AGDPLADAVVAMFARFPVGQGRRMFETAIEEGIDAVENPPEELVAFFEQI
DARPYWLDDKKLELAARVSMRTGVVGLGLALPGLALTGGYLSSRADKPLV
GTGNLQAMAPRRLNETAQWLIDVTSPGGLDRFSPGFKGIPRVRLMHALVR
AAMNRRDDWDYEAWDSPVNQIQLAGTLMLFSLANLAGCQAMGMSFSDSER
ESVFHFWRYVGLLMGIHPELVPTSEEDTWRLFWLEADTEFLPDDDSYALT
QALHASIPGEPVFMRLSRTYLSSYSRLILGKTNADRLGLPDNKPMQAAVV
GTSVMNWFFERRNVLPGMTRISEEIGQFARRQIVSQGMSQSGGDRTYRRH
DNLATAS
169630381YP_001704030.1 TetR family transcriptional regulator [Mycobacterium abscessus ATCCMPSRTYGGATSGERRARRRAALLDAALDLVAGSGVKGLTVRGVCAEARLN
DRYFYESFRSTDELVLAMLDEQMLAGSATIIEAIAKSSTSKDPVVRTRAA
VGSGLRFLTADPRRGRLLVESQATEGLAARRRDLVKTLAQVMADQGRVLL
PADDALDPDLDLATFTLVSGGLDLVTTWFRGELDITRDRLEDFLVALVTR
ANIRADQHEDSGEAAKPGN
169630380YP_001704029.1 hypothetical protein MAB_3299c [Mycobacterium abscessus ATCC 19977]MRLGRIASPDGVAFVSIEGEDGREESAIAREIAEHPFGTPTFTGRQWPLA
DVRLLAPILASKVVAMGKNYAAHAAEMGGDPPESPVIFIKPNTSIIGPGL
PIQLPPSATEVHHEGELAIVIGRPCKDVPAARAAENILGYTIGNDVSARD
HQRADGQWTRAKGHDTFCPLGPWIVTDLDPADLEIRTEVNGQVRQRSRTS
LLLHDVGAIVEWVSAVMTLLPGDVILTGTPEGVGPIVDGDTVSVTIEGIG
TLSNPVVRKAK
169630379YP_001704028.1 glutamyl-tRNA synthetase [Mycobacterium abscessus ATCC 19977]MSNTKIRVRFCPSPTGTPHVGLIRTALFNWAYARHCGGDFVFRIEDTDAG
RDSEESYLAILDALRWLGLDWDEGPEVGGPYEPYRQSQRKELHREVVRKL
LEAGEAYEAFSTAEEVEARHLAAGRNPKLGYDNYDRDLTEEQRAAFRAEG
RDPVVRLRMPDHDITWNDLVRGETTFAAGVVPDFALTRGNGDPLYTLVNP
VDDALMKITHVLRGEDLLPSTPRQIALYEAMIRIGVTDSIPAFAHLPSVL
GEGTKKLSKRDPQSNLFLHRDRGFIPEGLLNYLALLGWSIADDHDIFSLA
EMVTAFDVTDVNSNPARFDQKKADAINAEHIRLLAPEEFVTRLRTYFAAH
GHELGLDESAFAVAADLVQTRIVVLGDAWGLLKFLNDDAYAIDPGAARKE
LGEASLPVLDAAIGALESLEAWTTPAIEGALKSALIEGLELKPRKAFGPL
RVAVTGATVSPPLFESMELLGSGRTLTRLRNARSWENGVGDQTDSG
169630378YP_001704027.1 hypothetical protein MAB_3297 [Mycobacterium abscessus ATCC 19977]MGQLARDALDSFREGLRHKKIKRPLSDALVHHLGTGDAAGQYDDRIHELR
AETLDIEVDVDKADVYQARKFVIWTLRGRHPELTEEALRALGDYRAENWR
169630377YP_001704026.1 hypothetical protein MAB_3296 [Mycobacterium abscessus ATCC 19977]MGSNQRSQIVMSDEEITEFINNSRTTTMATVGADGQPHLVAMWYAVLNGE
VWFETKAKSQKVVNLKRNPTITCLIEDGLTYDTLRGVSIEGRAEIVEDPD
VLFQVGISVFERYTAPYTEEMKPFVEQMLNKRIAVRVRPTRVRSWDHRKL
GLPAMPLGGSTAPQQ
169630376YP_001704025.1 IclR family transcriptional regulator [Mycobacterium abscessus ATCCMRQHSGIGVLDKAVQVLTAIGDSPCGLAELCERTGLPRATAHRLAAGLEV
HRLLSRDGDGQWQLGAGLTELAAHVNDPLLSASAQVLPKLREITGESVQL
YRREGTVRICVAALEPPAGLRDTVPVGSRLPMSAGSGAKVLLAHSDPGTQ
AAVLPGATFTERALADVRKRGWAQSAAEREAGVASVSAPVRDRHGNVIAA
ISVSGPIDRMGRRPGARWAADLVAASEAITARL
169630375YP_001704024.1 3-isopropylmalate dehydratase- large subunit [Mycobacterium abscessMTSVQQPRTLAEKVWDSHVVVRGTGEGEAREPDLIYIDLHLVHEVTSPQA
FDGLRLAGRQVRRPDLTIATEDHNVPTIDIDKPIADPVSRTQVETLRKNC
EEFGIRLHPMGDAEQGIVHVVGPQLGLTQPGTTVVCGDSHTSTHGAFGAL
AMGIGTSEVEHVLATQTLPLRPFRTMAINIDGSLPTGVTSKDVILAVIAK
IGTGGGQGYVLEYRGQAVEEMSMEARMTMCNMSIEAGARAGMVAPDETTY
AYLKDRPHAPKGQLWDAAVAEWDSLRTDEGAQFDAEVHIDASTLTPFVTW
GTNPGQGVPLGADVPDPELMADEEERLAAEKALTYMDLTPGTPMREIPVD
TVFVGSCTNGRIEDLRAVADVLRDRKVAAGVTMLIVPGSMRVRAQAESEG
LGEIFAAAGAQWRQAGCSMCLGMNPDQLSPGQRCASTSNRNFEGRQGKGG
RTHLVSPAVAAATAVRGKLSSPADLAKSVK
169630374YP_001704023.1 isopropylmalate isomerase small subunit [Mycobacterium abscessus ATMEAFDTHTGIGVPLRRSNVDTDQIIPAVYLKRVTRTGFEDGLFAGWRTDP
SFILNLEPFNRGTVLVAGPEFGTGSSREHAVWALMDYGFRVVLSSRFGDI
FRGNAGKAGLVAGLVGQSDIELLWKLIEQNPGLELTVNLEDRTVTAGTAV
VPFEIDDYTRWRLLEGLDDIGLTLRKVDEIAAFEAARPEFKPRTLEPSE
169630373YP_001704022.1 DNA-binding protein HU [Mycobacterium abscessus ATCC 19977]MNKAELIDVLTQKLGSDRRQATAAVEHVVDTIVRTVHKGESVTITGFGVF
EQRRRAARVARNPRTGETVKVKPTSVPTFRPGAQFKAVVSGAQKLPADGP
AVKRGSTAAPAKRAAAKKAAPAKKAPAKKAAPAKKAPVKKAVVKKAAPVK
KAPVKKAVVKKAAPVKKAVTKAPAKKAATKAPAKKAATKAPAKKAPAKKA
PAKKGRK
169630372YP_001704021.1 MutT/NUDIX hydrolase [Mycobacterium abscessus ATCC 19977]MPDPISRTGAAVLAAGAALWRHQEHPEQDNAAGAIEVALVHRPRYDDWSL
PKGKLDPGETAAIAAVREIAEETGFTARLGRRLPSVSYPVSQGTKRVKYW
AAEALDGKFEANDEVDELRWLPVKDAIKTVSYAVDRKVLRNFAKHQIDTR
TLIIVRHAKAGRKERYSGDDTLRPLDKKGRAQAEALTGQLLAFGASAIHA
ADRLRCRQTVEPLAEELNTVIFSEPALSEEAYWADRKRAHRRVLEIAELD
GIRVLCTQGKVIPDLIEWWAQRDGVRPDKSRNRKGSMWVLSMRGQKLLAA
DHLDSPLPAGS
169630371YP_001704020.1 polyphosphate kinase [Mycobacterium abscessus ATCC 19977]MITRVTTPSVPPAATTIVSGEELPEDRYLNRELSWLDFNARVLALAADES
LPILERAKFLAIFASNLDEFYMVRVAGLKRRDETGLSVRSADGLSPREQL
KLIGERTQEISVQHARVFSESVRPELAENGIFVVTWADLSENERSYLSSY
FNDQVFPVLTPLAVDPAHPFPYISGLSLNLAITVQVPETGGQHFARIKVP
DNVDRFVRLRSPDGTESPQAAHTARFLPMEELIAAHLSALFPGLEIVEHH
AFRITRNADFEVEEDRDEDLLQALERELARRRFGSPVRLEVADDMTEHML
ELLLRELDVDPGDVVQVPGLLDLSCLWQVYGVDRPALKDPTFVPATHPAF
GQGETPKSIFSTLRDGDVLVHHPYDSFSTSVQRFIEQAAADPQVLAIKQT
LYRTSGDSPIVNSLIDAAEAGKQVVALVEIKARFDEQANIKWARALEDAG
VHVVYGLIGLKTHCKTALVVRREGSAIRRYCHIGTGNYNPKTARLYEDVG
LLTSAPEIGADLTDLFNSLTGYSRKVSYRNLLVAPQGIRAGIVERIDREI
AAHRAGQEARIRLKMNALVDEQVIDALYRASRAGVPIEVVVRGICALRPG
VPEYSGSITVRSILGRFLEHSRIIHFNAIDEFWIGSADMMHRNLDRRVEV
LARVTDPKLTAQLDDMFTSALDSHTRCWELQPDGQWLASPADGEEVRDHQ
VEMMKRHRSQT
169630370YP_001704019.1 hypothetical protein MAB_3289 [Mycobacterium abscessus ATCC 19977]MGRQAGTDFGVIIAVKNLATAKSRLAPSLPAPQRERLVLGMLTHAIAVAF
SAAGTVAVISPDPTAKAAASEAGARFIFDDTPEGHPDPLNNALRSAAAQL
RASSPNLVVLQADLPVVTATEFAAALAAARGHARSFVADRHGTGTAALFS
TDGDLNPLFGIDSAQRHRDSGAIELTGDWPGLRCDVDTPEDLAVARELGA
ALPL
169630369YP_001704018.1 glycerol-3-phosphate dehydrogenase- NAD-dependent [Mycobacterium abMATDEPLAGRRPVKAAVMGAGSWGTALGKVLADAGHDVRLWARRSELADE
INATHRNSVYLSDVDLPASIVATGVAEEALQGAELVLLAVPSQSLRANLT
PWADLIEPNSSVVSLAKGIEVGTLMRMSQVVTQVLGTDPSRVAVLTGPNL
ASEIAAGQPAATVIGCTDSTRAVALQRAFSTRYFRPYTNSDVVGCEVGGA
CKNVIALSCGMAAGVGLGENTIATIITRGLAEITRLGLALGASHTTLAGL
AGVGDLVATCTSAHSRNRTFGMRLGNGETLQEARNAAGGRVAEGVTSCES
ILALASSYDVEMPLTEAVHGVCHRGLSVTDAVAQLLGRSTKPE
169630368YP_001704017.1 cystathionine gamma-lyase [Mycobacterium abscessus ATCC 19977]MPEPGISTRAVVAATAEPVAGQPFLAGPVFASAYHLPVPEDDSLDTYGRA
SNPSWRQWESGLAALEQADAALVFGSGMGAIASTLRALVRPGQTLLVPED
GYYQTRRYASENLAALGINVITATSDQIVAAAAQADVVVAETPSNPRLDV
VDLALLARETHARGGVLVVDNTTATPMGQRPLGLGADLVVASATKALSGH
SDLIAGYVAGSRAELVAAVAQERSRAGAILGPFEAWLGARSLATAGLRFE
RQCQNALAVATMLREHPAVTSVRYPGLPSDPSYSVASAQMSRFGSLVSIE
LSSAEAVHALTRRSELLASSTSFGGVHTSVDRRARWGDAVPDGFARISLG
IEDTDDLLADIEAALAAGTV
169630367YP_001704016.1 D-alanyl-alanine synthetase A [Mycobacterium abscessus ATCC 19977]MNDSVGRSRADQQRIKVALVFGGRSSEHAISCVSAGSILRNLDQAVYEVV
AVGVTPEGGWVLTDGDPAQLAISDRTLPQVTDASGTELLLATDPRRAGQL
VNVDSSAAGQVLASVDVVFPVLHGPYGEDGTIQGLLELAGVPYVGAGVLA
SAAGMDKEFTKKLLAAEGLPIGKYAVIRPRDTTLTLDQREDLGLPVFVKP
ARAGSSFGVSRVTAWEELPAAIAHARQYDPKVIVEAAIVGRELECGVLEF
PDGDTRASVLGEIRVEGVNRDQTAAGAFYDFETKYLDDTAELDVPAKVDD
DVSDQIRELAVAAFRAIDCQGLARVDFFLAEDGPLINEINTMPGFTTISM
YPRMWDATGVDYPTLLDAMVRTALARGTGLR
169630366YP_001704015.1 hypothetical protein MAB_3285 [Mycobacterium abscessus ATCC 19977]MQSEDGPPRKLLIGIAVFGAIAALAVLFGVLKYAQFQNETRPLSVANIPA
PQANSPLCVDMASAYPGKMAGDWSRVEIAEPKPPAAAAWRRGQDSVIARC
GVERPAEFAVGTSVEQVNGVQWFRVSDSALASTTWFAVDRGVYVAVTVPD
GAGSEPLVEMSDAIAKALPAVKPDPKPLPR
169630365YP_001704014.1 thiamine monophosphate kinase [Mycobacterium abscessus ATCC 19977]MPNLGDTGEFGVISRLTAGRDLGADVLLGPGDDAAVVTVPDGRVVVSTDM
LVQDRHFRLEWSSPSDIGRKAVAQNAADIEAMGGRVTAFVVAVGAPAQTD
IAFLDQLNEGVWAEAALVQAPIVGGDLVSARELVVSVTVLGDLQGRAPVT
RSGAVVGDTVAICGALGTSAAGYRLWQEQIDEFPDLRRVHLVPAPPYGQG
PAAARAGATAMTDVSDGLLADLAHIAELSAVHIDLSSPSLEPYLQPVAGA
AGLLGADPWEWVLTGGEDHALVGMFPGVVPTGWVPIGRVTVGEPGVTVDG
AAWTRATGWDSFRLS
169630364YP_001704013.1 uracil-DNA glycosylase [Mycobacterium abscessus ATCC 19977]MTARPLAELVDPGWADALGPVADQVTKMGEFLREENSSGRGYLPSGANVL
RAFTYPLADVRVLIVGQDPYPTPGHAMGLSFSVAADVRPVPRSLGNIFDE
YQSDLGLPKPANGDLTPWSEQGVMLLNRVLTVRPGNPASHRGKGWEIVTE
CAIRALVARDAPLVAILWGRDAATLKPMLGPSVPTIESVHPSPLSASRGF
FGSKPFSRANELLVGLGAQPVDWRLP
169630363YP_001704012.1 lipase [Mycobacterium abscessus ATCC 19977]MRWSTGAFAALGGITAAVATGGTALRSPVVVDRLNDWAARRLTVQQRADP
YAAILPTPISGDDFYGDPGDLGLLAPGEVVRADRVTPRLPLRRATMQRIM
VRSTDTAGNPVPVTAALIEPERPWRGPGSRPVVVRNQAINSLGLKFTPSY
RLTHLWYRDNPPMFPFLSAQNYAVLFPDHEGPRMSYAAGKMAGHAVLDSV
RGMLSERPDLAESPIVMHGYSGGAIATAWAAQLQPTYAPELRIAGAAAGG
TPTDYALLYGSMNRGVGAGLFAAATIGQAREFPELVQIFGDFALYCAIRA
KNMPQPPLAAAGLLRFDLDLLAAIAKPFESELGQHVIAANRPGALTPTMP
VLLYHGSRSKAVGDLFIPEEGALALRDAWRANGADVDYWALPGEHVTADM
FAIPWVVNWIRRKLLG
169630362YP_001704011.1 putative enoyl-CoA hydratase/isomerase [Mycobacterium abscessus ATCMASDYIAVHNGVLHITIATAAAGTSLDFTGVDAAVQVLRDLPAEVGAILL
TSSGPNFCAGGNVRDFASAEDRSAKLHDLAGRLHAFVRAVDAADRPVVAS
VHGWAAGGGLSLVLLADIAIGGQSTKLRAAYPGIGYSSDGGMSWALPRVV
GKARAADILLTDRVVEASEALSIGLLSRVVADDEVQATAVATAEQLAAGP
REAQNRIRRLLRLSATNTLDAQLDLEQTSIAEASVSPTGIEGVDAFVGKR
KPVWP
169630361YP_001704010.1 50S ribosomal protein L28 [Mycobacterium abscessus ATCC 19977]MAAVCDVCGKGPGFGKSVSHSHRRTNRRWNPNIQTVHAVTSPGGNKQRVN
ACTSCIKAGKVVRGA
169630360YP_001704009.1 putative phosphatase/kinase [Mycobacterium abscessus ATCC 19977]MRLSVLDSAALLDWARASVEGLISRSDEINRLNVFPVADADTGTNMLFTM
RSAVNAAEALGEGATVAQVAAALARGAVHGARGNSGVILSQIVRGIADAA
DDQDAIGAEVVRRALRQASQFVIASMSTPVEGTIVSVLAAAADAADDAQS
DDLPVLVTTAADAAVSALEKTPKQLDVLADNGVVDAGARGLVVILDALVS
VVAGELPSRREYSPSPPKNAPSQVWVAGPGRGGGGLNLDPPRELPPEFEV
MYLLCGCDELQIADLRAQLDAMGDSIAIAGDGEMGHSVHAHVNDAGAAIE
AGMKFGTPQSIQISSLRGGLDVPGGGHHDGRHRHRRVLALAEGDGAATLF
SSEGAQVLRVDEPPASAKRLLDAVVDSGAHQIMVLPNGLMAAEELVAVCA
AARGWGITVIPLPSASMAQGLAALAVHDPERMAVDDSYTMARAAGATRFG
LVRVATERALTWSGTCEPGDAMGIIGDEVLVLNHDIANATKALVSIMLSS
GGELVTVLLSDEVDDSLAESLIEHTRSHHGGVEVMIYRTGQHTDVVHIGV
E
169630359YP_001704008.1 ATP-dependent DNA helicase RecG [Mycobacterium abscessus ATCC 19977MAKLSDRLDHVLGNKASDVLDAEFGLITVEDLLHHYPRRYSTDFSLRDEQ
DGESAKPGEHTTLVGFITSAELKRMRNRKGQFLSVTLGSAPHAVQATFFH
PHKVKRDLQVGNRVMLSGAVGEFRGKPQLTHPDYLVLETALGESTETRGS
TALRGIAGAARDASTAISAFQRNVFPIYPATKNLESWDIYRCIDQVLTQL
DPVPEALPDAVLAEYGLMSLDEALRKIHMSEDASEQKQARRRLAFDEALG
LQLALAMRRGSEIGSAGPPMPLAQAGLRADLLGQLPFDLTEGQRHVVAEI
GEDLAGVKPMNRLLQGEVGSGKTVVALLAMMQAIDAGYQCALLAPTEVLA
VQHARSLRAMLGSLATAGELGAPDDATSIALLTGSMSPAVKKQIKADVAT
GLAGIVIGTHALLQDSVDFHNLGLVVVDEQHRFGVEQRDRLRAKASQGIV
PHLLVMTATPIPRTVALTVFGDLETSTLRELPRGRQPITTTAVFTREKPG
WLARGWERIAEEVAAGRQAYVVASRIDADDKDSGPEEAEEKRPPPVPVTE
LYETIRGSLLPGLRIGLLHGRLPSEQKDAVMTAFNAGEIDVLVCTTVIEV
GVDVPNATVMLIMDADRFGISQLHQLRGRVGRGGNKGLCLLVSPCSPAGS
AGRRLRAVQDTLDGFTLAELDLEERREGDVLGRDQSGRAVNLRLLSLLDH
RDMIETAREMAMRACADDPELAQQPALAGMARRFLVADQIEYLDKS
169630358YP_001704007.1 hypothetical protein MAB_3277c [Mycobacterium abscessus ATCC 19977]MSNRTMLIVAIAAAIAVVVAYQVSTRYRLLRANAVAGQTNIPTLAPGQDP
LAGVIVVPKRIRGSDYQRSEFGDAWSDDTDAPSGRNGCDTRNDILNRDLT
DKSFVYTRRCPSAVGAGLLHDPYTGVQIAFTRGPKSGESVQIDHIVPLAY
AWDMGAREWQPATRWRFANDPANLIAVQGQVNKDKGDQAPGSWMPPNKEF
WCQYSMQFAEVVRGYHLSVDEQSANAIRKAAQTCPH
169630357YP_001704006.1 hypothetical protein MAB_3276 [Mycobacterium abscessus ATCC 19977]MTNTKTREQNSHHLDWGIKAPPGRVHAPVAESEALIEPFLRRCKDQENMY
VAAGFPLEGITDFWSTWFAAWNEDSPEALEECWTHDLVWTISSTGQLEYH
GRDATVDLARFGYLFARELGFYPWDGTDTHLPYYDFLDGQVRAAFPYSGA
TRTFWHNAIPWPRKPIRGCGVDRYLLRKEGNRWRIARIDTDQDVSAPFLQ
LLPFADATTRVMAWLIRTLPAAGRKLGLYDRESLYSPEYIASRRARNLPL
RTGSVTVSADKSAPPS
169630356YP_001704005.1 cytochrome P450 [Mycobacterium abscessus ATCC 19977]MIASLSDDPFWPTRKPLRASFSLLTGWGRDRPIPPGPIGLPFIGSAIPMA
RNPYKFLQDCHRRYGDIYRVPLPIHPLVLANHPDLVSEFMENTELKYSMS
APIQGKRLQKAVASVGCPVQVLEGQALRDRRKRLMPMFGKRHLSVVSDKF
VEVFTDRIDRWLLVADTGKEVNLQAELPKVVLPAFMYAMFSTRLSDDEVL
HADTATRSVMRAIASGLFLASPPNIFPLRGRENLPVSGLRLMRTIRQMIR
DRRANPTDDADLLNILLAARGDSSRPLTEIDVYSEIMSAIGGGYETIVAS
MSWTLALLLQHPEHLDRLYDEISILHGNAPTPDDLPRLPWARACFDEGQR
LQGAPINPRYAMEDTELGGYPIPKYTLVASSLYVVHRDPRWWGENAETYD
PMQFFDQDRVNARPRLAFQAFGAGPHHCMGTGMAYMMAQYLLAIIFQRYR
LHLRPGWQPRQFFSLSTLVKGGVPATITKA
169630355YP_001704004.1 hypothetical protein MAB_3274 [Mycobacterium abscessus ATCC 19977]MQKQSFAITVDDGVCMGAGYCYRSYPQLFAAAADGTSLALATAGGELLDD
ATRASQICPSGAIEIHRGKD
169630354YP_001704003.1 TetR family transcriptional regulator [Mycobacterium abscessus ATCCMDLGLVWSQLSSGQSALGDEDEERERLLDAARVEFVAHGFRRAAVADIAK
RANVSRQTLNRRCGDKDDMVSAVVGREVLQFFVTLAPLLDPKDNVEDQVV
ELFVTGMRECRVNPVVAALKEYETESMSVGLFATEHGNYQAVLTLLAMRL
MGDGYSEAGARQAAELIMRITGTLLLAPSKILRVETDDEARSFAVTYLVP
VLRAARAVTE
169630353YP_001704002.1 cutinase Cut1 [Mycobacterium abscessus ATCC 19977]MFARGTFEPPGVGGTGESFVNALRARTKGKSVEVYPVEYPASLAFATAAD
GVIDASNRVKDVAARCPNTKIVMGGFSQGAAVVAYTTADAVPPGFELPEG
ITGPMPAEVADHVAAVALFGKPSSGFLQRIDNTAPPINIGHLYVAKTMDM
CVPEDPICSPDGSDNAAHGSYGDNGMTSQAADFAARQINSPTDTVSAAG
169630352YP_001704001.1 hypothetical protein MAB_3271 [Mycobacterium abscessus ATCC 19977]MDIGIALPFMCRDYTRESTITWARLADEGPFSTISSGERISYHNQDMWVT
LAAAAAVTERVRILANVSVLPAHPVPLVAKQAATLDVLSEGRFILGVGVG
GREHDYRCLDASFGRRHQRLDDQVAELRRLWRGEPPFEGADPVGPAPVQD
GGPPVVAAAIGPKSLARAARWADGITGFSVSGAPAELTYSADSARAAWQA
AGHAEPPVLSSGCFYTLGIPGAESELKQFTSEYLAIFGTQIAENVPKTLT
NFDADALNRTLDGAEEAGLDEFILVPGASDVAVIEATIELIQRR
169630351YP_001704000.1 lipase/esterase LipN [Mycobacterium abscessus ATCC 19977]MSPFRDFALRASTAATPHIPTPVRRAMAGRQVIIDGNILDPTTQLLLRGM
ELMGEGEISRGEDVAENRANMRRQAGLLQFSTPVGQVRNFSIPGPAGPIG
VRHYKPVHDHTGALLVFFHGGGWVIGDLETHDQPCRQTCRDAGVSVLSVD
YRLAPEHKAPAAAQDCLAAYLWAVEHAGDLGVAPDRIAVGGDSAGGNLAA
VVAQQARDTGAQLPLLQFLIYPAVDFTVRRPSRDLFAEGFFLTKAAMDGF
ESHYLDGSDVDKADPQVSPILAADLAGLPPALITTAGFDPLRDEGNEYAA
KLRAAGVPVDLRVQGPLIHGFYNMAGLGGAPSEAMNQLTSALRAHLSR
169630350YP_001703999.1 hypothetical protein MAB_3269c [Mycobacterium abscessus ATCC 19977]MAKPKQPPSYDLKKAEQRRSQLIQIGLTAIVVLFAVGLVGFIVLSNKKDE
GPPAPPAGEVKAIQVVTPGPAKLITKEGTTEPKVVLTLIEDPICPACAMF
EQEFGPTVKKLIDTGAVRADYDMVGILDVPRLKRDYSSRASAAAYCVADQ
SQELFLKFHSVLYDPSKQPDEVNSKTWHDDKWLIDQAKAVGASDAVAKCI
KDKKYINMVKELGPKLNIQATPTIRINGKDWEIGKGTTPDDLIKAVTDIT
GPVPGLK
169630349YP_001703998.1 hypothetical protein MAB_3268c [Mycobacterium abscessus ATCC 19977]MTLRPATAWYVLVAGVAGLAAALALTIEKIEILIDPTYVPSCSLNPVISC
GSVMTTEQASAFGFPNSLIGIVAFTVVLVTGVLSVAGVQLPRWYWSGLAI
GSLLGAVFVHWLIFQSLYRIGALCPYCMVVWSVTIPLLVVSASIALRPLG
SHRWARILYQWRWSLVVFWFVALVLAILERFWDYWITLV
169630348YP_001703997.1 pyruvate carboxylase [Mycobacterium abscessus ATCC 19977]MFSKVLVANRGEIAIRAFRAAYELGAETVAVYPYEDRNSGHRLKADEAYQ
IGEKGHPVRAYLSVSEVVNAARNAGADAIYPGYGFLSENPDLAAACAEAG
ITFVGPPADVLELTGNKARAIAAAREAGLPVLASSEPSASVEELLAAAES
MEFPVFVKAVAGGGGRGMRRVAERDQLREAIEAASREAESAFGDPTVFLE
QAVINPRHIEVQILADTAGNVIHLYERDCSVQRRHQKVIELAPAPNLPPE
LREKICSDAVAFARHIGYSCAGTVEFLLDERGHHVFIEMNPRIQVEHTVT
EEITDVDLVASQLRIASGETLDDLGLHQDSITPRGAALQCRITTEDPANG
FRPDTGRITAYRSPGGAGIRLDGGTTLGAEVGAHFDSMLVKLTCRGRDFQ
TAVARARRAVAEFRIRGVATNIPFLQAVLDDPDFRAGHVTTSFIEERPQL
LTARSSADRGTKILNYLADVTVNKPHGAKPSTVYPHDKLPPIDLSVPPPD
GSRQRLLALGPEGFAKALREQKAVGLTDTTFRDAHQSLLATRVRTTGLLA
VAPYVARLTPELLSIEAWGGATYDVALRFLKEDPWERLADLREAVPNICL
QMLLRGRNTVGYTPYPETVTKAFIREASATGVDIYRIFDALNNIEAMRPA
IDAVREVGTSVAEVAMCYTGDLSNPGENLYTLDYYLKLAEQIVDAGAHVL
AIKDMAGLLRPPAAATLVTALRSRFDLPVHVHTHDTAGGQLATYLAAWQA
GADAVDGAAAPMAGTTSQPSLSAIVAAAAHSEYDTGVSLTSVCDLEPYWE
ALRKVYAPFESGLPSPTGRVYTHEIPGGQLSNLRQQAIALGLGDQFEEIE
ARYAAADRMLGRLVKVTPSSKVVGDLALALVGTGVSADEFASDPGRFDIP
ESVIGFLRGELGDPPGGWPEPFRTRALQGRGPARAEVALTADDESQLDGD
SATRRAALNRLLFPGPTKEFLAHREQYGDTSRLSANQFFYGLRYGEEHRV
KLEKGVELLIGLEAISDADEHGMRTVMCILNGQLRPVQVRDRSIESAVAS
AEKADRANADHVPAPFAGVVTLNVVSGQEVSAGETIGTIEAMKMEASITA
PKAGTVARVALTETAQVEGGDLLVVIS
169630347YP_001703996.1 hypothetical protein MAB_3266c [Mycobacterium abscessus ATCC 19977]MLEARLDFEGIAVLDLFAGSGALGLEALSRGAQHVTFVESNAAASRVISA
NIATVGLPGAVLRQCPVSTFLSMSPDRAYDLVLADPPYSVSAEEVSALLS
RLTDHWVTDEALVVLERDASGPEAVWPDGWELMSRKYGGTRLELGSL
169630346YP_001703995.1 hypothetical protein MAB_3265c [Mycobacterium abscessus ATCC 19977]MTPLQRYIAEEIATDHIEGLLTRREAFRRLALLGVGATAAGALISACGTG
NKPVAAPAPANSGAPPPGMDNVVVTEPITWRGPNGTLQGAWATAAEPRGT
VLVIHENKGLNDWVRSVAGRLAGVGYSSLAIDLLSEEGGASAFKDPAEAT
GTLGRIAPERFIADLKSGVDEILRRVPGKPAGAVGFCFGGGLVWQLLAAG
EPRLAAAAPFYGPLPDNPDFSRSKAAVLAFYGELDERVTASKDQAADALR
RGGLLHEIAVEPGADHAFFNDSGPRYNASAAVDAWQRLLGWLGQHIG
169630345YP_001703994.1 hypothetical protein MAB_3264c [Mycobacterium abscessus ATCC 19977]MVAVASGAVSLAAAGVALADDGDAPAPPTPQSPVADLLPGGAKTAVAPSV
ASDALSAGLPAPVAGLGAPGGPLSAEGPLLSPTGPLSANGPLTASGGPLS
ADGPVLSPTSPVSPVNEICGSGSLLKSVTDRFSGVIPESTLASMQNQHPV
GTAKCPAAPTADDQAPPADQPGN
169630344YP_001703993.1 hypothetical protein MAB_3263c [Mycobacterium abscessus ATCC 19977]MSKWRGIGKREEFDVVVRGIKAFKKIMQTTFDPELVIPEEVRVTEFTGDN
SLSRKDLCQHPIPADSLIWKYWGRFDVMYFGSGVLGPIAGAWPQMGRGTA
GSVLFNGDSSFRARAKIYKKRRQRSREYIYGSVYDPPEDAKKYGLKTRNM
HKSVKGTLQDGTFHALNAETFYFAHVTFFYHHLMVVTERLHFDGDMPRAV
KEQIFEESKEWYSMWGVDDGPQPDTYDDFERYLENVERNHLVRSQVTQLM
LEQFMERRLAPRWWPTAMKKFVWPWLVGRRQVVVSSYPPHVRELFALEWT
PEDEEMLRRFMDMYRRCYAVLERLLPVKCFYLPTAVRGFEREGIDPRNIT
LESARQALRDNRARRAPRKDAPIEGAVAAGQ
169630343YP_001703992.1 hypothetical protein MAB_3262c [Mycobacterium abscessus ATCC 19977]MVVVLVLGLTYLFGQAYWSKRTVFGDPQPAHDLPAYAELLVPVHAERAGG
LPRPENAVKWSVDGIKLPAGHVIVGPAGRPLAWVSDTAVVDIQSLWLRLA
GRFDRTGLWPLASRGLGGDLRRPWSDPEDLRHLAEPGDVGSVDIKSFLAK
EISSAGAATVDVPVAPITLAQRTQPPQRALPLTGDHLPQGSLLILAPVSR
PADALNALGWAHAVNYGVADTALSAVLRSWEDRFGAVLTTVDFDAIEVEV
TRPPGADLAVPVGYEHYGFCPDNIDQGAGTLSAYARQISDTRTWDFWWD
169630342YP_001703991.1 lipoprotein LpqH [Mycobacterium abscessus ATCC 19977]MRYGSAVVMGGAVLAGACFVGCSSGEGVHRDSSQTSQRVSNSASVTPAAG
PRVVVNGAVRTVENRVECVTAGEMTFVNIGSDSDGIAARLTAGESPSLES
LTLGVIDGQPVIYSPSNGGAKPEVTKSGRSYKIAGPATAGLSTPATFELE
FTCPAGR
169630341YP_001703990.1 hypothetical protein MAB_3260c [Mycobacterium abscessus ATCC 19977]MTTNVGQDLVKHLWKSAVVSGVLAVIVGAAILIWPQISVFVAAIFFGVYL
LVSGVAQIVFAFALPVSSAGMRVLLFLTGAASFVLGVLCFKDELNSILLL
AIWIGVGWIAQGIAGTITAVSDKDIPGRGWQIFSGIISTLAGIVLIVYPI
SSIVTLTLVVGIWLIVIGVMQIGSGIGIRAATKSAV
169630340YP_001703989.1 phosphopantetheine adenylyltransferase [Mycobacterium abscessus ATCMTGAVCPGSFDPVTLGHLDVFERAAAQFDEVIVAVLINPNKAGMFTVDER
IEMIRESTADLPNLRVESGQGLLVDFVRERGLNAIVKGLRTGTDFEYELQ
MAQMNKHIAGVDTFFVATAPAYSFVSSSLAKEVATYGGDVSALLPASVHQ
RLLGKLRGQAQ
169630339YP_001703988.1 hypothetical protein MAB_3258c [Mycobacterium abscessus ATCC 19977]MYRVFEALDELGAIVEEARGVPMTAGCVVPRGDVLELIDDIKDAIPGELD
DAQDVLDARDSLLREAKEHHETVIGNSNAEAEQTLSHARNEADRLLADAK
AQADRMVAEARNHAEQTVGEAREEAARTIANAKREQESTIARAKAEADRL
VDSGNASYDKAVQEGIKEQQRLVAQTEVVQAAHAESTRLIDAAHAEADRL
RGECDIYVDNKLAEFEDYLNGTLRSVGRGRHQLRTGAGTHDYVQR
169630338YP_001703987.1 hypothetical protein MAB_3257c [Mycobacterium abscessus ATCC 19977]MPGPFVLDVLALGLGRRPGSMREIERTFASPVRIGNDLIAIPEGTDVDMD
LRVESVSEGVLVTGTITGDLAGECSRCLEPITGHADATITELFAYPDSET
EATTEEDEVHRVVDGLVDLEQTIVDAIVPDLELAPVCRPDCPGLCPDCGI
ALATAEPGHHHDKIDPRWAKLANFGDDQ
169630337YP_001703986.1 ribonuclease III [Mycobacterium abscessus ATCC 19977]MSRTPEHRHDDLRAAIGVQLGDELLTLALTHRSYAYENGGLPTNERLEFL
GDAVLGLTITETLYHSHPDRSEGDLAKLRASIVNTQALAGVARGLTGDGL
GAHLLLGKGEENTGGRDKSSILADGMESILGAVYLEHGLETARAVVLTLF
GELLETAPKLGAGLDWKTSLQELTAEKGWGAPSYAVTSTGPDHDKEFTAT
VMVNDTAHGVGVGRSKKEAEQKAAAEAWNSISGDEPLGGRAEGGDEPLEG
RAEGTVSA
169630336YP_001703985.1 formamidopyrimidine-DNA glycosylase [Mycobacterium abscessus ATCC 1MPELPEVEVVRRGLHHHLVGKTIASTLVYHERAVRRQSGGAVELAGLLAG
QQISGTGRRGKYLWLTLEGSSGAQALVVHLGMSGQMLIGPISRPQHLRIA
ATLDDGSVLSFVDQRTFGGWMVTDLVTVDGSELPEPVAHIARDPLDELFE
IGAVVTRLRGKHTEIKRALLDQTVVSGVGNIYADEALWQARVHGRRLTDG
MSRAKLTEVLDSAAAVMRLALAQGGTSFDDLYVNVNGESGYFDRSLEAYG
REGEPCRRCGRAMRREAFMNRSSYFCPSCQRLVEPR
169630335YP_001703984.1 potassium-transporting ATPase subunit A [Mycobacterium abscessus ATMNSALAAGLQIGFVILALAIAYVPLGDYMARVFTGPHSLRASGLSTIKHS
RVERLIYRVGRVDPETEQTWVGYTLSLLGFSFASVIFLYVLQRIQGVLPL
SGGLGAVSPAVAFNTAVSFVTNTNWQSYTPETTMSNLTQMVGLAVQNFVS
AAVGLTVAVALIRGVVRTTSGGELGNFWVDLVRGSLRILLPLSFAVALIL
LSQGTIQSVYTHFEATALDGTAQHIALAPVASQEAIKEIGTNGGGILGAN
SAHPFENPTPLSNVIEILAILIIPVCLTRTYSTMVGDKRQGLTVLSVMGT
LFGGMLALVTWAESSPRGIAAQAAGAMMEGKEVRFGIPGSALFAVSTTGT
STGAVDAAHDSFTAAGGGALILNMLLGEIAPGGVGTGLYGILVLAIIAVF
VGGLLVGRTPEFLGKKIGRRQITMAALSVLVMPALVLVGTGISVALSTTT
GYQGNSGDPGTPSSIHGFSEVLYAYASAANNNGSAFGGLTVTSHWFQASL
GMAMLLGRFLPIIFTLALAGSLATQRKTPASAGTLHTHGPMFAGLHTGTV
LLVAALTFFPALALGPIAEAVL
169630334YP_001703983.1 potassium-transporting ATPase B chain [Mycobacterium abscessus ATCCMSKSKNAVVTTGVFDPAQLIKALPLAVRKLDPRHMARNPVMFVVTVGSVA
TTVLAVLHPSIFAWAITAWLWFTVVFANLAEAVAEGRGKAQAASLREVKR
DTVARRLVGDGNGNENEEEVPGSALRPGDRVVVEAGQVIPGDGDVVEGIA
TVDESAITGESAPVVRESGGDRCAVTGGTTVLSDRIVVQITAAPGESFVD
RMIALVEGASRQKTPNEIALNILLASLTIIFLLAVVALGPMGNYGGEQQD
PIKLIALLVCLIPTTIGALMSAIGIAGMDRLVQHNVLAKSGRAVEAAGDI
DTLLMDKTGTITFGNRQATEFLVAPGIPHETLAAAARASSLADETPEGRS
IVELAAGTIEESVAGEFVAFTASTRMSGLDTVEGRQIRKGASDAVFTWVA
SLSGVQEDDPVVVAVRKIADQVASEGGTPLVVADHDSTETRLLGVIRLSD
VVKPGMAERFAQMRAMGIRTVMVTGDNPLTAKQIAAEAGVDDFVAEATPE
DKLELLRKEQQAGRLVAMTGDGTNDAPALAQADVGVAMNTGTSAAKEAGN
MVDLDSDPTKLIDVVAIGKQLLITRGALTTFSLANDLAKYFAILPALFSG
IYPQLGALNIMRLATPQSAILSAVVFNALVIIALVPLALKGVRYRPVGAG
ELLRRNLLIYGLGGVIVPFVGIWLIDLVVRFIPGIG
169630333YP_001703982.1 potassium-transporting ATPase C chain [Mycobacterium abscessus ATCCMTKISIAWLRQSVAGLVVLLALTVVLGVAYPAAVWLFGRINSGSAEGSPL
KDRNGCVVGSAIIGVDPQASGADPYFHTRTSGDPAAGAPSNQGPNSEKLK
ADIDARRATIAARERVTPARVPADAVTGSGSSLDPDITPEYAALQIPRVA
AATGLSQARVKELVDAHTSSRQWGILGEPRVNVPTLNVALGLTGPPCR
169630332YP_001703981.1 sensor protein KdpD [Mycobacterium abscessus ATCC 19977]MPDGLRARGTLRIYLGAAPGVGKTFAMLNEAHRRAGRGTDVVAAVVETHG
RSKTAELLDGLELIPPKEMVHRGTAMYELDVDAVLERRPALVLIDEMAHT
NVPGSRNPKRWQDIDEILDAGIDVLTTINVQHLESLNDVVEQITGIVQRE
TVPDAVVRRAEQVELVDITPEALRRRMVHGNVYAPEKVGSALSNYFRTGN
LTALRELALLWLADQVDAALAKYRSDNRITKTWEARERVVVAVTGGPESE
TLVRRASRIAAKSSAELLVVHVVRGDGLVGASTAVMTRVRRLANDIGASV
QAVTGDDVPQTLLDFARGVNATQLVLGTSRRSRWARILDEGVAAAVIRDS
GAIDVHMVTHGHTSGRLRSWSVPQDGRKRLIINWLAAILVPPATALFIHF
FDTAFGVGSKSALFLIAVLGVSLLGGVSTALVSAVISGLLLNFLFVAPRY
SFTIGETDNALTILMMMVTAVAVAALVDAAATRARQARRASREAELLALF
AGGVLVNSDLSALLERVRTTYNQTAVSLLCAEGPAVASVGEDPPTRESEA
DSVFRVDDGAYALALNGPPVPSSDARVLQVVAGTAVGLVRSARLAEEASQ
ASALAEADRLRRALLSAVSHDLRTPLAAVKAAVSSLRSPDIEFSPEDTAE
LLATVEESADQLTALVGNLLDSSRLAAGVVKPRAVPVYVDEIAQRALLGA
TENDRKRVHLDLGGAVVRADPGLLERVLANLVDNALRYSQGEVRVSHEEV
DDRTLVIVADHGKGLEASKRGAAFDAFQRLGDRDNTVGVGLGLSVVKGFV
EAMEGTVNATDTAGGGLTMIVDLPSAGSAPTGAIR
169630331YP_001703980.1 transcriptional regulatory protein KdpE [Mycobacterium abscessus ATMTRVLVVDDEPQILRAMRINLSARGYEVVTASSGAGALRAAAETQPEVVI
LDLGLPDMDGTEVLAGLRGWTDVPVIVLSARTDSADKVEALDAGADDYVT
KPFGMDEFLARLRAAVRRGTPDSAEPVVHTETFDVDLSSHKVIRDGREVH
LTPTEWSMLAVLVRNRGKLVGQKELLHEVWGPAYSSETHYLRVYLAQLRR
KLEIDPAHPKHLLTEAGMGYRFQE
169630330YP_001703979.1 hypothetical protein MAB_3249 [Mycobacterium abscessus ATCC 19977]MTSRPQCYVIAAITAAATFCASFFWAQTAAAEPIVALESLLLRPYSEVRA
QLLSGSWAPRIEELVYIPPGDPKIVPTSAMRQTYTVVDTCFTKRITPMGI
YVLLASPENVEKVGADNFRATYGQLVPKYRPGCDPDVQQIDLGRPPF
169630329YP_001703978.1 hypothetical protein MAB_3248c [Mycobacterium abscessus ATCC 19977]MLIGSETVDGVFTPGELLKIALAACSGMSSDQPLARRLGEDYRVRIEVSG
PADREQERYPVLDEKMVIDLSGLTSEERQRVLTVVERAVDQVCTVGRTLK
AGAEVNFSIEP
169630328YP_001703977.1 hypothetical protein MAB_3247 [Mycobacterium abscessus ATCC 19977]MPAIHDEIDATWRFTAIQRGKQLFTCDLRTLRDDMYPAVARVRGISGQAE
FKGTGSHPPPEPDSLDVPVHPGG
169630327YP_001703976.1 chromosome partition protein Smc [Mycobacterium abscessus ATCC 1997MDALTWVMGEQGAKALRGGKMEDVIFAGTSSRAPLGRAEVTLTIDNSDHA
LPIEYSEVSITRRMFRDGAGEYEINGQTCRLMDVQELLSDSGIGREMHVI
VGQGRLSQILESRPEDRRAFVEEAAGVLKHRKRKEKAVRKLESMAANLAR
LTDLTTELRRQLKPLGRQAEVARRAATVQADLRDARLRLAADDLVSRRAD
FDGTNDAETALRKEHAEITDRLEVATALLAEHETALGELLPQAELAQQTW
FRLSALAERVSATVRIAGERASHLDEVAAAPTGPDPEELEAQAERVAEQE
RLLIAQLETVTEQLATAKAELSARESAVAQAQRQHMAAVAAEADRREGLA
RLTGQVDTMRTRLESIDGQAQRLTESIVEATVRGEAAQTEFDTVKARVAE
LDQGEVGLDEHHERSISSLSIANERVAELQSAERQAERQIASLKARIDAL
AIGLERKDGSAWLAENRSGAGIFGSIAQLVKVRPGYQGAIATAMGPAADA
VAAENPAAAHEAVKALKSSDGGRAAIVFGDWPAHTGARPAVTLPPGAHWA
NDLVEAPQRLAAAVSAMLASVVVVDELGAAIDVVLANPLLRAVTIDGDRV
GAGWVAGGSDKKQSTLEVQAAIEAAREELRATETQVGEISAALAGALAEQ
TARQDTAEQALAALNESDAAISAVYEQLGRVGQEVRAAAEEVKKLTLQRD
QLERGRATTLEELAEVESRLRNAEEAPNLFDDEPLDRDDMAIELEEARSV
EIEARLAVRTSEERVNSVRGKADSLRRAAVAEREARARAARAAAARMRAA
AVAAAVAESGRMVAARLEHVVAAASARRDELSATRAQHTSAIGAVRDQVR
ELTQAQTRLTDALHRDEVAKAQAALRIEQLSEQVLEQFGMAADDLIAEYG
PHIELPPSQQEIDEYEQARERGEQVSAPLPMPFDRDTQERRAKRAEKDLR
ELGKVNPLALEEFAALEERYNFLSTQLEDVKAARKDLLDVVADVDERILQ
VFTEAYADVEREFKGVFSSLFPGGEGRLVLTDPNDMLTTGIEVEARPPGK
KVKRLSLLSGGEKSLTAVAMLVAIFRARPSPFYVMDEVEAALDDVNLQRL
IGLFEQLREKSQLIVITHQKPTMEVADALYGVSMRDDGITQVVSQRMRGL
ETQLASQNA
169630326YP_001703975.1 hypothetical protein MAB_3245 [Mycobacterium abscessus ATCC 19977]MTTTPEFAPFGFFTHYATVDADLLRTVESLGFDTAWLGGSPPADLPWIDP
LLSATERIRIVTAIVNIWSAPAQQAAQSWQRIQQAHPGRFILGIGAGHPE
IDSGVAYKPYSGLVEYLDVLDQAGVPQEGRALAALAEKSLKLAAQRSALA
HPYLTPPSHTRWARELLGPDAVIVPEQKVVLTTDADEARTLGRQALDLYL
GLTNYLTMLERFAGSTDDLVKPGSDKLVDTLIAYGTPEQIAARLQEHRDA
GATQVAIQVLGDPADRAKTLGVLARELGL
169630325YP_001703974.1 mercuric transporter MerT [Mycobacterium abscessus ATCC 19977]MVRGPGAEIGKSQALARAVIATVVMAGGFVAVFTVFGLLTVSVASVIQRY
LPFVTVVFGIGLVILGLWLLAGRDIIALMPKMLDANAPTTRLGSMFGYGV
GYAVASLSCTIGPFLAVTSTTFESGSLFDGVMVYLAYASGITLVVGTLAV
STALASTMLLKAMRRALPYLNRVSGAILIVVGAYVGYYGSYEVRLFHANG
NPDDPIINAAGKIQRTISGWVYLHGAWPWLFILGLVAVGAAIWWRTNVSE
PPSN
169630324YP_001703973.1 soluble secreted antigen MPT53 [Mycobacterium abscessus ATCC 19977]MNIQFGGRKKFRAQQVRGLTRTVAVVVAVLLVSAGLVRAPSARADGLLDF
TGTTVSGAPFNGASLKGKPVVLWFWAAYCPFCNGEGPHVSAVSAANPRVT
FVGISGRGSVGEMEAFISRYNLHFTNLNDADGSLWRQFGVPWQPAYLFIN
SNGTSDFVNNPTSSMSEQELSDRVKALT
169630323YP_001703972.1 isopentenyl pyrophosphate isomerase [Mycobacterium abscessus ATCC 1MQYVTRTTGLERLDLPYMALPNSSLAGVDLSTEFLGRRLAAPVLIGAMTG
GAKLAATINRNLAAAAQELGIGMMLGSQRVMLVEPDSADTFAVREVAPDI
LLIGNIGLAQLGNIAPAAQLNSLVRRVGADALAVHTNPLQEAVQPGGDTD
FTGQVYRLAELTHAVEFPVLLKEVGHGISGAAARRLGGCRLAAIDVAGAG
GTSWARVEQFVRFGAITSPELAEWGIPTAEALVEVHAELPHMPLIGSGGI
RTGMDAAKAIALGASVVSVALPLLAPAVQSPQAVVAWLQQFLDELRIAMH
CADVSTIADLRRISLRPRSSPR
169630322YP_001703971.1 cell division protein FtsY-like protein [Mycobacterium abscessus ATMPLEVWIAIAIVAVVVVAALVFGLVRYRSRRISLTRSDKNTGITEGATPT
DRSGGYTAGSTITFSEGGAQAAPLPTVGDDAEIPRDAPRRTISNVQLPEP
AAEPEPVEVSEPAETAEAAEAAVPGETVAEAAPEPEPEPEPAPKPEPVLD
DIAPVAGRLDRLRGRLASSQNAVGRGLLGLLGAGDLDEESWEEVEDTLLI
ADLGTAVTASIVDRLRSEMAARSVRTEAQARALLREVLIDELQPELDRSI
KALPHNDKPSVLLIVGVNGTGKTTTVGKLARVLVADGRRVVLGAADTFRA
AAADQLQAWGQRVGAQVVRGAEGADPASVAFDAVDAGIREGADVVVVDTA
GRLHTKTGLMDELGKIKRVVERRADVDEVLLVLDSTIGQNGLAQARVFAD
VVDITGVALTKLDGTAKGGIVFHVQRELGVPVKLVGLGEGPDDLAPFEPP
AFVDALLG
169630321YP_001703970.1 ammonium transporter [Mycobacterium abscessus ATCC 19977]MGVPNTGDTAWMLASAALVLLMTPGLAFFYGGMVRAKNVLNMIMMSISAM
GLVTVLWVLYGYSMAFGNDVSGLFGNPAQFLGLKGLIGGNAAEAVVADPA
NGVEAAEVVNIPLVGTLPATVFVAFQLMFAIITVALISGAVADRLKFGSW
LLFAGLWVTVVYFPVAHWVFAFDGAAAEKGGWIANQLKAIDFAGGTAVHI
NAGTAGLVLALILGKRKGWPGTPMRPHNLPFVMLGAGLLWFGWYGFNAGS
ATSANGLAGSTFVTTTVATAAAMLGWLLTERIRDGHATSLGAASGIVAGL
VAITPSCSSVNVLGALAIGAIAGILCALAVGLKYRLGFDDSLDVVGVHLV
GGIVGTLLIGLFAAPETGAAVAGLFYGGGLEQLWRQAVGAGAVLLYSAIG
TAIVAFIVKYTIGLRISDEGEAAGADESQHAEGAYDFVALGSGSVIGRHV
SSGSSD
169630320YP_001703969.1 nitrogen regulatory protein P-II [Mycobacterium abscessus ATCC 1997MKLVTAIVKPFTLEDVKTGLEQAGILGMTVSEVQGYGRQKGHTEVYRGAE
YSVDFVPKVRVEVVVDDSAVDKVVEVIVTAARTGKIGDGKVWVSPVDSVV
RVRTGERGADAL
169630319YP_001703968.1 PII uridylyl-transferase [Mycobacterium abscessus ATCC 19977]MGAATDLVAARAQLLGDSGRLNAAAIREAMTDLNELWLTTKAAEVGITDS
SGFAIVALGGLGRREMLPYSDLDLVLLHDENIAPETLSEVADGLWYPLWD
ANIRLDHSVRTVADTLHVAGQEMSAALALLDARHIAGDAQLSSLMIGGVR
QQWRSQIRTRLDELVEYTQARWRRSGEIAHRAEPDLKSGRGGLRDVQLLR
ALAIAQLTDSGLAKSFDGAHSVILDVRTELHRVAGRERDQLLAQFADEIG
AALRIGDRFDLARMLSDAARTISYSVDVGLRAAANSIPRRGISALRRTVR
RPIDEGVVEHAGEVVLARDARPERDPSLILRVAAASATTGLPIAASTLAR
LAESAPELRTPWPREALKDLLVLLESGRPALATIEALDRTGLWGRLFPEW
GPVRDLPPRDIVHIWTVDRHLVETVVQASAFTTRVSRPDLLVLGALVHDI
GKGRGGDHSVVGADLAVQIGTRLGLWPSDVELLSKIVRYHLLLPNTATRR
DLADPETIDGVVNTLGGDLLLLELLQQLAEADSLATGPGVWGDWKASLIG
ELVRKCRLVMRGEQLPEPDPIDPELLSLAADGGVQVRLVPAGSPHMYIVS
LIAPDQRGLLSKAAGVLSLNSLRVFSASVASHAGSAINTFEVSPRFGSPP
AAGLLRQQLISAIDGDTDIIAALDERERESAQFATGVVGDAAPAVPTNYA
PAPPRIRWFEPAGNADQQIVEIRTSDAPGLLARITATLERHGVDIAWAKV
NTLGSSVVDTFCLSTGPEQAVLEAAIASVLPAVAPQPKKAAAS
169630318YP_001703967.1 Signal recognition particle protein Ffh [Mycobacterium abscessus ATMFESLSDRLTDALAGLRGKGRLSDADIDATCRTIRLALLEADVALPVVRT
FITRIKERAKGAEVSGALNPAQQVVKIVNEELIGILGGETRQLAFAKTPP
TVVMLAGLQGAGKTTLAGKLAKWLKGQGHTPLLVACDLQRPGAVNQLQVV
GERAGVSVYAPHPGTADGGLEVGSLVGDPVAVARDGLAHAKAQHFDVVLV
DTAGRLGIDAELMDQAARIRDAVDPDEVLFVLDAMIGQDAVSTAEAFREG
VGFTGVVLTKLDGDARGGAALSVREITGTPILFASTGEKLEDFDVFHPDR
MASRILGMGDLLSLIEQAEQHFDAEQSLAAAEKITSGELTLEDFLEQMLA
IRKMGPIGNLLGMLPGAGQMKDALAAVDDKQLDRVQAIIRGMTPAERADP
KIINASRRLRIANGSGVAVSEVNQLVDRFFEARKMMSSMAGRMGMGAINR
KSNRKGGKNNKKGKKGSRGPTAPKLKGGFPGMAGLPGGMPAGFPDLSGMP
EGLGELPPGLADIDISKLKFPKN
169630317YP_001703966.1 amidohydrolase [Mycobacterium abscessus ATCC 19977]MRAHLRGRTLPSEEPIDLWVHDGVISIEPIADADTVFDGGWLLPGLVDAH
CHVGIGPQGPTSLEEAVAQAEAEREVGALLLRDAGSPVDTRGFDEREDLP
RIIRAGRHLAKPKRYIPGLPLDIEDDAQLPEAVALQARWGDGWVKLVGDW
IDRAVGDLAPLWSDKILKQAIDAAHANGARVTAHVFGEDALPGLIHAGID
CIEHGTGLTDDTIALMVEHGTALVPTVINIENFPGIADKAGKYPKYAQHM
RDLYAGLHTTFGNAYDAGIPIYAGTDAGGSIAHGRISDEVAALTRIGMSP
TDALGAASWRARSWLGRPGLEHGAPADLLGYRADPRTGPGVLASPDLVML
RGQIR
169630316YP_001703965.1 hypothetical protein MAB_3235c [Mycobacterium abscessus ATCC 19977]MPGMRCAGVVLASWILAVSLPASAHAETLCRDFNAMDDTAKSAAVQEAAA
GGNAVAQISPRDAVALAEAMCRVRTGETVLQVLNSKS
169630315YP_001703964.1 D-alanyl-D-alanine carboxypeptidase DacB [Mycobacterium abscessus AMSDPMSTLRIRALAVLSVLFLSTLPVGVARADMAAPPPEGPAQAWLVADL
DSGQILAARDPYATHAPASTIKVLLALVALDEVPMDATVVADAADAKAEC
NCVGIKAGQTYTARELLDAALLESGNDAANTLAHLLGGRQATVDKMNAKA
AALGATSTHTDSPSGLDAPGMDMRTSPHDLAVIFRAALANPVFAEITAQP
SAPFPGRGLHNQNELMYRYPGVIGGKTGFTDIARKTYVVAAERDGKRLVV
SMMYGLVHEGGPTYWDQAASLFDWGFVNDGSSSVGSL
169630314YP_001703963.1 hypothetical protein MAB_3233 [Mycobacterium abscessus ATCC 19977]MSRTPENSPTTVDNLQALSVTDLLAARDLYHHHLTNKPNVVGTAIGRYLI
REQPGGARTLVNSRVEQGFSWPCVMVFISDWAAPKSLTPYDYVPKQLFMP
DGRVVPVCKVQVDPAPVSTTTPRHPAPARWPTTLLGGGLPVVVDVQNQSH
TATAGCLVSDGHSLYALTNRHVCGPAGQEIDMVRGLARSRIGVSSGQQLT
RLPFGEVYPFSMTNTYLTLDIGLVDVDDAGDWTSTAYGIGDIGPMVDTGD
MTNGLDLIGQPVVAHGASSGLVGGKVMALFYRYKSVGGSEYVSDFLIAPD
PQGPQTVPGDSGMVWHLTENRARPAPLAVEWGGQAFLDDATRCTLNFALA
TSLSTVCNLLDVEPVVGQQDGAQPFWGQTGHYSIATFTLDAIRSPNLKTL
MQANLDAISFSLSELDPKSIAQRLKEARSNPDGIIPLADVPDLVWKNLPN
KVVGGRDDHMVGYRSQGPEHPCHYADIDEPGPDGSIVRDLCLQDIANLTV
TKWQQFYDERGHRTPDKRGLLPFRVWQFYDAMVGFAKSRQVDQFVCAAGL
LAHYVGDASQPLHGSYLADGYPDGTGAGVHSCYESKMIDRYARQLVAAIP
ADLATLGDLELIDDGQHAALATVELMDRSAQRLPPTQLVDAFVALGGKPV
VATQDGLWSRFGEQTGLLMADSARTLAMIWDSAWAAGSGDKIKKSALQAI
PHDRLRELYQQRQFVESLDLDHVETALR
169630313YP_001703962.1 putative luciferase-like oxidoreductase [Mycobacterium abscessus ATMQFGLDTFADVPAGMTNPEAIRAVVEEGVRADQVGVDIFAIGEHHRAEFV
GESPETMLAAIAARTERITLATAVTVLSTDDPVRVYQRFATLDGISNGRA
ELVLGRGSFTDSFPLFGYDLADYDELFNEKFDLMAKLLPGAPVTWSGTLR
SALDNVEVYPKTAEGLRAWVGVGGSPESVVRSVRYRIPMILAIIGGNPMR
FEPYVDLYRRAQRELGVTEPMPLGIHSPGHIAESDEEAIAQYWPGFRELR
TTIGRERGWPAPRYEDYLAEVKAGSLYVGSPDTVAVKMAKTIRGLGADRF
SLVYQAAQPGLGMQNVELYGTEVIPRVRELLAGDAVGAA
169630312YP_001703961.1 hypothetical protein MAB_3231 [Mycobacterium abscessus ATCC 19977]MPTRTEIITQFVPNSPLCQHLGITLTEIGDDRAVLHMPFKSELATMGQTV
HGGAIATLADTAAMAAAWADDVVPEKFGGATASLAVNYVCAANAADLTAV
GQVVRRGKRLSNIEVTVCDSAGQVVAKALATYNFA
169630311YP_001703960.1 hypothetical protein MAB_3230c [Mycobacterium abscessus ATCC 19977]MVDYATAIDTRQFDDLDEVFTNDAYIDYRAMGGIDGEYPDVKAWLAQVLP
AFPMYAHMLGNVSITFDSEGGAERSSAQVRSLCFNPMVPAGDTEQVLFLG
LWYDDAAVRTRHGWRLTRRVETKCFSRLT
169630310YP_001703959.1 30S ribosomal protein S16 [Mycobacterium abscessus ATCC 19977]MAVKIKLTRLGKIRNPQYRIQVADARTRREGRAIEVIGRYHPKEEPSLIE
IDSERAQYWLSVGAQPTDPVLALLKITGDWQKFKGLPGAEGTLKVKEPKP
SKLDLFNAALAEADGAPTGEAIQQKKKKAPKKAEAAEAEAPAEEPAAESA
DAASE
169630309YP_001703958.1 hypothetical protein MAB_3228c [Mycobacterium abscessus ATCC 19977]MVDAVEHLVRGIVDNPDDVRVDLVTNRRGRTVEVHVHPDDLGKVIGRGGR
TATALRTLVAGVGGRGIRVDVVDTDR
169630308YP_001703957.1 16S rRNA-processing protein RimM [Mycobacterium abscessus ATCC 1997MELVVGRIARAHGVTGELSVEVRTDDPDERFAVGSVLTGRLPRGGGSRRF
TVESVREHSGRLLIRFAGVSDRDAADALRGTLFMVDTTDLPPIEDPDEFY
DHQLEGLAVRTLDGAAVGTVSEVLHTPGGELLSVRGSERREILVPFVSAI
VTSISLADKVIEIDPPEGLLDLS
169630307YP_001703956.1 tRNA (guanine-N(1)-)-methyltransferase TrmD [Mycobacterium abscessuMKIDVVTIFPEYLQPVRQSLPGKAIDAGLVDVAVHDLRRWTHDVHKSVDD
SPYGGGPGMVMKPTVWGDALDEICTSETLLVVPTPAGYPFTQETAWQWST
EDHLVIACGRYEGIDQRVADDAATRMRVREVSIGDYVLNGGEAAALVIIE
AVLRLVPGVLGNALSAQEDSHSEGMASLLEGPSYTRPPSWRGMDVPPVLL
SGDHAKIAAWRAEQSRQRTIERRPDLLGFDSPTGEHGGDGLS
169630306YP_001703955.1 putative lipoprotein LppW [Mycobacterium abscessus ATCC 19977]MRGQHLFVGLTLTAATALTSGCVASVRSDPATPVLAVVSAPAETPPVFEV
ESPTSFETLPERTTAATTQAKSAGATLTAVIKDRASGAVVSNGNNSTIAI
ASVAKLFIADDLLMRESQGEVTLTPADRAAFDRMLQSSDDSAAEVFWQRG
GGNSIITRVAARYGLASTNVPSDGMWWNTISTANDLVQYYDMLLSGTGGL
PPERANIIVDDLSRSTPNGIDGYPQRFGIPDGIPGEPVAVKQGWMCCVGS
AWMHLSTGVVGPDRRFIVVVSSLQTANDVTARNTLTQAVATMFPGGRIET
E
169630305YP_001703954.1 50S ribosomal protein L19 [Mycobacterium abscessus ATCC 19977]MNTLDFVDQASLREDVPDFRPGDTINVHVKVIEGSKERIQVFKGVVLRRS
GGGVSATFTVRKESYGVGVERTFPVHSPNIDHIEILTRGAVRRAKLYYLR
ELRGKKAKIKEKR
169630304YP_001703953.1 signal peptidase I LepB [Mycobacterium abscessus ATCC 19977]MSYDVYFVRQHPPQDFEHVPENEHPLKESSDLRSRLVADMNAPEVFEGSD
GTWELSDSVTTAQVNYAPDGVGMGVSYGSATSDEFDSRIEHLMRLAKIIE
DETGLTAWDPQAEKVFGDVTLDDSRQSLGQFETVGDNVEHDAAEKVSAVD
STDEDPAQDSKDASDSDEGGSGMLREVGVLLLIALVLYCITQNFIARPYL
IPSESMEPTLHGCRGCTGDRIMVDKVVFRFSEPQPGEVVVFKGPPEWNGN
YRSIRSSNTAVRYVQNALSFIGVVPPDENDLVKRVIATGGQTVECRPNTG
LTVNGKKLDEPYLDPETIGPNIDGCWGFPFGPVKVPEGKLWMMGDNRTHS
GDSRAHCQSRDRDAGLDVDIDHKIYCTGDPNIGTVPVANVIGKARFIAWP
PGRWGAVKTVNPQT
169630303YP_001703952.1 ribonuclease HII [Mycobacterium abscessus ATCC 19977]MSTSWPPRTVIRKASGLRTLELTLDRVGLGPVAGVDEAGRGACAGPLVIA
ACVLGSNQRKSLAALNDSKKLTEKMRETLFPLICRYAEAYHVVSVPADEV
DRIGVHVANIEGMRRAVAGLGVKPGYVLTDGFRVPGLPVPSLPVIGGDAS
AACIAAASVLAKVSRDRVMVNMDSDHPGYGFAVHKGYSTAVHTEALRRLG
PSAQHRQSFVNVRNAAMGSSLMRPLAPRESDTGG
169630302YP_001703951.1 hypothetical protein MAB_3221c [Mycobacterium abscessus ATCC 19977]MSAEDLEKYETEMELSLYREYKDIVGQFSYVVETERRFYLANSVEVIPRN
TDSEVYFELRLSDAWVWDLFRPARFVKHVRVITFKDVNIEEVDKPELRLP
E
169630301YP_001703950.1 hypothetical protein MAB_3220 [Mycobacterium abscessus ATCC 19977]MQDSRQRKKQDQRSPTHLTREHPMKTRTVKPAKVFAGCAIALGAALAGCG
TNNDGGPTSTSTTTTTTTTTTTTITPAPSGAPEGTPAPGPTGGGGPDGGS
GAIPGGPTGGGGPEGGSGSIPGGPTGGGGPEGGGGHIPGVGGGHGGPGGG
GGCVDNVGCVSIP
169630300YP_001703949.1 hypothetical protein MAB_3219 [Mycobacterium abscessus ATCC 19977]MIPSISKKFAVAVFAVTAVSLAGCSDVINQGGDTTCKEFLTQDDNAQNDA
VTKMLKDENQQEPSGLQTTAAKNSAMAYCKTLGNEKSKIKEAPHI
169630299YP_001703948.1 hypothetical protein MAB_3218 [Mycobacterium abscessus ATCC 19977]MISPLAANVAAAHLGFGIGWIAWIVIGGLAGWVASKIMDTDAQQGLLLNI
VVGIVGALLGGFLLSLFDVGTYGFGWVLTFITALVGACILLFLVRLVTGR
R
169630298YP_001703947.1 hypothetical protein MAB_3217 [Mycobacterium abscessus ATCC 19977]MSDDNKDSGFEAGIKGVVEDVKGKVKEAAGKLTGDESLEREGQAQQDKAE
AQREVATKEAEAEKARAEAAVHEAREDAEK
169630297YP_001703946.1 TetR family transcriptional regulator [Mycobacterium abscessus ATCCMARAQKCTVGVTDAVDETESGTVAGGAEGRRPRSLTRAEILDTAIALVDS
EGLDQLTMRRLGSACGVEAMALYRHVHGRQDLLGGIVDHLVDKLYDDQLA
ARRQEDGWQDYLVRLAHGVREIAIGHPHLFPTLATRPPEAPWVRPPLRSM
KWMETFLDTLISYGFDDRAAVSAYRAYTTFLLGQLLLEVSARGASLSSVE
DELPEKTLRSLSSYPNLQRMQKQLSEDHSATEFEEALESLLDRLENGAPR
169630296YP_001703945.1 hypothetical protein MAB_3215c [Mycobacterium abscessus ATCC 19977]MTVPVVVVALPMGSPGATVSGSPVHCAPSKTAKDVCIANHDAEIKSAPNE
KDLPAPASGAIGKVAPVVHPVKMWN
169630295YP_001703944.1 hypothetical protein MAB_3214c [Mycobacterium abscessus ATCC 19977]MTHSLSRSQIGIHGEDLAADYLRQHGFTVLDRNWRCRHGELDIVAVCGDL
LVFVEVKTRTGQRFGTPAEAVTYAKLRRLRRLAGIWLAAQGGSWSSVRID
VIEVRLAGATPELTHIHGVG
169630294YP_001703943.1 putative magnesium chelatase [Mycobacterium abscessus ATCC 19977]MALGRAYSVAVKAVTGQTVEIEADISAGLPGVHLVGLPDAALQESRDRVR
AAITNCGFTWPASRLTLALSPATLPKMGSVYDLALATAVLSANKAIPPDR
LEKTLLLGELALDGRVRPVRGVLPAVLAAKRDGWPTVVVPQANLGEAGLV
EGIEVLGVRTLRQLTAWLCADGELDPVSQSEYRHVTEAPDMADVVGHADA
RFAVELAAAGAHHLMLTGPPGIGKTMLAQRLPGLLPPLRHEEALEVTAVH
SVAGLLTARRPLITEPPFVAPHHTSSVAALVGGGSGTAKPGAVSMAHRGV
LFLDECAELSTPALEALRTPLEDGEIRLARRDGVVTYPARFQLVLAANPC
PCAPANPRDCTCPAQLRRRYLGKLSGPLLDRVDLRVKMHQVSQTALNDAA
EGTAVVRERVLLARERASRRWADYGFRVNADAPGPLLRREFRPSRAVMEP
LRNAMERGLISVRALDRCLRVAWTLADLGGRDLPAAEDVKLALTFRDKR
169630293YP_001703942.1 hypothetical protein MAB_3212c [Mycobacterium abscessus ATCC 19977]MSSATADWAYLSRVSEAPSAELAAMVSVFGVRETAARVRRLDVPDQVRAV
VRARHDVDRSREDLEILSRLQGRLVTPDDAEWPHWQFQAFASVDTKRMPN
GRMPLALWVVGERSLAEVTSRAAALVGTRACSGYGEHVTAELAAGLTARE
VAVVSGAAFGIDGVAHRATLACDGVTVAVLAGGVDVPYPAGHSGLLYRIA
RHGLVVSEYPPGVRPARHRFLTRNRLVAALSGATVVVEAGARSGAANTAA
WARILGRPVGAVPGPITSAASVGTHVEIAERGAQLVVCAQDVVALAGRLG
EFTAAPDRPGSVIDGLGDDEKRVYEALPGRGSTTVRELVRESGLSVGRVQ
GALAILELEQLVIDVAGDWKLRRTNMVR
169630292YP_001703941.1 carbonic anhydrase [Mycobacterium abscessus ATCC 19977]MASDPKSAWTALKEGNQRFVGGFPQHPSQSVTRRAELANGQNPQVMLFGC
SDSRVAAEIIFDQGLGDMFIVRTAGQVIDSAVLGSIEYAVAVLGVPLIAI
LGHDSCGAVGATLDALDTGEVPGGYIRDLVVRVMPSILGGRKDGLSRVDE
FEARHVEETGTKLLQRSQVVADAVKAKKLAIVYLTYKLADGRVVLHGHVG
DIDNP
169630291YP_001703940.1 hypothetical protein MAB_3210c [Mycobacterium abscessus ATCC 19977]MNRKGRSATLESGPQGEIEIGSDKGAIAPLKGDDAVITREAAIGSEARLS
WLLSGLAGMVGAVAFLHSAGYFVTFMTGNTERAVLTWFKVTDKQQVAGAG
PIAAISMIGAFLFGVIVASYCRRKFWKNHPHGATVLTTVGLLAAAAVDFY
QDRSFTANIDVHFTPILLLAFSIGALNTSFVKKGETAIPLSYVTGTVVKL
GQGIERHLFGRGSVFEWLGYAMLYLSFVLGAATGGVIASVYSGSKVILTV
GIICGATTLVTFFYSDRKTILG
169630290YP_001703939.1 hypothetical protein MAB_3209c [Mycobacterium abscessus ATCC 19977]MEPGFQIYGPHKAEAASPIEHMNDLVTALLIAALFIALGVAKFGPFWTVN
Y
169630289YP_001703938.1 LysR family transcriptional regulator [Mycobacterium abscessus ATCCMELRQLEYFLAVAEHANFTRAAEALHVAQPWVSAQVRRLERELGNELFDR
SSRVLRLTEFGKALLPLAGAALRTVGEIRSAADAMAGVLCGQLAIGTVPH
PSPLLAEALAAYRRAHPAVTVTLTEARSDQLATAVVERRLDMAVMAWLAQ
PPSQLRERILAKENIVAVVHRDDPLAGRESVALAELRDRALISHPQGCEI
RTALDQACLATGFTPRVVFETSSADMMRHLVVRDLGVAVTPRLPREQLGR
LRQIDLSDRAMSGRLSLLWRGKGATLEAVAFAACIDELCRKDANLVS
169630288YP_001703937.1 hypothetical protein MAB_3207 [Mycobacterium abscessus ATCC 19977]MDAWLWVCAGVLAVVHLAAGAFKLITPHEKIAANANLAWANDFSPHVVKA
IAGSEVLGAIGVVIPYATGIAPVLSPLAAAGLAVLQAGAFGVHVRRNEGK
LAGVNIVLIVLIVLAVFVAFEWYG
169630287YP_001703936.1 putative transcriptional regulator TetR [Mycobacterium abscessus ATMAFGEPDKDHDRCADVITAIASKWGDDDRRKDVTDFVTEAGELTRRPRGR
PRKGGEGVSADAIFTAALRAFATHGYQGMSMRTLNRELGVSHNLLHQRFS
SKEQLWYAAVDWGFQAIIDKVLADDDESLGPSARIKRFIKTFVMFAAEHP
DLIRIMDIEAGQDSERLQHICKAYVLPMQERLGPVYEEAVAAGELREVPL
QTSFFLITSGTAALFSSAALARTVFGDDVLDPDQVKAHAEAAAELIIRGL
LP
169630286YP_001703935.1 hypothetical protein MAB_3205c [Mycobacterium abscessus ATCC 19977]MTRPLHELQVVRTEQVSPHITRVVLGGNGFEGFEVSSFTDSYAKLIFLPQ
SHEGPGPRDIDEARDMQATVRTYTIRSVDTDRREVAIDFVVHGDTGVAGP
WASRAKPGDKLYITDSHGAYAPDPAADWHLLAGDESAIPAISVALQALPE
KARAKVFVEVAGPQDEIDFDTRGDVDVVWVHRGAGADEVGEEHAGDNAPL
VAAVRSAEWPPGQVQVFIHGEAQTVMHNLRPYIRKERGVAPKWAASISGY
WRRGRTEETFRVWKQELAAAEATVKE
169630285YP_001703934.1 site-specific tyrosine recombinase XerC [Mycobacterium abscessus ATMTPQLAAILDEFAEHLALERGRSVHTQRAYRGDLTLLFDHLSASNPEATL
ADLSLPVLRSWLGAQARQGAARSTVARRTSAVKIFTAWATRRGLLPTDPA
IRLQQPKSRRTLPAVLRQDQAAAAMEAAHSGAEQDDPMALRDRLIVEMLY
ATGIRVSELCGLDIDDIDRPRKVLRVLGKGDKERTVPFGDPAADALSAWL
DRGRPHLAVPASGAALLLGARGRRVDPRQVRTVVHQTMSAVPGAPDIGPH
GLRHSAATHLLEGGADLRVVQELLGHSTLATTQLYTHVTVARLRAVHDQA
HPRA
169630284YP_001703933.1 hypothetical protein MAB_3203 [Mycobacterium abscessus ATCC 19977]MRAESGLAADPRRHLTHTAPGARAMPTIVGLSAVLMLLIAVTLWATGGND
STSYYQREVMRAMRTQSRQEKNHLAARAHRHRLRRWASRLGAVFTRRNKR
HH
169630283YP_001703932.1 putative membrane protein MmpL [Mycobacterium abscessus ATCC 19977]MNKFRTQILDNLRARPADVVPAPGRPPLARFLYRFSIPILVLWLGAAGLL
NLAVPQLETVIKQHARSFLPDDAASVQAISKMGDYFGGAGTNNFVYLLLE
GESPLGAEAHQYYSSILDRINQDKKHVNSSMDLWSDPQFAPANESADGKA
AYVLINLKGNMGTALAMESTAQIRELIAQYPPPKGITAHLTGPSAVVNDE
LVSINDSILILLVACAGLVGVILLVVYRSPITIALPLLVAGAGLGVGRPI
VAFLGQHQVIGVSIFASALLAVIVLGAGIDYGIFLLGRYQEARRAGEDPV
TAYYTALAGVQHIIIASGLTVAGATACMVFTRLAIFSTSGLPCTVAVVVT
LGAALTLAPAALAAGSRFGFFEPREEKSQRRWRRIATYVVRWPGPVLAGS
MAVLAIAFLAVPGFQPSYNERQAQPSDSPANVGFAASDRHLPPNIMSPSV
FIVESDHDMRNSGDLIALAKMSSAILNIPGISNVQGITRPLAAPLELGTL
PAQAGYVGGRLTQMTNLLKQRIEDLTALSGRVGQLSLTVRGLEQAVRTGT
TGATQIHSGAAELRTSLAAVVQKVDSLRGTAKPAEDFIGGIPNCRDNDYC
QAALTGFSLFDDLHRFDGLVGNLVNGTGTLAQTLPALGAQLPGLKDFINQ
VNAVIAPLQSTLQVLLPQVSEITQFTDDLSKSFTDGDPNNSFFIPTQAFQ
NPLFKSAMPYFFSGDGKVTRMVVTPEREGFSQEAMELSSKIIPTALQAIK
GTSLAGSTVSIGGPGGTLLNIEAFTREDFITSAVAAFAFVFCVILILLRS
LVAAIVVIGTVALSYVSALGVTVFVWQELIGIPLHWSVAPLSFVFLVAVG
ADYNMLLVARFREELHAGIKTGIIRSMANTGGVVTTAGLVFGFTMFAMIV
APARNIAQLGTAVGLGLLMDTLIVRSFVVPAIATLLGRWFWWPAVVHDRA
ASRDTVARAVTSADVTGPVRLVGASR
169630282YP_001703931.1 putative membrane protein MmpS [Mycobacterium abscessus ATCC 19977]MRGAWVYLVSIATLCIAGAYIAHLRLSDIPDPAIGHSPKPPVIGKPRDKI
VEYRLDGPAGSTVKASYLDVDGAVREVSGTLPWQATLHAKQLVVPVGLVA
QSSSEQMSCSITINGLTRDQSPANASAVSCQVTVA
169630281YP_001703930.1 TetR family transcriptional regulator [Mycobacterium abscessus ATCCMTRAGTKGMPRAERERQILDAACQEFGRSGYVGMSLAAVAAAVGVSKPMV
LAYFGSKEQLYIACVERAGATVGDHIEAAMTAAPPTLALPRAVLQAIFQA
LAPRPSDWLVIWDQTLPEGSEALAAARVARTRLAALAGQGVAAVGSAATQ
LRDAQDIGVLTQGWMGMVGAMITWWIRHPEQSAEQMAERASRLIGIIASA
GISEAEAPEGGAVPRPGTPVRGSGSGQPLNAAFDLFGRRWAILVVWELRS
GTKTLPELKAEMGDASSSVLATRLKELTAAHIVRNQDGQYSLTTVGKGLL
VALAPLHLWAKAWSASVR
169630280YP_001703929.1 hypothetical protein MAB_3198c [Mycobacterium abscessus ATCC 19977]MTKVPTMRAGIPAMTVAATALALSLGLVAPAAAVADVYPPWWVCMANGGE
MRAFYQVVSEQDALDRFHDAVARLSQSTGKPAHVDVCQPA
169630279YP_001703928.1 hypothetical protein MAB_3197 [Mycobacterium abscessus ATCC 19977]MLATRGFATWPSPRIQRAGLSTAAGMTLSRTALPGHYDVVRFRRLGCVPL
ILALAVAGSPMAATAPADTGDRFGWPLSPRPAVIRQFDNPQQRWNRGHRG
VDLAGGPDQAVVAAGPGVVVFAGVLAGRPLVSIEHHGGLRTTYEPVTPVV
RPGQRVDEGAVIGLLQRGHPGCAMTACLHWGALRGPASSAHYLNPLGLLA
AIPLRLKPL
169630278YP_001703927.1 30S ribosomal protein S2 [Mycobacterium abscessus ATCC 19977]MAVVTMKQLLDSGAHFGHQTRRWNPKMKRFIFTDRNGIYIIDLQQTLTYI
DKAYEFVKETVAHGGSVMFVGTKKQAQEPIAEEATRVGMPYVNQRWLGGM
LTNFSTVHKRLQRLKELESMEQTGGFEGRTKKEILMLTREKNKLERSLGG
IRDMQKVPSAIFVVDTNKEHLAVAEARKLNIPIIAILDTNCDPDVVDYPI
PGNDDAIRSAALLTKVVASAIAEGLQARSGLAGGDEKPEAGEPLAEWEQE
LLASAVATTDEASAPSAAATETTTEEG
169630277YP_001703926.1 elongation factor Ts [Mycobacterium abscessus ATCC 19977]MANFTAADVKRLRELTGAGMLDCKNALAESDGDFDKAVEVLRIKGAKDVG
KRAERATAEGLVVARDGALVELNSETDFVAKNAEFQALADAIVGAAAAGK
IGEVDALLAAKVEDGRTVEQAIADLAAKIGEKLELRRVAYFGGTVEAYLH
KRAADLPPAVGVLVEYESASGDATGADAAHAVALQIAALKAKYLTREDVP
ADVVENERRIAEETAKAEGKPEAALPKIVEGRVTGYYKDVVLLDQPSVSD
NKKSVKALLDEAGVTVTRFARFEVGQA
169630276YP_001703925.1 hypothetical protein MAB_3194c [Mycobacterium abscessus ATCC 19977]MGVTPSAKVAAGGVAGAITVVLLFVLGLFNVVVPGEVGSAITVIITSLTS
YLVRDGISARGGDVDEPAVQGTPLTDRVSLAEVPTARLITRGPVRPRMAY
PAYRPPYRQ
169630275YP_001703924.1 TetR family transcriptional regulator [Mycobacterium abscessus ATCCMSAAGTGTKRYPKGEAKRQEILSAALTVLERDGEAGASMRVIAKEANISL
AGLMHYFPTRDVILTEIQRGADATFEERYRNSEIELDPGEVLAQAMLDKA
NKPGSGTVYLSLAAAAAVDPEHPAGAYLRDRYERMRARIAAYVRGRQVDG
TVPAHVDADFAATALIAAADGIQIQWMSDPSIDMGEHMRRVWELLLR
169630274YP_001703923.1 putative glycosyl hydrolase [Mycobacterium abscessus ATCC 19977]MKWMNAVMASAAVVALGLTACSPRQEAPKEDAGWDRGFYWGTATAGYQVE
GSAPDSNWRRYVERSAGKPVHPDESNLLADGPVDPYKQADDFRHRYAEDI
ANAHAMGVNTFRFGLEWSRVMPEPGKWDEKELAYYDSVVATLRENGMTPM
ITLMHWVYPGWVADSGGFMNNLPAFEEFAKAITKRYAGQGVLWVSINEPL
AFGAMEVRTGAIKPDQFNGFLDRVADAHRAVYRAAHEADPEAKVTTNEAY
IPPDVLAQFAGFGVKGIEGSFFDRVAGSLDYLGFDYYTGTAADNPASAQS
MAARWNIKLQPEDIYYVSRHYAQRYPGLPIYIVENGMVTDNGKPRADGVT
RSQYLSDTVFWLQRAKADGIPIVGYNYWSLVDNYEWGSYRPRFGLYTVDA
LGDPALKRVPTDAVATYTQITRDAGTVPGYRPVIPAAKCSTTVGQDSCAP
LDPNGPTVALR
169630273YP_001703922.1 hypothetical protein MAB_3191 [Mycobacterium abscessus ATCC 19977]MTTADQQRSFSWLAGLINDSEPRCGNVRVVAIDGRGAAGKSTFAARLHSA
LTETSSPTAVLHTDDFASWDTFFGWWPRLEEQVLAPWARGEEARYRRYDW
QTREFGPWEPLSPPSVLILEGVGSGRTAGADQLSMLIWVQTDQPTRRLRA
RIRDGAQLSEFWQLWIDAEEAHFRLDPTAGRADIVVDGDPAVAPQHPERD
FMVRAATPRASNAARPWARSDPAGRSCPVPPSWSTSPPE
169630272YP_001703921.1 putative nicotinamide mononucleotide transporter [Mycobacterium absMDWTELIGSLSGVLFVILAVRQNIWTFPVAIVSSLFYMVVFSRQTLYADA
ALQIMFIALAAQGWHLWLRGSQDRHGVTVTRTPQRAWLPLVSCLVALVAG
LYAFLVTFTDSNAPQLDSAITGFSVVSQLMMNRKWIENWILWIVTDTFSV
GVYLYKGLNLTAGFYAFLSVMAAVGLWSWRKELHAVATTESA
169630271YP_001703920.1 hypothetical protein MAB_3189c [Mycobacterium abscessus ATCC 19977]MGKFRLTTHEEELQAEREYIAGLYERLDAERARVKGRYRSALRGPVDQQN
GGAMAERDDEVRALARQAQRLDVADDGLCFGRLDAITGERSYVGRIGLLD
ESNDYEPLLIDWRAPAAQAFYIATSAHPENTRRRRQFRTRGRHVDDFTDE
ILGRPDGEDHDGERGTLSDAALLAAVNAPRGHGMRDIVATIQAEQDRIIR
LDHPGVLVIEGGPGTGKTVVALHRVAYLLYTQRKRMERHGVLVVGPNAAF
LGHISRVLPSLGETNVVFTTAGDLVPGLKVTAEDDEEAARVKGSLQILDV
LAAAVADRQRAPENPMPIQLADVSVRIDADIAQWAIEEARASKLPHNEAR
TVFTDVLTWALTERAIPRIGKGWLTREDRKAWEHLRAELLDELGDHEGFA
AALDALWPMLTPETLLSELYTSPERLRAAGADPALARRIGDAWTVSDVPL
LDELVDLLGRDKAAEEAAERERRAEAEYAAGVLDLMTGREDMMDDEDHLF
ATDLLGAEDLAERFTERDTRDLVERASADRDWTYGHIVIDEAQELSEMDW
RVLMRRCPSRSFTVVGDLAQRRSAAGATSWEAMLQPYVPGRWLYRPLSVN
YRTPAEIMAVASAVLAEFAPGTQPPESVRSSGVLPWSRRLSEGELPKAIE
EFVLNEKGREGTSVVIGPPGVPGTVPASETKGLEFDAVLVVEPERILADG
PRGAAELYVALTRATQRLGVLHVAPLPQPLIGLTESTTGPGPDHRVMPTG
VAQ
169630270YP_001703919.1 uridylate kinase PyrH [Mycobacterium abscessus ATCC 19977]MTRDVSRTGYKRVLLKLGGEMFGGGAVGLDPDVVHRVARQIAEVVRTGAE
VAVVIGGGNFFRGAQLQQRGMERTRSDYMGMLGTVMNSLALQDFLEKEGI
VTRVQTAITMGQVAEPYIPLRARRHLEKGRVVIFGAGMGLPYFSTDTTAA
QRALEIGAEVVLMAKAVDGIFTDDPRANPDAEFLPEITHREVIDRGLQVA
DATAFSLCMDNRMPILVFNLLTEGNIARAVAGEKIGTLVTP
169630269YP_001703918.1 ribosome recycling factor [Mycobacterium abscessus ATCC 19977]MIDEVLLDAEEKMEKAVTVARDDFATIRTGRANPGMFQRVVIDYYGTPTP
ITQVAGINVPEARMVVIKPYESNQLKAIEDAIRNSDLGLNPSNDGSIIRV
AIPQLTEERRRELVKQAKGKGEDAKVTLRNIRRKANDELNRIKKDGEAGE
DEVGRAEKDLDKTTAQYVSQIDELVKHKEGELLEV
169630268YP_001703917.1 phosphatidate cytidylyltransferase [Mycobacterium abscessus ATCC 19MGDTDAAPAPGSSPAPPAGAKSRAGRNLPAAIGVGVALAALIIFSLLYQK
EIWVGIISVFLGIAMWEVTKRLRQADISVPFIPLFFGGQAMIWLTWPWGT
AGSVGAFAATVVVCMIWRLLSQGLGSQPVNYLRDVAITVFVAAWIPLFAS
FGALLVYPDNGAEQVFCLMLGVTFSDIGGYAAGVLFGKHPMAPAISPKKS
WEGLAGSLVVGTTASTLAVTFLLGHHPFVGIALGVMLVITGTLGDLVESQ
VKRDLGIKDMGTLLPGHGGIMDRLDSLLPSAVATWIVLTLFI
169630267YP_001703916.1 hypothetical protein MAB_3185 [Mycobacterium abscessus ATCC 19977]MASFNALSTALSTSWDIFKTSTRLLSHRKALLFFPIAAAATLAVFIVALI
VLGLLLPPNIDKTSPQFVRAALAIDYVILLYVALFWQTALITQTTAALQG
EKPSFTRGFAAARRYRTRLLPWVLIDTAVTWGFGIIDENLLYVGSLVHVL
FIGRFLDLMWRAVSFQVLPTIVLRNVGTVEAIKTCKKTLRSMLSRNVLAQ
LGLRIFILVLVLPGVGMLFAAAAAGHGVLSGVLGLAGGLWIAAAILYGAT
VSGIYQTVLYRSAEASNHA
169630266YP_001703915.1 hypothetical protein MAB_3184 [Mycobacterium abscessus ATCC 19977]MGGNDPSMTRGNLMAFANTLSTSWQIFKTSAKVLSSRKELAVFPLLSGIT
SLLVLVGMVALGVLLLPATTGDSVPPLFYPVFAVGYFILMYVATFWQAAL
ISQANIALEGGDPSVAAGISAAAQRGGRLLPWVLITGVVSWIISAVEERV
PFIGRFLDVAWRVVSFQVLPTLVLENLGAIDAVKKTKETLKNAWGRNVVG
IVGLNFFTALLSLPGIGLIYLGVAANMAAVTGVFALFGVLWILVASIVGA
ALTGIFQTALYRFTVDGHVPGPFAGLDLRQALKTR
169630265YP_001703914.1 dienelactone hydrolase [Mycobacterium abscessus ATCC 19977]MQRRDAQILTPDGLCSATLHLPDQPGPAVVLYPDAGGARDVMRAMGDRLA
SWGYVVLVPDVYYREGNWQPFNMATAFGDTQERGRLFATMGTLTPDRIDA
DAGSFLDFLADQPEVTGELVGLTGYCMGGRISLRVAATHASRVGAVASFH
GGNLAKADDLNSPHHLAGRITGVVLIAAAEEDASFPAEQEQLLGQVLTDA
GVRHTIETYPAKHGFAVTDNPTYDEGAAQRHWKALEDLYGATLGH
169630264YP_001703913.1 hypothetical protein MAB_3182c [Mycobacterium abscessus ATCC 19977]MLFEPRLRAGIHDGSISVAYRRWKRPQVRVGGRYRVGSDRIRSMTEFDFI
EVDAVDEILARDIDDADAQLAGYPSAAAARSDVGAQDAADVLYRLAFRKI
DMPDPRAELASSVALSVGEIADIDARLDRMDRNAKPGPWTREVLREIAHR
PAVRAKDLESCSRWPDLATFKVQVRKLKNLGLTLSLPVGYRLSPRGAEYL
ARTSR
169630263YP_001703912.1 lipoprotein LppI [Mycobacterium abscessus ATCC 19977]MRALLLGGLTLLGAMLLVAGCSKGATVSPTVPSSSQPPSSSSTSKPITTT
TTTTAPVDLPEPVAGAPYDAVAQWISKGAPVDVTNFHAATSQDGQKTDLG
DNVAFKTPSGKTRCMTDNIQPGTLSCLVNLTNPPKRPAGTEGNWVGGWTD
FSGRQVTVGGLHGDPGPFQSGDGNPLDYGGRLSFGDFSCRSETSGLFCAN
TKAKSAIRISDAGIEPFGCLQEATPSEGNGREFSC
169630262YP_001703911.1 hypothetical protein MAB_3180 [Mycobacterium abscessus ATCC 19977]MQKTPVPMTKSSAVALTFLYALGYPIGALSVSAMTPMLVLVARFALAGAI
LATWALIARALWPTGRTLCHVIVAGLLMQAVQFCALYEALEHGAPAVLGA
VVISMNPVVTAVLAALFLDERLNRWRLVALALGVVAVLAACANRLLATGG
IDTVLVLLLVALLGLAAGGVYQQRFCADVDFRVNSTIQNLSGLLPAGALA
LLTPSAVHDPWKGAAAVAAVVLLNATLCTSLYVRSVSTFGAAAVAMLFCV
IPAVAGLLSWLLLGQRVDIGMGIGLVIGALACWLNARASRSTKLAVKPQS
PSIGAATAAPTREPAVAS
169630261YP_001703910.1 LysR family transcriptional regulator [Mycobacterium abscessus ATCCMASSTFDIAPLRSLAAVADCGGFHRAAAVLHLTQSAVSQHVRKLETAIGE
PVVRRYGRGVVFTDRGARLLVHARRILAAHDAAVDDLVAGQERALVLGVT
EHGADLILPSITSALRSHLPDWSVRVRFDRNLYLAESVDRGIMDLAVILD
GSGLDRANAVGTVPLQWVAARGYKPNPIEPLRVMTFTEPCTLRAPMFSAL
HTLGNQYQIVGESPDLSGLYAGLRSGLGMALLPIIGWLPDGIAPVDAMPA
ANLATLSVVGRRGLDPVAFNAVKDAAREALSGESAAIA
169630260YP_001703909.1 hypothetical protein MAB_3178 [Mycobacterium abscessus ATCC 19977]MHDHNNPPSDEKSWDEFYQSHDALWSGNANPQLVAEISSLPPRTALDAGC
GEGGDAIWLAQHGWQVTGMDFAHTALRRAADNAVKVDPELANRISWTQAD
LTAWQPNRQFDLVTSHFMHLPTNLREPVFAALAAAVAPGGTLLIVGHHPS
DMQAAIGRPDLPDWYFTAEDIADTLNPKEWTIIVAESRSRKFTRDDEEFD
IADTVLRAERKPTTESA
169630259YP_001703908.1 putative FAD-dependent pyridine nucleotide-disulfide oxidoreductaseMNKLWDVAIIGGGAAGLSAAITLARSRRSTVVIDDHHPRNAPADRVHNYL
GRESTPPAELFGIGRDEAAQYGATFLDGRATAVSHAENHFDVSLDGGPAL
RARRVLVATGVEDELPDIEGLAERWGRDVLHCVYCHGWEVRDRTIAVLGT
GPLAVHHALIFRQLSDNVTLLRHNDFPMSIDEAAQLARRNIRIIDGPVSR
LHVTQDSLRGVQLETGATIACEALVVATVVSARVDMLAPVQLAPQEMRLG
EHLLGTYLPVTRGATAVPGIYAAGNVTDIKAQVITSAAAGTEVAVAINAD
LAVADAQELQYA
169630258YP_001703907.1 hypothetical protein MAB_3176c [Mycobacterium abscessus ATCC 19977]MDDQNRRMEAVLDALGPRLRALRLHRQITLAQLSETTGISESTLSRLESG
QRRPTLELLLLLAEAHQVPLDELVNAPATGDPRVHPKPFKRNGSIYLPLS
RRPGGIQCFKQIIPPHSPKGEPNLKVHDGYEWMYVLAGNLRLLLGELDLI
LPAGEAAEFDTHIPHWFGNPTDKPVEVLHIFGPQGERMHVRARSGSGN
169630257YP_001703906.1 ribosomal RNA large subunit methyltransferase N [Mycobacterium abscMPADNKPLPLVFDAPRRAMPPRHLADMSLEQSRDVVTELGLPAFRAKQIA
NQYYGRLVGDPATMTDLPAGARGGVAEALFPRLLEPLRQIACDAGDTRKT
LWRLHDGSTVESVLMRYPDRNTLCISSQAGCGMACPFCATGQGGLTRNLS
AAEILEQVRDAAASLRDGQLPGGPGRLSNIVFMGMGEPLANYNRVLTVLR
KITAPPPEGFGISQRGVTVSTVGLAPAIRRLADEGLGVTLAVSLHCPDDE
LRDTLVPVNTRWAISEVLDAARYYADVTGRRVSIEYALIRDVNDQPWRAD
MLGKKLRKALGQMVHVNLIPLNPTPGSQWDASPKPVEREFVRRVREQGVS
CTVRDTRGREIAAACGQLAASER
169630256YP_001703905.1 hypothetical protein MAB_3174 [Mycobacterium abscessus ATCC 19977]MPPSPTAERAWHTMACSRRLRFGGLAVATTEVVKYDGVDVEDVPSVAFGR
GLSGQNPRVFHVLGVVMAAILLLMLIGNHVGKVEDIFLVGFAAIVLAFTA
NDYFGRRSGRIR
169630255YP_001703904.1 hypothetical protein MAB_3173c [Mycobacterium abscessus ATCC 19977]MDLQSYVDSVREELAIAAKAGGVDAEELADRLTAPLESAIRLALLDALSA
AAEEITRELAPTVVDVRLRGREPEFVVTQPILATPPEATLPTDDGGGTWR
VTLRLPENLRTTVEAAAAGEGISLNAWLVRAAVAAAEKRTGTRTSRTGNT
IRGWVR
169630254YP_001703903.1 hypothetical protein MAB_3172c [Mycobacterium abscessus ATCC 19977]MTAPATFDTPHPITAKVELARGTLQVVASDRSDTVVAVLPRDEAKALDVR
TAERTRVSYSKGVLSVLSSQGITFRTGTIDILIELPRQSILDIAVASAAV
RADGDYADVRFQSSSGELVIDAINGAAEADTASGGVSIRELTGDIKRNSA
SGDLAVKVLRGHARVASASGSVDIGTAVAGGLVFETASGNTSIGIARGTA
ARLAIDTHSGAFTNSLEPAEGPDAADEIFDVNIRTAKGDVDLHRPVALAG
169630253YP_001703902.1 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Mycobacterium abscMSSEVCRVLLLGSTGSIGTQALEVIAANPERFEVVGLAAGGGNVELLRQQ
ISETGVTNVAVADERAAVRLDIPVLSGPDAVTELVENTEADVVLNALVGA
LGLRPTLAALKSGARLALANKESLVAGGPLVTKAAAPGQIVPVDSEHSAL
AQCLRGGTRGEVAQLILTASGGPFRGWTAQQLTAVTPEQAGAHPTWSMGP
MNTLNSASLVNKGLELIETHLLFGVPYRQIGVVVHPQSIVHSMVTFTDGS
TLAQASPPDMKLPIALALGWPDRVPAAASACDFSTASTWEFEPLDAQVFP
AVDLARSAGEAGGCMTAVYNAANETAAAAFLDGRIGFRSIVRTIADVLDV
ASQWEGTSAEPATVDDVLDAQRWAGQQAAQFIFAEENRT
169630252YP_001703901.1 protease/peptidase [Mycobacterium abscessus ATCC 19977]MAAYAIGIALFALAILVSVALHECGHMWVAQATGMKVRRYFVGFGPTLWS
TKRKSNRPNKQGANDIVEYGVKAVPLGGFCDIAGMTSVEELTPEESDRAM
YKQKVWKRVAVLFAGPAMNFLIGIVVFYGVVLFWGLPDNNAPTHPEITQT
SCVAPQKSADPRDVVACTGEGPAALAGLRAGDQVLTAGGTSVSTSTDLVT
AIRGLRGPQVFEIVRDGKPQSLMVNVTETQRWDEKAGKLVPVGAVGASLS
TYVPQKHYNPVTAIPATGNLIGTVAVETVKAIGKIPMKVGALWDSITGSE
RAMDTPMSIVGASRMGGETVEHDMWIMFWILLAQLNFALGAINLLPLLPF
DGGHIAVATYEKVRNMIRSARGLAVGAPVNYMKLMPATYLVLVVVVGYML
LTITADIVNPIRLFQ
169630251YP_001703900.1 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [MycobacteriumMMTGLGMPSLPGAPPPTLAPRRQTRQLMVGSVGVGSDSPVSVQSMCTTKT
HDVNSTLQQIAELTASGCDIVRVACPRQEDADALAEIARKSKIPVIADIH
FQPKYIFAAIDAGCAAVRVNPGNIKEFDGRVKEVAKAAGDAGIPIRIGVN
AGSLDPRILGKYGKATPEALVESALWEAGLFEEHGFGDIKISVKHNDPVI
MVAAYELLAAQCDYPLHLGVTEAGPAFQGTIKSAVAFGALLSKGIGDTIR
VSLSAPPAEEVKVGNQILESLNLRPRSLEIVSCPSCGRAQVDVYTLANAV
SAGLEGLDVPLRVAVMGCVVNGPGEAREADLGVASGNGKGQIFVKGEVIK
TVPEALIVETLIDEAMRLAEQMGLENGAGIGSDGTPTGQPVVTVS
169630250YP_001703899.1 hypothetical protein MAB_3168c [Mycobacterium abscessus ATCC 19977]MLGLSDTEAVRAVLDIDPVASCMLAARVEARGADPTAIGGEIWSTGVLAD
SLCFVGTTIIPLAGGPEATRLFAERAIEQHRICPSLVGPADVVLDMWCHL
DPVWGPAREVRACQPLLAMLDAPTCVVDPAVRQVRAEELDEYLNASVQMF
IGEMGVDPRNGDGGRGYRRRVAGLIEAGRAWARFEDGRVIFKAEIGSQSR
SVSQIQGVWVDPEFRGRGLGTAGVAAIAAAVHRSGRIPSLYVNSFNEVAR
ASYAKAGFTRIGTFATVLVS
169630249YP_001703898.1 penicillin-binding protein [Mycobacterium abscessus ATCC 19977]MFRRGWVLAMVGTVLLVAGAVACTPRPDGPGPVAEKFFEALAKGDTAAAA
KLTDDPDGAKVGLDQAFSGLQATSFKAAVNGSQYTQDTGSADATYTWQLP
RKRVWTYNGRLEMLRTAGSWQVRWAPSDLHPKLGERQMLSLRTDPAKRAT
VNEAGGTTVLAPANLYRIAFDASKAGKSLMSTATALADAIRPYDDTMNAA
SLAEQASAQTSPMDLITLRKDDWDKVSIALETRPGALRPGVVMTPIADLL
PTDDAFAPDIVAQVKKAVLDELDGEAGWRVVSVNQNGVDTAVLNEVKPTP
APSKTISLDRAVQNAAQNAVNTRGQKAMMVVIKPSTGEILAVAQNAAANA
DGPLATTGLYPPGSTFKIITAGAALERGMATPDTMVGCPKRITIGDRSVP
NYNEFDLGTVPMWRAFANSCNTTFAKLASEMPLDGLTVAASQFGIGPDYD
VAGIPTISGNVPPTVNLTERTEDGFGQGKVLVTPFGMALAAATVANGKTP
VPQLISGQITGITGERPAVTPTMVDGLRGMMRETVLSGTAMDLKGEGAVF
GKTGEAEFPGGSHAWFAGYRGDMAFATLIVGGGGSEAAVRATKVMFQSLP
PDYLA
169630248YP_001703897.1 hypothetical protein MAB_3166 [Mycobacterium abscessus ATCC 19977]MGLPAGLTLEAIVIDCRDAIALGRWWSEVLEWPHTIDGDGYVSVFQPDRH
PPLLFFMNVPDPKTAKNRLHLDFRDDDQSALVDRFLAHGATRIDIGQGDS
PWVVLADPEDNEFCVLASRADQAK
169630247YP_001703896.1 hypothetical protein MAB_3165c [Mycobacterium abscessus ATCC 19977]MLVVTGLVSLLMNAAVTAPATLGHALAASPSGVASVSPTPGQTVGVAMPV
TIRFAAPVADRIAAERSIEFSAPKVPAGAFSWVDNATVRFTPREYWPAHS
SITVSVNGVSGMKYKFQTGSEVLGIGSISGHTFTVKIDGTVMRTMPASMG
KPKHPTPVGSFTALEKQSPVVMDSRTIGIPLNDPEGYKLTVYYAVRVTWG
GVYVHSAPWSTGAQGNSNVSHGCINLSPDNASWYYNTVSIGDPIIINA
169630246YP_001703895.1 methionine aminopeptidase [Mycobacterium abscessus ATCC 19977]MSIDRPEYVGKSKVAEAIGEPYVQTPEVIEKMRVAGRIAARALALAGEAV
APGVTTDELDRIAHDYMVSQGAYPSTLGYKGFPKSCCTSLNEIICHGIPD
STVIEDGDIVNIDVTAYIDGVHGDTNATFLAGDVSEEHRLLVERTREATM
RAINAVKPGRALSVVGRVIEAYAKRFGYNVVRAFTGHGVGPTFHNGLIVP
HYDDPNLDIVIEPGMTFTIEPMINLGSLEYEIWDDTWTVATADKLWTAQF
EHTMVVTEDGVEILTVP
169630245YP_001703894.1 cobyric acid synthase [Mycobacterium abscessus ATCC 19977]MTGAVSGALLVGGVSSDAGKSLVVTGLCRLLARKGIRVAPFKAQNMSNNS
VVTVDGGEIGRAQALQARACGLEPSVRFNPVLLKPGSDRTSQLVVRGRAT
GNVSARSYVEHREELRQVVAEDLRTLREEYDVVICEGAGSVAEINLRTTD
IANMGLARAAGLPVVLVGDIDRGGVLAHLFGSVAVLEPADQRLVAGFIVN
KFRGDPTLLEPGLEQLATLTGRPTYGVLPYDDQLWLDAEDSVSVVASGQV
GQTSDPIGQEWLRVAAVRLPRISNSTDIEALACEPGVTVRWAAHPADIAD
ADVVVIPGTKATVADLAWMRRHGVADAVVAHARSGGPVLGICGGFQMLAT
TIDDRVESGAGAVEGLGLLDIDIAFEPVKTLRRWGPPGLTGYEIHHGTVT
RSAVPPWLTDHDEGAVDGAVWGTHWHGVLDNDDFRRAWLTQAAAAAGRSG
FAVAADTNVGDRRAAQLDRLADLVGTHVDVDALESVWEESGLPASAPSYP
VIAARVE
169630244YP_001703893.1 hypothetical protein MAB_3162c [Mycobacterium abscessus ATCC 19977]MGCTQTVAGTATWPGARIAQSLLTADELPEGTKYDRVVADLGPMTVNSQS
QQVVVGGMPSNPQGCADGLSPRLANAGKAGPENTARYIARFNGANIIVSL
LRDTIDLTNVKDVATRCAQYEVFFDTNSPGTPMTTEPVQGGPVGVLTYKQ
TMIMPKGTTSRYMAFANVRGVAMVATSFDLRDPSVKATATMPQTFLDIVG
KQVDKIERT
169630243YP_001703892.1 hypothetical protein MAB_3161c [Mycobacterium abscessus ATCC 19977]MSPTPELHRPRPAVPPARDGELHQVVTIDGRTVQVNVSGPDKGTTVVMLA
AAGHFALSYRAVCERLHTAGLRTAVIGHDPHLHAKAITGVLDDIGVKVAL
LVGDRAGGELAWDLAASKLDRFIGLVAIDRGHPRVADRAGLIRDKHCPPV
EINTTVLVTSDATRAIARASQRFVYGDYRIVELMGRRSATRDLTPELAAE
VVLRSSSW
169630242YP_001703891.1 hypothetical protein MAB_3160 [Mycobacterium abscessus ATCC 19977]MTWEPDVLDGYLRQTIDLGIDPDGEGVITATLVRPEIQPENGRAVLMVHG
YTDYFFHTELAEHFLARGYRFFALDLRKCGRSRHEHQTPHYISDLSLYDA
ELNAAIAIINGEAGGGTSEAPILVYGHSAGGLIVSLWLNRLRVSDRLGRI
AGLILNSPWLDLQGRPFLRSGGTTAAVKAISRFRAKQAIPLPHEGAYGAS
LHKDFHGEFDYNLEWKPVGGFPVRFGWISAIRRGHAELHRGLDVGVPNLI
LRSDRSLPGDIDPAVALQGDLVLDVQQIARWAGCIGNDQRVVPIPGAKHD
VFLSVAQSRARAYRELNSWLQWYETAE
169630241YP_001703890.1 malate:quinone oxidoreductase [Mycobacterium abscessus ATCC 19977]MSATLGALLRLVEPDLSITLIERLDAAASESSDPWNNAGTGHSALCELNY
TPQKADGSIDITKAITVNEQFQVSRQFWAYAVENGVLPDVRGFLNPIPHV
SYVHGADKVEFLRKRHEALVGNPLFAKMEFIDDDDEFARRLPLMAAGRDF
TDPVGLNWSQDGTDVDFGELSKQLVGFGVRSGTSAVFGTEVRNISRESDG
GWLLKLVNGRTGEKRKLKAKFVFVGAGGGALGLLQKAGIPEAKGFGGFPV
SGAFLRTNSTDLTDGHKAKVYGFPPLGAPPMSAPHLDTRVINGKEWLLFG
PFAGWSPKFLKMGKVTDLPASIKPNNLLSMVGVGLTEFKLATFLLSQLAL
TPDDRIDMLREFAPKAQRADWELITAGQRVQVIRPAKGKGGALEFGTMVL
NSADGSIAGLLGASPGASTAVPAMLDVMQRCFPDRYSNWMPKLKEMIPSL
GISLSDEPSLFGEVWDWGTRVLGLEQ
169630240YP_001703889.1 hypothetical protein MAB_3158c [Mycobacterium abscessus ATCC 19977]MSIGWSWSADLDTTTLYGLLRLRAEAFIVGQNCAYQDLDGRDLDPGTRHF
WIKDQDNAVVSGLRLLVDPAGDGFWIGRVCTAEAERGRGHAARLVRAVLA
EIGGAGCRLNAQAHLKDMYGKLGFVVSGDEFLEDEIPHVPMTWVAGNG
169630239YP_001703888.1 magnesium-chelatase [Mycobacterium abscessus ATCC 19977]MASATAGYPLSAIVGHDRLRLALVLSAVRPDIGGVLIRGEKGTAKSTAVR
ALASVLGSVDGARLVELPIGATEDRVVGSLDLQKVLRDGEHAFSPGLLAR
ADGGVLYVDEVNLLHDHLVDVVLDAAAMGRVHVERDGVSHSYDARFVLIG
TMNPEEGELRPQLLDRFGFAVDIHASRDVEVRAEVIRRRLAYEADPAGFV
SRYASEEAELAARIADARQLLARVVLPDAELRRIATLCAAFDVDGMRADL
VVARAAIAHAAWRGADTVGEPDIRVAAELALPHRRRRDPFDEPGLDPDQL
DQAMRDSAPPQDQDGEDPDPEPDGPGGGASDSAPDPAKASDSQQDSAYAA
GSSRPSPAPSATFRTKTLRVPGVGMGAPGKRSVARNRAGKVIAPSSDEGF
GVHVIGTLMSAASRVTEPGRLPRPVLTDLQWAIREGREGNLVIFVVDASG
SMAARQKMSAVSGATLSLLRDAYQRRDKVAVITFRGQDAAMLLAPTGSTH
IAGRRLQRFDTGGKTPLAQGLLAARDLVARERGRDPHRRALVVVLTDGRA
TGGRDPLGRTRRASALLRAEQVACVVIDCETSFVRMDLAVTLAQQLDAPV
IQLDHLNADRLAGVVRGATAAA
169630238YP_001703887.1 cob(I)yrinic acid a-c-diamide adenosyltransferase [Mycobacterium abMPQGQPLVVPQDGLTTKARRNAPILAVHTGAGKGKSTAAFGMALRAWHHG
ADVAVFQFVKSAKWRVGEESVFGELAKLHDEHGIGGSVQWHKMGSGWSWS
RKAGTETDHAADAAAGWAEIARRLAAQEHGFYVLDEFTYPLKWGWVDPDE
VVEVLRSRPGMQHVVITGRDAPQQLLDAADLVTEMTKVKHPMDQGRKGQR
GIEW
169630237YP_001703886.1 cobyrinic acid A-C-diamide synthase CobB [Mycobacterium abscessus AMVIAAPASGSGKTTVATGLMGALRHAGHRVAPFKVGPDYIDPGYHALATG
RPGRNLDSVLVGDDLIGPLFRHGSRNADIAVVEGVMGLFDGRVGDAKGST
AEIAALLGAPVVLVVDAKGYSQSLSALLHGFVAHAAEAGIRIAGVILNRV
GSARHRDILTAAADRAGLRVFGALPRTDELSVPSRHLGLVTAVEHGQAAL
GAISAMAQLVATHVNVGAIAAAAHSDVTSPIWEPAEAVGAPTDREPVVAL
AAGQAFTFGYAEHRELLAAAGALVAEFDPRSDSLPAETAALVIPGGFPEQ
FATDLSANATLRQQVGEMVGPIHAECAGLTYLCRDLDGVPMCGVLDARAR
FTDSLTLGYREAVALTGSVLFEEGERLSGHEFHRTTVDYPEDGAPRAWAW
RTADGVRREGTVVGEGRIHASYLHTHPAAHPSATARFVARAAATGLSNDA
RSG
169630236YP_001703885.1 hypothetical protein MAB_3154c [Mycobacterium abscessus ATCC 19977]MIARLITTGLLMAALGLTEAAAAIAEPIDMAPQLYSRTTRDGWRLEIRLD
NERVNSVPNLAAATNSREAFVTLSGTATATGGTNPITDSLFLIGYQLGCQ
SDVSSGLQIGGSAGVAPSVNVGVLPLQTVGVGGSAGVSGFVQTVLQPGVI
VNLPLGNMVLSRGNTGALDLDNVHLKADACGGDVTIRSFASLRVSTETGH
TEFAIYGDPIRI
169630235YP_001703884.1 hypothetical protein MAB_3153c [Mycobacterium abscessus ATCC 19977]MALAVVYSPAAVAAADPLPINPMPAVPVTVPGSAPNNHASTPSQPAFGLL
PRPGHGTQVSAGLEAGHTTRITGGMTGGQLEDPRGIRAGDAP
169630234YP_001703883.1 hypothetical protein MAB_3152c [Mycobacterium abscessus ATCC 19977]MIRVVCVAMIMSALAAGVGVTASAELPPPSPAPYGPAVAPGQLPALNVSR
GTRLPSSMSGARGPRMSGGVEGAGAAGGVKVSGGFGP
169630233YP_001703882.1 TetR family transcriptional regulator [Mycobacterium abscessus ATCCMTKNAATQRQRTSGRLNRSLDIAILEAAFVTLAEQGYDAMSMDNIAARAG
VGKAAIYRRWSSKAALTADAILHGRPSLGKLDEVPDTGSLRGDLHSLYEA
RDFGDDQVLTGNLLAGIIAEAVNDPTLAAALDDLLVSQTHKRMELVFARA
VERGEITQGRDLSLVYDIPLGLSLTAALKRTVIDETYMHRMVEEVILPLV
QAPTTHT
169630232YP_001703881.1 MmpL family protein [Mycobacterium abscessus ATCC 19977]MRHGSGDHTARPPRIARLIRTLSIPIILFWLGIAIVLNIVTPSLDEVGKA
HSVSMSPKDAPSMIAMMHTGKVFGEFDSDSSVMIVLEGQQELADEAHRFY
DEIIKKLKADPTHIQHISDYWGDPLTASGAQSADGKSAYVQVNLAGDQGT
TLANESVDAVRKIIAETPGPAGVQAYVTGGTAASADTGTAGNKSMQKTTL
IAVGVVLLMLLLVYRSVITTIVALLIVGLELMAGQGVVATLGNLNVIGLS
TYAVSMVTMLGIAAGTDYVIFLLGRYHEARHRGQDREAAFYTAYSGVSHV
ILGSGLTIVGATLCLSLTRLPLFRSMGVPCALVILVIVAAALTLAPAILA
LGSRFGLFEPKRKYDEGGWRRIGAAVVRWPGPILVVTCGIALVGLLTLPG
YTPGYDDRQYMPDNVPSKVGYAAAERHFSPARMNPEMLMIEADHDLRDPS
DMLVIDRIAKTAFHARGVGRVQAITRPLGTPIEHSSIPFQIGLQGAGQIQ
NMKYMKDRMADMLTMANQMGILIGTMERVYGMMRELTDIMHDMTGQMKEM
QGKMHDMRDLMYTFDDFFRPIRNYFYWEKHCADIPICWASRTVFDALDGV
DQITEDMDGMVVNVDKIDVLMPRVLAEFPPMIAIMKTMHGSLLTMHSTMA
GIMNQMDESTKNSTLMGKYFDEAKNDDSFYLPPEVFDNPDFKRGLKMFLS
PDGKAVRMTVSHQGNPASVQGIETVGNIREAVADAIKGTPLENAKVYMGG
TAATNRDLQEGAKYDLILAGIASLCLIFIIMLLVTGSVVAALVIVGTVAV
SLGASVGVSVLIWQDLLGMDLHWFVVPLSVIILLAVGSDYNLLLIARFKE
ELHGGLKTGFIRAMGGSGKVVTNAGLVFAFTMCAMVVSDLRIVGQLGTTI
GLGLLFDTLIVRSFMMPSIAALLGRWFWWPLRVRTHGTAGV
169630231YP_001703880.1 MmpS family protein [Mycobacterium abscessus ATCC 19977]MFRTIRKIWMPLLIAAVVAIGGFAVFRVRGIFGSESFGASADNNAKDAVP
YNPKTLVYEIFGEPGAMADVNYFNEDAQPTRVDNVQLPWAFKIVSTLPSL
SGNIVAQGNGDQIGCRITVNGEVKMERVSTEHNAYIYCLVKSA
169630230YP_001703879.1 polyketide synthase Pks5 [Mycobacterium abscessus ATCC 19977]MGCRLPGGIESPEQFWQALLRGEDFITEVPPARWDLTEYYDPESGVPGKS
PSKWGAFLEDVGGFDADFFSINEREAVSIDPQHRVLLETSWQAVEHAGID
PRALAGSQTGVFVGVTHNDYQLVAADAADLGGPYGFAGTNFCMASGRISY
ALGVHGPSLTVDAGCAAGLATVHMGCQSLAAGESDLVLAGGVNLVLEPRR
YVGASQQRMLSPTGRCHTFTGEADGFVMSEGCVMVLLKRLDDAVRDGDRI
LAVVRGTASNQDGRTVNQSTPSSEAQAAACRTALAVAGVEADTVGLIEAH
GTGTPVGDPIEYTGLAQVYGVDGPCAVGSVKTNFGHTMSAAGALGLMKIV
LAVEHGVVPPNLHFTGIPDKLAPVKTNLFVPQTVIPWPGKAQGPRRAGVS
AYGMSGSNVHAVVEQAPPVESSTPPAVESPLGSQLIFPVSSTSAEELRRT
AARLADWVAERPEVAPGDVGYTLARRRAHRSVRTAVVADGADELIDALRG
VAEGDAPYPAAVAQDDRGPVWLFSGQGSQWAGMGAELLGKEPVFAETIAR
LEPLIHAESGFSVTDAISAPETVTGIDRVQPTLFAMQVSLAATLASYGVR
PGAVIGHSMGEVAAAVVSEALSLEDGVKVICRRSQLMLRISGAGAMASVD
LPAQQVVSELADRDIHDVVLAVVASPQSTVVGGATETVRQLIAEWSDRGL
MAREVAVDVASHSPQVDPILDDLADALEDLTPRTPVVPLYSSVSFDPRER
PIMDADYWVDNLRHTVRFAAAVQAALDDGYRVFGELAPHPLLVYPAEQTA
RSLDIPMVALAGMRREQELPHGLRDFVGDLYTAGGAVDFSVLYPTGQLVD
VPLPSWTRRSYLLDLSAQAQQGHGTHTVAVHPLLGAHVRLAEEPERHIWQ
ADVGTVGQPWIADHQVRHVAVYPGAAYCEMALSAAAAVFGEGSAVQSISF
EQLLTLGESTPISATATAKSADILEFVVETHDEGDVVKRATAVLGNGGDV
DMPIAYDLSALRAEHPHRESGDDLRASFDERGVQYGPAFQGLAAAYRGDE
TVRSVLAEVTLPRDVRAQQGSYIVHPALLDACFQSVIALPDVQEASKDAL
PLPKGVRSLHAYESARATQYCYTRVTKVVGNEVEADIDLLDETGSVLIAV
RGFRFGTGSSDDEQRDQLLNNRLLAIEWQQQRLPESVSGAPRRWLLVSTG
ESVDPWAAELIDSLKVRESEVSLIQWRPNTDRVAALKLLYDQLESGTFDG
VLVVTAPGSEGGADRVVLQGADQVRHLVRITRELVDLPGEPPRLFVVTRN
AQTVVDGDITNLEQAGLRGLVRVIGAEYPHLRVTHIDVDRHTAAQNVAGE
LVSGSEEDETAWREDHWYRARLNLGPLGPDDWRSTVATPNNEGVRFEVRT
PGDLQSLGFVAFDRVAPGPGQIEVSVTATSINFADVLNVYGRYSSFEGRQ
ELGVDFAGVVTAVGEGVTQHQVGDRVGGMTPTGAWRSFVVVDANLAATLP
AEVPDREAAAVPGAHVTAWYGLHELARISAGDKVLIHSGTGGVGQAAIAI
ARAAGAEIYATAGSPERRDLLRSWGIKHVYDSRSTDFAELIRRDTDGYGV
DIVLNSLTGAAQRAGVELLTFGGRFIEIGKRDIYGDTRLGLFPFRRNLSF
HAVDLVLVAKTRPEAIYRTLTALYGQMAEGVLPLPEISPSPLQEAAESIR
VMGAAGHTGKLVLDLPKAGEVSAVIPPSHAPAFRRDGAYVVTGGLGGLGL
FLARKLAAAGVGRIILNGRSAPKPEALAAIEQIRQGGTEIDVALGDIAEP
DTAQRLVAAATETGKPVRGVLHAAALVHDATLANITDELIDRGDWRPKVH
GAWNLHEATADQPLDWFCSFSSIAALVGSPGQGAYAAANSWLDGFTHWRR
AQGLPATVIAWGAWSEIGQGTHLAQNAEAAILPDEGAYAFDTVLRHNRAY
TAYAPMAGISWLADFVERSPFAQAFRDAGQNQTETNKFLDELRALPREEW
PTRLRKLVAEQVGLVLRRSIDPDRSLPDYGLDSLGNLEIRTRIQADTGVR
IGPADVSTVRSLAAHIYDRLAEQESEVASS
169630229YP_001703878.1 polyketide synthase associated protein [Mycobacterium abscessus ATCMRGGPVTVSLTDKWEPTAGSVITWQPSPASYAKALEAPVSDVPPSFMQVQ
HLRTYLRQAAKGLDFSRVLVFTLDMPGRCDKRAMGHVINAHLRRHDTYRS
WFSLDDEQNIVRRTMADPADVEFVQVKLGEMTSDEVRELVVSETPDPFRW
DCFRFGIVQSSGHFTFYFSVDHLHLDATFARLLIMEILMGYKALVQGGAP
IELPPAGSYGDYCIRQHEFLSGLTPDSEPVREWTQFAENNRGSLPDFPLP
LGDHGVQCGTAIVTEQLLDEQQALKFESLCVDAGARFIGGVMAALGFAER
ELTGTDTYYGITPSDAREEADMFTTGWFTGLVPITAPVDGTFAAAAVAAQ
ESFDRGRQLVNVPFYRVLELVPQLSWPRPYHPMINFFDGGAPPLSQLFTN
PLLVSNPIGLYAESKSVYQLTIFISRFPTETTLMIAYPDNPVARESITRY
VDLVKSTFARVCEQNDVVPAR
169630228YP_001703877.1 hypothetical protein MAB_3146c [Mycobacterium abscessus ATCC 19977]MWTIVLLMAIGVSVEPTRLGLTVLMLNRPRPLLQLFVFLCGAFAMGLSLG
LTLLFVLRVSPVGKADVSGPYIQIGLGVLALLVAAVLAVTASGSRPPAAP
RTTTGFAGKLATRVRGFLQNNSLWVAGVSGLGIALPSADFLAVIALIHAS
GETQPVQSMALLFFNVVAFSMVGLPLLSYAAMPGRTYQMVSALHTWVRSR
RRIDVAGIVAVLGLILLTLGIFGILRA
169630227YP_001703876.1 hypothetical protein MAB_3145 [Mycobacterium abscessus ATCC 19977]MSQRRPLMLMRPVPGPSPIHALWAGTKLLAVLAISVLLTITPSWPAIGLV
ALLILVTAGLAGISPRCIPSVPRWVWLLVVAGSLFTIVNGGAPELKLGPA
TIGVGGFLDFLRVTSLGLVLIGLGAVISWTTQVADIAPAVALLCRPLRVL
RVPVDDWAVTISLAFRMFPMLSEEFRLLAAARRLQPPAPEKPSRRAEVVD
LCTAAMVVSLRRATEMGDAITARGGAGRISAHTVYPGWRDAIAAAVLVGV
VTLAVVLG
169630226YP_001703875.1 ABC transporter ATP-binding protein [Mycobacterium abscessus ATCC 1MQPAELAQAAMTAALMGAIAVVSIVLPGAVVFAWLGAVPMGVLCYRHRIR
VALAACVAAGLISFLIAGFGGLVSALTCAYMGAISGQVRRRSRGAATMFT
VAALWGVLVSTFCVGVFAALRNLREVVLGAVAANVGGFATLLQGVPVLGR
GAAGLDHAVAGWLVHWPWFFGVSVWLIVIFGTSFGWRVLTPVLRRLEEVT
DLASVGTLPAPHESTAPGPLPTVLTDVGYRYAGAERDALAPVTMRVDVGE
HIAVTGANGTGKSTLMRILAGVPPTTGSVERPAGVGLGQVGGTALVLQHP
ESQVLGLRVGDDIVWGLPPDRDIDIEGLLTEVGLSGMAGRDTAGLSGGEL
QRLAVASALAREPALLIADEVTTMVDHDGRQTLINVLDGLTTHHRLGLVH
ITHYPQEADAADRVVALGGIAVRPPAEPPSPAESPSKETILDVRSVSFDY
AVGTPWSQPVLRDVSFRVDSGDGILLCGGNGSGKSTLAWIMAGLLDPSAG
QCLLDGRPTAEQVGAVALCFQAARLQLLRGHAGAAVAALAGYSAADTDSI
DRALASVSLDPAIGGVLIDRLSGGQLRRVALAGLLARSPRLLILDEPLAG
LDVDAQADLIDLLIRIRNGGQAVIVISHDTDSLSPLCPRTIRLEQGELVT
AG
169630225YP_001703874.1 multifunctional siroheme synthase CysG/uroporphyrin-III C-methyltraMTHDAYLVGLRLAGRKVVVVGAGSVAQRRLGLLIASGADVHVIAPHATPA
VEGMASINLQLRPYQDGDLDGAWYAIACTDDPAVNAAVVDEAERRHIFCV
RADSARDGTAVTPASFNHDGIAVGVLTGGQHKRSAALRSAIHEALQRGLI
TETADVKPEGVALVGGGPGDPDLITVRGRRLLAQADVVVADRLAPAELLA
DLGPHVEVIDAAKIPYGRAMAQQEINRVLIERAQEGKFVVRLKGGDPFVF
ARGYEEVLACAEAGVQVTVVPGVTSAISVPAAAGVPVTHRAVNHEFVVVS
GHVAPGHPESLVNWDALAALNGTIVLLMAVERIEQFARVLIEGGRPAHTP
VLVVQHGTTDEQRVLRADLATAPERIRSQGIRPPAIIVIGPVAAYGAF
169630224YP_001703873.1 putative transmembrane efflux protein [Mycobacterium abscessus ATCCMSGLSVEQLTQKAREFLPSRHYLYAVIAIAGMQFLATMDGTIAVVTLPKI
QAELHLNDATRSWVITAYMLSFGGLMLLGGRLGDTFGRKRVFIGGITLFT
LASIGVGLAQEDIGLAIFRLIQGVGAAVASPTALALIATTFPKGPLRTAA
VGVFGAMTGVGSIAGLIVGGALAEVSWRLAFLINVPAGALMIYLAVRSLT
ETEREPMKLDVAGSVLATLGCTAAVFGFTQGPDRGWDSPYTIVSLIAAAA
LLIAFLFVERTAENPVLPFSLFTDRNRVATFAAIFMAGGVLFTLTITIGL
YMQDLMKYSPLRTGIAAIPFVVGMGIGLGLSSQLVTRLAPRVLILCGGVV
VFGAMLYGSTIDRTIAYFPDFATAIFVGGIGIGTIVVPVILSAITGVDAD
RIGPLSAISLMLQNLGGPIVLVIIQAIITSRTLYLGGATGPVQNMNRDQL
HALDHGYTYGMLWIAGTAVLVGVAALFITYSAADIAHAQKAQAAHDQGLD
EDELE
169630223YP_001703872.1 hypothetical protein MAB_3141 [Mycobacterium abscessus ATCC 19977]MRAWTVIPAVTVLGLGFAVPAEAAPATVKYSLSAIGIGNADFTVQFQDGG
QLREESGHTFAGYYWERTVKLDGARPILRVTPAGPPSVFRMSCHITVNDG
IPVTNGLLFRAGDYTPQDC
169630222YP_001703871.1 prolyl-tRNA synthetase [Mycobacterium abscessus ATCC 19977]MITRLSELFVRTLRDDPADAEVPSHKLLIRAGYVRPVAPGVYSWLPLGLR
VLRKIENIVREEMNAIGGQEILLPALLPRAPYETTNRWTEYGDSLFRLKD
RRDNDMMLGPTHEELFALTVKGEYSSYKDFPVILYQVQTKYRDEARPRAG
ILRGREFVMKDSYSFDTSDDGLKAAYHAHRDAYQRIFGRLGLDYVIVAAT
SGAMGGSASEEFLAESPTGEDTFVRCVESGYAANVEAVITPAPPARPIEG
LAEAVVHETGDTPTIATLVDWANSAGLGRTVTAADTLKNILLKVRQPGGD
WELLAVGVPGDREVDDKRLGAALEPAEYELLGDADFAKYPFLVRGYIGPK
ALLANGVRYLVDPRVVEGTSWITGADEPGKHVVDLVAGRDFTADGTIEAA
EVRDGDPSPDGAGQLVSARGIEIGHIFQLGRKYTDAFTVDVLGENGKPVR
LTQGSYGIGVSRLVAVVAEQQHDELGLRWPSAVSPFDVHVVIANKDDAAR
AGAEELAAELDRLGHEVLLDDRTASPGVKFKDAELLGVPWIVVIGRGWAD
GTIELRNRFTGETQPIAVTDAVASVTQAIG
169630221YP_001703870.1 hypothetical protein MAB_3139c [Mycobacterium abscessus ATCC 19977]MVMPSFKLEPLVESDFNTSDFVYTFSTPLPKDAATVWAELNGESPLHWCK
AINQIGWTSPEPRGVGSTRTAKLALPGAAVNERFIVWEESPERYRNAFTV
ETATFPGTKRFGELYEVVGTATGSLFTWSFFIEPSLGFTRHLKPVIRRGL
SGLITDTQKHFA
169630220YP_001703869.1 hypothetical protein MAB_3138 [Mycobacterium abscessus ATCC 19977]MTTTEPTPQPASSADDTALANALANEHAAIYSYGLVSAHSVPDNNWLVTE
CLVEHRQCREECIATLRGRSVTAPVAAAGYKVPFPVSTPADAIKLALQVE
TDTAACWRAVAEQADSADDRRFAVRMLTESAIRAARWRVAGDIAPASVAF
PGGTEKA
169630219YP_001703868.1 hypothetical protein MAB_3137 [Mycobacterium abscessus ATCC 19977]MLRSLSRRDLLIGGAALGVTAVAAACQQTPDTKPEEDALQAQIDLAVRDA
ASATAAATANVELAPALNTIAGIRSAHVAALAKELKRIPGAAATVRSTPS
TTTAPVAPPSADQVKNQLKDSARAATDLAAKQSGYRAGLLASISAACSCA
AEVDLP
169630218YP_001703867.1 hypothetical protein MAB_3136c [Mycobacterium abscessus ATCC 19977]MPDPLDPSDSSTGLPSDDQVLELLAPEFSRSGVEIESVVVSDGGVAGRPS
RIAVVVDSDTPVDLDAVAGLSRTASALLDEADTGWQAYELEITTPGVDRP
LTTVAHFRRAHLRLAQIRLTNGEDLLGRIGITHDDGVQVVLRKPIKGTGW
TVRDLAFSDIESAVVQVEFNTPNPQELNLAGAAETGGGA
169630217YP_001703866.1 transcription elongation factor NusA [Mycobacterium abscessus ATCC MNIDPAAVNLMAADKGITVDEAIDIIKSALLTAYRHTDGHEPNARIEIDR
KTGVVRVMARETDQDGNLITEWDATPEGFGRIAATTARQVFQQGVRDAEN
EHKFGEFSTREGEIVGGVIQRDARANARGLVVVRMGSETKGSEGVIPSAE
QVPGEEYHHGDRLRCYVVGVSRGAREPLITLSRTHPNLVRKLFSLEVPEI
SDGSVEIVAVAREAGHRSKIAVASKVSGLNAKGACIGPMGQRVRNVMSEL
SGEKIDIIDYDPDPARFVANALSPAKVVSVSVIDEAGKAARVIVPDFQLS
LAIGKEGQNARLAARLTGWRIDIRSDADPEN
169630216YP_001703865.1 hypothetical protein MAB_3134c [Mycobacterium abscessus ATCC 19977]MQLTRFTDLGLRIVMRLAVEGPNAQLHTDDLAAQLCVSYTHATKVVARLS
EMGAIESTRGRHGGVRITQDGLGRRVGSLARKLERSGEVIDCEGDPPCPL
RRNCRLREALRSAQDAFFTHLDQWTVAEIARPTMERK
169630215YP_001703864.1 putative flavohemoprotein [Mycobacterium abscessus ATCC 19977]MDGGRNSPSNNGKEVVKVLSAESLGVIRETLPAVAGAIDEITPLFYSKMF
AAHPELLRDLFNRGNQAAGEQPKALAASIAAFAGMVLEGNGAQYDSVLDR
IAHKHASLGIVAEQYPIVYEHLFAAIAEVLGGAVTADVAKAWSEFYWLMA
DELIAREKALYDAAGVAPGDVWLQAIVVRRQLESADVAGFELRGVSGKLP
NFVPGQYISVQVTLPDGARQIRQYSLSRGSTAGDWRIAVKRLNVGDTPAG
EVSNFIYDNVFEGQQLRVSVPMGEFTLDDSADPLVLVSAGIGCTPIMGML
QELVATQSPREVVVLHADQSAAAHAYRHELADLVGRLPAGRLHTWYERAH
VEHPADGIGRMSLDRLPIDLSSTVFVCGPRPFMSAINEDLVSLGIPQEQI
NHELFGPLASAVA
169630214YP_001703863.1 hypothetical protein MAB_3132c [Mycobacterium abscessus ATCC 19977]MTRVEVLTAALAAFWLGLVVAISFIEAPLKFRAPGVTIQLGLAIGRLVFR
ALNAVECVLAAVLVLLLVVGKPATAVTVAAVGACACLAIQLLAIRPAIAQ
RTNAIRDGAAYAGRSRIHLAYVAAECLKTVSLITLVALVAAGVQ
169630213YP_001703862.1 translation initiation factor IF-2 (InfB) [Mycobacterium abscessus MAGKARVHELAKELGVTSKEVLARLSDQGEFVKSASSTVEAPVARRLRES
FGGGDKPAPAASNGAAAEAAAPPKKAGPKPGAPKPAPKKVAEPVVEAPVA
PEPPAAPAAPAAPAPKPSPAARPAAAEAAAPAPAPAPAPRPGATPGPKPG
APRVPRVGNNPFSSAQPAERPAPRPQAPRPGAPRPGGASPSNMPPRPSPG
SMGPRPPRPGGGPRPGGGPRPGGAGRPGGGGGGNYRGGGTGTGAPAGGPP
GAGGGFRGRPGGGGGGGRPGQRGGAAGAFGRPGGAPKRGRKSKRAKRAEY
ENMQAPVVGGVRLPHGNGEVIRLARGASLSDFAEKIDANPASLVQALFNL
GEMVTATQSVGDETLELLGGEMNYVVQVVSPEDEDRELLESFDLTYGEDE
GGEEDLRTRPPVVTVMGHVDHGKTRLLDTIRKANVREGEAGGITQHIGAY
QVAVEHDGTERPITFIDTPGHEAFTAMRARGAKATDIAILVVAADDGVMP
QTVEAINHAQAADVPIVVAVNKIDKEGADPAKIRAQLTEYNLVAEDFGGD
TMFVDISARQGTNIEQLLEAVLLTADAALDLRANPDMEAQGVAIEAHLDR
GRGPVATVLIQRGTLRVGDSIVAGDAYGRVRRMVDEHGEDVEEALPSRPV
QVIGFTSVPGAGDNLLVVDEDRIARQIADRRSARKRNALAARSRKRISLD
DLDAALKETSQLNLILKGDNAGTVEALEEALLGIAIDDEVQLRVIDRGVG
GVTETNVNLASASDAIIIGFNVRAEGKATELANREGVDIRYYSVIYQAID
EIESALKGMLKPVYEEVELGRAEIRAMFRSSKVGNIAGCLVTSGIIRRNA
KARLLRDNIVVAETVTISSLRREKDDVVEVRDGYECGLTLTYNDIKEGDV
IEAYELREKERV
169630212YP_001703861.1 ribosome-binding factor A (RbfA) [Mycobacterium abscessus ATCC 1997MADPARARRLAKRIGAIVASAIEYEIKDPRLTMVTVTDTRVTNDLHDATV
YYTVMGQTLSDEPDFAGAAAALDKAKGVLRTKVGAGTGVRFTPTLTFVLD
TMADSARHMEELLDRTRAADAALAEVRQGAVHAGDADPYKESAAEEPAAY
EDDERRPD
169630211YP_001703860.1 hypothetical protein MAB_3129c [Mycobacterium abscessus ATCC 19977]MSAVPIETGAVGARVDEDGAVALLAKASRVVIICHVHPDADTVGSGLALG
QALVAKGVDVQVSFGEPAAPPESVGTLPGAHLLVRPQELRRDPDLVVTVD
SPSVRRLGQLAQLTEGSTPVLVIDHHVSNELFGTANYVDIAADSTTMMVV
QLLDAWGVDITPEMAHCLYAGLVTDSGSFRWATPRGHRLAARLLDLGADG
VNITRTFMDSHPFVWLPILSRVLGTAELVPHAVGGAGMVYAVVTHDVWSR
ARTEEVESIVDIVRTTTEAEVAVVFKEIEPEHWSVSMRARSAVDLSAVAA
TFDGGGHRLAAGFSATGPVDDVVAALVRALD
169630210YP_001703859.1 DNA-damage-inducible protein F [Mycobacterium abscessus ATCC 19977]MTDATGIAGMPGLARRIISLALPALGVLAAEPLYLLFDIAMVGRLGAVPL
AGLAVGGLVLSLVGTQLTFLSYGTTARAARRFGSGDRPGAVHEGVQATWL
ALLIGAVVVLVVHAVAGPVVRAIAAAPDVAAQGLGWLRIAIFAAPAILVS
LAGNGWMRGVQNTVRPLRYVIAGFAVSAVLCPVLIYGLAGVPRMGLAGSA
VANLVGQWLAAILFLRALHAEHAPLRTDRAVLRAQLVLARDLLVRSLAFQ
ACFISAAAVAARFGAAALAAHQVVLQMWSFLALVLDSLAIAAQTLVGAAL
GAGRVPEAKSVAWRVSIFSLGFAVLLAGILALGAPVLPRLFTSDAAVLHE
MRVPWWFLVCQLPISGLVFALDGVLLGAADARFMRNATMISALCGFLPSV
WLALVFGWGLAGIWCGLTLFLVLRLVLVGWRALSGGWAVPGTGS
169630209YP_001703858.1 hypothetical protein MAB_3127 [Mycobacterium abscessus ATCC 19977]MKQLSERGEKIVSYPQHYPAAGPRSFQVRLTKHTGMLLMFSTRSYTITGT
LEQCEAAYRDAQTHNLAAGWWSFLSILLMNWIAIFGNMGQINQIRRLAAQ
PPAYQAYPPVGYPQPPYPQYPQTS
169630208YP_001703857.1 hypothetical protein MAB_3126c [Mycobacterium abscessus ATCC 19977]MNLDRFAVWTGYFLGLMSVTITALGLAALASGHHGWGMVAAVALLVTAGL
GFAVVGGTVHHDHKIHRETPHLM
169630207YP_001703856.1 hypothetical protein MAB_3125c [Mycobacterium abscessus ATCC 19977]MNSPTGYRIARENTDVVAEVMAAGPPPMPSFDGTRYALRRVDPLGTDPEM
LSEWFARPHLVETWEQPWSAARWHEDSSYRLAGDYSLPCILSVDGTEIGY
IELYRAARDEIARIYPAHAHDVGLHVATADTRYLGRGVVSEWMRLLPSAT
YHADPDCRRMMIEPAASNTPMRKALDRIGWTFLGEFDIRPDRRIALYRTD
RA
169630206YP_001703855.1 enoyl-CoA hydratase [Mycobacterium abscessus ATCC 19977]MTEPILLTHTEDRICTITLNRPQARNALSTALGEEIVKAVTAADADENVD
VMILTAADPVFCAGVDLKELGSGDRAESLDPWWPELSKPVIGAINGAAVT
GGLELALACDILIASEKARFADTHARVGILPTWGLTTLLPLSVGRGLARR
MSLTGDYLSAEDALRAGLVTEVVAHNELLPAAKRLAATIAGNNQPAVREL
LASYRRIESELVGNGLQVALDDAHRWIDQNSIAEGVEARRTAIMERGRSQ
NA
169630205YP_001703854.1 putative acyl-CoA dehydrogenase [Mycobacterium abscessus ATCC 19977MSASEDHQTRMSASEDNQTRMSASEDNQAQINEFEFTEEHGDLRSLVRSW
CERVWTPKHVRQIAEAGSVDLDAWRALGSELGVVGLSLPEQHGGGGLGVI
ELSIVAEELGRALACLPWISSAALGATALVSSGDDSALAEWVPALAAGEK
TITLAGGRTRLADAITVSAESDTDGWKLTGDTEHVPDGATADVILVLADT
DSGPSLFAVDGDAPGVDRHSLATLDMTRRQANIHFNSAPARLIGAQGRGA
EAVATALDVAATVLAAEQAGIAAHMLDVTTEYAKSRIQFGRIIGSFQAVK
HRLADMAAATGNVRGAAYHAAWSHDHPSLDDPALATSIAQQVASAGAVEV
TAKAIQSHGGIGFTWEHPAHLYYKRAVSNSALFGGRAVHAERIAKEVIDA
169630204YP_001703853.1 putative acyl-CoA dehydrogenase [Mycobacterium abscessus ATCC 19977MPVTSSEPSSAGSNALHTSGSSQRDRVAAAAHEVLAKHPPATTPVTDLLG
AVYDAGLAWVHFPVGLGGLDAPPALQAVSDTILRAAGVPDPLFVNVIGYG
MAAPTVLAHGQPELIRRILRPLFTGEELWCQLFSEPGAGSDLAGLATRAV
RDGDEWVINGQKVWTSGAHQARWALLVARSNPDVAKHRGLTYFVVDMTDP
GVEVRPLRQMTGDAEFNEVYLTDVRIPDAHRLGNEGDGWRVSMTTLMNER
SALGGAFDHGRGGGSIGNALNLWKQRPDLHTPELRAKLTNLFVRSEGNRY
GTQMRIAAQGDAPMGPEGSIGKLMGAELNQQIYDFCVELLGIEATLYASY
DMRRVVEDDRRADTMWAFLRSKANTIEGGTSDVMRNIIGERVLGLPGDIR
VDTDKAWKDVPRG
169630203YP_001703852.1 hypothetical protein MAB_3121c [Mycobacterium abscessus ATCC 19977]MCRNITELRGLEPAATDQEIEAAARQYVRKISGIQKTSDANREAFEQAVA
EVTATTMRLLGSLPARRQPPKTVPPLRRPEVLARIAARG
169630202YP_001703851.1 hypothetical protein MAB_3120 [Mycobacterium abscessus ATCC 19977]MAQRAALVRAGICVALVALVLSIVTVWRTAPAEHTASAPVQLRFSTAPMT
GPANTGATTTIKWPVVPVTDPRPFDPCFDIPSSVIAAAGLDQTPPAPEEG
LRCRYDSRNNYQLAVEAVVWRTYEDSLPADGVETTIAGHRAAEYNIMKPT
DWNNQWWVSCMITFKTSYGVVQQSLYYASQKYSPDGPGCLVENRRVANIL
APSYKF
169630201YP_001703850.1 carboxymuconolactone decarboxylase [Mycobacterium abscessus ATCC 19MARIGNYADDDVAGWLMGSPEMAPGFAGFSDAVYNRSRLPLGVRELARMA
VAFANECSVCQNTRFVQSGELDGDFYAEADRWRTSARYSEAERTAAEFAH
RFATDHVGLREDDEFWERARQHFDDGLLTDLALSCAFWVGSGRALRVLDV
GQSCKINL
169630200YP_001703849.1 hypothetical protein MAB_3118c [Mycobacterium abscessus ATCC 19977]MTQEREPTLWAISDLHVGQSANKSVLEELHPASPEDWLIVAGDVAERSDD
IRAALDLLRRRFTKVIWVPGNHELWTTARDPMQIFGQSRYDYLVNMCDEM
GVITPEHPYPVWVEQGGPATIVPMFVLYDYTFLPEGANSKAEGLKIARDR
NVVATDEFLLSSEPFATRDAWCRDRLRYTRKRLEDLDWMTPTVLVNHFPL
VREPCDALFYPEFSLWCGTTETADWHTRYNAACSVYGHLHIPRTTWYDDV
RFEEVSVGYPREWAQRKPYSWLRQILPAPHYPPGYLNEFGGHFEITEQMR
VAAKRFRERLAKERASD
169630199YP_001703848.1 4'-phosphopantetheinyl transferase [Mycobacterium abscessus ATCC 19MPVTDQLIASVVPELLPSAELYEDPPGLEPLPEEEPLIAKSVAKRRNEFI
TVRYCARQALSVLGIPEVPILKGDKGQPLWPDGIVGSMTHTEGFRGAVVG
RTGEVRSVGIDAEPHDVLPNGVLKSIALPVERDELDALPAGTHWDRLLFC
AKETTYKAWFPLTARWLGFEDAHITIDPDGTFTSRILVDGRANDGTVLSA
FDGRWIIDKGLILTAIVVP
169630198YP_001703847.1 tRNA pseudouridine synthase B [Mycobacterium abscessus ATCC 19977]MTDPLSRAGLVIVDKPAGMTSHDVVSRCRRIFSTRKVGHAGTLDPMATGV
LVIGIERATKIMGLLTLTTKSYAATIRFGQSTSTDDAEGEVLQTISASHL
TEVDIEAAVAGLRGDIAQVPSSVSAIKVDGQRAYKLAREGQSVELAARPV
RISRFDVLAVRGSGEDLIDVDVEIDCSSGTYIRALARDAGAALGVGGHLT
ALRRTRVGDFGLDRARTLEELADGATLTLDLDSACRQGFPRRDLDAAEVD
AVRNGRPLAPAGIEGTYAAVDADDRVIALLADKGSRTTSVVVLRPANL
169630197YP_001703846.1 hypothetical protein MAB_3115 [Mycobacterium abscessus ATCC 19977]MSDRTPVVVRAPGVVYQSDFDEAVFFQWLDKMPGAWSHGGARQTLQVAVD
PDALDEDALSEFVGLYRRYHVSAAELQVLAGTRLGSWFSSPDRFWHREIF
ERPSPAEDQLSRELFSGDLPWNIEPTVGTRVNVWPPDINVSPTPDHVVLK
ATGVRYYSELDEAAFFEWLDKNPQVESYRGRNHTLYINVNVDSGEEWELC
ELAALYTRYNIDMTELRVLNSGNFGPWFSDPKWWWHKAVFG
169630196YP_001703845.1 hypothetical protein MAB_3114 [Mycobacterium abscessus ATCC 19977]MPVVVESAAYYAAANTCYKLSTDVQAAFKPLSRVLTLETSGMAGGYQAVK
AWSSGYDNRAAALTTATTEYARALQRLGDILTAAGYNWAIADWRANRDPN
KGTGPACPRTIPSELPYGADVVVGVASSKHNGPGLESDVPDLYKKVVAQV
AGGEIPDGDTNKLDSAAKAWKTFADNDAISRGESDLRLAASALSNFHAPD
IPNLSEHLTTLSTSAGRIKLAASDLATSTTAHYAALSQLRSDMQFAIATT
LGVGLAAIAAIAVITRGRATAGGAEIAATAVDACASSLAACIRPFLTTLG
GITFNAEAVTAAGLGAIIGLSIATITGETVVYSNYKPPGDAFDKTGAKSP
GYPGDYPAGSLPREFVPPKDGPKWVPNPNPKGNRFGWLDADGNVWVPTGK
GGLAHGGPHWDVQDPKTGKHENVPPPLPEGEGK
169630195YP_001703844.1 hypothetical protein MAB_3113 [Mycobacterium abscessus ATCC 19977]MPAHVESEFSFDLDHIEQVTSRARGFKEFVTENLDQLESRAQKLVQSGQW
TGAAAAAYSEAHKEWMDAARELVEGLNQMEEAARTAHGAYSEAQEANLRM
ARG
169630194YP_001703843.1 hypothetical protein MAB_3112 [Mycobacterium abscessus ATCC 19977]MTSAGNPPLQVVIDEVGALSKFAASLADQMRAGSSSLDRDVQSLFGVWRG
SAADAYRSGWDEMQDGATKVWNALTDIASTLGSNAAVFHAQETSTASSIT
STQAG
169630193YP_001703842.1 hypothetical protein MAB_3111 [Mycobacterium abscessus ATCC 19977]MADHAACECLLCVDYGDRDQYNDSDRDIIGSVTEYGWSALGIGPTSSEES
PPFAYTVGLWHTMRLPELAIYGVNDITMMQRALNAVAKQAQEGRVLQVGE
TFADVLALPDVDDYRVKLSPIDPSWYDNEFGFGLWFNRTNHVRYLQILWP
DGAGRFPGNPELDPHFDDRQPLMWMPRELHPPSRWIRPAD
169630192YP_001703841.1 iron dependent transcriptional repressor FeoA [Mycobacterium abscesMSPTRSDRPAGSADTDLTTVAQDYLKVIWTAQEWSHEKVSTKMLAERMGV
SASTASESIRKLADQGLVDHEKYGAVTLTDHGRKAAVLMVRRHRLLETYL
VNELGYGWDEVHDEAEVLEHAVSDLLLAKIDAKLGHPQRDPHGDPIPGPD
GQVPTPPARQLSDCANGDTGVVARISDSDPEMLRYFDTVGVALDARVTVD
ERRDFAGTISVSIDSDEPGRDERKLELGNPAAQSIWVVLD
169630191YP_001703840.1 bifunctional riboflavin kinase/FMN adenylyltransferase [MycobacteriMQRWRGQDEIPSDWGRCVLTIGVFDGVHRGHAELIGRAVKAARELNLKSV
LMTFDPHPMEVVFPGTHPAQLTTLTRRAELAEELGVDVFLVVPFTPEFMK
LSPERYVHELLVERLHVAEVVVGENFTFGKKAAGNVQMLKKAGERFGFKV
DAVTLVTEHAVTFSSTYIRSCVDAGDMVAATEALGRPHRVEGVVVRGDGR
GRELGFPTANVAPPMFSAIPADGVYAAWFTLLGHGPTMGTVVPGERYQAA
VSVGSNPTFSGKARTVEAFILDTTADLYGQHVAVDFVARIRSMEKFKSID
DLVVAMGKDAEKARTILARN
169630190YP_001703839.1 30S ribosomal protein S15 [Mycobacterium abscessus ATCC 19977]MSLTTEQKKEILAQYGLHETDTGSPEAQVAMLTKRIVDLTEHLKTHKHDH
HSRRGLLLLVGRRRRLLKYVAKVDVARYRSLIERLGLRR
169630189YP_001703838.1 lipoprotein LppU [Mycobacterium abscessus ATCC 19977]MGGPGTLGAASIVLLTVGVALLSGCSAAAASDGLAVGDCVNLSGSDQRAK
MVKEPCGSPTSNFKVFAKAATDADCPRDADSSYYAKRGFGRKSQALCLDI
DWVVGGCMDVPDKWDGDPVRVDCNDPRAQNKKRVTQILQQVSTADDCITG
LGYPYVDRNFTVCVEELP
169630188YP_001703837.1 polynucleotide phosphorylase/polyadenylase [Mycobacterium abscessusMSVTEIEEGIFESTATIDNGSFGTRTIRFETGRLALQAAGSVVAYLDDET
MLLSTTAASKTPKDHFDFFPLTVDVEERMYAAGRIPGSFFRREGRPSTDA
ILTCRLIDRPLRPSFVSGLRNEIQVVVTVLSLNPADLYDVLAINAASAST
QLAGLPFSGPVGGVRVALIEGQWVAFPTVEQLEKAVFDMVVAGRKVGTAG
DSDVAIMMVEAEATDNVIALIDGGAGAPTETVVAEGLEAAKPFIAALCTA
QEELAGSAAKPTGEFPLFPDYQDDVYAAVAAVATEPLSQALSIAGKAERD
EKTDEIKVDVLGRLQEGFDGREKEIGAAFRSLTKKLVRQRILKDQFRIDG
RGVTDIRALSAEVAVIPRAHGSALFERGETQIMGVTTLDMIKMAQQVDSL
GPETTKRYMHHYNFPPFSTGETGRVGSPKRREIGHGALAERALIPVLPSI
EEFPYAIRQVSEALGSNGSTSMGSVCASTLALLNAGVPLKAPVAGIAMGL
VSDDIELADGTAERRFVALTDILGAEDAFGDMDFKVAGTKDFVTALQLDT
KLDGIPSQVLAAALSQAKDARTTILEVMAEAIDAPDEMSPYAPRITTIKV
PVDKIGEVIGPKGKMINSITEETGANISIEDDGTVFVGAADGASAQAAID
KINAIANPQLPKIGERFLGTVVKTTDFGAFVSLLPGRDGLVHISKLGKGK
RIAKVEDVVKVGDKIQVEIADIDNRGKISLVPVGEEDAAEAPAPAEAQPA
DAVTQ
169630187YP_001703836.1 hypothetical protein MAB_3105c [Mycobacterium abscessus ATCC 19977]MPSVRSASVGVWVDVGSRDEGRSVAGAAHFLEHLLFKSTPTRSAADIAQS
IDAVGGELNAFTAREQTCYYAHVLDSDLELAIDLVADVVLRGRCASDDVE
VERDVVLEEIAMRDDDPEDLLGEAFLGALFGDHPIGRSVLGSSESISAMT
RAQLHSFHVRRYRPERMVLAVAGNIEHDRVVRLARKYFKSHLDSSVRTVA
PRKGSGRVAAKPGLELVSRDGEQVHLSLGVRTPGRGWQHRWALSVLNSAL
GGGLSSRLFQEIREQRGLVYAVYSTVDTFSDTGALSVYAGCSPERFDEVT
KVTSQVLGSVVEDGFTPAEIDRAKGALSGGLVLGLEDSASRMNRLGRSEL
NNGKHRTISATLDRIDAVTADEVNAIARQLLGGPAGAAVVGPYRSKRTLP
RTLRTMIESTS
169630186YP_001703835.1 hypothetical protein MAB_3104c [Mycobacterium abscessus ATCC 19977]MAAVILLSWLAFALLPQHAGAHSQAPAGEHSMHGMQHAGMAPMPTPVTHQ
PVLWIAIIAWIVMTVAMMGPATLPSVRYIEQTTPRGRRGGAVVLYGAVWL
AVWTVIGVVVALAQSAAVGPSPWWLFTGALVVAALWQLTPLKRRALGDCH
ASRPLPPTGWPAAQGAIRFGAFGGWACVRSCWAVMLAMALAPTAHIVWMV
PLTVAVTWERFTQSPRRTARVLAGVFAVAAAAVGVFAAIQ
169630185YP_001703834.1 putative short chain dehydrogenase/reductase [Mycobacterium abscessMDINGSVAIVTGAGSGIGQALAWGLVDAGATVVASDIDADAVGRTAAARD
GIVGQRADASAVSDIEDLIALAEKEFGPVDLYAANAGIAGGLGLGIGEAA
WDLTIDVNLRAHIRAATLLVPGWVERGRGYFLSVASAAGLLTQIGSPAYS
VTKHAAVGFAEWLSITYGGQGVGVSCLCPMGVKTALLDGLTESDDPDVRV
AGTSITAAGDVLEPAVVAAMALDAIRDEKFLVLPHPQVLDMYRQKGADYD
RWIAGMRRYQAILEDQIIR
169630184YP_001703833.1 putative monooxygenase [Mycobacterium abscessus ATCC 19977]MVSAQMAVNNPVDVAIIGAGIAGLGMAARLRQARVQDLLILEQAPEIGGY
WRRSTFSSVAGDELAVQQSYSFSPSTSSRTLWATREGVLSYQRDLIARYG
LEPALRLRNRVTGLSFEQGKAAWRITVAGKKSVSARRVILAVGAGTLSEP
PELAGIEQFEGPILSTADWDPSFDFAGRNVAVIAAGASTVHVVPELVKKA
ARVRVFQRAPDWVLPRWGAEAPGAVGRLVSRASGSLAGRVASRSHEALRR
GLVWRGVGTRLVEAVAENHLNRNVKDPWLRRNLLPAYRAGSRRILFSDDF
YSAIQQDNCKLVPWPVTGVSAIGVRSADAMTHKADCLVFALDAPEVLIEE
PFPIKGVDGSTLGEHWGTQPTAFRGVNVPGFPNLFLLAGPGSGTNALAGL
AHVEAQIDYVTASLALIDSLAFVSIEVRREALEREQARAAQRLDRTTWRD
GAFRWYKPEDTVASELFPGTTTEFRRALADVDAADYKILTQQELDSINSA
KLGVAQ
169630183YP_001703832.1 hypothetical protein MAB_3101c [Mycobacterium abscessus ATCC 19977]MTAVLPDELTRDNTKDIAKNDEFFENVLGKIKARQWTLADFDWDKPGADT
INPEQFDDLKQFMSDLVWIEHIGGRMMGTLGITAPNDTLREIYSYFHAEE
QRHANAEIALMRRWGMLAEGEIPPQSGDIKALLQALRGFDNLGDRRLPFV
YMATVIPFFEVGLDGAVLKFLSGEVEDPLFHEVFAKINSDESRHLAIGFA
VMDMLGTRKFSRMLVEDVAPLLKPVTIVRAVGLANPHVIRFAGFLTRVGD
AMRNMGIDTILIQRAFDRYAESGGRKSSNARRLPIFRVLRYPIVNSTYFT
DFDHPLHKVGRAVNKFNDKVPYRKKIKTPTWTNDLTAQTAV
169630182YP_001703831.1 L-alanine dehydrogenase (ALD) [Mycobacterium abscessus ATCC 19977]MRVGIPTEIKNNEYRVATTPAGVAELTRRGHEVIIQSGAGDGSSISDVDF
KAAGAQVINGAEQVWAEADLLLKVKEPIEPEYALMRRGQTLFTYLHLAAS
LPCTQALLKSETTSIAYETVQTSDGALPLLAPMSEVAGRLAAQVGAYHLM
TPVGGRGLVMGGVPGVGPADVVVIGGGVAGYNAARIAAGMGAHVTVFDVN
LGKLRELDGEFGGTIRTRYSSTMELEGAVKRADLVIGAVLIPGAKAPKLI
SNSLVSQMKPGSVLVDIAIDQGGCFADSRPTTHDEPTYTVHDSVFYCVAN
MPGAVPRTSTFALTNATMPYVLALADKGWRQACRDDAALAQGLSTHEGAL
LNTHVAHDLGLAFTDPAEVLG
169630181YP_001703830.1 AsnC family transcriptional regulator [Mycobacterium abscessus ATCCMVAKSPESRFDMPPAPNDVRRVELDDVDRRILLELHNDARIPNSVLAEAV
GIAASTCHGRVRRLQETGVIRGFFTDVDPAAIGRPLQAMISVSLQANARG
KIRTFIRDIRELPQVIDVYFLAGADDYILHVAARDTEDLRSFVVEKLNAL
PDVAGTQTSLIFEHLRGGAPL
169630180YP_001703829.1 transmembrane carbonic anhydrase [Mycobacterium abscessus ATCC 1997MTTSVTEQTAKPSLLQNLRHDLPASLVVFLVALPLSLGIAIASGAPLMAG
LIAAVVGGIVAGAIGGSPLQVSGPAAGLTVVVAEIINKFGWQMACLITIG
AGLLQILFGLSRIARAALAIAPVVVHAMLAGIGVTIALQQIHVLMGGSSQ
SSAWQNLKALPQGVINHHLPDVIIGVMVIAILLLWPKLPPKIRMVPGALV
AIVTATAFAVLTNSPAERISLAGDFFDAISFPTLIGPADGDWAGVLLGVL
TVALIASVESLLSAVAVDKLHTGPRTNFDREMIGQGSANVMSGFLGGLPI
TGVIVRSSTNVAAGAKTRASAILHGIWVLLFASLFSSLVQLIPKAALAGL
LIVIGIQLVKLAHMKLAWRTGDLAVYAITMVCVVFLNLLEGVGIGLLVAI
GILVGRVMRAHMDARPFGTEGSRQWHVELDGTLSFLSLPRLTKTLSTVPP
GAHVTLAINADYVDHAISEAISDWKRAHEAGGGTVMIVESSHAKLHHAHT
TRPKRHFVSRAVGLVPWRSWRREQNGEAGASIIDGINEYNSRGSGALRPH
VTELADYQDPDALFLTCGDSRILPNVITASGPGDLFTIRNVGNVVPTDPA
DGSVDASLDFAVNQLNVSSVVVCGHSSCGAMKALLSESTDTPTTPVGRWL
DYARDSLIAFQEHHPARASAEAHGFNEVDQLGVVNVAIQVERLVHHPILA
GAVVSGRVRVVGTFFNIAEAHVYEVDENGIVGQDGNSDGVLEDPAPAIS
169630179YP_001703828.1 hypothetical protein MAB_3097 [Mycobacterium abscessus ATCC 19977]MSGRKRYARVGGFVIAFLAAVCFLGPAAHGQMFGWRAAVVGTSPATSLLP
EEIHEHVKSSVNSAVTRIRQQPTSIPVPFALVLTSLLGASLLALLAARGF
VFSRAPDNLGRQRLITIGIDRR
169630178YP_001703827.1 dihydrodipicolinate reductase DapB [Mycobacterium abscessus ATCC 19MTNIATGVLGAQGKVGQAMCQAVDSAADLDLVAAVDKNDSLEALTAASVV
IDFTHPDVVMDNLKFLIGKGIHAVVGTTGFTDERLDQVRSWLADSPGTGV
LIAPNFAIGAVLSMKFAQQAARFFESVEIIELHHPNKADAPSGTATRTAR
LIAEARRGLPPSPDATSTGLEGARGADVDGVRVHAVRVSGLVAHQEVLFG
TTGETLTIRHDSIDRSSFAPGVLLAVRDIAKRPGLTIGIEPLLEL
169630177YP_001703826.1 hypothetical protein MAB_3095c [Mycobacterium abscessus ATCC 19977]MSAAARVKILIAFMCVAMVVYFLILGKMGIALVQTGKAAAIGMGVGVLIL
PFIGLWAMIATLRAGFAHQRLAALAAQQGRELDVSALRTTPSGRVNREDA
DALFATVKAEVEAEPDDWVGWYRLARAYDYAGDRGRARDTMRTAVQMQQD
AAR
169630176YP_001703825.1 hypothetical protein MAB_3094c [Mycobacterium abscessus ATCC 19977]MSRLLVVHHTPSPATRELLEAVLEGANDPEISGVEVVIRPALAATIPDML
DADGYLFGTTANFGYMSGALKHFFDTVYYPSLDHVAARPYGVWVHGNNDT
VGAAAAVDKIVTGLALEKAADVLEVVGPIDASTREQAYNLGGTLAAILMR
169630175YP_001703824.1 hypothetical protein MAB_3093c [Mycobacterium abscessus ATCC 19977]MPALAELALGAAPIAGGALLGAVAGNLKPPDIRELISKDFDLLDRIPEEQ
AERRAAVRRMVDQRIDDLVASNDRGRSLREAALSYGGGWRDILVFVGAVL
FTVIWWNIEHTRSNWLVMFLVMLALTLIAGFYAVRTVSRGLYGAAGRLRH
RSPGSS
169630174YP_001703823.1 acyltransferase PapA5 [Mycobacterium abscessus ATCC 19977]MSATARVKETVGIERMLSAAESELNHLRKYTTIWYVARLRGDLDIAALSA
AGAVMQGNHPYLAARVDPVGRLFRVTTEQVRDTVVSVRYERLRDVAALPV
LSLDDGTYAILVYPGDSGSAVAVGVDHSIADARLSYSYFHELWELYTEIV
TSGTIPRPRRQPIPMAPEAALAKRGLHRAALPEKPWFGPTSWAGRQQDNS
TSPQMVLGWKQRFDPELSASLRASARRRDTTLNTLVTGVIALAERALFRI
GDDEPVNLGFESLVDYRRHLTPPAELGEIANGIMIARSQVPVRANDDPLR
VGAAVAAQINDDIASGFLVQSVNHIGGTALTGNWGPFIRITNPGVLPLPP
LPAGLTLEDFDAQLTTPRTPSSGPPAPQASRYEVYSIGAEFTVVCKFAAG
ALTGEQAEALRAGIVAGVEALAEP
169630173YP_001703822.1 thymidylate synthase ThyA [Mycobacterium abscessus ATCC 19977]MSLPTPYEDLLRLVLEEGTPKADRTGTGTRSVFGHQLRYRLEDGFPLITT
KKVHLKSVIYELLWFLRGESNVRWLQERGVTIWDEWASEAGELGPVYGVQ
WRAWPTPSGEHIDQISAALDLLRTNPDSRRNIVSAWNVGEIPQMALPPCH
AFFQFYVADGKLSCQLYQRSADLFLGVPFNIASYALLTHMMAAQAGLGVG
DFVWTGGDCHIYDNHVEQVTEQLSRDPYPYPTLVLAQRDSIFDYRYEDIT
VENYQHHAAIKAPVAV
169630172YP_001703821.1 dihydrofolate reductase DfrA [Mycobacterium abscessus ATCC 19977]MTGTIGLIWAQTRAGVIGADGAIPWRLPEDQARFKRITMGHTVIMGRKTW
ESLPGSVRPLPGRPNIVLTRDALFEPDGALAVGCADAALAASDEAPWVIG
GGEIYRLFLPLAQRCEVTVVEADVPGDALAPELGEGWVVEENDWQTSESG
LRYQFLSYRKVDG
169630171YP_001703820.1 hypothetical protein MAB_3089c [Mycobacterium abscessus ATCC 19977]MSAPGAAGVPKVLLLAAIVLLVLTGCARTVEGTASAPVEAAGWGNSQGAG
VTVGGAGDVAAGITVFLDFQCPFCQRFEAQYGEDITTYVTEGRLQVTYRP
VSFLDRISASGDYSSRAAAALFLIDKAGATDAVILGFIGEMFRRQPVEGV
GNLTNLQISEIAAGAGVTGEVLREISSLQVNEVDRQRTAGNEQQLTDHGL
GGVPGVIDNSGEMIDPSDSGWLSRLVGAR
169630170YP_001703819.1 hypothetical protein MAB_3087c [Mycobacterium abscessus ATCC 19977]MSRSALTVAQARRIAIAAQGFTDTSATAVTRAHLRKLISRIQVLQLDSVS
VAVRAHYAPVFSRLGPYDRALLDDAAWSHSARTPRLLIEYWAHEAALMSI
QDWPLMRWRMREYRHGRWARKFVEENPGLVDEVLAAVAELGPCTAGQIEA
YLEREAPGRKGPWWDRSETKWIAEALFSSGELTTDKRVGFSRHYQLAHKV
IPAEIYQREVSDEEAVLELARRAVGALGVGTEADIRDYFRLSAGQIKPAL
AVLADAGEVERVSVDGWGAPAYLAAGRTIPRADQGTALLCPFDPLIFFRP
RVERLFDFHYRIEIYTPAAKRQYGYYVWPFLLDGQLVGRVDLKADRAAGT
LNVVGAFAEEGRDPVGIAGPLAEQLVSMASWLGLERVAVGERGDLVRPLG
AVLRTTP
169630169YP_001703818.1 hypothetical protein MAB_3086 [Mycobacterium abscessus ATCC 19977]MSSWTLGPENGTLTLHTGVTGAAARMGHRLTIVMDAWTISVDGPDDQPSA
VSLVVDVDSLRVESGEGGLTPLTGPEKTIVRSNALKTLNAQRFPTIEFHA
EQIGKTAAGYVMRGALTIHGATRAVDIELSVAADGALSLSTDVSQRAYGI
KPFSMAMGSLKVADAVTVSFEGRRPGA
169630168YP_001703817.1 FAD-dependent thymidylate synthase [Mycobacterium abscessus ATCC 19MAEIVPLRVQLIAKTDFIAPPDIDWSTDADGGPALVEFAGRACYQSWSKP
NPRTATNESYLRHVIEVGHLSVLEHASATFYITGISRSCTHELIRHRHFS
YSQLSQRFVPEDDSNVVLPPAVEDDPELVALVRKATDASRAAYVELLEKL
ESTLADVPNAVLRRKQARQAARSVLPNATETRIVVTGNYRAWRHFIAMRA
SEHADVEIRRLAIACLRQLADLAPSIFGDFDIATLADGTEVAISPLVYEG
169630167YP_001703816.1 dihydrodipicolinate synthase [Mycobacterium abscessus ATCC 19977]MARLGTVLTAMVTPFDAEGALDVDTAVRLAAHLVDAGCDGLVLSGTTGES
PVTSDAEKLTLLREVVAAVGDRARIIAGSGTYDTAHSIKLSRECEAAGAH
GLLVVTPYYSRPSQAGLLAHFTAVADAVNVPVILYDIPPRSVVPIDFHII
RELAAHPNIVAVKDAKGDLHGGAQIIAGTDLVYYSGDDPLNLPWLSVGAV
GFVSVISHFVAGPLRELLAAYNAGDVETARKLNAQVAPITEACRRLGAVG
AVKAGLRLQGIEVGDPRLPNVPPSPEQIEGLAADMRAAGVL
169630166YP_001703815.1 hypothetical protein MAB_3083c [Mycobacterium abscessus ATCC 19977]MAVTPPEDLRAPGPLADGALRVTALGGISEIGRNMTVFELRGRLLIIDCG
VLFPGHNEPGVDLILPDIRHIEDRLEDVEALVLTHAHEDHIGAIPFLLKM
RPDIPVVGSAFTLALVEAKCREHRITPRFIRVTEGERSTHGPFECEYFAV
NHSIPDALAIAVHTEAGTILHTGDIKLDPLPPDRRPTDLPGLSGLGDRGV
DLFLVDSTNSEVPGVGPSESEIAPTLNRLIETARGRVIVACFASNVARVQ
QIIDASVAHGRRVALVGRSMVRNMGIARELGFLEVDDRDLINVEAANELA
PQRVVLITTGTQGEPMAALSRMARGDHRQITLTPDDLVILSSSLVPGNEE
AVYGIIDSLAKVGTRVVTNTHARVHVSGHAYAGELLYLYNAVRPRNVMPV
HGTWRHLRANAGLAAKTGVEEGRIVLAENGVSVDLHNERARISGRVPVGK
MFVHGLVDGDVSDATVGERLVLGNGGFVAVTVVVRSNGRPVGRPQLFSRG
FSDDAKALDPVTELVITELNSLAEQSVNDTGRIAQSVRRVVGKWVGETYR
RQPMIVPTVLTVD
169630165YP_001703814.1 hypothetical protein MAB_3082 [Mycobacterium abscessus ATCC 19977]MPQSNPAAQTAFGPMAITAVEQHEPAAARIVDDDLAAHILPRGLRWFVRA
TAWAPLRHWLIRLTERGGQGAWSLFVCRKRYIDDQLAASSIDAVVDLGAG
LDTRGCRVARAAPTPVFEVDQAVNIAIKQQAVKRALGAVPASLHLVPVDF
QRDELAEELRRAGHDTAHRTFFIWEGVTQYIPETAVRATLAYLGTAATGS
RLAFTYVQRDFIDGSNLYGNSMLYKRFRVRSQVWMFGLTPGTVGPLLAEY
GWQVLEDVSGPEYQRRYLIPAGRTLSTTELERTVLAEKI
169630164YP_001703813.1 Short-chain dehydrogenase/reductase [Mycobacterium abscessus ATCC 1MGKLDGKVAFITGAARGQGRAHAIKLASEGASIIAVDICAQIPSVEYPMA
TTEDLDLTVKEVDALGRAISAHETDVRDREALQAAFDAGVHDLGPVDIVV
ANAGIATLTPECGDDGWRDVLDVNLTGVYHTIEVARPSMVQRGAGGSIVL
TSSVAGLTGMVMDNPGGLAYTAAKHGLVGLMRSYANMLAPHNIRVNTIHP
SGVATPMLINPVTEKLFADGSPEGMSDTGNALPVVLMEPEDMANTVAWLV
SEDARYITGVALPVDAGFTNRR
169630163YP_001703812.1 putative antibiotic biosynthesis monooxygenase [Mycobacterium absceMPTVVAFLYPQPDKRDEVRAALLETIPLVHDEPGCNLYTLHEAQDRFVFV
ESWASGEALAEHGKAPAVTAMFGKVGPLLSQPPEIVVAEALPAGDPAKGD
LVH
169630162YP_001703811.1 hypothetical protein MAB_3079c [Mycobacterium abscessus ATCC 19977]MTDQGPPGGLPIRTEVFFTEDGRARLAKGALQTIGRSRGVWILLALALLY
VAFFFFFVGISAGVVILVVVAAAAALITSRIRARTRQSMRPIPAGTVQRA
EFGASDFTFWALRPTPNALLGQSFLTTRLMVLRDYADIKNVVVNDHAVGI
LFSDRPGTREAFPRELFPDQALALISRYTKVSGKWSPPPTPTN
169630161YP_001703810.1 TetR family transcriptional regulator [Mycobacterium abscessus ATCCMTEKVSRDDYFTAAFELLAAGGKSALTTTAVCRRIGMTTGSLYHHFGSGA
AFYRAVIDYWENDVTVAQRRRVDAVADPRERLATLEQAAREADHEVEKAI
RSWAMADRYVAAAQQRVDQVRHEHLTKHYIEAGFTPARADTLARIGFSIL
VGAQQFGTRVDHKRLNSALDEYSAWVNSSVSAEVTTSH
169630160YP_001703809.1 hypothetical protein MAB_3077c [Mycobacterium abscessus ATCC 19977]MSRKLFAIAGAVAGLAISAGAALPAAADPQKNPYPDTSKYAKLDFEGFRI
ADKPGLWFSTPFGLDCGIWEDSSFGCTGTIPGAPGGANQIGWFRGDSSAH
FDNTGQPRFSSGQAQRVLPANNYIELGSTRCATTPENNVYCTGGGNYASY
TNQFMVSPGKTWLGAQD
169630159YP_001703808.1 hypothetical protein MAB_3076 [Mycobacterium abscessus ATCC 19977]MSGNGALPTVGTHPHDYYWRAGMELRPAPSRLRFDSMWTQSRRDILEPWM
DFHEVPRETDRTRLLADHLWQGDELMDAVVDRIRKMPARQGRAMLNRALD
HGIESIEDPPAEFVALFEQLDNPPAWYDPDLWERGRQLWNNSSLAAKFGM
GFGDTFGTFVGDEVAYATGATGRFVNDTLRRNLETTAWFRKMTYRGALER
YAQPFKDTVLVRLMHAQVRAGLRRSWGNEQFAHHGNPISNSMMMGAAMTF
GLIPPLIDHQHGRTRTQADLQAAVMYWAYIAYIFGVAEELIPTSVSEGME
TMDYMVAYAGGPSEWTDIMMGAAFGFVDKGFAGRVGRAVFTPILGVAAYY
GGEDLVRALVRATPLRDARLQPWTTLTGIAVHANVTLRRVGDKLPGAARR
AQQRDGELLWWSAMLVNKTLAKLGGMHDMSYTHHDATAATPAGCPVPHAP
RVSA
169630158YP_001703807.1 hypothetical protein MAB_3075c [Mycobacterium abscessus ATCC 19977]MRLEVEVGLLTRIVGITALALGLMGGSPMSALADPDISADPNPYPDVNNA
TKFRQADFEQFLRDDTDGAWFSTPRGLNCAIWIDGSFGCNGSFPGAPAGT
NQVAWFPGDWRAHFDATGEQLFTPATRPPVLTPGNYFNYRAVKCAVTKDE
GVYCFRGHSASSFNGDQFYIAANQSWLGETKPRPDR
169630157YP_001703806.1 cell division protein FtsK [Mycobacterium abscessus ATCC 19977]MASKTVSRSRSRNTKPGPRSRNTAPTRRPAPRRRNQRRNQHWTAPLAALG
RGARTGWHACAHGVGSLFRSVGRAHDIEHGHRRDGVALALLGVAFVVGAS
SWFHAAKPVGGWIDNAFRVVVGSGVALVPIIALVIAVFLMRTEPNPEERP
RLLLGFAMVALPILGLWHLFAGSPDSPEGRSAAGGFVGFVIGGPLAQGLT
AWIAAPLLVMAIVFGVLLLTGTTIRDVPDTLRNMFSPRDYDEWDEEWDDP
DYEDYEDGQSEGDYEATREFTRGATPMDNYPIEEEAAAAPEPPAPPAPKP
APVVKSTKKAKPKPQMPVVDRVIEGPYTLPSLDLLVAGDPPKESSAANDD
MIAAITGVLEQFKVDAAVTGFNRGPTVTRYEVELGPGVKVEKITALQRNI
AYAVATDSVRLLAPIPGKSAVGIEVPNTDREMVRLADVLTAPETRRDHHP
LVIGLGKDIEGDFISANLAKMPHLLVAGSTGSGKSSFVNSMLVSLLARAT
PEEVRMILIDPKMVELTPYEGIPHLITPIITSPKKAASALAWLVEEMEQR
YQDMQASRVRHINDFNAKVRSGEITTPLGSQREYRPYPYILAVVDELADL
MMTAPRDVEDAIVRITQKARAAGIHLVLATQRPSVDVVTGLIKTNVPSRL
AFATSSLTDSRVILDQPGAEKLIGMGDGLFLPMGAGRPIRMQGAFITDEE
ISAVVSACKEQAEPEYTEGVTTAKVGGGPGKDDVDPDIGDDMDAFLQAVE
LVVSSQFGSTSMLQRKLRVGFAKAGRLMDLMETRGIVGPSEGSKAREVMV
KPEDLAGVLASIRGGGGADEDEDDGGVPEDF
169630156YP_001703805.1 hypothetical protein MAB_3073 [Mycobacterium abscessus ATCC 19977]MPRLRQVSRAETDDRLVHRMYDQIFGDRDPVADPGTTTGTPGDWWTVFAL
VPDALKHSVQGFAFYRSPDRKLDPVLRELGQTRAGWARRSQFVFSQHCKS
CRMVGMTEEMIAAIPSWSTAECFTAVQRAVLAYTDCLVLDGGRVPDGVFA
ALQAHLSDEEILELTYITAMYEMHAVMSTALRLEWDNREEPIVEIAAPEG
FTSFDVGDAIALRRDENA
169630155YP_001703804.1 N-acetylglutamate synthase [Mycobacterium abscessus ATCC 19977]MSAEGTSGISDNPGHPAPAVTVRRARTSDVPAIKALVDVYAGRILLEKNL
VTLYEAVQEFWVADLDGEIVGCGALHVLWSDLGEVRTIAVHPRLKGAGVG
HALVSRLLEVASELELKRVFVLTFEVDFFAKHGFREIDGTPVTAEVYEEM
CRSYDTGVAEFLDLSYVKPNTLGNTRMLAHLSSRPT
169630154YP_001703803.1 phosphatidylglycerophosphate synthase [Mycobacterium abscessus ATCCMPMPPETQPDSAASAAPVPVLNIANILTVLRIVLVPVFVVVLFTEGGHQS
SWRIAAFGVFALAIATDRYDGILARRYGLITPFGQLADPIADKALICAAL
VGLSLLGDLSWWVTAVILVREIGITVLRFSVLRHGVIPANRGGKLKTLVQ
SLAIAGYLLPLTGHWHTAALILMGLAVALTVITGIDYLVQALRPRPKTP
169630153YP_001703802.1 short chain dehydrogenase [Mycobacterium abscessus ATCC 19977]MPRTPYDVDIPDLSGQRAVVTGASDGIGLEIAMKLAGAGADVFMPVRNLR
KGQAAVSRIRALHPRAHLTLAELDLSSLVSIADLGEKLCAEGTPIHLLIN
NAGVMTPPERQTTADGFELQFGTNHLGHFALTGHLLPLLRAGRARVTSHT
SIAARSGEINWDDLNWERGYDGMRAYRQSKIACGLFGLELSRLSNTAGWG
ITSNIAHPGVAPTSLLAARPEVGRTKDTTEVRMIRWLSARGLIVGTVASA
TLPALMAAVAPEATDGGFYGPRWPGSAGGPPGPQKLWKPLHSIRNASRLW
QASQELTGVTFT
169630152YP_001703801.1 putative DNA-binding protein [Mycobacterium abscessus ATCC 19977]MDKRAAAVQDARMIDRAGLAGFLRSRREAMQPDDVGLPRGQRRRTRGLRR
EEVAALCHMSTDYYARLEGARGPQPSEQMIAAIAQGLHLSREERDHLFRL
AGHQPPASGGESEYISPGLMRIFDRLTPDTAAEIVTELGETLRQTPLGIA
LAGDLTRYAGPARSIGYRWFTDPATRSIHPVEDHQFYSRMYASGLRRVLA
ARGPGSKAARFAELLNAESEQFRALWKEHEVGVMPKEMKRFRHPEVGLLE
LNCQILLDPVESTSLLVYTAVPGSESYEKLQLLAIIGASSPPGR
169630151YP_001703800.1 transcriptional regulator [Mycobacterium abscessus ATCC 19977]MALLLREAIGDTLRSARSGQGKTLREVSDSARVSLGYLSEVERGRKEASS
ELLAAICGALDVPLSQVLSEVSERLARREAPVAASEAALASTAGSLSGID
VATKVVIPQVRAMAAA
169630150YP_001703799.1 hypothetical protein MAB_3067c [Mycobacterium abscessus ATCC 19977]MANPFVKAWKYLMALFNAKIDENADPKVQIQQAIEEAQRNHQALSQQAAS
VIGNQRQLEMRLNRQLADVEKLQVNVRQALTLADQATTAGDTAKATEYNN
AAEAFAAQLVTAEQSVEDLKALHDQALAAAAQAKKAVEQNAMMLQQRIAE
RTKLLSQLEQAKMQEQVSASLRSMSELAAPGNTPTLDEVRDKIERRYANA
LGQAELAQNSVQGRMIEVEQASVQMAGHSRLEQIRASMKGEALPTGSTAT
PAPATSPEQANPANPLGQQ
169630149YP_001703798.1 hypothetical protein MAB_3066c [Mycobacterium abscessus ATCC 19977]MTPQPPRRAAVHGGWEQLLRRLATNVNDLGEELAARMRAMSDKREKLLRK
RLRAKRWSIRWALACVAGLLVTTVLATTGAPPWLLIIPALLTAGCAIPAT
YLLVRYRYLKAEPLPPPRPGVERRLPPYGSSARPPMAALDAAERSLFSLL
GVVERGSMIPESEGRQVLSAANRAAYVMAATAKEVVSMERAAAETPHTRE
YLQPTIKAFTAQLDTGVRQYNELVTAAAQLVSAGNGGAVVASPMSRGALF
DDLVSATDRLTGWAGALDELGQLSG
169630148YP_001703797.1 hypothetical protein MAB_3065c [Mycobacterium abscessus ATCC 19977]MWKIIGVLLLVWLAFLMVGAIFKLVVPMLVVGALILGTVLLYRAVRETDK
TPLS
169630147YP_001703796.1 hypothetical protein MAB_3064 [Mycobacterium abscessus ATCC 19977]MTDTLTSTRPTEIIEGFWDAMRRSDLAALDALLEDSVRWENVGLPTVRGR
AAVMRALSALRLPGAGFDVKIHRIAANGNTVMTERTDVIFAGPLHIAFWV
CGVSELSDGGKLTLWRDYADVWNITKGFARGILGIVVPALRPKL
169630146YP_001703795.1 hypothetical protein MAB_3063 [Mycobacterium abscessus ATCC 19977]MTDTTLERSTLAPAETVTRFLEAAQNGDTEFAEKVLDENLVYQNVGLPTI
YGRRAALKVFEPLKRPGFGFEVKIHRTTTNGNTVMNERHDAIVLGPLRLQ
FWVCGVFEVSDEGTITLWRDYFDMFDMFKATLRGLIAIPLPALRPRF
169630145YP_001703794.1 hypothetical protein MAB_3062c [Mycobacterium abscessus ATCC 19977]MRVAVVAGPDPGHAFPALALCLKFAAAGDDPVLLTGTRWLDQARAAGVES
VELLGLQPRVDDDDADSGAKIHQRAAHMALANLDQLRALAPDLIVSDVIT
ACGGMAGELLGVPWVELNPHPLYLPSKGLPPLGSGLAPGVGLRGRLRDGL
MRRLTQKSIDQGLRQRSQARVEIGLPARDPGPMRRLIATLPALEVPRPDW
PAEAVVVGPLHWEPTDVVLQPPSGSGPVVVIAPSTAFTGAEGMTELAVQA
LESAGARVVISALEPPSSGLPSWAIAGLARQDLLLSGADLAVCGGGHGFL
SKALLAGVPTVVVPGGGDQWELANRVVRQGSAELVRPLSRDSLASAIGRV
LGEPRYREAARRAAAGAIAVEDPVRVCQDVLAALR
169630144YP_001703793.1 hypothetical protein MAB_3061c [Mycobacterium abscessus ATCC 19977]MRLTEFHELVTGRFGAAYGSSVLVDHVLTALGGRTASQAVEDGVEPRDVW
RALCADFDVPRDQW
169630143YP_001703792.1 RecA protein [Mycobacterium abscessus ATCC 19977]MAQAPDREKALELALAQIDKSFGKGSVMRLGDEVRQPISVIPTGSIALDV
ALGIGGLPRGRVIEIYGPESSGKTTVALHAVANAQRAGGIAAFIDAEHAL
DPEYAKKLGVDTDSLLVSQPDTGEQALEIADMLVRSGAIDLIVIDSVAAL
VPRAEIEGEMGDSHVGLQARLMSQALRKMTGALNNSGTTAIFINQLREKI
GVMFGSPETTTGGKALKFYSSVRLDVRRIETLKDGTDAVGNRTRVKVVKN
KVSPPFKQAEFDILYGKGISKEGSLIDMGVEQGFIRKSGSWFTYEGEQLG
QGKENARNFLLENVDVANEIEKKIKEKLGIGAVLTDDEVVPAPVDF
169630142YP_001703791.1 recombination regulator RecX [Mycobacterium abscessus ATCC 19977]MTKSSRPQSISDSVSVAGSQGTLDDLRARVASVPEAPTREPVDSRDEQAW
SYCLRLLTSRARTRAELTERLARRGYPDDVSERIMDRLATAGLVNDADFA
TQWVQSRHTYSGKGKRALAAELRTKGVSAENAAAALAQIDGEAERSRAAE
LVTKKLRSENLDDGGIKAARRLVAMLARRGYGQSMAYDVVKNALASEKDR
RDVG
169630141YP_001703790.1 hypothetical protein MAB_3058 [Mycobacterium abscessus ATCC 19977]MRNIVLTIGVSAVFGAACAGAALSGAPVAYGAPLNFDCLQVATPVGMNLT
CVNPTPFTMDAHFKGNCGPLPMLNEDTEIGPFKTISRQVPCLPGVQSPSA
EASMSMRSNGTDEGDPPPSPSARPFGL
169630140YP_001703789.1 hypothetical protein MAB_3057 [Mycobacterium abscessus ATCC 19977]MSDPRPHLGEPLALDLLNTRWMSGDGPRDLLTDLDGLRVWLHTNNLHTLC
AADTQTREALLAAREAIYRAVKDSQIDGLNAVLSHGAIRRSLTANGPLDT
AEVTESHWLPGWLAADNLLALLSESPDRIKQCAHPQCVLFFYDTSKNGAR
RWHSMTTCGNRAKAARHYAKNT
169630139YP_001703788.1 hypothetical protein MAB_3056c [Mycobacterium abscessus ATCC 19977]MSAATAPRVVTGHIGLNVSDLERSIAFYRQAFGFDELAVSADGAQRFAFL
GFDSGPVLTLWEQSSGEFSAATPGLHHLSFQVDSVRQVQQVEAILKQLST
VFVHDGVVAHREGATSGGIFFTDPDGIRLEVFAASGAEQHQAPVGDAPTC
GFF
169630138YP_001703787.1 hypothetical protein MAB_3055c [Mycobacterium abscessus ATCC 19977]MAYHPGELAVQHRMGQSDNAIRVGQIISADIPEVAAAFLAAQPLVFISAR
DDDGRMWASQIVGPPGFAHAADARTIVIDATPDYGDPLAGVLQSERKIGM
LALQPQRRRRMRVNGTSVPSGDGLIVTTDQVYSNCPKYIARRDISEIGPS
LPGETRRGSALDDAQQQAVSVTDTFIIGTADGDGNADASHRGGNPGFLRL
LSPKLLRWPDYLGNSMFMTLGNLHVDPRCGLLIPDWRTGSTLQLTGTARL
NWDESTFAPGAQCSVDFTIDEVVETVNGSPLRWGHAEPSPANPPL
169630137YP_001703786.1 hypothetical protein MAB_3054c [Mycobacterium abscessus ATCC 19977]MTRPPLPPFDIETAHQKVRAAENAWNTRDPEGVAAAYTEDSVWRNRDEFI
TGRAEIVAFLTRKWAKENGYALRKELWGFRENRMAVRFQYEWHDEAGQWW
RSYGNELWEFTSEGLMSRREASINDTPIAETQRRIFGPRPEGDESPLPIR
169630136YP_001703785.1 putative glutamate ABC transporter permease [Mycobacterium abscessuMTGATVMYDAPGPKGRALNRIIAVVFTALVGVVAAWVIWTLVANEQLTTE
KWSPFLRLNTWTTYILPGLLGTVTAAALSIVFALALGAVLGIGRLSEHRA
VRWICSALVEFFRAIPVLILMVFSYYLYGQQAVFPSEYLAFAAVVTGLSL
YNGSVIAEILRSGIQSLPKGQSEAAVALGMRKSQMMRLILLPQSISAMLP
ALISQMVIALKDSALGYAFGYIEVVRSGIRSASYYGNYLPALVVVAVIMI
IINFALSSLATRIERQLRQGRTKKTIEKDLSQDFGE
169630135YP_001703784.1 putative glutamate ABC transporter permease [Mycobacterium abscessuMNALWASMGPQLWPAFWTTLRLTFFSAVGALVWGTLLAEFRVSPVPVMRI
FGTWYVNVVRNTPLTLIILFCSVGLYQNLGIALAPENSNFIKNNNFWLSV
LGFSLYTATFVCETLRSGFNTVPLGQAEAARSLGLPFWRVLTLIVLPQAM
RSVLAPMGSVLIALVKNTSIASAIGVAEAALLMRSEIELFADQIVWIFLI
IAAGYMVITLTIGLSFGYFAKRLAVKR
169630134YP_001703783.1 putative glutamate ABC transporter- periplasmic protein [MycobacterMSRLRDEDARVMRRRHTALVAALALLATLVSACGSTEPRQLLGSIRGGTV
ILGTKFDQPGVGLQHPDKKMSGFDVKISEYVVNAIADELGVKHPTIRWYE
TPSAQREQLIDNGTVDMIAGSYSVNYSRAQKVSFAGPYLITYQGLLVRKA
DDSLTTLDDLNRGKKLCSVSGSTPAQNVKNLLPGTQLQEFDSYSSCVEAL
RRGKVDALTTDETILAGYAKRYEGEFKLIQMNYELSKPLCIGNPKRQRRN
GDPFSREVYGIGLARGDTAAIEAIDRALDKMIATGAWDSDLREALGDSTI
DGWEKRAESGTYGLRPDPSLAAIEKITGTKPAADPACGAA
169630133YP_001703782.1 putative glutamate ABC transporter ATP-binding protein [MycobacteriMPVSTDTSTSGESSSAPSVPMIALEHVNKHFGDLHVLKDITLEIPRGQVV
VILGPSGSGKSTLCRTINRLEPIDGGTIRIDGAILPEEGRALASLRAEVG
MVFQSFNLFSHKTILDNVTLAPIKVRKHNKETARKRAIELLERVGIASQK
DKYPAQLSGGQQQRVAIARSLAMGPKVMLFDEPTSALDPEMVNEVLDVMV
SLAKEGMTMLVVTHEMGFARKAADRIIFMADGAIVEDSDPESFFTNPKSE
RAKDFLGKILGH
169630132YP_001703781.1 hypothetical protein MAB_3049c [Mycobacterium abscessus ATCC 19977]MLFITSFPVAVMNGATTWGWTMASLGLIFGLFLLPSSLMRLATPSGQVTV
DTGAHFREGENLERPRPRRDISFAIVIALICLTVLVALCEPVVEPTVPGA
WFGAGWLAWIGVNAICAVDDWWQGWHVRDRAGGSGASRR
169630131YP_001703780.1 putative tRNA-i(6)A37 modification enzyme MiaB [Mycobacterium absceMTSTATSGESAVRTYQVRTYGCQMNVHDSERVSGLLDAAGYVKAPEGTDA
DIVIFNTCAVRENADNKLYGNISHLAPRKAANPNMQIAVGGCLAQKDREG
MLAKAPWVDVVFGTHNIGSLPALLERARHNNEAQVEIVEALEHFPSALPA
TRESAYAAWVSISVGCNNTCTFCIVPSLRGKEIDRRPGDILGEVQALVDQ
GVLEVTLLGQNVNAYGVNFADPEIPRDRGAFAELLRACGRIDGLERVRFT
SPHPAEFTDDVIEAMAQTPNVCPQLHMPLQSGSDRILKAMRRSYRSERFL
SIIDKVRSAMPDAAITTDIIVGFPGETEEDFQQTLEVVRRARFSSAFTFQ
YSIRPGTPAAKLPDQLPKAVVQERYDRLIALQESVTLEENQKQIGRMIEV
LIATGEGRKDGETARMSGRARDGRLVHFRPQGHVDGALRPGDIITVDVTG
AAPHHLIADDGVRSHRRTRAGDAHEAGKKPSTPGIGLGMPAIGAPKTERI
EVAGCGL
169630130YP_001703779.1 hypothetical protein MAB_3047c [Mycobacterium abscessus ATCC 19977]MNDSEPGKEDAEFDEFAAFHKDIDAAEKKVAGEIDPGARAMVVAVLVFAL
LLTFVLPHTGHARGFDVLVNGAIADQEAVRVPSRIFVWLAMIFGVGFSML
ALLTRRWVLSWIALAGSFVASVIGMLAIWTRQTAGSGHPGPGIGLVIAWI
AVILLTFHWARVVWSRTAVQLAAEQERREAAKRDQRTILDDAFEDDEDRD
K
169630129YP_001703778.1 hypothetical protein MAB_3046 [Mycobacterium abscessus ATCC 19977]MSDQTQPELSTQQERVTPVPRPGPKPHPMPRRPAAPAPAAHHVDPHKFGR
VDDDGTVWLITSAGERQIGSWQAGDADAAYAHFGRRFEDLETEVQLLELR
LGSGSGDARKIKTAAEHLAETLPAAAVLGDVDSLSARLSALVESADAQAA
AARAQRDEARSASISRKEELAAEAEELAANSTQWKAAGDRIRAILDEWKS
IHGVDRKTDDALWKRYSTARETFNRRRGAHFAELDRERAGAREKKEELCK
RAEALSDSTDWGATSAAFRNLLNDWKAAGRAPRETDDNLWHRFKAAQDKF
FAARNAESASRDAEFVANAEAKRALLVEAEKIDPEADVDAARAALRAIGD
KWDAIGKVPREQQADLERRLRAVEKKVREAGESGWGDPEAEARAEQFRDR
ARQFEEQAAKAEAAGKTKDAEKARASAQQWQEWADAAVAAVKSRSR
169630128YP_001703777.1 hypothetical protein MAB_3045c [Mycobacterium abscessus ATCC 19977]MNLSIAICPSTPLLVPELGGEAAAETGELRAASVTVARSLPAQWIAIGVG
DGQYHADMSGTFAGYGADVRVSLSDRMGKPAQLPLPVLIAGWLRSRAEAD
EAEVRLVGPATDALAFGRALRGEIERRPVPPGVLIVADGANTLTDKAPGG
YRPDAEAAQRAVVDALTRGDAASLRHLPDAITGRPAYQVLAGLVDSDVVE
ARCLYRGSPYGVGYFAGIWRVS
169630127YP_001703776.1 tRNA delta(2)-isopentenylpyrophosphate transferase [Mycobacterium aMTRPIAVIGPTATGKSALALELAERLGGEIVNADAMQLYRGMDIGTAKVP
ECERRGLVHHMLDVLDVTETATVATYQERAVATIDDIRARGHVPVIVGGS
MMYIQALLDDWAFPATDPQVRARWEERLAQIGVTALHAELAARDPAAAAI
ILPTDGRRTVRALEVIELTGQPFAASAPTIGPPRWDTLIVGLDWETEKLD
DRIARRTDLMFEQGFVGEVEYLLSTGLRDGVTASRAIGYAQVIAALDAGG
GAGALAQARDLTFVGTRRYVRRQRSWFGRDHRVVWLAGESVETGGPEGLA
GEIVSRWRLSSNT
169630126YP_001703775.1 diaminopimelate epimerase [Mycobacterium abscessus ATCC 19977]MKFTKGHGTQNDFVVLPDVHIKRDLSVAAVQALCDRQRGLGADGVLRVTT
VGAALEGGVLAEKPAGVSSEDWFMDYRNADGSIAEMCGNGVRVFAHYLRS
VGLEHRDEFVVASLAGPRPVRINSWSQLTADVTVDMGPVKEFGAGEAIVG
GRRFSGLAIDVGNPHLACVDAVLTTEQLRILDVGAPVTFDEQLFPDGVNV
EVLTAPSAGPANTVHMRVHERGVGETRSCGTGTVAAAYAALRHIGQRTGE
VVVNIPGGQVRVTVTGESSFLRGPSMLLADGEISDEWWGGIGACG
169630125YP_001703774.1 GTP-binding protein HflX [Mycobacterium abscessus ATCC 19977]MRTTYETPTDGELALEDRAALKRVAGLSTELADVTEVEYRQLRLERVVLV
GVWTEGTSQEAEASMAELAALAETAGSEVLEGLIQRRQKPDPATYIGSGK
AIELREIVLATGADTVICDGELSPAQLVALEKAVKVKVIDRTALILDIFA
QHATSREGKAQVSLAQMEYMLPRLRGWGESMSRQAGGRAGGAGGGVGTRG
PGETKIETDRRRIRERMSKLRREIRDMKKVRDTKRSRRLESDVPSVAIVG
YTNAGKSSLLNAITGAGVLVQDALFATLEPTTRRGTFDDGREFVITDTVG
FVRHLPTQLVEAFRSTLEEVADADLLVHVVDGSDMAPLAQIEAVRTVIGE
VVADHDASAAPELLVINKVDAAGDLALAQLRRALPKALFVSAHTGEGIAT
LREAIAEAVPRGDVPVDVVIPYERGDLVARIHTEGQVQSTEHLADGTRVV
GRVPRALAAVLTAL
169630124YP_001703773.1 putative biotin sulfoxide reductase BisC [Mycobacterium abscessus AMIRPAFSAVQVSGSARLSHTHWGAFTPEVRDGEVIGVTPIETDLDPSPLL
QNIPGSIRHQARVTAPAVRSGWLREGPGPSDKRGADEYVEVSWDELTELL
ADELRRVVDTHGNEAIYGGSYGWASAGRFHHAQSQVHRFLKLLGGYTFSR
HSYSLGATGVIMPHVIGTHDGLFKRSTSWDVIVENTDLLIAFGGIALKNT
GVNHGGTTAHPARDALNRFRDRGGRIVSFSPLHDDIDGECEWHAPIPGTD
VAVMLALAHVLAVEKLADLTFLSSYCTGYERFERYLLGVDDGVPKSPEWA
APISGLDAAELRTLARRMAAGRTLVTVSWSLQRVRHGEQAPWMGLTLAAM
LGQIGLPGGGFGHGYGSMNEPGLAPVSCPLPTFPQGPNPVETFIPVAAIS
ELLLRPGQTLAYNGQTLTLPDIRCVYWAGGNPFHHHQNLPRLRRALSRVD
TVVVHDPVWTAMAKHADIVVPSTTSLERDDFSGSRNDPLLVAMKAVAPPY
ANSRDDYTTFSALADRLGFGEQFSEGRTAAQWLRHIYTEWAGALNFSVPS
FDEFWDRGYLELPTDAGLTLLSDFRENPAAHPLHTPSGRIEIFSETIDGF
GYSDCGGHPQWYEPTEWLGGERAQRFPLHLIANQPRTRLHSQLDFGGTSQ
GSKVRGREPLRIHPQDAATRGIADGDVVRVFNDRGACLAGAVLDEGLRRQ
VVQLSTGAWFDPIEPADPNSACAHGNPNVLTDDSGTSSLAQGCTGQHVLV
QIERFEGTPPPVRAHTPPRFVARD
169630123YP_001703772.1 acyl-CoA dehydrogenase [Mycobacterium abscessus ATCC 19977]MAGAVKFKRTIFEPEHELFRESFKTFLDRHAEPYKEEWEKNKIVDRALWV
EAGKQGFLGTDMPEEFGGGGLIDFRYNTIITEEVTKGRHTGVGFSLHNDV
AGPYFRDLANDEQKARWFPGFCSGELISAIAMTEPGTGSDLQGIKTRAVK
DGDHYILNGAKTFITNGINADLVIVVAQTDPEKGALGFSLIVVERGMEGF
ERGRKLDKVGLDAQDTAELSFTDVRVPAANLLGEEGQGFIYLMKNLPQER
MSIAVMAAAAMESVLEETIAYTTERKAFGKPIKSFQNSRFLLAELATDAT
VIRVMVDEFISLLNKEELSVEQAAMAKWYSTEKQVHLIDRCLQLHGGYGF
MREYPVARAYMDSRIQTIYGGTTEIMKEIIGRSL
169630122YP_001703771.1 phosphinothricin N-acetyltransferase [Mycobacterium abscessus ATCC MHIRDATAADAAACAAIYAPYVTDTAISFEEVPPSDAVLAERIQTAAHRH
AWLVAEDGGEILGYAYAAPWKSRTAYQWACEVSVYVDGARRQRGTGRQLY
TALLGRLRELGYRTVLAVVVTPNAASEKLHRTMGFEQVALYRRIGYKLGS
WHDVTHFQLFLTSAGDSRAPGPAPGEA
169630121YP_001703770.1 LexA repressor [Mycobacterium abscessus ATCC 19977]MSDTPSKGPATGSLTERQRTILEVIRASVNERGYPPSIREIGDAVGLTST
SSVAHQLRTLEQKGFLRRDPNRPRAVDVRGIDDAGTPSATTDVIGSGDLP
EPTFVPVLGRIAAGGPILAEEAVEDVFPLPRELVGEGSLFLLKVVGESMV
DAAICDGDWVVVRQQNVADNGDIVAAMIDGEATVKTFKRTSGQVWLMPHN
PLFEPIPGNDAAILGKVVTVIRKV
169630120YP_001703769.1 hypothetical protein MAB_3037c [Mycobacterium abscessus ATCC 19977]MSTNVLTPPRSSHAREGAPREYAPPARAYSAEYPLTQRRALPVRTVAYRR
PAGRPVAYRGNGIRVSGVAHRVHRRRPVSLKATIVVAVGAAVATMWLLML
GQVSAAGIGGAGVPDRLAVVQVAPGETLADVASRVAPEAPRSAVVSKIRE
LNELDSATVQAGQTLVSPVG
169630119YP_001703768.1 transcriptional regulator NrdR [Mycobacterium abscessus ATCC 19977]MHCPFCRHPDSRVVDSREADEGQAIRRRRSCPECGRRFTTVETAVLAVVK
RSGVTEPFSRDKVVKGVRRACQGRDVDDDALNLLAQQVEDAVRAAGSPEI
PSNEVGLAILGPLRDLDEVAYLRFASVYRGFSSAEDFEREIAALRAHRDA
PAES
169630118YP_001703767.1 hypothetical protein MAB_3035 [Mycobacterium abscessus ATCC 19977]MSVDVAVVRVFTDETGNFGNPLGIVNGADVGAADRQQVAARLGFSETVFV
DLPAEGSNTAHLRIFTPAAELPFAGHPTVGLAWWLRERGTPVNTLQVPAG
VLQVSYDDRTWIRARSDWAPETDFHESDSPADVEAADPADYPDELLHCIW
AWQNRDANLVRSRVFASDLGVDEDEATGSVAARLTDLLSRDLIINQGKGS
QIFTQWSPEGWVTIGGRVVADQPLTLD
169630117YP_001703766.1 hydrolase [Mycobacterium abscessus ATCC 19977]MNPPPRLLRPVPDTEHIDGVDGGGDTPSAATSTRPRLAFRTIHGYRRAYR
IAGSGPVLLLIHGIGDNSATWDSVHAQLAEHFTVIAPDLLGHGQSDKPRA
DYSVAAYANGMRDLLAVLDIERVTVVGHSLGGGVAMQFTYQFPHLVERLI
LVAPGGVTKDVNIVLRCASLPFIGDALGLLRLPMAMPMLRLGGAVARATF
GRASMARDIPDVLRVLADLPEPRASAAFTRTLRAVVDWRGQVVTMLDRCY
LTESVPVQLIWGSDDLVIPVSHGHLAHAAMPGSALEIFDKSGHFPFHDDP
ERFIGIVRQFIASTEPGEYNEDELRRLLRTGVTEHAISGAARTRMAVLDA
MGTDERSAT
169630116YP_001703765.1 hypothetical protein MAB_3033 [Mycobacterium abscessus ATCC 19977]MTSNEGVEPQPYKPDQSGMYELEFPGPQLASADGRGPVLVHALQGFSDSG
HAVKLAAAHLRQTLESELVASFAIDDLLDYRSRRPVMTFKSDHFTEYATP
ELNLYALKDTKGTPFLLLAGLEPDLKWERFVNAIRLLAEQLGVRKTIGLG
AIPMAVPHTRPITLTAHGNDRKTLDEHPGWIDEVQVPGSASNLLEFRLAQ
HGHDVVGFAVHVPHYLAQTDYPEASQRLLEEVARTGDLDLPLQELSEAAA
KVRNQINEQVEGSEEVAQVVQALERQYDAFVAAQENRSLLARDEELPSGD
ELAGEFERFLAEQAKFGDDPSGPSPEGPIL
169630115YP_001703764.1 soluble pyridine nucleotide transhydrogenase [Mycobacterium abscessMTNGLRPSGSSPTADTPSYDLVVIGSGPGGQKAAIAAAKLGKSVAVVERD
NMLGGVCTNTGTIPSKTLREAVLYLTGMNQRELYGASYRVKANITPEDLL
ARTEHVIRKEIEVVRAQLQRNRIDLISGIGRFADEHTVVVEEPSRGERTT
LHADYVVIATGTNPARPDGVAFDEKRVLDSDGILNLRFIPGSMVVVGAGV
IGIEYASMFAALGTKVTVVEKRDTMLDFCDPEVVEALRFHLRDLAVTFRF
GEEVTTVEVNDTGTMTTLASGKQIPADTVMYSAGRQGQTDQLDLPKAGLE
ADRRGRIWVDANFQTKVDHIYAVGDVIGFPALAATSMDQGRLAAYHAFGE
PSKGMTDLQPIGIYSIPEVSYVGATEVELTKNAIPYEVGVSRYRELARGQ
IAGDSYGMLKLLVSTEDLRLLGIHIFGSDATDLVHIGQAVMGCGGTVEYL
VDAVFNYPTFSEAYKVAALDVMNKIRALNQFKA
169630114YP_001703763.1 hypothetical protein MAB_3031c [Mycobacterium abscessus ATCC 19977]MTASRLVATMVVAGCCAAIAPACTRAIDGSAVEASGSAQPATPTPASAVR
APAGPVGPLLLAPTDFPRQYPATTLEPEAAGSALREIRGVPDAAAVVPTA
CAPAPLPAVPQDAAVAVGTNQSDASTITVAVLRVAEPLAAYKSQLQRCAS
FTFSGPDQIQSTVTASEAVAPPINADDSVAVNQAVSPAGTGGGTQTTLSL
IAQIADIRIQATYTTFQGTEPDAVLLDQAFTAAVLKVHDNVR
169630113YP_001703762.1 hypothetical protein MAB_3030c [Mycobacterium abscessus ATCC 19977]MTSLIPGPAGRPDFRLDRPSALIAALPAMLGFIPEDSLVVVTLADGLIEA
VLRRDLRDLDNPEHAAFEALAAVLGPGPADAVIAVVISPVLDELEAGDII
RRLAKHLEYHGVSLIAGHVVDRVGAHGWWRCYDGCGAGGPVDDPQCSPLT
AAAVLAGRTVHRRREDLVALIAPTDTTRTAALAVSLRRPFQGPCDTAAAD
RRAVNRVMRTACRAAEFRPLSNREILAIARSLMALRVRDTLCALAVGALA
ADVERLWLALSRLLPPPWRAEALVLLGFSAYVRGDGPLAGVALDAALMAQ
ADHRLGQLLMSALLSGMRPDEIGTLADTGYRIAHELGISLPPRQIRRAG
169630112YP_001703761.1 Iron-dependent repressor IdeR [Mycobacterium abscessus ATCC 19977]MNDLVDTTEMYLRTIYDLEEEGVVPLRARIAERLEQSGPTVSQTVARMER
DGLLNVAGDRHLELTDKGRALAVSVMRKHRLAECLLVDIIGLPWEDVHAE
ACRWEHVMSEDVERRLLTVLNNPTTSPFGNPIPGLSELGVPADRSESASA
VRLTEIPSGSQVAVVVRRLAEHVQADTDLLSRLKDAGVVPNARVTVESSP
DGVIIIIPGHESVELPHEMAHAVMVEKV
169630111YP_001703760.1 RNA polymerase sigma factor SigB [Mycobacterium abscessus ATCC 1997MANATTRPARTTESEDLDAQSPAADLVRVYLNGIGKTALLTAEDEVELAK
RIEAGLYAQHLLDTKKRLGEARKKDLAVIVREGNAARSHLLEANLRLVVS
LAKRYTGRGMPLLDLIQEGNLGLIRAMEKFDYAKGFKFSTYATWWIRQAI
TRGMADQSRTIRLPVHLVEQVNKLARIKRELHQRLGREASDEELAEESGI
PVEKIGDLLDHSRDPVSLDMPVGTDEEAPLGDFIEDTEAMSAENAVIAEL
LHSDVRSVLATLDEREQQVIRLRYGLDDGQARTLDQIGKLFGLSRERVRQ
IEREVMAKLRHGDRAERLRSYAS
169630110YP_001703759.1 hypothetical protein MAB_3027 [Mycobacterium abscessus ATCC 19977]MRKELSFDDDGRPVLITAAAVSVEEQHRARVRRYLTIMAFRIPALIGAAW
AYSVWHNGWVSLAILAASIPLPWMAVLIANDRPPRKAEEPRRYGPQTQHH
ALFPTAERRAIDTASAPQPHHPPQDSADPS
169630109YP_001703758.1 hypothetical protein MAB_3026c [Mycobacterium abscessus ATCC 19977]MDTQTLERPDTTVDESTDSDTPKVFHYVKKDKIVESAVMGNHVVALCGEV
FPVTRSAKPGSPVCPDCKRIYEMMKKD
169630108YP_001703757.1 ribonuclease BN [Mycobacterium abscessus ATCC 19977]MSEKPRHVSFGRDVLHVMRRTAVKSWDDSIFAQSAQAAFWQVLSLPPLLL
GILGSLTFVGPLFGPDTLPEIQERLVRVANSVFSKSVVTEIIEPTIIDIM
RDGRGEVVSIGFVISLWAGSSAISSFVDSVVEAHDQTPLRHPVRQRFFAL
GLYVAALAMAVVTLPMVALGPKRIAEVVPDSWNSLLRYGYFPLLGIALVA
LVTLLYRVSLPRPLPSHRLWIGALLAVTFFAIASLGLRFYLNWITGTGYT
YGALATPIAFLLFAFMLGFAIVLGAELNAAIEENWPAGATHARQLREWLS
PQNGQNGRDDGTPTQSPEGC
169630107YP_001703756.1 hypothetical protein MAB_3024 [Mycobacterium abscessus ATCC 19977]MNATLTSPELTKADRCDRCGAAARVRATLPSGAELLFCQHHANEHSEKLA
AMSAVLVISGPLED
169630106YP_001703755.1 hypothetical protein MAB_3023c [Mycobacterium abscessus ATCC 19977]MQSRDADAAELLHMCSVEDWARARALGEHRPTSLAESGFIHLSAPYQIHL
PANRLYRGRCDLVVLSVALNLLDCPVRWEPGVPSDPESMLFPHLYGPLPI
AAVTSVANFRPGPDGFFEPLAQTTY
169630105YP_001703754.1 hypothetical protein MAB_3022c [Mycobacterium abscessus ATCC 19977]MASSNHPLETVLADEPVVGACWRPELAAMFNQGAVTDDSLNLAFTEIVAE
NFRPGELPAELTRLREAGTVVVPHGVSLGLAGADLPDAKRVKHLAALAAE
LNAPMVSEHVAFVRAGFENGRHSGVLEAGHLLAPPRTTLALDVLVDNVSR
VQDDLGVPLALENVATTLQWPENELSEADYLRELSRRTECWLVLDIPNLY
ATAVASGTDPIALLRRFPLERVAYVHIAGGRFEGDLYWDTHADTIIEPVA
DLLTELVALTSGRSLGVLIERDGSIDEASVSADLSIVRQAIKAGVVHA
169630104YP_001703753.1 hypothetical protein MAB_3021c [Mycobacterium abscessus ATCC 19977]MLDNREVLRRRQLSVLSDLLAGNAPSGFDEYTALTAGAQLRAKRRFDMAS
AVPWLAAMPNWEYEFEQYARLHSMQCCVLCDAKEFREYTYELPRLRDWVM
DREVSEGLRRIALVHRGGRRELQVAFGKKLRYFALRPEQAEV
169630103YP_001703752.1 hypothetical protein MAB_3020c [Mycobacterium abscessus ATCC 19977]MTAVIVAVTVIVLLVAGLGFFVATNSGSRPRNRADGPDHQENGYSGASHG
PGSGN
169630102YP_001703751.1 fatty acid hydroxylase [Mycobacterium abscessus ATCC 19977]MTRTATRKGMTLRDALAEFIKHPTPWMLLAWSSALIIGRITLGSWSIADA
IVPIALVAISPIAEWLIHVGILHWRPRSLGPVTLDSRLARDHRLHHQDPR
DVPLVFIPWPSLIVVIVGVTAIGLLMFPRNGLGLTFALAIALFLMFYEWT
HYLIHTDYKPRRAIYRAVWRNHRYHHFKNENYWFTVTSSGTADRLLGTFP
DPQQVKSSPTVRNLHAPSITG
169630101YP_001703750.1 GntR family transcriptional regulator [Mycobacterium abscessus ATCCMALQPIARQSIPDEIFSQLAAQVLTGDRIPGDTLPSERALAEALGVSRAA
VREALGRLERSGLIQIRQGGSTVIRDYRSDAGFDVLPLLLAYGGDVDRRT
LASVIEARAIIGPQVARLAAQRAHQTPGVADRLRAMTSELEAEDDPLQRM
WQALGFWELVIDTADSIAFRLVFNTMRDSYVRALDVLVNVMAAEVGDIGH
YRALADAIALADPDAAQDAAAGMLALGTKAFDKLLREMEKER
169630100YP_001703749.1 hypothetical protein MAB_3017 [Mycobacterium abscessus ATCC 19977]MGRFRISSDGEWEAAVGYSRAVRVGAHIAVAGTTAARPNQPPAGGDDIAE
QTHEVLRRIESALSQTGASLSDVVRTRIFVTDISRWREVGLVHGAFFGDI
RPAATMVEVSALIDPALLVEIEADAIVE
169630099YP_001703748.1 hypothetical protein MAB_3016c [Mycobacterium abscessus ATCC 19977]MTDRIRIGIQLRPAKTQSYKQWRDAVLRAEDKGADVIFGYDHFHWPAGTL
SSQGVVLDEVQPDVNNFEGWTALGSWAEVTSRAEIGLLVTGVGYRNPDLL
ADMARTVDHISGGRLILGVGAGWYERDYTTYGYDFGTTGSRFDLFEDSLV
RIESRLGQLLPQPVRPIPILIGGGGEKRTIPLVARHAHIWHAFGDIDTYR
RKNSVLIAEADRIGRDHNEIERSTSWGLDPERGLTAAEADAYVEVGARLF
TVGIDADNGYDLSVLDAPLAWRDSRS
169630098YP_001703747.1 hypothetical protein MAB_3015 [Mycobacterium abscessus ATCC 19977]MRIRDVQITATDLPGAARFYSETLGLPVQLAPDRATVSIGDSTLTMVPGP
AYHGAHHIAFTIPAGSLASAKQWLSRRVTLQADGEWHDEFDCPPHWRARS
IYFAGPDDAVLELIERNVLDNRIERAFGVGDIRYISEVGFGVPDVLQTQL
QLRDTLGLLPFGEPNPRFGPVGDHDGLFILVPADATWRPENRGAPAAAHI
VVTADIPTALEIGEHYLVQPRPLGA
169630097YP_001703746.1 mercuric reductase [Mycobacterium abscessus ATCC 19977]MSTHFDAVVVGAGQAGPSLAARLRGAGLTVAIVERHLFGGTCVNTGCRPT
KALVASAHAAHMAREAARWGVVVDGSVSMDMVRVRERKDAVILPSRNGGQ
TWLKDLGCAIYHEHASFLSPTELSVGDEIISAERIFLNVGGRAVVPDWPG
VDDVPLFTNSSLIEYDGIPEHLVVIGGSYVGLEFAQIYRRFGSQVTVVHR
GPRLVEREDPDASAIIQEVLEREGITFRLNASCINLARHDEGVAVGVDCT
DGAPKVVGSHVLVAVGRRPNTDDLGLENAGVATDARGYITVDDQLRTSTP
GIWALGDCNGRGAFTHTSYNDFEIVAANLLDDDPRRVTDRLPCYALYTDP
PLGRVGMTEAQARASGRSLLVGRKPMSHVGRALEKGETDGYMQVLVDADS
DLILGATILGVGGDEVVHCLLDTMQYGIPARQLQRTVHIHPTVAEFLPTI
LGELQPLI
169630096YP_001703745.1 hypothetical protein MAB_3013 [Mycobacterium abscessus ATCC 19977]MTGLYVAALLIGIVAGLRAMTPLAVLSWAAFAKCLLLEGTWASFLASLVV
AIIATVLAAGEIVNDKLPKTPSRKAPPAFAARMVLGAFYGAVFGTLAHDT
SPGLLIGLVLGAIGAVIGTLGGAWARGALATAFGKDLPAALIEDAITVAA
ALAITAGLAT
169630095YP_001703744.1 methylated-DNA--protein-cysteine methyltransferase [Mycobacterium aMSTVGHCFFDTAIGSCAIAWSDRGIVALQLPERDDAATLARIRRPAGSEL
APPDFVAQAIDGIRRVLAGDDDDLQWARLDLDGTTDFDREVYAATRAIGP
GRTRSYGEVAASVGEPGAAQAVGQSLGRNPIPLLVPCHRVLAADRSLHGF
SAYGGVVTKRELLRLEHTPGFDDPTLF
169630094YP_001703743.1 hypothetical protein MAB_3011 [Mycobacterium abscessus ATCC 19977]MKNDGSSPPPGGGPIADRRRQFEELSRTHREDADERAHIEHKIEIVTSDP
DLTAEEKAAAIAELRRALE
169630093YP_001703742.1 hypothetical protein MAB_3010 [Mycobacterium abscessus ATCC 19977]MTATLEKEVTAPQPPLDGDVADRRSKFRKLTAETPRDPSAERAFLASKLA
VLQSHPKLSAATRYEGEQTLAEAAGLADSAQLAAAVAPPPGGVGYGMFYT
NSFRTRFARGTAFYYEIVCPHQPGGNVADYLYLTATNRAQKGVEAFVSYH
AQDIARFKVFDWARSDHWQTDIPFANLTSYLRSTSSHGWGLQTLLVWNQS
FEIAPNRWRNEVLLHNRAANRWDLVYRFDYQSSTAEQTSGWVGSWGPIVE
TFQNSYTNTRWLGFLNTMLVGRDAAGNWGQWALLRAADSTVRNDGHGFSP
LFLDPNYSFVVKS
169630092YP_001703741.1 RNA polymerase sigma factor [Mycobacterium abscessus ATCC 19977]MAATKAAPVTQATAETPSNTTATKAAPAKKAPAKAATKAPAKKAPAKKAP
AKAATKAPAKKAPAKKAPAKKAAAKATDPALEPQGAADDADIEPGDDLDT
DLADDADIEADLAEAAAEPEPEAEADGDDEPSEKDKASGDFVWDEEESEA
LRQARKDAELTASADSVRAYLKQIGKVALLNAEEEVELAKRIEAGLYATQ
IVTELTEKGEKLPAAQRRDMMWICRDGDRAKNHLLEANLRLVVSLAKRYT
GRGMAFLDLIQEGNLGLIRAVEKFDYTKGYKFSTYATWWIRQAITRAMAD
QARTIRIPVHMVEVINKLGRIQRELLQDLGREPTPEELAKEMDITPEKVL
EIQQYAREPISLDQTIGDEGDSQLGDFIEDSEAVVAVDAVSFTLLQDQLQ
SVLETLSEREAGVVRLRFGLTDGQPRTLDEIGQVYGVTRERIRQIESKTM
SKLRHPSRSQVLRDYLD
169630091YP_001703740.1 polyphosphate glucokinase PpgK [Mycobacterium abscessus ATCC 19977]MTATDSAPAATAADPSNTPQQAFGIDVGGSGIKGAIVDLTTGEMVGERVK
YPTPQPATPKAVAETIARVVRDFSWTGPVGVTYPGVIVRGEARTAANVDK
SWLGVNVHDIISTELGGQTVTVLNDADAAGLAEDRYGAGKDQSGVVVLLT
FGTGIGSAVLHNGILLPNTEFGHIQVDGMEAEHRAASSVKEKNDWSYKQW
APEVTKVLEAVENALWPDLFIVGGGISRKADKWVPLLTNRTPVVAAALQN
TAGIVGAAMAAHAGVSP
169630090YP_001703739.1 inositol-1-monophosphatase SuhB [Mycobacterium abscessus ATCC 19977MGIEAGALRSVAVRLASEAAEFVRHRRGTVDWTASVRTKSSETDPVTLVD
TDCERLLRRRLASLRPDDAILGEEDGESAGGSLSGRSGQPSGVRWVIDPI
DGTVNFVYGIPAYAVSVAAQVGGVTVAGAVADVVADRVFSAASGAGATVR
EANGLQRPLACNPVRETRLALVATGFAYSTVRRERQAHLVAQLLPRVRDV
RRIGSAALDLCAVAEGRVDAQYEHGLGPWDWAAGALIAREAGAVVILPGP
DTRSAAGALIAATAPGIAGEFGQLLADIGATAPIPG
169630089YP_001703738.1 hypothetical protein MAB_3006 [Mycobacterium abscessus ATCC 19977]MVADITEGTSVDKDGRPFRRRNYLPALILGIALLAVTVFVWASALTREAP
VKEATACNPPAAQTEPGSGTIGKPVSRSSLTGTSAATLNDVRVRVLNANG
QAGQAGEVSASLRDLGFPAPTADNDPFYPSGSRLNCVGQIRFGESGYANA
LTLSLVAPCVEFVEDTRSDDSVDLALGSEFTELASGNAVTSALNSLKPGS
QANSDLISRARQSTC
169630088YP_001703737.1 hypothetical protein MAB_3005c [Mycobacterium abscessus ATCC 19977]MATDYDAPRRSDADDVSEDSLEELKARRNEAQSAVVDVDEAETAESFELP
GADLSGEELSVRVIPKQADEFTCSSCFLVHHRSRLASEKNGQLICTDCAA
169630087YP_001703736.1 hypothetical protein MAB_3004 [Mycobacterium abscessus ATCC 19977]MMASPSNTTDIRYLERLWVPWWWALPGFGAATLLGLEVNQGLRQLPSWVP
YPILFAIVAGVLLWFSRIRVEVAAGPDGTPELRAGSAHLPVSVIAKSAAI
PATAKSAALGRQLDPAAFVVHRAWIGPMVLVVLNDADDPTPYWLVSSRHP
DRLLAALRS
169630086YP_001703735.1 deoxyuridine 5'-triphosphate nucleotidohydrolase [Mycobacterium absMAIVRLDRELPLPSRAHADDAGVDLYSAEDVVIEPGRRTLVGTGIAVAIP
SGMVGLVHPRSGLAARVGLSIVNSPGTIDAGYRGEVKVNLINLDSEVPIV
IARGDRIAQLLVQQVELPELVEVDSFDEAGLAVTTRGAGGYGSSGGHASL
169630085YP_001703734.1 hypothetical protein MAB_3002c [Mycobacterium abscessus ATCC 19977]MALHRSGGLNDLDDTADASGETFDGPYEIEDFDSPEDAGVGRLDLGSVLI
PVPETGQIQVELTAAGAPGAVFVLTPNGRYSVAAYAAPKSAGLWREIAGE
LAESLRKEAAEVSIADGPWGREVVGAAQGGSVRFIGVDGYRWMIRCVLQG
PAETFDALADEAREAVADTVVRRDDSPYPVRTPLPVVLPEPMLEQLQQAQ
AQAMAQAEAEAPAQEPAPQDDPTPAARRSVAGSAMQQLRSTITGG
169630084YP_001703733.1 hypothetical protein MAB_3001 [Mycobacterium abscessus ATCC 19977]MTTVTNTQPPRWLKPMNKVVRAFHRLGVSTGPAMVLTVPGRKTGQPRPTP
ITPFEVDGQLFAVGGYPGSDWARNAAAAGSGTLTKGNKVRHIRIVTVPPH
VARRVLREFALQVPVGVRFAKSAGLVRQGTPDEFEGLAGTLSVFRFDPD
169630083YP_001703732.1 hypothetical protein MAB_3000 [Mycobacterium abscessus ATCC 19977]MTILVTGATGNVGRPLVDLLVAAGADVRAVTQHPERASFPPQVATVASAR
AGLDGVTAVFLNSRALGEDLDRFVNQSAREGVTRLVALSAINCDDDFSRQ
PSRFRGDRNKEVEQYAAGSGLQWVSLRPTVFASNFLGMWGTQLQAGDVVR
GPHAAASAAPIADSDISEVAARALLTDELLGQRIPLTGPQAFTNAGLVAV
LGDVLGRPLEYQQVSDDLVRQRFGRLGFPAGFADAYLAMQAATVTEPAIV
THDVDRILGRPAETFASWANRFRTRFAPAEFAAQKG
169630082YP_001703731.1 RNA polymerase sigma factor SigI [Mycobacterium abscessus ATCC 1997MSSSSTHDALVTAAWREHYPYLVNLAYQMLGDIGDAEDAVQEAFVRLARA
EETEIDEPRAWLSVVVGRLCLDQLRSARMRRERTGVASVVESAAPLHVPA
VTDPADRVTLDDEVRGALLEVLRSLSPGERVAFVLHDVFAVPFEEIASTV
GRPVGTCRQLARRARTRFQQSAARSTDVTGAEHQQLIEKFVTACAQGDLT
GLMAVLDPGVWGVGTILGDPAPPPQVNRGRTDVATNLLVYLGPGATLVGG
PFGQPVLLAFTQRRLFAVVTLTVREGLVLKIEATADPAARGR
169630081YP_001703730.1 hypothetical protein MAB_2998 [Mycobacterium abscessus ATCC 19977]MPGTGSDDDFINRAFGPALTQVGATLIAVRPEPDDLVNGYRRALNQAAQL
GPIVVGGVSIGTAVALTWALQNPEATVAVLAAMPAWTGAPENSPASVSAR
VTAESLRSDGLAAVTAAMQASSPAWLAAELTRSWAVQWPGLPHAMEEVSA
FVNPSAAEIRALSVPMAVAAATDDPIHPLEVGRDWAAWAPRAALRTFTLD
QLGADPACLGRACIAALADI
169630080YP_001703729.1 hypothetical protein MAB_2997c [Mycobacterium abscessus ATCC 19977]MATTGGYLRRLTRRLTEDLEQVDAEKIGDDAAATGAQRVIDCQRGQEVTM
CGTLRTVETNSKGCVAGVKAELFDGTDTVMLVWLGQRRIPGIESGRTLLV
RGRLGKLENGGKVIHNPYYEIQR
169630079YP_001703728.1 hypothetical protein MAB_2996c [Mycobacterium abscessus ATCC 19977]MPETPSHEPDGSGGLDAHEGPHLKISVPGTKPEEPGSSPLHEMWHQAGGW
QGIVYSSIPVIVFVVAVSVSSLIPAIISALVAATLVLIWRLVRRESVQPA
VSGFISVGISALIAYLLGEAKGYFLIGIWANFFWGTVFLVSVIIRRPIVG
YAYSWATGGDMSWRGNRRIVTAFDIATVSWIVLFAVRFVVQEWLYLAGNT
AWLGGAKIAMGWPLTAVGALVTLLVIRYVRRHTDQAEDRAPESEPPA
169630078YP_001703727.1 Trk system potassium uptake protein CeoC [Mycobacterium abscessus AMKVAIGGAGAVGRSIARELIESRHEVTLLERNPDHIDPEAVPEAQWRLGD
ACEISLLEAEELHTFDVVIAATGDDKANLVLSLLAKTEFAVARVVARVND
PRNEWLFDDAWGVDVAVSTPRMLASLVEEAVAVGDVVRLMEFRKGQANLV
EITLPDDTPWGGKPVRKLELPRDAVLVAILRGSRVIAAQPDEPLEGGDEL
ILVATADIEDELHRAVLPE
169630077YP_001703726.1 Trk system potassium uptake protein CeoB [Mycobacterium abscessus AMRVVVMGCGRVGAALAGGLARIGHEVAIIDKEAAAFNRLGPEFTGERIVG
MGFDRDVLLRAGIERAQAFAAVSSGDNSNIISARAARETFGVERVVARIY
DAKRAAVYERLGIPTVATVPWTTDRLLHALTRESDTTKWRDPSGSVVVTE
LALHEDWIGKRVTALEAATGARAAFIIRFGTGVLPDAKTVIQDSDEVYVS
AVSGRAAEAMAIAAQPPGEDADDDHGGAR
169630076YP_001703725.1 hypothetical protein MAB_2993c [Mycobacterium abscessus ATCC 19977]MLAFVSTLSKLSTAARRLVIGRPFRSDSLGHTLLPKRIALPVFASDALSS
VAYAPEEIFLVLSVAGMSAYAMTPWIGLAVAAVMMVVVASYRQNVHAYPS
GGGDYEVVTTNLGPTAGLTVGSALLVDYVLTVAVSMSSAMSNIGSAIPLV
AQHKVTFAVAAIVILMSMNLRGVRESGAAFAIPTYAFMIGMYLMLGWGLF
QIYVLGTPLRAESASFEMHGEGNGILGFALVFLVARAFSSGCAALTGVEA
ISNGVPAFRKPKSRNAATTLLLLGGIAITLFMGIILLAERTGAKIAEDPT
RQLSGAPADYHQKTLVAQLAEAVFGDFRIGFLFITVVTALILVLAANTAF
NGFPVLGSILAQDRYLPRQLHTRGDRLAFSNGIIFLSAVAILFVVAFKAE
VTALIQLYIVGVFVSFTLSQIGMVRHWTRLLKTETDPAVRRKMMRSRVIN
TIGFIMTGTVLLVVLVTKFLAGAWIAILAMGLLFVLMKMIHKHYNTVARE
LDNHEGEVVLPSRTHAVVLVSKVHQPTLRALAYARATRPDVLEAVTVSVD
DRDTRELVREWETSDISTPLKVIASPYREITRPILDYVKRISKEAPRTVV
CIFIPEYVVGHWWEQVLHNQSALRLKGRLLFVPNVMVTSVPWQLDSSERR
RELDRQSAPGDSRRGFDS
169630075YP_001703724.1 hypothetical protein MAB_2992c [Mycobacterium abscessus ATCC 19977]MTIGDILEVHTGGAANGGSVVARHDGRVIFVRDALPGERVRVQITDDRQA
SFWHGAAVEVLDPSPHRIEPLCPIAHSAVGSGCCDLSFADPVYVRELKGD
VVSQQLARLGKYEWQGVAQPLGAGDPTGWRTRVRLDVNALGQPGFHRYHS
DELVTDLRCAQVVPGLLDGLDQPELGSEGPLHAVMDDQGRRHVLRGSTIV
EGEDVAVQKVGDRHWLVPVTAFWQAHRDAAGTYSRLVSDWAELEPGMSAW
DLYGGVGVFAAALGEAVGRTGHVVSVDTSRPAFRSAKSALGDLRQVTMIC
GSVRHAIRDLGEADVAVLDPPRAGAGREVIGKVAAANVSRVIHIGCEAAA
FARDVGLYLERGYRVRELRVFDAFPLTHHIESFALLTR
169630074YP_001703723.1 Na+/H+ antiporter NhaA [Mycobacterium abscessus ATCC 19977]MRLSQRVFTRGSWAESSRVAEILRKETVGGVLLVVAAVAALLWANSPWSS
WYYRLGAITVGPEQLHLHLTLAGWATDGLLAIFFFVVGVELKREFVAGDL
RDPGRAALPIVAAVGGMLVPAAIYLAVNASGGGAAMRGWAIPTATDIAFA
LAVLAVISTHLPTALRTFLLTLAVVDDLLAVIVIAVFYTDELHWGPLGLA
LVPLGLFALAVQRRRREWWLLVPLAVATWALVHASGVHATVAGVLLGFTV
PVLRRDGRTDAHGMAEQFEHRLRPLSAGVAVPVFAFFAAGVTLGGFAGLG
QALLDPVALGVVLGLLVGKPVGVFLTTYLLARFTRASLDDDLSWLDIAGV
ALLAGIGFTVSLLIGELAFGAAESATSGVGAETASHVKVGVLAGSLTSAA
VASVVLRLRNRVYQRIEAKETLDADHDGVPDVFGSAPGDRI
169630073YP_001703722.1 1-deoxy-D-xylulose-5-phosphate synth