Antigen browsing page


The page has been created to visualized all the protein sequence their gene ID and protein ID from NCBI from selected strain. The strain can be selected from the option given in the form and then click submit to display all the proteins and their corresponding information available in our database. The output will be presented in a tabular format where Gene ID is linked to display an antigen card. If you click on gene ID of a proteins, the number of epitopes mapped and/or predicted will be displayed in result page.

Please select a strain:

Selected strain is M_avium_104
Gene IDProtein IDProtein DetailsSequence
118466551YP_880709.1 hypothetical protein MAV_1467 [Mycobacterium avium 104]MQISNLANAFHAAGRSTAEADTTFAQARSRFDAAWNHQDGDHPINDSAEV
ERVTKSLGAQSVQLPKIGADLENIAASLAEAQKAAAGQIGTLEAQLKGLD
EMIAEAVEIETTHPELSAADRDALNGYITSLEDDAIRDTKAALAQLQATR
DGYSNTLQKALGNLKSDGYDPAGIRAQEGPLSPAPPLPDDPTQFTQVWNS
LTQEQKDAEYARDHFIGNHPGMPFPDRDHYNRMHLPELQNANQADLDRLR
AAHPDWANGKTPFLKTNEYLDWRRQWDAANRARDGYSKVKNEMGPPPDKV
QPGEIPKYLGIIDDKGHAAVSLNNPDTAKRNATFVPGTGQDLTRFDASAD
KSRAMLQATMNADKSLQPGDVSVTTWMGYDRPMNVFEAASTSYAHNGAAA
LDDFQAGVRASHNDAVTGGRPSLNTVIGHSYGSTEVGAAALNGHHLDADN
VIAVASPGMLTGHASDLNLDPGSHVFATRAQNDIIGVVTGMTLGPDPTGA
SFGGTPFEAAPGKAWPFGLPSIGAHGSYWDNMSNPALINMGRIIAGRTDV
TPPTFTP
118466550YP_882743.1 hypothetical protein MAV_3565 [Mycobacterium avium 104]MYGALVTAAESTGLRDWIQAAFRPRTSAPSVATVLRSALWPIAIFSVLHR
SIVVTTNGNITDDFKPVYRAVLNFRRGWDIYNEHFDYVDPHYLYPPGGTL
LMAPFGYLPEYPSRYLFILINTVAILIAWYLLLRLFGYTLSSVAAPALLL
AMFCTETVTNTLVFTNINGCVLLAEMLFLRWLLDGRVGRQWWAGVAIGLT
LTLKPVLGPLLLLPLLNRQWRALVPAFAIPILINAAAWPLVSDPMDFVTR
TLPYIGGVRDYFNSSIEGNGVYFGLPTWLIVFMRILFTLIAIGALWLLYR
YYRTRDPRFWFTNSAGVLLLWSWLVLPLAQGYYSMMLFPFLMTVVLPNSL
IRNWPAWLGIYGFMTLDRWLLFNWMRYGRALEYLKITYGWSLLLIVVFSV
LCYRYLDAKAEDRLDRGIDPAWLTAGRE
118466549YP_880269.1 hypothetical protein MAV_1011 [Mycobacterium avium 104]MDSRARLRLMKDETVPWATGLTVTAFVAAVTGVAIVVLSLGLVRVHPLLA
VGLNIVAAGGLAPTLWGWRRTPVLRWFVLGAGVGVTGAWLVLLVLAVAG
118466547YP_882631.1 hypothetical protein MAV_3449 [Mycobacterium avium 104]MFDCERVGLDFIDSAPVVFRNSVDLAITPEQLFEVLSDAAAWPRWATVIT
KVTWTSPEPRGVGTTRVVEMRGGIVGNEEFLAWEPFTHMAFRFNECSTRS
VAAFAEDYRVQVIPGGCRLTWTMAQKPAGPAKLAMAVVGPLLNLALRRFL
RNLRSYTDSLATRQP
118465081YP_880386.1 hypothetical protein MAV_1134 [Mycobacterium avium 104]MMETAFRRAMPADAVPQPRRTVAAGRGSARATAAARTRKIVLVVGVCLAL
LLDGCGQRGDLGPLSLIVSPAIPLSVQDVPNPLRGQYEDLLQPLFPQGNP
AQRRYPAWPASQDASLRVPWRQLQPTDPSSLPPDAPDDRKFDFSVIDDAL
AKLASRNMRLTLRVVAYNSCCDTVYPNNTNIAMPDWMRPAATNYTGPQRY
WWSPGVTQVVPNWNDQNYLNAFGQLLAALGRRYDGDERLSVFEFSGYGDF
SENHISYLRDSLGAPGPAPDESVAKLGYFSQFRDQNITAGSIRLLVEATV
KAFPHTQLVTTALNPEIVRQLIADDVTKRLSAPVGIRADCLGVQDPLPAW
AERDGSHYVQTKDPLVGALRDRMAAAPVITEWCQLPAGTDPRSYYEKGLR
DVMKYHVSMTSSFNFPAVDASTPMDPALYLLWAQANVVAGYRYSAEARQG
SQSLADGKATLDVTWTNYGSAAATENWVPGYRLVDFSGAVVRTLPARVTL
KTLVPGPDGAGKEPAPVSSVETVHIDLAGVAPGHYTLCAAVGWQQHKPGA
EHVVNYPPMRLARDGRDGNGCYPLATLNLAREASTA
118465080YP_884163.1 hypothetical protein MAV_5044 [Mycobacterium avium 104]MTAFGVAGLLAWPVAADPAPEVEQAVNAARGHCGPLRDDPRVAQAAEIVN
RSTFKYLNHTAENVPADDPHPTAILKDLGVQGSKAYSLLGAGHSEDVALK
SALLEGYKVLPDCGYTDVGTSVLREDESGYVLVAAVLVGP
118465077YP_881416.1 hypothetical protein MAV_2208 [Mycobacterium avium 104]MASLNLSPPAARYHGDQAVAPGMLDFAVNVRHSRPPQWLLDRLAARLPDL
ARYPGDDDVHRAQDAAAERHGRRRDEVLPLAGAAEAFALLSNLRPKRAAV
IAPSFTEPAAALSAAGVPVHHVVLEPPFGLHGAAVPEEADLVVVGNPTNP
TAVLHGREQLLALRRPGRLLVVDEAFADAIPGEPQSLAGDALPDVLVLRS
LTKTWALAGLRVGYALGAPEVLARLTAQRAHWPVGTLQLTALAACCGRRA
VADAAAGAERLSRLREKMAAGLASVGADVLDGRAPFVLFRMPDAVRVRKL
LHDKGIAVRRGDTFVGLDERYLRAAVRPEWPLLVQAIAEAQR
118465075YP_881766.1 hypothetical protein MAV_2575 [Mycobacterium avium 104]MIVVKAADSLDDLHCGGRPMLPLDAERRADATLDPAFADGTTMGKRYVDD
GDAEVLVTKAGAGSLSVGGKPLALKEAKPLPASD
118465074YP_882998.1 thiamine monophosphate kinase [Mycobacterium avium 104]MRDESTLRQLGEFGVIDRLVAGRRQPAAVTLGPGDDAALVTTGDGRVVVS
TDMLVQDRHFRLDWSTPHDIGRKAIAQNAADIEAMGARPTAFVVGFGAPG
QTAAAQVDALVDGMWDEAQRVGAGIAGGDLVSCPQWVISVTALGELDGRS
PVCRAGAEPGALIAVAGDLGRSAAGFDLWRNQIGGFDELRRRHAVPQPPY
GQGAVAAAGGAQAMIDVSDGLIADLRHVAEASGVGMDVSTAALAADRDAV
AAAAAAVGVDAWPWVLTGGEDHALVACFPGPAPAGWRIIGRVLDGPARVL
VDEREWSGPAGWQSY
118465073YP_881185.1 hypothetical protein MAV_1965 [Mycobacterium avium 104]MTVTAVTVRHTWQGTTSHVHLDVDYAEPDTQLPRHLFLKSQLSTVHDLPE
AVDVSLSEGGGGTVLLDDETRFYRDLRSDLDIETMTTYFADYLNGPSQFL
ILGEDITLRGAQVPDAVAGLSVEQVDQLLTTLGRVHAAYWGSPRLEDGGD
LSWLQHPLTGGFADFLRINGFAIIRAFLEIPYKQALLDSAGADADAMEAT
FWKLQERVARDPITLLHGDPHPRNTYALPDGTMGVLDWQLVRRGSWSHDV
GYALIGALPPDLRRAHERELLDNYRGRLVDAGVTSVPDREQMWTAYRESP
AWGFCMWAITPDQMYSVDIVTAVLGRFAEAYSDLGTGKLLCS
118464320YP_883983.1 hypothetical protein MAV_4861 [Mycobacterium avium 104]MAPDLDPFDPPIPVPDVPGADVPPGAGGLPPTSALSPRQRMVVEASALGD
LALRTWVASLLSTTVAPFVVANALRHADAATERANLEFYAELGAAADPDR
SFPPPTEPPRVTSRRASPLAEWVARGTVDNLAFDSSFTAVNPAMRARWSG
WGRNNVVRAQHWRHDDGPRPTLCVIHGFLGSSYLANGRFFSLPWYYRAGY
DVLMYTLPFHGKRAERFSPFSGFGYFAGGLSGFAEAMAQAVHDFRSLIDY
LRHTGVERIALTGISLGGYTSALVASVDDRLEAVIPNCPVVTPATLFDEW
FPANKLVGLGLRSSDISRAQLAAGLAYHCPLTYRPLLAKDRRMIITGLGD
RMAPPEHAVKLWQHWDHCALHWFPGSHVLHISQLDYLRRMTAFLQQVMF
118464318YP_880090.1 hypothetical protein MAV_0817 [Mycobacterium avium 104]MPSNNEAVAKLIADNLHNLTIPGPDGQPVRYRLLSHSTVGHSPEMADKIN
RRALDVARAIVHHITSAGYTISHPNDPAPTDNLGPYLVATAYCAHCACAI
HTLTNLQLDPNRPDHFTAKLYRQGIEAIGHNHRCWE
118464316YP_880658.1 hypothetical protein MAV_1416 [Mycobacterium avium 104]MKAHHAHRRYGRPGGWQQAQQPDASDAAEWFAGRLPEQWFDGDPTVIVDR
EEITVIGKLPEPADAEKEASEARTAGRASRFREETRSERMRIADEAQDRY
GRKVSWGVEVRSKTGTERILFTHIAVPVMTRLKQPERQVLDTLVDAGVAR
SRADALAWSVKLVGEHAEEWLAQLRDAMSAVDDLRAQGPDL
118463964YP_879603.1 phosphotransferase enzyme family protein [Mycobacterium avium 104]MTSADQLEGLDLAALDSYLRSLGIGRDGELRAEFISGGRSNLTFRVYDDA
TSWLVRRPPLHGLTPSAHDMAREYRVVAALQDTPVPVARTIGLCEDESVL
GAPFQIVEFVAGQVVRRRAQLESFSHTVIEGCVDSLIRVLVDLHSVDPDA
VGLADFGKPSGYLERQVRRWGSQWALVRLPEDRRDADVERLHSGLGQAIP
QQSRTSIVHGDYRIDNTILDADDPTKVRAVVDWELSTLGDPLSDAALMCV
YRDPALDLIVNAQAAWTSPLLPTADELADRYSLVAGIPLAHWEFYMALAY
FKLAIIAAGIDFRRRMSDQARGLGEAAEHTPEVVAPLISRGLAELAKLPG
229220810YP_883328.2 3-phosphoshikimate 1-carboxyvinyltransferase [Mycobacterium avium 104]MTTWAAPLAPQPVHATVTVPGSKSQTNRALVLAALAAAQGRGTPTLSGAL
RSRDTDLMIGALRTLGLRVDGTGPELTVSGHIAPGPHARVDCGLAGTVLR
FVPPLAALADAVVEFDGDEQARARPIAPLLDALRGLGVRIEGTALPFRVH
GGGALAGGTVAIDASASSQFVSGLLLCAASFTEGLTVQHTGAALPSAPHI
AMTVAMLRQAGVDVDDSVPNRWQVRPGPVAARHWEVEPDLTNAVPFLAAA
VVSGGTVRITGWPADSVQPADNILSVLSKLNAVVSQTDSSLEVRGSGSYD
GFDVDLRAVGELTPSVAALAALATPGSVSRLSGIAHLRGHETDRLAALSA
EINRLGGDCTETPDGLVITATPLHSGVWQAYADHRMAMAGAIVGLRVAGV
RVDDIGATGKTLPDFPRLWARMLDTSLPDGEEHGM
229220809YP_882610.2 shikimate 5-dehydrogenase [Mycobacterium avium 104]MSSTAPPASGDRKRGGAGRSGSPPGQAAGPRRAAVLGKPIAHSKSPQLHL
AAYRALGLHDWTYERIECDADQLPGVVGGFGPEWVGVSVTMPGKFAALRF
ADERTERARRVGSANTLVRTATGWRADNTDIDGVAGALGAASGWALVCGS
GGTAPAAVAGLAQLGVAGITVVARNPDKAARLVRLGDELGVPTRFCALDG
AGLADEVAAAEVLVSTLPAEVAERYAGTLARVGVLLDAVYDPWPTPLAAA
VSAAGGRVISGMQMLLHQAFAQVEQFTGLPAPREAMTCAAADAD
229220808YP_883568.2 adenylate kinase [Mycobacterium avium 104]MRVVLLGPPGAGKGTQAQKLSEKLGIPQISTGELFRSNIENGTKLGLEAK
RYLDAGDLVPAELTNQLVDDRLSEPDAANGFILDGFPRSLQQAKALHEML
ERRGTDIDAVLEFRVSQDELLARLKARGRADDTDEVILNRMKVYRDETAP
LLDYYRDQLKTVDAVGTLDEVFARALRALGK
229220807YP_882839.2 dihydrodipicolinate reductase [Mycobacterium avium 104]MRVGVLGAKGKVGSTMVAAVQAAEDLTLSAEVDAGDPLSLLTDGGTEAVI
DFTHPDVVMGNLEFLVRNGIHAVVGTTGFTAERLAQVREWLVDSPGTSVL
IAPNFAIGAVLSMHFAKQAARFFDSAEVIELHHPHKADAPSGTATRTAKL
IAEARKGLPPNPDATSTSLPGARGADVDGIPVHAVRLAGLVAHQEILFGT
EGETLSIRHDSLDRTSFVPGVLLAVRRIREHPGLTVGLEPLLDLG
161579556YP_884276.2 methionine sulfoxide reductase A [Mycobacterium avium 104]MTNTQKAILAGGCFWGMQELIRKQPGVVSTRVGYTGGDVPNATYRNHGTH
AEAVEIIYDPAVTDYRQILEFFFQIHDPTTKDRQGNDRGPSYRSAIFYTD
DEQKRIALDTIADVEASGLWPGKVVTEVSPAGDFWEAEPEHQDYLQRYPN
GYTCHYIRPGWKLPRRATSGS
161579555YP_883998.2 50S ribosomal protein L33 [Mycobacterium avium 104]MPRNEIRPLVKLRSTAGTGYTYITRKNRRNDPDRLVLRKYDPVVRRHVDF
REER
161579554YP_882511.2 glucose-6-phosphate 1-dehydrogenase [Mycobacterium avium 104]MSPARTAQQWHNPLRDKRDKRLPRIAGPCGMVIFGVTGDLARKKVMPAIY
DLANRGLLPPSFSLVGFARRDWSTQDFGKVVYEAVKEHCRTPFRQENWDR
LAEGFRFVPGAFDDDEAFGRLAETLDKLDAERGTGGNHAFYLAIPPKSFP
VVCEQLHKSGLARPQGDRWSRVVIEKPFGHDLESAQSLNKAVNAVFPEES
VFRIDHYLGKETVRNILALRFANQLFDPIWNSHYVDHVQITMAEDIGLGG
RAGYYDGIGAARDVIQNHLMQLLALTAMEEPVSFSPLALQAEKIKVLSAT
HLAHPLDETTSRGQYTAGWQGGEKVVGLLDEEGFAKDSITETFAAITLEV
DTRRWAGVPFYLRTGKRLGRRVTEIALVFKRAPHLPFDATMTDELGANAM
VIRVQPDEGVTLRFGSKVPGTAMEVRDVNMDFSYGSAFAEESPEAYEQLI
LDVLLGEPSLFPVNAEVELAWHILDPVLDNWASGGRPEPYEAGTWGPDSA
FEMLHRTGREWRGHDTQR
161579553YP_879906.2 acetaldehyde dehydrogenase [Mycobacterium avium 104]MPTKAKVAIVGSGNISTDLLYKLLRSDWLEPRWMVGIDPQSEGLARARKL
GLETTHEGVDWLLAQPEKPDLVFEATSAYVHRDAAPKYEAAGIRAIDLTP
AAVGPAVIPPANLRQHLDAPNVNMITCGGQATIPIVYAVSRVVEVPYAEI
VASVASVSAGPGTRANIDEFTKTTSRGVETIGGAKRGKAIIILNPADPPM
IMRDTIFCAIPEDADRDAIAQSIHDVVKEVQSYVPGYRLLNEPQFDDPSL
NSGGQALVTTFVEVEGAGDYLPPYAGNLDIMTAAATKVGEEIAKETLSVA
GGTR
161579552YP_883621.2 short chain dehydrogenase [Mycobacterium avium 104]MSGQAGSLQGRVAFITGAARGQGRSHAVRLAAEGADIIACDICAPVSASV
TYAPASPEDLDETARLVEDQGRKALTRVLDVRDDAALRELVADGMEQFGR
LDVVVANAGVLSWGRVWELTDEQWDTVIGVNLTGTWRTLRATVPAMIEAG
NGGSIVVVSSSAGLKATPGNGHYSASKHGLTALTNTLAIELGEYGIRVNS
IHPYSVETPMIEPEAMMEIFARHPSFVHSFPPMPVQPNGFMTADEVADVV
AWLAGDGSGTLTGTQIPVDKGALKY
161579551YP_879904.2 3-ketosteroid-delta-1-dehydrogenase [Mycobacterium avium 104]MSAQEYDVVVVGSGGAGMVAALTAAHRGLSTIVIEKAPHFGGSTARSGGG
VWIPNNEVLKRDGVKDTPEAARTYLHGIIGDVVEPERIDTYLERGPEMLS
FVLKHTPLKMCWVPRYSDYYPESPGGRAEGRSIEPKPFNARKLGPDEAGL
EPAYGKVPLNVVVMQQDYVRLNQLKRHPRGVLRSLKVGARTMWAKATGKN
LVGMGRALIGPLRIGLQRAGVPVVLNTALTDLYLEDGVVRGVYVRDSQAA
ESAEPRLIRARRGVILASGGFEHNEQMRVKYQRAPITTEWTVGAKANTGD
GILAAEKLGAALELMEDAWWGPTVPLVGAPWFALSERNSPGSIIVNMSGK
RFMNESMPYVEACHHMYGGEYGQGPGPGENIPAWLVFDQQYRDRYIFAGL
QPGQRIPRKWLESGVIIQAETLEELASKAGLPVDEFLATVQRFNGFARTG
IDEDYHRGESAYDRYYGDPTNKPNPNLGEISHPPYYAAKMVPGDLGTKGG
IRTDIHGRALRDDGSIIEGLYAAGNVSAPVMGHTYPGPGGTIGPAMTFGY
LAALHIAGEN
161579550YP_881400.2 3-oxoacyl-(acyl carrier protein) synthase II [Mycobacterium avium 104]MRAATARKVAGQVREGIFARPMTELVTGKTLPNVVVTGIAMTTALATDAE
TTWKLLLDSQSGIRTLDDPFVEEFDLPVRIGGHLLEEFDSQLTRVELRRT
GYLQRMSTILGRRVWENAGSPEVDSNRLMVSIGTGLGSSEEMVFSYDDMR
ARGMKAVSPLGVQKYMPNGAAAAVGLEHHAKAGVITPVSACASGSEGIAQ
AWRNIVFGEADIAICGGVETKIEAVPIAAFAQMRIVMSTKNDDPVGACRP
FDRDRTGFVFGEAGALMVIETEEHAKARGANILARIMGASITSDGYHMVA
PDPNGERAGHAMSRAIQLAGLTPGDIDHVNAHATGTSVGDVAESKAINNA
LGPHGGNAAVYAPKAALGHSVGAVGAVESILTVLALRDQVVPPTLNLENL
DPEIDLDVVAGKPRPGNYQYAINNSFGFGGHNVAIAFGRY
161579549YP_881401.2 3-oxoacyl-(acyl carrier protein) synthase II [Mycobacterium avium 104]MSKPSTANGGYPSVVVTAVTATTSIAPDVESTWKGLLAGESGIHVLEDDY
ITKWDLPVRIGGHLKEPIDERMSRLDLRRMSYVQRLAKLLSTQLWETAGN
PELDPDRFSVVVGTGLGGAERIVESYDLMNEGGPRKVSPLAVQMIMPNGA
AAVVGLQLGARAGVITPVSACSSGSEAIAHAWRQIVMGDADVAVCGGVEG
PIEALPIAAFSMMRAMSTRNDEPERASRPFDKDRDGFVFGEAGALMLIET
EEHAKARGAKPLARLMGAGITSDAFHMVAPAADGVRAGRAMTRSLELAGL
SPKDVDHVNAHGTATPIGDTAEANAIRVAGCQEAAVYAPKSALGHSIGAV
GALESVLTVLTLRDGVIPPTLNYETPDPEIDLDIVAGEPRYGDYQYAINN
SFGFGGHNVALAFGRY
161579548YP_882885.2 malate:quinone oxidoreductase [Mycobacterium avium 104]MSSLARTTRTDVVLVGAGIMSATLGALLRRLQPDWSMTFVERLDAVAAES
SSPWNNAGTGHSALCELNYTPQRADGSIDIAKAVRINEQFQVTRQFWAYA
VEDGMLTDRGFVTPIPHASFVRGARAVEYLRRRQQALAPNPLFAGIELIE
DADEFARRLPLMADRRDFSEPTALNWARHGTDVDFGALSRQLIGFCVRGG
ATALFGHQVHNLTRESDGSWTLLIRNRRTGEKHRCNAKFVFVGAGGDALP
LLQKSGIGEARGFAGFPIGGRFLRADNPVLTAAHRAKVYGAPAPGAPPLG
ALHLDLRYVNGKPWLVFGPYAGWSPKFLKHGHFTDLPRSVRPHNLVALLG
VGVTQLTLLRYLIGQLRLSAPDRMRMLREFAPTAVDSDWELTVAGQRVQV
IRRDRRRGGVLDFDTTVVAAGDGSIAGLLGGSPGASTAVPIMLDVLQRCF
ADRYRSWLPALKEMVPSLGVTLSDEPALYEEVYSWGTKILGLDELDEERP
K
161579547YP_881965.2 fatty-acid--CoA ligase [Mycobacterium avium 104]MDDALRRDDGVPGLLRIEDCLDADGGVALPPGVNLISLIDRNIANVGDTV
AYRYLDYSGSDDGTAHEVTWSQFGVRLEAIGARIQQVASRGERVAVLAPQ
GIDYVAGFYAAVKAGTIAVPLFAPELPGHAERLDTALRDSQPSVLLTTTV
ARDAVEQFLAGHPHLHRPRVIAIDEIPDSAAESFAPTELGMDDVSHLQYT
SGSTRPPVGVEITHRAVGTNLVQMILSIDLLDRNTHGVSWLPLYHDMGLS
MIGFPAVYGGHSTLMSPAAFVRRPQRWIKALSDGSRHGNVVTAAPNFAYE
WAAQRGLPGGGEDIDLRNVVMIIGSEPVSMDAIRTFNKAFAPYGLPRTAF
KPSYGIAEATLFVATIAPRAEATAVYFDRRQLGAGHAVRVPANAPDAVAA
VSCGQVARSARAGIVADGAELPDGQVGEIWLHGNNIGRGYWGMPEETRRV
FGATLRSRLPDGSHAAGADPDGSWLRTGDLGVYLDGELYVTGRIADLVRI
DGRNHYPQDIEATVAEASPMVRRGYVTAFSVPAVDDPEAGRLVVVAERAA
GTSRQDPRPAIEAIRAAVAQRHELAVADVRLLPAGAIPRTTSGKLARRAC
RAQYLDGSLGTR
161579546YP_882485.2 aconitate hydratase [Mycobacterium avium 104]MTDSVNSFGARNTLKVGDKSYQIYRLDAVPNTEKLPYSLKVLAENLLRNE
DGSNITKDHIEAIANWDPKAEPSIEIQYTPARVVMQDFTGVPCIVDLATM
REAIADLGGNPEKVNPLAPADLVIDHSVIADLFGTADAFERNVEIEYQRN
GERYQFLRWGQGAFSDFKVVPPGTGIVHQVNIEYLARVVMERDGVAYPDT
CVGTDSHTTMVNGLGVLGWGVGGIEAEAAMLGQPVSMLIPRVVGFKLTGE
IQPGVTATDVVLTVTEMLRKHGVVGKFVEFYGEGVAEVPLANRATLGNMS
PEFGSTAAIFPIDQETIDYLKFTGRNAEQVALVETYAKEQGLWHDPAHEP
AFSEYLELDLSQVVPSIAGPKRPQDRIALSQAKSVFREQIPSYVGDGDGQ
QGYSKLDEVVDETFPASDPGAPSNGHADDLPAVQSAAAHANGRPSNPVTV
RSDELGEFVLDHGAVVIAAVTSCTNTSNPEVMLGAALLARNAVEKGLASK
PWVKTTMAPGSQVVHDYYDKAGLWPYLEKLGFYLVGYGCTTCIGNSGPLP
EEISKAINDNDLSVTAVLSGNRNFEGRINPDVKMNYLASPPLVVAYALAG
TMDFDFEKQPLGKDKDGNDVYLKDIWPSQKDVSDTIASAINSEMFTKNYA
DVFKGDERWRNLPTPSGNTFEWSPDSTYVRKPPYFEGMPAEPEPVADISG
ARVLALLGDSVTTDHISPAGSIKPGTPAAQYLDEHGVDRKDYNSFGSRRG
NHEVMIRGTFANIRLRNLLLDDVAGGYTRDFTQDGGPQAFIYDAAQNYAA
QNIPLVVLGGKEYGSGSSRDWAAKGTRLLGVRAVIAESFERIHRSNLIGM
GVIPLQFPDGKSAKDLGLDGTEVFDITGIEELNKGKTPKTVHVKASKNGS
DAVEFDAVVRIDTPGEADYYRNGGILQYVLRNMLKSG
118467339YP_879487.1 seryl-tRNA synthetase [Mycobacterium avium 104]MIDLKLLREDPDAVRRSQQSRGEDPSLVDALLAADAARRAAISTADTLRA
EQKSASKSVGAASPEQRPALLARAKELAEQVKAAETAQAEAEAAFTAAHL
AISNVVIDGVPAGGEDDFAVLDVVGEPTALENPRDHLELGESLGLIDMAR
GAKVSGSRFYFLTGKGALLQLGLLQLALRLAVENGFVPMIPPVLVRPEVM
AGTGFLGAHAEEVYRIEADDLYLVGTSEVPLAGYHADEILDLSAGPLRYA
GWSSCFRREAGSYGKDTRGVIRVHQFDKVEGFVYCTPADAEAEHQRLLGW
QREMLARIEVPYRVIDVAAGDLGSSAARKFDCEAWVPTQQTYRELTSTSN
CTTFQARRLSTRYRDGGDAKGKPQIAATLNGTLGTTRWLVAILENHQRPD
GSVRVPEALVPFVGTELLEPVGPRG
118467338YP_879670.1 KanY protein [Mycobacterium avium 104]MGQVSADSTILINADPAATLAAVADYQTVRPKILSPQYSDYQVLQGGQGA
GTVAKWKLQATKSRVRDVQVDVDVAGHTVIEKDANSSMVTNWTVAPAGPG
SSVTVKTTWTGAGGVKGFFEKTFAPLGLKKIQGEVLANLKRELES
118467337YP_881780.1 hypothetical protein MAV_2589 [Mycobacterium avium 104]MESTDRPAEDAGRNKVDEDDHDLLTFGEAGERLRLEIAAAAREVQGLQQS
GPVEALEKAQARLDALRSAAARNSAQPINDANFEKFFGYPGKAKRNLPGA
PSAR
118467336YP_879638.1 short chain dehydrogenase/reductase SDR [Mycobacterium avium 104]MSYSHPDSMRGQVAIVTGAAQGVGKGIAAALLERGAAVLLVDIQQETLEA
TAAELRALGRVERLVTDLRDPDSAPRIAAAAVDAFGSVHGLVNNAIATNE
PKAFVDITTDDLALGYEVGPRATFLLMQAVHPLLVKEGGGAIVNLGSGTG
TGGEPRWGGYAAAKEGIRGLSKVAALEWGRDNIRVNVVCPFAESDGVKLW
KQFAPNDYAKAVGRVPMKRIGDVRTDVGALVAFLLSTDATFITGQTIHVD
GGIGCFR
118467335YP_883106.1 phosphotransferase enzyme family protein- putative [Mycobacterium aviuMSSAEPDLDVLRGRLAGAGITALTPLSGGASGLTFAGIRDGRPVVIKVAP
PGVAPVGHRDVLRQARIIKALAPTDVPVPRVCWEDAGRPPYTPPLYVMSR
VEGDCGEPLFDGWPAVPGLADRYRNACRTMAALHRIPPTELGLGGEPVID
PVAEVHRWSDTLGTVDPALAPGWPKVRDALLDCAPRAMPPAVVHGDFRLG
NLLADGPRINAVIDWEIWSIGDPRIDVGWFLINCDPDTYRRVTPSDGAVP
STAELADLYLHELGCDAGDLDWFSALACFKSAATWSLIVKHNRRRSSPRA
ELESMTTTLPRLLDRAGALLARRR
118467334YP_880935.1 hypothetical protein MAV_1706 [Mycobacterium avium 104]MAQQAPAKNKADFWFDPLCPWAWITSRWILEVEKVRDIEVNFHVMSLAVL
NENREGLPDEYRERLAKAFGPVRVAIAAEQAHGAEVLAPLYTAMGTRIHN
EGNKDLTDVIKQSLAEVGLPAELAEAADTDAYDDALRKSHHAGMDPVGDD
VGTPTIHVNNVAFFGPVLSRIPRGEEAGKLWDASVTFASYPHFFELKRTR
DEKPEFD
118467333YP_879364.1 AP endonuclease- family protein 2 [Mycobacterium avium 104]MTGAHKRLSVHNVTFYGAPPAALQAHWAALGVSRLSILDNQLLDPQLPML
LGRNDYTVEAVYHLFAGGRLTSDPGAAREALIAVIDAAASVGAHTVYLLT
GGRAGLTWPQAAERFAAMVAPCAARAKAAGVVLAIENASSLYADIHIAHT
LRDTVALAEMSDLGICIDLFHCWAEGDFEAQLPRALPRTALIQLSDYVLG
DRALPGRAVPGDGAIPIEAFVAQALAVGYAHGFDLELIGPRIEREGRLES
ARRACDVVGAMLDKLGG
118467332YP_881632.1 cobaltochelatase subunit CobN [Mycobacterium avium 104]MAEPTILLLSTSDTDLISARSSGKNYRWANPSRLSDDELPDLLADAAIVV
VRILGGYRAWQHGIDTVLASGVPTVLVSGEQAADAELTGLSTPAAGIAVQ
AHIYLAHGGVENLRQLHAFLSDTVLMTGFGFAPPVMTPTWGEPARPNAID
TDGPTIAVLYYRAQHLAGNTGYVEALCAAIEDAGARPMPIYCASLRTAEP
ELLQRLREADTMVVTVLAAGGLKPAEAAAGGSDDSWNVEHLAALDIPILQ
GLCLTTPRAQWLQNDDGLSPLDVASQVAVPEFDGRIITVPFSFKEIDDDG
LISYVADPERCARVAGLAVRHARLRHVGPADKRVALVFSAYPTKHARIGN
AVGLDTPASAVALLRAMRAHGYRIGDLPGVEANDGDALIHALIERGGQDP
DWLTEGQLAGNPIRVSAGDYRAWFATLPAEFTDAVQQHWGPPPGQLFVDR
SNDPDGEIIIAAIQSGNLVLMVQPPRGFGDNPVAIYHDPDLPPSHHYLAA
YHWLDAGFGAHAVVHLGKHGNLEWLPGKTLGLSAGCAPDAALGDLPLIYP
FLVNDPGEGTQAKRRAHAVLVDHLIPPMARAETYGDIARLEQLLDEHANV
AALDPGKLPAIRQQIWTLIRAAKMDHDLGLTERPEEDSFDDMLLHVDGWL
CEIKDVQIRDGLHVLGQKPTGEAELDLVLAILRARQLFGGEQVIPGLRQA
LGLAEDGTDERSAVDGAEAAARELVAALQATGWDPDAAGRLTNNAEAAAV
LRFAAAEVVPRLAGSSAEIDQVLRALDGRFIPAGPSGSPLRGLVNVLPTG
RNFYSVDPKAVPSRLAWEAGVALADSLLTRYRDDHGRWPQSVGLSVWGTS
AMRTAGDDIAEVLALLGVRPVWDDASRRVVDLAPIPLTELGRPRIDVTVR
ISGFFRDAFPHVVTMLDDAVRLVAGLGEPAADNYVRAHAQADLAQHGDQR
RATTRIFGSKPGTYGAGLLQLIDSRNWRDDADLAAVYTAWGGFAYGRDLD
GREAVDDMNRQYRRIAVAAKNTDTREHDIADSDDYFQYHGGMVATVRALT
GQAPAAYIGDNTRPDAIRTRTLSEETTRVFRARVVNPRWMAAMRRHGYKG
AFEMAATVDYLFGYDATAGVMADWMYEQLTERYVLDPENRKFMAESNPWA
LHGMAERLLEAAGRGMWAQPQPETLDGLRQALLETEGDLEG
118467331YP_881817.1 TetR family transcriptional regulator [Mycobacterium avium 104]MAELRTESAAGARRRNASGESTRVMLMEVAERLFATRGIEAVTLREIQQA
AGQSNTSVIRYHFGSRDGLIRALISYRQASLGADRREMLMSMREQGKEAD
PRAVVWLLARPLANSIAAGEMFAPFLARLVEDPRARSRYWPDHVDDDWTQ
EKLEELVDAALQDLPGRIRRGRTFQLYVSLINTLAAAARSGHGLSEAQLH
NYVDTWVGMLTAPVSYETRALIADDDD
118467330YP_884237.1 oxidoreductase [Mycobacterium avium 104]MTGGSAQPPRVALVTGAAGGQGRAIAERLRGNGFAVAACDRRIDELAATV
AASGDDRLIAVELDVTSEQQWRSAVERVVDRFGALSALVNCAGVLHRTPL
PQETADAFENAWRVNCFGAFLGMRAALERLRGTPGASIVNICSTGAIRPF
PQHCAYGSSKWALRGLTQTAAAELAPAGIRVNAVFPGPIATPMLDEATQT
RLAAAASFGRIGQPGEVADAVAFLVSAEASFITGAELVVDGGQCLQIR
118467329YP_884382.1 hypothetical protein MAV_5270 [Mycobacterium avium 104]MDDDCLKLTTYLAERRRAGNRFVSDVLLDLYARHRVECAVLLRGIGGFGT
GHRLRSDESLTLSEDPPVAIVATDTRTKIEALLDEVLAVKQRGLVTLERA
RLLHADVGAARPPEGDAVKLTVYLGRKQRVNGAPAYIGVCDLLHRRGLAG
ATVLLGVDGVVHGERRRASFFGRNVDVPMMIVVVGSGAHIGGVLPEIAAL
LRRPLFTLERVRVCKRDGRLLEPPHALPGVDERGLPLFQQLTVYTSESAR
HGGVPIHRAIVARLRQATAADGATVLRGVWGFHGDHPPHGDGLLALTRRV
PVVTIVVDTPAHIAESFAVIDELTGAEGLVTSEMVPALVSDDGGPGAGRM
ARHRY
118467328YP_883966.1 hypothetical protein MAV_4842 [Mycobacterium avium 104]MDPLASIGYNGQPVRSPFRVVRPPIAVLVDLTVLFPRQPHRSGRYQPNGL
QLHKVVEGRLSCWALCEQGDWWGLVTYPVAYGAKCRTVTHWVPAWTLRRK
G
118467327YP_882632.1 metallopeptidase- zinc binding [Mycobacterium avium 104]MTFNEGMQIDTSTASSSGGGGMGMAVGGGGLGLIILLGALFLGVDPGRVM
PQQQTNTGGYSAPGFDLSQCKTGADANKYVQCRVVATGNSVDAVWHQLMP
RYTRPHVRLFTGRVNTGCGPATTAVGPFYCPVDQTAYFDTDFFQELVDRF
GSSGGPFAQEYVVAHEYGHHVQNLQGVLGRSQQGAQGAGGNGVRTELQAD
CYAGIWAHYASTVKQESTGVPYLEPLSDKDIADALSAAASVGDDRIQKQA
TGRVNPESWTHGSSEQRQKWFTIGYQTGDPKQCDTFSAPDLG
118467326YP_879397.1 ABC transporter transmembrane protein [Mycobacterium avium 104]MTASTYIPGLARPFVGAYRVAAAPTMRLGHMLVFFVRAVLAVPTVLRQYR
TEFLRLLSNIAWGNGSIVVGGGTAGVAVVLGFTAGALVAVEGYNFLNLLG
LGPATGIISSLVNTRELAPIMASLAFAMQAGCRFTAQLGAMRIAEEIDAL
ESLAIRPIPFLVTTRLMASVIAVIPLYIACLAVTYLTCQVVANIISGGSI
GPYLHYFTMMLSAKDIAYSVLKCVVFVWLSSTVQCYYGFYAAGGPEGVGV
AAGHAMRASITVVIMVNMLLTMALWSIDAGARFGG
118467325YP_882927.1 ANTAR domain-containing protein [Mycobacterium avium 104]MAEQSEAGAVASAAGGEKADPATVFAALAEIIYQGSDANEIYAAICIAAT
LTVRGCDHASLLVRENDRYVTVGASDQLARHIDELERRAGDGPCIDAIEE
ETPQIDPDLTTPSLWPKLASVLVAETPVRGAMGFRLPVDKRKGAALNLFS
DTPNMFDAESAGRAAVLAAFASVAINAVAKGEDAASLRRGLLSNREIGKA
VGMLMLLHEMTEDEAFDLLRRHSQALNIKLAEVARAVIDNRGQLPPEIEN
QLPPNT
118467324YP_882137.1 acyl-CoA synthase [Mycobacterium avium 104]MNIAEHALAAAQSPALITDGGTISYGELHDRSRRVAAALHELGLRRGDGV
AVVLPNRPEFLEITWGCQLSGLYYTPVNTHFTADEVVYVIDDSDAKAVFV
DASLPGIAARLRSANPAVHIGVGGKLPGWRDYEGVLGVAGDAPPVSDGSE
MLYSSGTTGRPKAVRRPLPQDGNGSWAQSVLELALIHKYGMTQRSVYLSP
APLYHAAGVNYTMAVNRVGAASIIMRKFDAETVLRLIETHRVTHAQFVPT
MFVRMLKLPEAVRDRYDVSSLRCVIHAAAPCPVDVKHRMMRWFGPIIHEY
YGGTEGFAGTTIGPQEWLAHPGSVGIPLAPVHVLDEDGREVPVGQTGELY
FEGGPDFEYFKDPVKTASVYNERGWRSLGDMGHLDEDGYLYLTDRSTFTI
VSGGVNIYPQEVENLLVMHPKLLDAAVFGVPNDEFGEEVKAVVQPADGVP
PGPDLAAELIAYCRAHLAGYKCPRTVEFDTLPRDPNGKLYKRRIRERYWQ
GRESRIV
118467323YP_883232.1 transferase [Mycobacterium avium 104]MRIAMISEHASPLAHLGGVDAGGQNVHVAELSCALARRGHDVVVYTRRDD
PRLPDSVETPHGYSVVHVPAGPARVLPKDELLQYMYGFAQFLRQQWCSDG
PDVAHAHFWMSGVATQQAARAHSIPTVQTFHALGLTKRLHQGSDDTSPDC
RIDVEARVAREADWVAATSTDEVFELVRMGRARSRTSVVPCGVDLDAFTP
DGPVAARGARPRIVTVGRLVPRKGFDTIVRALPRIPDAELVIVGGPPAAE
LAGDEQARRLQRLAGELGVADRVRLLGGVTRAQMPALLRSADVVACTPWY
EPFGIVPLEAMACGVPVVATAVGGIRDTVVDGATGRLVPPKDPDALGEAV
AALLRDGRRGRTLGEAGRERARARYSWDRVAADTERIYERLSPARRGVGT
PSTRSG
118467322YP_881120.1 small subunit of dioxygenase in aniline dioxygenase [Mycobacterium aviMTVDAASEHSRTRPTPRPLPDPEILAFLYLEARLADEGRYSEWESLWADD
DDTVEYRVPMHPDDDPRTTLAYINDNRRRIKSRVAQLNTGNRHSQTPPSV
MRRIVSNSEVVAEDADTVTVESNFALFEYRIRQRFWAGRVIHTIRRSADG
LRLIRKVVHLVDAGGPVETLAFLI
118467321YP_880359.1 hypothetical protein MAV_1107 [Mycobacterium avium 104]MRIGTRATSLAEADRRYASNEGASAAEFAAVAAPVTTV
118467320YP_883607.1 30S ribosomal protein S10 [Mycobacterium avium 104]MAGQKIRIRLKAYDHEAIDASARKIVETVVRTGASVVGPVPLPTEKNVYC
VIRSPHKYKDSREHFEMRTHKRLIDILDPTPKTVDALMRIDLPASVDVNI
Q
118467319YP_882488.1 ABC transporter ATP-binding protein [Mycobacterium avium 104]MITATDLEVRAGARILLSPDGPDLRVQPGDRIGLVGRNGAGKTTTLRILA
GETEPYAGTIARSGEIGYLPQDPKEGDLDVLARDRVLSARGLDVLLTDLE
KQQALMAEVADDDARDRAIRRYGQLEERFVALGGYGAESEASRICASLGL
PERVLTQQLRTLSGGQRRRVELARILFAAAEGGATGSGSATTLLLDEPTN
HLDADSIGWLRDFLRAHTGGLVIISHNVELLADVVNRVWFLDAVRGEVDV
YNMSWQKYLDARATDEQRRRRERANAERKAAALRTQAAKLGAKATKAVAA
QNMLRRADRMMAALDEERVADKVARIKFPTPAACGRTPLTATGLSKSYGS
LEVFSGVDLAIDRGSRVVVLGLNGAGKTTLLRLLAGAETPDTGRIEPGHG
LRIGYFAQEHDTLDNDATVWQNIRHAAPDSGEQDLRGLLGAFMFSGPQLD
QPAGTLSGGEKTRLALAGLVASTANVLLLDEPTNNLDPASREQVLDALRS
YTGAVVLVTHDPGAAEALDPQRVVLLPDGTEDYWSDEYRDLIELA
118467318YP_882129.1 hypothetical protein MAV_2943 [Mycobacterium avium 104]MSGHQDVGTAEFSRGNPAVSNHLDETPAGPQALGLELRWPTRRRGARRRG
RAGTPPGPETDFGINLVR
118467317YP_881954.1 P-cumic aldehyde dehydrogenase [Mycobacterium avium 104]MTVQAVLDDIRKRPGTGDVIAVIDPATEEKITEFTDCGAEAVDEAAARAK
ASFESGVWSQLPGRERAKILWRIGDLIDEHAEEFAQLDSLNTGMPLLQAQ
LQMSTCSEFFRYYAGWCSKINGTAYDVKTDGIATDTFVNMHAYTLKEPYS
VVGLIFPWNGPIFNASAKLAPALAAGCSLLVKPAEETPLSALLLDRLVHE
AGVPEGVVNLLTGYGHTAGAAITAHPDVEKVAFTGSTEVGKEIVRASAGN
LKKVTLELGGKSPVLIFDDADLDKAILMASLGIFVHSGQGCVCGSRIFVQ
RGVYDRVVEGIAMMANTFKLGAPSEEGCVSGPLISQKQLNRVMGFIDEGK
NDGVEVVTGGYRLDRKGYFVHPTVLTNVDPGMRLYQQEIFGPVVAILPFD
DEDEAVAMANDTTYGLAATAWTENLGRAHRIVKRLQAGSVQVNCQLVFDH
DVPFGGYKQSGWGHEFGKEGLEIYLKTKSVWAQL
118467316YP_881793.1 hydrolase [Mycobacterium avium 104]MDIEYTDSGTGSTILFVHGVYVTGAVWNDVVAELGEGFHCIAPTWPLGAH
STPTGGADLGAEAAARRIVHFMEALDLTDVTVVANDTGGGLVLASLGDPG
LDTSRIARLVLTNCDSYEHFPPGSFAQIVKLCRLSSRVGGGIVRLLATGP
GQSFFLKAVSKHPPSRERQREIFGAFATSGAARRDAVMVTASLDPALTLR
AAPAIKAFDRPVTLTWGTEDKLFPLDHARRLRDAFPHAALIEIPDCSAFV
MIDAPAKLAEAIRNG
118467315YP_879872.1 2-hydroxy-6-oxo-6-phenylhexa-2-4-dienoate hydrolase [Mycobacterium aviMTATEELTFESTSRFAEVDVDGPLKLHYHEAGLSFKGTGRTVVLLHGGGP
GAASWTNFGRNIPVLARHFHVLAVDQPGYGLSDKRAEHGQFNRYAARALN
GLFEQLELGRVPLVGNSLGGGTAVRFALDYPDKAGRLVLMGPGGLSINLF
APDPTEGVKRLGKFSAEPTRENLEAFLRVMVYDQKLITDELIDERFALAS
TPESLAATRAMGMSFAGADFELGMMWREVHRLRQPVLLIWGREDRVNPLD
GALVALKTIARAQLHVFGQCGHWAQVEKFDEFNKLTIDFLGGA
118467314YP_881570.1 transporter- major facilitator family protein [Mycobacterium avium 104MTMSVAPTTRLWSRQFVAVIVAIGGMQLMVAMDGPVAVFALPKIQNEMGL
SDAARSWVITAYMLTFGGLMLLGGRLGDTIGRKRAAFLVGVALFTFASGL
CGIAWAGGTLIAARLLHGAAAAIIAPTNLALIATTFPRGSARNAATAVFG
AMTGLGGVLGLVVGGALTDVSWRLAFLVNVPIGLAVIYLVLITRQETQTE
RIKLDVTGAVLATVTGTAAVFGISMGPEAGWRSPITIGSGVVALAAFVAF
VVVERTAENPIVPFNLFLDRNRLAAFAAMFLAGGVFFTLTVLVGLYVQTM
MGYSPLRAGVAFIPFGLAMAIGVGVASKLVTWFPPRVVVIASGGLILGAT
LYGSTFNRGMPYFPNLVVPLIVCAIGIGAVFVTLTLSVIASVDVDRIGPT
SAIAVMLQTLGGPLVLVVVQVAITSHALRLGGTLGPVKSMNAAQLHALDR
GYTYGLLWLAGVVALLGGVTLLIGYTAAQVARAQEVKKAVDAGEL
118467313YP_881609.1 twin arginine-targeting protein translocase TatC [Mycobacterium avium MKAFKVSARTSGLLKRLNPRNRRSRTNPDATMSLVDHLTELRTRLLISLA
AIALTTIFGFFWYSHSIFGLESLGEWLRHPYCALPQSARAEISANGQCRL
LATAPFDQFMLRLKVGLTAGVVLACPVWFYQLWAFITPGLYQKERRFAIA
FVIPAVALFVAGAVLAYFVLSKALGFLLTVGSDVQVTALSGDRYFGFLIN
LLIVFGVSFEFPLLIVMLNTIGVLTYPRLKAWRRGLIFAMFVFAAIFTPG
SDPFSMTALGVALSVLLEFAIQIARLHDKRKAKREAQAVIPDDQASVIEP
PTAIPEPSLSAGQHDDVT
118467312YP_881175.1 hypothetical protein MAV_1956 [Mycobacterium avium 104]MTATEVDLSSGLPADREQTVESCPDVPGWTENLLFTPYDPVNDIGMWLHL
GTVADMWEMWEDRVLIALPEDQGVLSMWAYHRTVPDRQPAGSNLAFRCER
PFTKWRITFDGFCVKSSYEAMRTGLLTDGPKSHVQLDLNVAGLTPVWDAE
SGPAIASGAGMAEQSWAREHYEQLTRVTGEVRIDGEPIRFDGGGWRDHSR
GPRGADTLTDWGGHVIVGGVMPSGRAFGLCRYWARDGRITLEGAYVVEDG
ALRHVQVDEIPSPAELSRDGEQFIVAFDGGTWLTGTVRSSLWLSMADGLP
YGVLEPTRAYHVSWAEVTWGDETGHVYIERSNLSGR
118467311YP_880224.1 cytochrome p450 [Mycobacterium avium 104]MSNFDSIDFFTDPSLVPDPHPYFDYLRSQNPVLRLPHYGVVAITGYEEAT
EVYKDPETFSNIVALGGPFPPLPFTPEGDDISAQIDAHRSSFPMFEHMVT
MDPPEHTKARSVLAKLLTPSRLKQNEEFMWRLADRQLDEFLHNGECEFIA
EYSKPFATLVIADLLGVPEEDHTQFRTVLGADRPGARVGALDHETVGINP
LEWLDDKFCNYIEERRREPRADVLTFLAEAKYPDGSTPPVIEVVRSATFL
FAAGQETTAKLLSAALQVLGDRPDIQQQLREDRSLIPAFIEESLRMESPV
KSDSRLARRATTIGGVDIPAGTVVMILPGAANRDPRRFENPHEFDLRRKN
VREHMAFARGVHSCPGGPLARVEGRVSIERILDRMPHIEINETHHGPAGD
RRYTYEPTYILRGLSELHLTFTTADAVAPVG
118467310YP_879371.1 transglycosylase [Mycobacterium avium 104]MSSNNEGRHSQSSGDQRGPAAEQGAGERRETARPDADPQRRNGPSTSSRR
RQAPPDDRLTTILPPVDDDRAPRRSDPIEEVKAALAGPPSTPLRRDALDE
VKAALDSRGPASGRQQRAGLGGRPPVGPPPPPPRRGWSGGPGGPGGRGSG
PWRDWSWTQQINWLWVRRAAYLCAAVLVLLPIVTFAMAYFIVDIPKPGDL
RTNQVSTILASDGSEIAKIIPPEGNRVDVNLNQVPVHVRQAVIAAEDRNF
YSNPGFDFSGFARAVNNNLFGNGDLQGGSTITQQYVKNALVGSAQHGVSG
LMRKAKELVIATKMSGEWSKDEVLQSYLNIIYFGRGAYGISAAAKAYFDK
PVEQLTVSEGALLAALIRRPSTLDPAVDPKGALARWNWVLDGMVETKALP
AKDRAAQVFPQTVPPDQARAQNQTTGPNGLIERQVTKELMELFNIDERTL
NTQGLQVTTTIDPKAQQAAEKAVSKYLDGQDPDMRAAVVSVDPHDGAIRA
YYGGSDANGFDFAQAGLQTGSSFKVFCLIAALEQGIGLGYQVDSSPLTVD
GIKITNVEGESCGTCNIAQALKMSLNTSYYRLMLKLKGGPQAVADAAHQA
GVATSFPGVDHTLSEDGKGGPPNNGIVLGQYQTRVIDMASAYATLAASGV
YHRPHFVQKVVNSDGQVLFDAGKSDNNGEQRIPKAVADNVTAAMEPIAGY
SRGHALAGGRPSAAKTGTTQLGDTTSNKDAWMVGYTPSLSTAVWLGTAKG
DQPLVTASGGPVYGSGLPSDIWKATMDGALKGTPNESFPKPAEVGGYAGV
PAPPPPPKAPPSETVIQPTIEVAPGITIPVGPPTTVTLAPAPPAGGPPGG
PEPGGGVPPGPGGGVPPGGPQAPPPPP
118467309YP_882345.1 adenylate cyclase [Mycobacterium avium 104]MAAKSCGAAPLWPTGSSKRPDCVAAARAQSRARNQHYADSAARQSRVLAI
AAWLAVLVCADFILLQVVTGAWTWQIVSLNVVAALIFAIVPWLHRFGDLV
APLTFLGAAYVTVFVSCWDVGTASGGQYFFLVGACLVLLVMGIEHTVLAA
VLAAIGAGLVIAVEFAFPRDTGLQPAWAQSMSFVVTIVSACIMVFVAVWF
ALRDTQRAEAVMESEYQRSEALLANMLPGSIAERLKHSDGDIIADKYDDA
SVLFADIVGFTERASGTAPADLVRFLNRLYIAFDELVDKHGLEKIKVSGD
SYMVVSGVPRVRPDHATALADFALDMVKVAAALKDPYGRPVPLRVGMACG
PVVAGVVGSRRFFYDVWGDAVNVASRMESTDSVGRIQVPETMYERLASEF
VLQERGRIEVKGKGVMRTWYLIGRKPAEAPTDLVAEQPHTAHV
118467308YP_880121.1 hypothetical protein MAV_0852 [Mycobacterium avium 104]MAQGTVKWFNGEKGFGFITPDDGTKDLFVHYSEIQGSGYRSLDENQRVQF
DVEQGAKGPQAVGVSTV
118467307YP_882312.1 lysyl-tRNA synthetase [Mycobacterium avium 104]MIATVSLLGSVSPLIRYLIKVPREFINDYLFNFPDTSIAWSFVLALLAAA
LTARKRIAWLLLLGNMILAAALNVADIAAGDNTAAEIFGENLGFAVHIVA
IVLLVLAYREFWAKVRKGALVKAAAVLVAGDVVGILVSWGLVELFPGTLA
RQDRLPYVVNRVVGFALADPDLFTGRPHVFLNAIFGLFGALALIMATIVL
FQSQRAENALTGEDESAIRGLLELYGKNDSLGYFATRRDKSVVFAQSGRA
AITYRVEIGVCLASGDPIGDPRAWPQAVDAWLGLCQTYGWAPGVMGASTQ
GARTYREAGLNALELGDEAILRTSEFKLSGPDMRGVRQAVTRARRAGLTV
RIRRHRDISPEAMADTIARADAWRDTQTERGFSMALGRLGDPADGDCLLV
EAIDRDGSVVAMLSLVPWGTTGVSLDLMRRSPSSPNGTIELMVSELALNA
ESLGITRISLNFAMFRSAFEQGAQLGAGPVARLWRGLLLFFSRWWQLETL
YRSNMKYQPDWVPRYACYEDARLIPRVGVASVIAEGFLVLPFSRRDKVHT
GHHPAVPARLAQSGLLHHDGSAPDVSGLRPERTDAEEARSRLPEQVRVRL
AKLKVLQRNGVDAYPVGCPPSHTVAQALDADDQQDITVAGRILRIRDFGG
VLFAQLRDWSGEMQVLLDNSRLERGRTADFTAAIDLGDLVEVSGQMGFSK
KGTRSLIVTDWRMIGKCLRPLPNKWKGLTDPEARVRTRYVDLAVNPESRE
LIAARSEVLRSVRQTLFAKGFIEVETPILQQIHGGATARPFVTHINTYDM
DLFLRIAPELYLKRLCVGGVERVFELGRAFRNEGVDFSHNPEFTLLEAYQ
AHADYRVWIDGCRELIQNAAQAAHGEQTVLRPGADGRLQPVDISGIWAVK
TVHDAVSEALGEQVDPGTSLSTLRKLSDAARIPYRAHWDAGAVVLELYEH
LVEDRTEEPTFYVDFPTSVSPLTRPHRSRPGVAERWDLVAWGVELATAYS
ELTDPVEQRRRLQEQSLLAAGGDPEAMELDEDFLQAMEYAMPPTGGLGMG
VDRLVMLITGRSIRETLPFPLAKPH
118467306YP_883683.1 hypothetical protein MAV_4552 [Mycobacterium avium 104]MAAISAPGALRARYPRTAANLDRYGGGTVRRLWQIGIFARFARISIGQIG
WALRHYRRETLRLVAEIGMGTGAMAVVGGTVAIIGFVTLSGGSLIAIQGF
ASLGNIGVEAFTGFFAALANTRIAAPIVAGVTLAATVGAGATAQLGAMRI
SEEIDALEVMGIKSISFLVSTRILGGLAVIVPLYALALDMAFTSGQVVTT
VFYGQSNGTYEHYFRTFLRPEDVGWSVFEVVIIAVVVMITHCYYGYTASG
GPVGVGHAVGRSMRFSLVSVVVVVLLAQLALYGVDPNFNLTV
118467305YP_883096.1 acyl-CoA dehydrogenase [Mycobacterium avium 104]MGIALTDDHRELAEVARGFLTSQKARWAARSLLDATDEPRPGFWPNLVEL
GWLGLHIDEEYGGSGFGLPELVVVVEELGRAVAPGPFVPTVIASAVIAKN
GTAEQKSRLLPGLIDGTVTAGIGLDSRVRLGDGVADGEAGILLGAGLAGL
LLIAAGDDVLVLERDRDGVSVDVPDNFDPTRRSGRVRLDNVRVSDADVLA
GARPSALARARTLLAAEAVGGASDCVDAAVAYAKVRQQFGRTIATFQAVK
HHCANMLVGAESGIAAVWDAARAAGEDEDQFHLIAAVAAALAFPAYVRNA
ELNIQVHGGIGFTWEHDAHLHLRRAVVTAALFGGDAPAADVFERTAAGTV
RDNSLDLPPEAEELRTKIRADAAAIAALDKDAQLDKLIETGYVMPHWPKP
WGRAADAVEQLVIEEEFRAAGIKRPDYGITGWVILTLIQHGTPWQIERFV
EKALRKDEIWCQLFSEPDAGSDAASIKTRATRVEGGWKINGQKVWTSGAH
YCARGLATVRTDPDAPKHAGITTVIVDMKAPEVEVRPLRQITGGSDFNEV
FFNDLFVPDEDVVGTPNSGWTVARATLGNERVSIGGSGSFYEGLADQLVQ
LAQQRPDRLAGGKIRVGSYLAEETALRLLNLRRAARSVEGTGPGPEGNVT
KLKLAEHMVEGAAIMAALLGPEVALTDGPGALSGRLMMGARGMAIAGGTS
EVTRNQIAERILGMPRDPLIN
118467304YP_882544.1 hypothetical protein MAV_3362 [Mycobacterium avium 104]MMKRSLAKLAVTVGGLALASTAGAGVASADPDYGPMINTTCSYDQAMRAV
HAENPMAAQYLDQSPPNQQFLQQYLASSPDQRVNLLHAIEHNQGAQQALP
IFQQMMTDCTRY
118467303YP_879770.1 transcriptional regulator [Mycobacterium avium 104]MVPKLSDQTRARRRQHILTSAWTCFSRGGFHATSMDDVIAATGMSSSAVY
RYFRSKDELIAATVDEGLAKVRGIFLALLDRDPCPTPAETLSLVVAELDS
RTRNPQYDMTRIALQTWAEAVRDPFLRKRARSLYRETLRHITELADRWRD
NGHLPPEANTHAAAATLFSVMHGLIVMHHVVDDVGADALRDGLVLLGAAA
APHAVPTTPLPEAHP
118467302YP_880828.1 acyl-CoA dehydrogenase [Mycobacterium avium 104]MDRYELRRLDYSLTDDHQALQAAYRDFFTTHCPIETVRAAEETGFDKNLW
ERLCAMGATSMAVPESAGGDGATLVDLTLVAEEIGRSLAPVPWIDQVCTA
RLLARLGAVEPDVVHGKRLAGFDPQHDSLSGPRLIPTGSIADAIIVRDGD
DVVALSFGTRPAKVDNIGRLPMAWVDPAAADTRTVLAGGSDALAEYQRAL
DEWRVLTAAALVGLVEETMTIAAEFAKTRYTLGVPISTLQGISHPLANIA
ITVQGGRNLARRAAWFLDNEPDERPELAPSAFVFMAEEAAKAATMAVHVQ
GGLGVSAEAAATAYLVRARGWALAGGDPGASAKYIGELVAARESGKGA
118467301YP_884018.1 hypothetical protein MAV_4897 [Mycobacterium avium 104]MPFLEILRTGPLAVVEDLGRPGLAHLGVSRSGAADRRAHKLANRLVANPD
DRATVEVTFGGFAARVRGGDVDIAVTGADADPTVDGIEFGSNSIQHVRDG
QVIALGTPRAGLRSYLAVRGGICVDPVLGSRSYDVMSAIGPAPLRAGDRL
PIGEHTQDYPELDQAPVAAITGHLMELQVVPGPRDDWLVNPDALVHTIWM
ASDRSDRVGMRLEGRPLQHRYPDRQLPSEGTTRGAIQVPPNGLPVILGPD
HPVTGGYPVVGVVTDEDVDKIAQVRPGQYVRLHWARPRALAGAHAGAASW
PFA
118467300YP_884149.1 transposase- Mutator family protein [Mycobacterium avium 104]MVKRPRITTERNIAMALDQSALLEVLDALRTADAGERITQAAETIYQALI
DAELTAFIGASPHERTETRSNQRNGSRPRTLSTVAGDLELRIPKLRTGSF
FPALLERRRRVDQCLFAVVMEAYLHGTSTRKVDDLVKALGTDTGISKSEV
SRICKDLDTEVAAFRDRPLGDQRFPYVFLDATYCKARVNHRVVSQAVVIA
TGVAADGRREVLGFEVGDSEDGAFWTAFLRSLKSRGLAGVQLVISDAHAG
LRSAIDAVLIGAAWQRCRVHFLRNVLAQVPKGSAEMVAAAIRTVFAQPDA
EHVREQLDTIAGMLGRQFPKVETMLREAAADITAFADFPVAHWKKIWSTN
PLERLNKEIKRRTDVVGVFPNPAALLRLAGSVLVEAHDEWQVADKRYLSE
TSLALLDVSDQSAETIAPTAALTA
118467299YP_883118.1 taurine catabolism dioxygenase TauD- TfdA family protein [MycobacteriuMSLLTITKLTDSVGAEVTGLDPAALAHDDSVGEAVLDALEDNGVLVFRGL
YLDPAAQVAFCGRLGEVDHSSDGHHPVPGIYPITLDKSKNASAAYLKATF
DWHIDGCTPLGDECPQKATVLSAVRVAERGGETEFANSYGAYDALTDDEK
QRFGALRVVHSLEASQRRVYPDPSPELVARWRSRRTHEHPLVWTHRSGRK
SLVLGASADYVVGMDVDEGRALLEELLQRATVPERVYRHGWSIGDTVIWD
NRGVLHRAAPYDPDSSREMLRTTVLGDEPIQ
118467298YP_879793.1 hypothetical protein MAV_0512 [Mycobacterium avium 104]MVLVACLAGITAVSMQVRCVDAAREAARLAARGDERSATAAAARLAPAGA
RVDLRRDGDLLVATVVAHSKLLPALDIRAQAVSAAEPAR
118467297YP_883516.1 oxidoreductase [Mycobacterium avium 104]MRIGIALNYSGGFHEAVDRVVELEKAGIEVAVVAEAYSFDAISQLGYLAA
KTSTVELASGVLPLYIRTPSLLAMTAAGLDYVSDGRFRLGIGTSGPQVIE
GFHGVPFDAPIGRTREIVEICRMVWRRERVQYAGRHYQLPLPPDRGTGLG
KPLHLINHPVRERIPISIAALGPKNVELTAEIAEGWQPVFYLPDKAGSIW
GEALAAGAAKRDPALGPLDVMVHASLAIGDDVDQRLAWVKPQLALYIGGM
GAKGRNFYHNLATRYGFGEVADRIQELYLSGRKQQAIDLVPDELVRGMSL
VGPRGYVAERMAAFAESGVTTLLLSPLAADRDEALGFVEQALQLRP
118467296YP_881220.1 hypothetical protein MAV_2001 [Mycobacterium avium 104]MFCATGVVNGSRFLTVVAHQGGAGNATATPELACAALADLQLSATTVYEG
RN
118467295YP_882641.1 hypothetical protein MAV_3459 [Mycobacterium avium 104]MNQPDAPTPPNDAAKALQVLKSLPSFEDTQAQVQAAMNEITAAAGKVVPS
VTWETPHEGSGLGCEKPYEQTDGRGYFLPDQVAANVSVSEQQWATIQEAA
KQAAAKIDATEIQVMQNNPGNHDVGFYGPTGIFIKVGYRGNLVVSGYTGC
RLPRDKK
118467294YP_880928.1 hypothetical protein MAV_1699 [Mycobacterium avium 104]MVGAGPAGIAAVGRLLDHGADSIAWIDPAFAAGDIGQKWRSVSSNTHAGL
FLEYFNGCKSFRFSEAPPMPLREIDAGETCALALVAEPLLWVTGQLRERV
DTVTTTATALYLSDRRWRIETEQREIFSRNVILAVGAVPKKLCHPGLEEI
PVEVALDPEKLARQPLSGATVGVFGSSHSSMIALPNLLRQPVEKVINFYR
SPLKYAVYFDDWILFDDTGLKGQAAVWARENIDGVLPERLHRCLVSSPEF
AENLARCDRVVYTVGFERRTLPETPQWGRLDYNPTTGILAPGLFGVGIAF
PQYAEDPYGYGQFRVGLKKFMDYLDSVLPLWLRYGP
118467293YP_883021.1 6-phosphofructokinase [Mycobacterium avium 104]MRIGVLTGGGDCPGLNAVIRAVVRTCDSRYGSSVVGFQDGWRGLLENRRI
QLHNDDRNDRLLAKGGTMLGTARVHPDKLRAGLNQIKQTLDDNGIDVLIP
IGGEGTLTAAHWLSEENVPVVGVPKTIDNDIDCTDVTFGHDTALTVATDA
IDRLHSTAESHQRVMLVEVMGRHAGWIALNAGLASGAHMTLIPEQPFDVE
EVCRLVKRRFQRGDSHFICVVAEGAKPIPGSISLREGGIDEFGHERFTGV
AAQLGAEVEKRINKEVRVTVLGHVQRGGTPTAYDRVLATRFGVNAADAAH
AGEYGQMVSLRGQDIGRVPLADAVRQLKLVPESRYDDAAAFFG
118467292YP_881224.1 PapA2 protein [Mycobacterium avium 104]MFLGTVEDWTAEGTVVAWYPTAATYRRAAQAQYHPAPVSYQQAQHLRYYR
RQVSRGRDIPRLCIGAWEISGTCDIDAMTQAVNTHLRRHDTYHDRFVFGD
GDEILRYVIPEPEAITLAPTDLGRMAPPQIRKLLLDTPDPLQWDCFTFGI
VQAQDRFTIYIAVDHLRADGMSAGVIFLDIQTTYFAALQRTHFALPPAPS
HREYSARQHTYTRSLNEESPEIRSWHAFLAANNGALPRFPLELGESNADT
PGAIEVFDLIDDEQGRRFEAACRAAGARFSGGVFACAARTEHRLTGAATY
FGLTPFDNRRDPAHATAVGWLASFVPLAIPTAGASFNEVVSAAQASFDSN
AALGAVPYYHLLETTGPSSTPIEVPDRPVPMLSYIDIRKLPFGDYFDGLR
AGVWGYNRLSETVCMWVNRMHDRTQLVVAYPGTDVARGSVRRYVETMRAE
FARVCDAGPRSDA
118467291YP_880767.1 F0F1 ATP synthase subunit epsilon [Mycobacterium avium 104]MAELNVEIVAVDRKIWSGEATFLFTRTTVGEIGILPRHIPLVAQLVDDAM
VRVEREGEDDLRIAVDGGFLSVTEETVTILAESAEFSSEIDESAAREAAE
SDDPRVAARGRARLRAVGAID
118467290YP_884402.1 hypothetical protein MAV_5291 [Mycobacterium avium 104]MFGDFAAADAFHSAVAVAHEQHVNNLQAHSETLTGVGTKAHHAANSFTNM
DEQNATEMRALRPSSSPSPSNA
118467289YP_883625.1 30S ribosomal protein S7 [Mycobacterium avium 104]MPRKGPAPKRPLVNDPVYGSQLVTQLVNKVLLKGKKSLAERIVYGALENA
REKTGTDPVITLKRALDNVKPALEVRSRRVGGATYQVPVEVRPDRSTTLA
LRWLVSFSRQRREKTMVERLANEILDASNGLGASVKRREDTHKMAEANRA
FAHYRW
118467288YP_883591.1 hypothetical protein MAV_4456 [Mycobacterium avium 104]MCEDATAWFDELMERCYPSATPESAALVQRIGVFARVENRAAAEQLAAIG
ELFAYRLSRCSECEDWAVDTEAAVSAEVAAQLRIGQGLAAAKVRYARAMR
ERLPRVGEVFRAGEIDFRLFATIVYRTDLITDRRVLAAVDAELAATAARW
PSMTRARLAARVDAVVAKADADAVRRTEKQAASRHVWIAEMGEGLSHLEG
TVSSPDAHALDKRLDALAATVCEHDPRTGEQRRADALGALAAGADRLGCR
CGRADCAAGTRPAAGPVVIHLIAERASVEGTGGGPAVEVGAEGLLPAQLV
AELAASARLMPLVHPADAPPENRYTPSAALADFVRCRDLTCRWPGCDRPA
TECDLDHTIPYAEGGPTHASNLKCYCRTHHLVKTFWGWREQQLPDATLIL
TSPAGRTYVTTPGSALLFPSLCVPTGEPARPVAAGSQPCGERTAMMPTRR
RTRGQNRAARVAAERRANRAARLARATRPAPAASQSWPAGHGPDADPPPF
118467287YP_882098.1 hypothetical protein MAV_2912 [Mycobacterium avium 104]MRALALLAGAAALVGMAIPAHADSDDDAFLAALNKAGITYPDPTRAIRAG
QKVCDLAGSGTTELDIIRDVHELNPAFSTAKAALFVQAAAGAYCPDRLSI
SDGGTNPHSNS
118467286YP_879391.1 alpha/beta hydrolase [Mycobacterium avium 104]MLSCMANREGQKLFSRSRQMPATPSWFTAALDQKPERCDVEVDGCRIRMR
VWGAADQPPVVLVHGGGAHSGWWDHIAPFFSHTHRVIAPDLSGHGDSDPR
DSYDLRIWAGEVMAAAAAAGPAGRPTIVGHSMGGWVVSTAAMHYSSKINS
MLVIDSPLWERAPEEGRLRRRKHTEYRTRDEILARFTAVPSQELILPYVR
EHIAAESIRKTSAGWVWKFDPAIFGGEFLQPTPADEESLESMLTAMRCRV
GYLRCEAGLVPPAMAERIRSLLQLRGPFVELAQAGHHPMLDQPLPLVATL
RTLLEFWSIT
118467285YP_882951.1 acylphosphatase [Mycobacterium avium 104]MPEPDARLTAWVHGHVQGVGFRWWTRCRALELGLTGYAANQPDGRVLVVA
QGPRPAGEKLLELLRGGTTWPSRPGRVDKVVADWSAPQERFEGFVER
118467284YP_884302.1 trehalose synthase-fused maltokinase [Mycobacterium avium 104]MTEPAKLPWSDWLPQQRWYAGRNRRLTGAEPSVIVGLRDDLDLVLVDADY
ADGSRDRYQVLVCWDAAPVSEYSTVATIGAADDRTGFDALYDDEAPQFLL
SLIDSSAVRSASGAEVRFAKEPDAQLPLEAMAHVSDAEQSNTSVIFDRDA
IFKVFRRVSSGINPDIELNRVLGRAGNPHVARLLGTYEMAGADGTPETAW
PLGMVTEFAANAAEGWAMATASVRDLFAEGDLYAHEVGGDFAGESYRLGE
AVASVHATLAETLGTSQAAFPVDNVLARLSSTAALVPELTEYAATIEERF
AKLATETITVQRVHGDLHLGQVLRTPESWLLIDFEGEPGQPLEERRAPDS
PLRDVAGVLRSFEYAAYGPLVEQGSQNTDKQLAARAREWVERNRTAFCDG
YAAASGIDPRDSAPLLAAYELDKAVYEAGYEARHRPGWLPIPLRSIARLT
AA
118467283YP_880708.1 hypothetical protein MAV_1466 [Mycobacterium avium 104]MHSTKLPIAVGAVFALLIACSPTKPAPSHGPATPSGATLIPGGPMEPTPV
VPSPKIPASQQEAQDTVLRYLQQTVNGLPKGSSLDGSRYVVGGDTQYCED
EPSGPNAPVRFSDWRDIKTPPGIDFNALVAQVGDLWKSWGWQVIERNGYD
KPNRFGYAPDGYVLQITASYPPTYPPSIIGASPCYPGNLRRNDIQRNPPV
ITQTQSSG
118467282YP_880245.1 TetR family transcriptional regulator [Mycobacterium avium 104]MQRTSLQDIADRLGITKPALYYHFPSREDLVRSILVPLIEEGERFVAEHE
SREHTEARELLEGYFDFHYRHRRDLVLLLTELSTLIDLDLIDTVLAWRER
LARLVFGKRPTLAQSTRAVVAFGGLQDCCVQFPDAPQAELRDKSVAAALD
ALGERPRR
118467281YP_879646.1 hypothetical protein MAV_0359 [Mycobacterium avium 104]MTAFQDLPLADRDREWDGDAAEKRVRKWAGAQDEPNEKYRDAHVWYDADK
KENFTAYKLLIADVIGGELKAVPRGVMAAGAIMDGARGGIDVPKSDIDRI
KSHLAKYYQKMGESPPWERS
118467280YP_879726.1 cysteine synthase/cystathionine beta-synthase [Mycobacterium avium 104MTRTRIAVRNLPRDWTDNAIRLIQADARRSADTHLLRYPLPSAWAGDADV
ALYLKDETTHVTGSLKHRLARSLFLYALCNGWIGEGTTVVEASSGSTAVS
EAYFAALLGLPFVAVMPESTSAAKVALIESQGGRCHFVADSSQVYAEAER
VARQSGGHYLDQFTNAERATDWRGNNNIAESIFEQMRDEKHPVPAWIVVG
AGTGGTSATIGRYIRYRRHATRLCVVDPEHSAFFAAYAEGRDDVVASRSS
RIEGIGRPRVEPSFLPGVVDRMVAVPDAASVAAARHVSAVLGRRVGPSTG
TNVWGAFGLLAELVSQGRGGSVVTLLADSGDRYADTYFDDEWVAAQGLDP
AGPAAALAEFERSCAWQ
118467279YP_879372.1 hypothetical protein MAV_0072 [Mycobacterium avium 104]MTGAAEPSTTISPGPLAADRRSADNRDCPSRNDFLGAAFAEVIGGPVGRH
ALIGRARIMTPLRVMFLIALVFLALGWSTKAACLQSTGTGTGDQRVANWD
NQRAYYELCYSDTVPLYGAELLSQGKFPYKSSWIETDSTGAQQIRYDGQP
AVRYMEYPVLTGMYQYVSMALAKTYTALSKLAPLPVVAEVVMFFNIAAFG
LALAWLATVWASAGLAGRRIWDAALVAGSPLLIFQIFTNFDALATAFAMA
GLLAWARRRPVLAGVLIGLGAAAKLYPLLFLGPMLVLGIRTGRLGAWART
AVVAVATWLLVNLPVLVFFPRGWSEFFRLNTRRAEDMDSLYNVVKSFTGW
RGFDPKLGFWQPPTVLNTVVAVLFVTCCAAIAFIALTAPRRPRAAQLVFL
VVAAFLLTNKVWSPQFSLWLVPLAVLALPHRRVLLAWMTVDALVWVPRMY
YLYGNPNRSLPEQVFTTTVLLRDIAVITLCALVIRQIYRPDEDLVRWGGR
VDDPAGGPFNRAPDAPPGWLPDWLRPAGSRRGQAAEPEPALAGAT
118467278YP_883126.1 aldehyde dehydrogenase [Mycobacterium avium 104]MDHDAAVRTDGHGRRADVIRVISPHTERPVAEVDAATPSDVDAAVAAARA
AFDAGTWSRGGPSHRIAAIRRLADIYDRRRAEMAETITAEIGAPISFARR
AQVGLPAFMIRAFCDLAERHPWQETRPGFFGSDVYVRREPVGVVAAIVPW
NMPQFLIVTKLIPALLAGCTVVLKPAPESPLDALLLAEMISEADLPPGAV
SVLPGDAALGAYLAGHRGVDKVSFTGSTAAGRAVAAACAANLTKVSLELG
GKSAALVLDDAPPDKVAAGVRAASLSNSGQICNALTRVLVPQARHDDYVD
ALAAHMGGLRVGDPADPDTDLGPLVSRRQQQRVRDYIRIGQQEGARLVVG
GADMPDGLDRGWYVRPTLFAAAGNAMRIAREEIFGPVITVIPYRDDDEAV
AIANDSDYGLAGSVWSDDTDRALALATRIHTGTVGVNQGYTMDPFAPFGG
VKASGYGRELGPEGLDGYLDTKSIAVAPSG
118467277YP_879944.1 hypothetical protein MAV_0665 [Mycobacterium avium 104]MKLRHGLAAGAAVVMAVGTGLAVQSGQPAKAVGPPADGTYNYNEAGVSGV
TWTISALCDQPSGTRNMNDYSDPIVFAFNCALNIVSSTPEQISAADKLQN
FSGRARMSSMLWTFKVQKDNGVSCPGGGTAPTTETYAFSDETMSGTHTTL
HGAVCGLQPEMKKQPFSLQMTGPPPSPIERYPLYCNGIAMCY
118467276YP_880602.1 glucose-1-phosphate adenylyltransferase [Mycobacterium avium 104]MLGIVLAGGEGKRLYPLTADRAKPAVPFGGAYRLIDFVLSNLVNARYLRI
CVLTQYKSHSLDRHISQNWRLSGLAGEYITPVPAQQRLGPRWYTGSADAI
YQSLNLIYDEDPDYIVVFGADHVYRMDPEQMVRFHIDSGAGATVAGIRVP
RSEATAFGCIDSDESGRIRKFVEKPLDPPGTPDDPETTFVSMGNYIFTTK
VLIDAIRADADDDHSDHDMGGDIIPRLVDDGMAAVYDFSDNEVPGATDRD
RGYWRDVGTLDAFYDAHMDLVSVHPVFNLYNKRWPIRGESENLAPAKFVN
GGSAQESVVGAGSIISAASVRNSVLSSNVVVDDGAIVEGSVIMPGARVGR
GAVVRHAILDKNVVVGPGEMVGVDLERDRERFAISAGGVVAVGKGVWI
118467275YP_884345.1 hypothetical protein MAV_5230 [Mycobacterium avium 104]MSDTEAERIVSATRVIAANAARIFELIADPARQPGWDGNDNLASAAPGQR
VHRVGDVFKMTLTNGAVRENHVTEFVEGSVIAWRPAEPGKQPPGHLWRWE
LSPVNAELTTVTHTYDWTALTDPTRLQRARATTPEMLRESMDRLATLAQS
GD
118467274YP_883556.1 histidinol-phosphate aminotransferase [Mycobacterium avium 104]MLTVPRPADGGIGEALPDAVDPFALSLNENPFPPLPAVRAALIRSVCTAN
RYPEFLPERLRGVIAEHIGVPAELVVLGAGATGVMLQVLQALTAPGDAIA
MATPTFDGYPIVARMARLNTIAVALDEHGQHDLDGLADAAARARVVVLCR
PHNPTGTVESAAAVFRFLRRVPRDTVVLLDEAYVEFTAPEHRIDVAALVA
CFPNVVVVRTFSKAYGLAGLRIGYGVASPRLARPLWDQQLPFGIAITSLL
AVTASYRAEDELSRRIRSITAERRRLRMRLSALGVYTTDAHANFVYLPPD
PQGRAWQRVFARGGVRARYYPDGAARLTVGSRASTVAVLSAVGKATLERQ
VR
118467273YP_882358.1 indole-3-glycerol-phosphate synthase [Mycobacterium avium 104]MSPATVLDSILEGVRADVAAREALISLSEIKAAAAAAPPPLDVMAALREP
GIGVIAEVKRASPSAGSLATIADPAKLARAYEDGGARIISVLTEERRFHG
SLDDLDAVRAAVSIPVLRKDFVVQPYQIHEARAHGADMLLLIVAALEQSA
LVSMLDRTESLGMTALVEVHTEEEADRALRAGAKVIGVNARDLATLEVDR
DCFARIAPGLPSNVIRIAESGVRGTGDLLAYAGAGADAVLVGEGLVKSGD
PRAAVADLVTAGTHPSCPKPAR
118467272YP_880167.1 hypothetical protein MAV_0904 [Mycobacterium avium 104]MATSLPAEFADLEPYLEWDLATEPERYAKRLASSMSEMQAFYDAAFPRLN
DVIAYCDQYPLDDLPEDAKTLMHMMQSLVMVSFPIEAWKQPRVPDSGAAW
VELIREPVI
118467271YP_880662.1 ABC transporter [Mycobacterium avium 104]MTTTTRPAPPAPAGRSRDFWGSAARLVKQLAPQRRTAIAVITLGIAGTVI
GVMVPRILGHATDLLFNGVVGRQLPAGISKAQAVAAARSRGQNTFADLLS
GMNVVPGRGVDFGAVARTLALALLLYLVSALLIWVQARLLNRTVQRTMVA
LRSAVEDKVHRLPLAYFDGRQRGELLSRVTNDIDNIQSSLSMTISQLLTS
VLTVLTVLAMMLSISPLLAGITLLTVPLSLLATRVIVRRSQRLFVAQWTS
VGRLNAHIEETYSGFTVVQTFGHRAAARDRFRALNDEVYRASFGAQFFSG
LVAPATAVIGNLGYAAVAVLGGLQVATGQITLGNIQAFIQYVRQFNSPLS
QLAGMYNTLQSGVASAERVFALLDEPEEPPDAPPEEKPTAPGPAGRDAGG
GGRVEFAHVSFAYRPGIRVIDDLSLVAEPGSTVAIVGPTGAGKTTLVNLL
MRFYDVDAGRISIDGVDIATMDRRALRSRIGMVLQDTWLFDGTIAENIGY
GRPGAGDDEIVAAARAAYVDRFVQNLPDGYHTRVSGDGGNLSAGERQLIT
IARAFLARPQLLILDEATSSVDTRTEALIAHATRELRRDRTSFIIAHRLS
TIRDADRIAVIEAGRIFEQGTHAELLARRGVYYAMTQA
118467270YP_883146.1 phytanoyl-CoA dioxygenase (PhyH) family protein [Mycobacterium avium 1MSIDDESVTTLEDLRGDLAQRYKRTPTSGSSVDSAIVGADMAALDRDGYV
IWENLLSTEQCAQIRETVRPWLGHTGRNSFEGRRTQRVYSVLSRTRVCDR
LVDHPRVLAVLDRLLMPNYLLSALQAINIQPGEAAQLAHHDDGFYPVPRP
RAPLAAATIWAIDDFTADNGATVLYPGSHRWGKRRPGPDDEAIPVVMPVG
SCVLFVGTLWHGGGANTTDRDRLAVTAQYCQPWLRPMEAFTLSVPRDIAR
TVSDDIRRMLGYSIHPPFVGAVDGLHPLRLLEIEPDA
118467269YP_881094.1 amidohydrolase [Mycobacterium avium 104]MKAWNDFYIDEWCATAPDRYIPLAILPVWDIDATVAEAERVAAKGARTVS
FPDSPVPMGLPSFHSDHWDGLWRVCSETQMPVSLHFGSGSFVPGFSFSSM
KPIAGQMVVPDAPFAVATTLFSSNLMWTTVDLLFSGKLQQFPDLQFSLAE
GGIGWVPYILERSDYVWERHRYYQDIDFDTRPSDLFRKHFWGCFIDDMHG
LKNRHEIGIDRITLEIDFPHSDSNWPNSRKRAAEVLADVPDDECSLIVEE
NARRMLNFPRLTAA
118467268YP_880311.1 ATP-dependent DNA ligase [Mycobacterium avium 104]MNAPRAWPAEPTATPRVKLTNADKVLYPATGTTKADVFDYYTRIADVMIP
HIAGRPVTRKRWPNGVDQESFFEKQLASSAPDWLPRASVTHRSGTTTYPI
IDSATGLAWIAQQAALEVHVPQWRFVAEWTRSRAEELKPGPATRLVFDLD
PGEGVTMAQLAEVARAVRDLIDGIGLQTFPLTSGSKGLHLYTPLTEPVSS
KGATVLAKRVAQQLEKTMPKLVTSTMTKSLRAGKIFVDWSQNNGSKTTIA
PYSLRGRDHPTVAAPRTWDELDDPALRHLRYDEVLTRVARDGDLLAELDA
SDNQTPVPDRLTKYRSMRDASKTPEPVPAAKPAAGRGNTFVIQEHHARRL
HYDFRLERDGVLVSWAVPKNLPDTPAVNHLAVHTEDHPLEYGGFEGVIPK
GEYGAGRVVIWDSGTYDAEKFQDDEVIVNLHGRKISGRYALIQTEGDQWL
AHRMKDQNVFDFDTIAPMLATHGSVSALKASQWAFEGKWDGYRLLVEADH
GTLRVRSRRGREVTGEYRELRSLAKALEEHHAVLDGEAVVLDKRGVPNFH
EMQNRGKSARVEFWAFDLLYLDGRSLLRARYRDRRKLLEMLASGGDLTVP
ELLPGDGDQALRQSAERGWEGVIAKRRDSTYQPGRRSSSWIKDKHWNTQE
VVIGGWKAGEGGRSSGIGSLLMGIPGPGGLHFAGRVGTGFTERDLANLKK
TLAPLRTDQSPFDAPLPRSEAKGVTFVEPVLVGEVRYSEWTPDDRLRQSS
WRGLRPDKEASEVVRE
118467267YP_881410.1 epoxide hydrolase [Mycobacterium avium 104]MKPFRIDVPDDVLDDLRARLARTRWPEAECVDDWSQGMPLAYTRELADYW
ANDYDWRAREAALNRFDQFVTEIDGLDIHFIHQRSPHADAFPLLITHGWP
GSIVEFHKVIEPLTNPASGRGEDAFHVVCPSLPGYGFSGKPTRAGWGVER
IARAWETLMLRLGYQRYGAQGGDWGAAVTTQIGRNRGHCVAIHLNMPIGR
PGQEALTNPTEQERAALAALANHRKRGTGYSKQQSTRPQTLGYGLADSPV
GQLAWIVEKFWDWADCDGHPENALSRDELLDNVMVYWVTNTAASSARLYW
ESFSAWGGGDRVELPTGVAAFPGELLKAPRSWCEPAYNITHWTDMPRGGH
FAAFEQPELFVEDLRVFFATVR
118467266YP_880437.1 LpqV protein [Mycobacterium avium 104]MGIVLGVVTAAPGCSHGAPRGAPAPAPARQSGIPAGPAAAPPGAVGLSPG
GVTTRIDIPADSTEEEYYQACHAAKEWMDAQPKTGASLFEPYLSMVQASP
SGTAGSWNTPWSALAPARQAAVIVAARAAANDECG
118467265YP_880610.1 trypsin [Mycobacterium avium 104]MTSDPGYDQAKDSANRLAPRPISRPPVDPASRREFGRPAGLRGSFVAERV
RPKKYREQSEFRPSEQSADPVLQEAFSRPDGSPETLQRHPVDSGALAAEK
DGVEPDHADDPWRDPGAPAALGTPAVAPSPSRSALGYGGKLGVRDVLFGG
KVSYLALLVLLLIALVIGLIGGVVGRKTAEVAEAFTTSKVTLSTNGNGEA
PAGRFAKVAAATAGAVVTIESKSDQEGMQGSGVVIDGRGYIVTNNHVISE
AANNPSQFKTTVVFNDGKEVPANLVGRDPKTDLAVLKVDNVDNLSVARLG
DSDKVRVGDEVLAAGAPLGLRSTVTHGIVSALHRPVPLSGEGSDTDTVID
AVQTDASINHGNSGGPLIDMDSQVIGIDTAGKSLSDSASGLGFAIPINEA
KEVAQTLIRDGKIVHPTLGVSTRSVSNAIASGAQVANVKAGSPAQKGGVL
ENDVVVKVGNRKVADADEFVVAVRQLTIGQDSPIEVVRDGRHVTLTVKPD
PDGS
118467264YP_881750.1 enoyl-CoA hydratase [Mycobacterium avium 104]MTTSEIATLPGYEEFAPWLLVEKRGNVHVVSINRPEAFNAVNEQVHHAFA
TIWRVLTADDDVRAVVTTGVGKAFSAGGDMVMFGRLIDDAVARQFQISEA
RTVFLEVINFPKPLVSAVNGPAVGLGCSIALLSDFLVMGESSYLADPHVA
VGLVAGDGGAAMLPLLIGLMKAKEYVLLGDRITPAIADKLNLVTKVATDD
TVLDEALAIGERLAGLPPQALRASKVAMNMHLSRAALGVLEYALAEEYTS
FSTPEFKERVAAFRARSKK
118467263YP_879901.1 lipid-transfer protein [Mycobacterium avium 104]MLSRKAAIVGIGATDFSKDSGRSELRLAAEAVLDALDDAGLSPADVDGLT
TFTMDTNNETAVARAVGIGDLKFFSQIGYGGGAACATVQQAAIAVATGVA
DVVVAYRAFNERSGMRFGQVQTRLAGDARAQADSTAADNSFSYPHGLSTP
AAQVAMIARRYMHLSGATSRDFGAISVADRKHAAKNPKAYFYEKPITIED
HQNSRWIAEPLRLLDCCQETDGAVAIVVTSVERARDLKQRPAVIEAAAQG
SSPDQYTMVSYYRSELGLPEMGVVGRQLWQQSGLKPTDIQTAVLYDHFTP
FTLIQLEELGFCGKGEAKDFIADGAIEIGGRLPINTHGGQLGEAYIHGMN
GIAEGVRQLRGTSVNPVPDVEHVLVTAGTGVPTSGLILG
118467262YP_881151.1 TetR family transcriptional regulator [Mycobacterium avium 104]MSSGQPSKPQKHSVRTAEIADRAEATRAALIAAGRRLFVEKGYFATGTEE
IVAAAGVGTRGALYHHFANKEALFLAVFLAVQEQVDSQAPRPEYTEDALG
ALRAGLRAYLKSSLTGEVQRILMIEGPAVLGWQRWRELQVQFGLGSIRAL
LEKAVEQGAVTPQPLDVLAHVLLAAADEAARFVANASDPQQARDDAIQVI
DGILQRLGAAN
118467261YP_882038.1 caib/baif family protein [Mycobacterium avium 104]MQMADRLLDAVRVLDLSNGVADAVTRLFADLGADVLKVEPPGGCLGRDAL
PTLRGASIPFAVHNANKRSTVLDPFDDEDCARFLDLAADADIVVDTGVDE
RGAMFGTSAEELAARYPHLVVLSITDFGATGPRSSWRATDPVLYAMCGAL
SRSGPTTGTPVLPPDGIASATAAVQAAWAALAAYYNRLRCGTGDYIDFSW
FDAVVMALDPAFGAHGQAAAGIRRSGRWRGRPKNQDAYPIYPCQDGYVRL
CVMAPRQWHGLRRWLGEPEDFQDPKYDVIGARFAVWPQISELLQKLFAGQ
TMKDLVAAGQAHGVPIAAVLTPSQILGSDHFQAVGAITDAELVPGVHTAV
PSGYFVVDGRRAGFRAPVPAAGRDEPYWRGAPSVVPSPAGRLGDHPFAGL
RILDLGIIVAGGELSRLFGDLGADVIKVESADYPDGLRQARASEAMGESF
AWTHRNNRALGLDLRSAQGKTIFARLVAEADAVFANFKPGTLAALGFSYE
QLRAINPRIVLAESSAFGDTGPWSTRMGYGPLVRATTGVTRLWTSDDARE
HDDDGRHAFYDATTIFPDHVVGRVTAIAALAALIHRDRAGAGAHVHISQA
EVVVNQLDTLYVTQAALAAGVAQIRPDTGLHAVYPCAGDDEWCVISIRSD
DEWRRAAAVFDHAEWADDPRFGTAEARLAHRRELVELVSAWTRTRTPVRA
AELLQAAAVPAGPMNRPPDILEDPQLIARNLYRPMRHPLIDNPLPAETGP
APFRHIPPARQAPAPLPGQDTVAICRDLLGMNTADIRRLIDERVLFGPAD
PAGPAPGPTARPDS
118467260YP_880520.1 aldehyde dehydrogenase [Mycobacterium avium 104]MMIDGKLVDGQAGTFTNINPATEEPLGEVADASKEDMHRAIDAARRAFDE
TDWSTNRELRKRCLLQLHEAIESEKEELREELILEVGSPRAITFGPQLDA
PLEDGLKYPARLIDEYAWETDLGDKVISLTGTLTTRKVWREPVGVVGAIV
PWNFPFEVTLNKLGQALGTGNTVVLKPAPNTPFNATRLGRLIAEKTDIPA
GVVNVVTASDHFVGEELTLSPKVDLISFTGSTVVGQRIMEKGAATMKRLF
LELGGKSATIVLEDADFGMACAIGIAPCMHAGQGCANPTRMLLPRSRYDE
GVAILKGIYENVTCGDPQDPGTLCGPVISQVQRDRVMGYIRKGVEEGATA
LVGGPDAPTGFDKGYYVRPTLFTDVDNSMTIAQEEIFGPVLCVIPFDDEE
DAIRIANDSRYGLAGNVMSGSLERSLSVARRIRAGFMGVNGGAPYGADTP
FGGYKYSGVGRQNGVAGFDQYTEIKSVAYPAG
118467259YP_880894.1 ErfK/YbiS/YcfS/YnhG family protein [Mycobacterium avium 104]MGAVACGGGHTAAPPKVIFDKGTPFADLLVPKLTASVSDGAVGVTVDAPV
TVSVADGVLASVTMVNENGRSISGQLSPDGLRWSTTEQLGYNRRYTLTAK
ATGLGGAASKQMTFETSSPAHLTMPYVSPADGEVVGVGEPVAIRFDENIA
NRAAAQKAITITTNPPVEGAFYWLNNREVRWRPEHFWKSGTVIDVAVNTY
GVDLGDGMFGEDNVKTHFTIGDEVISTADDTTKTVTVRVNGEVVKTMPTS
MGKDSTPTANGIYIVGARFKHIIMDSSTYGVPVNSPNGYRTEVDWATQMS
YSGVFVHSAPWSVGAQGHTNTSHGCLNVSPSNAEWFYDHSKSGDIVEVVH
TVGPTLPGTEGLGDWNIPWSQWKAGNANT
118467258YP_882810.1 hypothetical protein MAV_3632 [Mycobacterium avium 104]MGAGLRRTRRVTRRRLVFRARAVALDVGAVDVGVALPGDLVDQLGVQIVH
GQHVPAPHLVERVRKIHERNENRQRHAQVNVERRRDQPERGQHQHRRHRH
PPHHPGRRALAGQVVAHPVAHRVRQPPAAAIADELNEIRPGAAPVLAHGA
LRTWLSATAAAARPPRAPWP
118467257YP_882019.1 drug transporter [Mycobacterium avium 104]MNAPARADTGSGGERISPQRRNLIFVAIVLGMLLAALDQTIVATALPTIV
ANLGDAGHQSWVVTSYLLASTIVTALVGKLGDLYGRKRVFQAAVLFFVAG
SVLCGLAQSMAMLVGARALQGIGGGGITVTASALIGEVVPLRERGRYQGI
LGAVFGVTTVIGPLLGGYFTDYLSWRWAFWVNVPVSVIVIFVAAAAIPAL
AASAKPVIDYAGIVFVGLGAAGLTLATSWGGSRYPWGSPTIIGLFAAAAV
ALGVFVVVERRAAEPILPVRLFASPVFTVCCVLSFVVGFAMLGAMTFLPT
YMQYVDGVSATTSGLRTLPMVVGMLFTSTGSGTIVGRTGRYKIFPVAGTA
LMALAFLLMSRMQPSTSAVIQSLYLFILGAGIGLSMQVLILIVQNTSDFE
DLGVATSGVTFFRTIGSSFGAAIFGSLFVNFLNRRIGPALAASGAPPGAV
SSPGALHRQPHEVAAPIVAAYAESLTEVFFWAAPVALVGFVLALFLREIP
LRDIHDSTVDLGDAFGMPTTETPDQMLENAIARMLRGETGMRLRSIAMRP
DCRLDVAGLWGVLRINRYTQMYGTARLTDMAEYLRIPFEVLEPTFSRLVT
AGYAGSDGDRLWLTPAGAQQVGYVHSLLLAWLVDKLGRSPGFEGRPDRQA
VQAALERVAYRVLAQRDWHDAQPTAAITAAAR
118467256YP_884323.1 Rieske (2Fe-2S) domain-containing protein [Mycobacterium avium 104]MTDVAKDANSAVAEELSTPMTIGVEAYISEDYARAERDKLWRKVWQQVGR
VEELPEVGSYLTYDILDDSIIVVRTGANEFRAHHNVCMHRGRRLIDTPEG
AKNALGRTRKSFVCGFHGWTYGLDGACTHIREQQDWRQALTPDNTHLRPV
RVDTWGGWLWINMDPDCEPLADYLFPAAKILEPFGLENMRYKWRKWLYFD
CNWKVALEAFNETYHVYTTHPEFNKFGEFKGWAKAQGRHSNIGYDAPEDM
EATKSKIRLGIGADPRVSTAEMQVYTMEETNATTTQTLVNAAKRLVDELP
EGTPADKVLEHWLASARRDDEARGVIWPTIPPDILGQAGTAWQIFPNFQI
GQGLTSALCYGARPHPSYNPDKCIFEVSVFELYPKGEEPQTEWEYTPVGD
PRWRSVLPQDFSNMAAVQQGMKSLGFPGTKPNPYRERSTVNLHYQLSRYM
GTGAPRELSDKEHPLA
118467255YP_881685.1 transposase [Mycobacterium avium 104]MRMVRTLRAELGTEHGTVHRVARQLGYGIESVRAWVRQADIDDGYAPGVS
TAESKRIKDLEQENRELKRANEILKRAASFFGAELDRQHRK
118467254YP_883601.1 50S ribosomal protein L22 [Mycobacterium avium 104]MTTTEFPSAVAKARFVRVSPRKARRVIDLVRGRSVTDALDILRWAPQAAS
EPVAKVIASAAANAQNNNGLDPATLVVATVYADEGPTAKRIRPRAQGRAF
RIRKRTSHITVVVESRPAKDQRSAKSSRTRRAEASKAAAKAPAKKAPAKK
APAKKAPAKTAAKKTPAKTSETSDAKGGSD
118467253YP_880989.1 pyridoxamine 5'-phosphate oxidase [Mycobacterium avium 104]MAALSAEVVEFLSAGTRTGMLGYVAADGRPLVAPIWFVVDDGELAFNTGR
GTAKARAIARDSRVVICVDDPHPPYSFVQVQGVAAVSEDPAEVLDIATRT
GARYMGADRADEFGRRNAVPGELVVRVRPTKVNSAFDVAD
118467252YP_883839.1 transporter- major facilitator family protein [Mycobacterium avium 104MTDSSPPAKGTFTVEMLSRAKRGVTAVFVAHGLLFASWAAHIPQVKAGLG
LDDAALGTALFGAPLGSVLATLAGHWALPRWGSHRLIPVTVAGYAAAGTT
VGLARSGPALFAALALWGMFQGALDVAMNTQAGTVERRAGAPMMARFHGM
WSLGTLAGALIGAACVGAGIGLTAQLTVLGAVVLLVVVMLTRRLLPDAAD
SVAAPPEPAAGRRVTPAVAILAAVSFASFLCEGAATDWSATYLRDVVGAG
PSVAAASYAAYTLTMVVTRFAAGRLHARLPSRRLLPALAVLAVAGMSVTL
ATADAAAGVLGFAALGVGVALLVPTAFSAAYGARGAGSAIAIVAATGWLG
YLLGPPLIGHLSEWVGLSGALVTIPVMMTIVAVAIRYTPAFDTADEFHRA
PAG
118467251YP_880533.1 hypothetical protein MAV_1288 [Mycobacterium avium 104]MTTVVVDNPFFARIWPVVATHETAAVRALRRENVAGLTGRVLEVGAGIGT
NFPLYPETVDEVIAVEPEPRLADRARAAAQVVPVRVVVTGETAEAVGGDE
PFDAVVCSLVLCSVRDPQNVLRRLYSLLRPGGQLRYLEHIASAGARGRFQ
RFVDATLWPRLFGNCHTHRDTERSIVEAGFDVDASRREWTLPAWSPMPVS
ELLLGRAHRPA
118467250YP_883084.1 secreted protein [Mycobacterium avium 104]MGSLRSASINRQIAELASAVAGEDVVVTVFEGLGELPFYNEEIDDAMTSD
APTLAPVAALRAAAADADAALVVTPEYNGSIPAVIKNAIDWLSRPFGDGA
LKGKPLAVIGGSFGQYGGVWAHDETRKSFGIAGARVVESIKLSVPFKTLA
GKAPAEHAELSANVRDVVGKLAAEVG
118467249YP_880180.1 hypothetical protein MAV_0918 [Mycobacterium avium 104]MNGAAPRPRLVIVDGVPMSALVAEAEDPKAVLVAIHGGGTTAVYFDCPGH
PSFSLLRAGATAGFTVVALDRPGYGSSAPYPGAMTRPEQRVELAYGAVDR
ILGQRPRGAGLFLMGHSGGCELVLRMAADERGADLLGIELAGTGRHYHPA
AREILKTATRERRPAGLRELLWHPENLYPPEVLGGATVSPSAPSYEDQMV
SNWARRDFPALAPAVRVPVHFSIAEHEKVWQNDASAMDEIAALFTGAPEF
TVHRQPGAGHNISLGYTAADYHATVLSFANACATAGPAPNVKLASRSASN
VKLASRSAADGEPAADGEPAEDGEQAEDREQAAHETTAAQEEAG
118467248YP_880622.1 hypothetical protein MAV_1378 [Mycobacterium avium 104]MSQALEPVRAHVRAHFCGDEPDSASVTFLGTETIEVLRFRTADGLVHYVS
LGCSRHPMTEPTAEIADPVRGPRAEIVLRLRDPGPVTGIAKSLAILAASP
AVEGAVLVAGALIDLGSPLWASPSARVPFTAVLLGRSDIPDLPLPPPRDP
VQFLSATPITATEAAWVRLKGAEAMRQAWDNDGVDVLDPNRPAAQPD
118467247YP_881088.1 hypothetical protein MAV_1866 [Mycobacterium avium 104]MVVMLFLVVSLTAGIAVPSANADNKRLNESVFVNIYTAQAQNGCPGEPHL
DGRLVEAARVHTLDVLHNRTLGGDIGSDGSTPQDRANRAGFVGKASETVA
INPALAISGIEILNQWWHNPAYQAIMRDCSNTAIGVWSENSLDRSVVVAV
YGQPG
118467246YP_880600.1 hypothetical protein MAV_1356 [Mycobacterium avium 104]MAAMKPRTGDGPLEATKEGRGIVMRVPLEGGGRLVVELTPDEAAALRDEL
KGVTSSS
118467245YP_883198.1 NADH dehydrogenase subunit N [Mycobacterium avium 104]MMTLPTPSIQYFLLCPTLIVFGVAVAGVLAEAFLPRRIRYTAQVTLALGG
LVAALFAVIEVAESLPASGRAAVLGAMAIDRPTLYLQGTVLLVAVMAVIF
IAERTQTKSDSKVAVVAGSGGLDSFTPQASAVPDSDAEREAERAGAAQTE
LFPLAMLSVGGMMVFPASNDLLTMFVALEVLSLPLYLMCGLARHRRLLSQ
EAAMKYFLLGAFSSAFFLYGVALLYGATGTLLLTGIRDALITRGDTSLAL
VGVALLSVGLLFKVGAVPFHSWIPDVYQGAPTPITGFMAAATKVAAFGAL
LRVVYVALPPLHDQWRPVLWTISILTMAVGTITAVNQSDVKRMLAYSSVA
HVGFILTGVIADNHTGLSATLFYLLAYSFSTVGAFAIVGLIRDADGVEDA
TLSHWAGLGQRSPIVGVMFSMFLLAFAGIPLTSGFVSKLAVFKAAAQGGA
VPLVIVGVVASGVAAYFYVRVIVSMFFTEATEDTPHVVAPGILSKAAIAV
CAAVTVALGVFPQPLLDLADQAAQLLH
118467244YP_879968.1 hypothetical protein MAV_0689 [Mycobacterium avium 104]MTPEMVSESEYMSIEFPPSAPNAPSIQFLLKITERIVNLSRETLSFTTVP
VEDTIHPRPLPFEPPLQQYSNGDTKGFRHHWEKLDYVFGLPDPYVFPTIP
LLEDDQVAVERYIRMCRRLAGFSVINHGSTLSVGSDADGVWHVHVVDPPS
DESFLGTSAAFRQLHNDGEPASFINASNALFKAMKTLPEDQQTAIRGTVK
QWRSARSKLQKHTLQTLTALKAGNATLDNPVSYGNINPEELIRTFNYGDS
LHFGSERSQLDDLLVDPRHEAYYRYAALSSIIGLSHLYFGFAVLVDSAIG
GMA
118467243YP_880416.1 hypothetical protein MAV_1168 [Mycobacterium avium 104]MWDGSAMNRLLLKGIELRYVLAMQLAVHGPADIGELIKALDWHGFCVQGR
PSKAVSDALRWEIVHGRVRRLGRGRYGPGGMPRSTEHRIHQRVLALREAA
RCRCEAGT
118467242YP_881653.1 hypothetical protein MAV_2461 [Mycobacterium avium 104]MRRVIQFSTGNVGRHSLRAIIGRPDLELVGVHAAGPEKIGRDAAQLCGLD
EPTGIIATDDIDALVALNADCVVYTSQGETRPMEAIEQMSRFLAAGTNVV
GTSMVWLVAPRHAEEWLREPLQRACEAGNTSLYVNGIDPGFSGDTLVHAA
VSLATRVSSITVQEIFDYGNYDDAEFTGAAMGFGTAPDDDSPMMFLPGVI
VAMWGGQVRSLADHLGVELDDVRQRIERWFTPERIDCTMMTVQPGRMAAV
RFATEGVRDGEPVITLEHVTRLTRAAAPDWEYPPDGHTGVHRVVVAGEPR
VEINTHVSHPLFDSTDAGCISTAARVVNAIDWVCRAPQGLIGVEDIPLAA
TMRGVLWQDR
118467241YP_883192.1 NADH dehydrogenase subunit H [Mycobacterium avium 104]MTTPLTAFGHDPWWLVLGKALAIFVFLMLNVLVAILLERKILGWMQLRPG
PNRVGPWGVLQSLADGIKLALKETITPGGVDKFVYFAAPVISTIPAFTAF
AFIPFGPVVSVFGHRTPLQLTDLPVAVLFILGLSAIGVYGIVLGGWASGS
TYPLLGGVRSTAQVISYEVAMGLSFAAVFLYAGSMSTSQIVAAQDRVWFV
FLLLPSFVIYLISMVGETNRAPFDLPEAEGELVAGFHTEYSSLKFAMFML
AEYVNMMTVSSLATALFFGGWHAPWPLNMWAGANTGWWPVLWFTAKMWTF
LFIYFWLRASLPRLRYDQFMGLGWKLLIPASLVWVLIAAVIRTLQNQGYA
HWTPILVISSIVFAAALVLSLRKPFTTPHIRALRRAAAPPGQAAAHRAGF
HPGIPDTAAAGESAGGRE
118467240YP_881730.1 hypothetical protein MAV_2538 [Mycobacterium avium 104]MEARDDEVEDYDASVDDAAEPDAEDPAPAKKLRSPALLATVFGLVTVVGL
AALGGWFGYQTYQSHQAQQQRELMVRIGRQGALNLTTIDWQHADADVQRI
LDSATGTFYDDFSHRSKPFIDVVKKAQSKSVGTITEAGLESQSGSEAQVL
VAVSVKTSNLGAAEQDPRHWRMRVIVQKVGNDMKVSNVAFVP
118467239YP_879802.1 hypothetical protein MAV_0522 [Mycobacterium avium 104]MVQLAVRAVLAFGGYFYWDDLILIGKAGTHNLLAPSYLFDDHDGHLMPGA
FLLAGTIIRAAPLDWTWPAVSLLVLQLLASLALLRALHVILGWRPVLLIP
FTFALFTPLAVPGFAWWAAALNSLPLLAALAWVCGDAILLVRTGNRRYAL
TGVLVYLGGLLFFEKSAVIPFVAFAVAALLRHVAGDAGPGSALRAVWRAG
LRLWVPSLALTAAWVGLYLAVVNQRRWSSDVVMTGRLLVRSITHGIVPGL
AGGPWHWDRWAPASPWATPPPLVMALGWLALAGVLAVSLLRKRRIGPVWL
TAAGYAVACQVPIYLMRSSKQTALELAQTLRYLPDLVVVLALLAAVALCA
PNRPAGPRWLDASPKRTIVACGLAALFLASSLYSTATFLTSWRDNPAQPY
LRNARAALAAAHAASDAPLLDQEVDPLVLQRVAAPENLASHLFALLRDRP
EFASATTQLRMLDSSGRLIRARVTWVRTITPGPMPQCGYFAQPDRPARLV
LDGPLLPADWTVELNYLANSDGSMTLSMTQGPPVKVPVHPGLNRVFARLP
GAGDAITVRANTTALALCLASGPVGFLAPA
118467238YP_882986.1 morphine 6-dehydrogenase [Mycobacterium avium 104]MIPKSVKPSRIASNFDVFDFDFGAETALTSSRDDGPRLDAHERLTSQAGE
118467237YP_884190.1 NADPH-ferredoxin reductase fpra [Mycobacterium avium 104]MPGEDAVTAPMLYIDPQACVDCGACVEVCPVDAIRHEDELTDEQARFKDI
NAAYFAAQPLTVRPMSPISVPEPLEQGALRVAVVGAGPAGCYAVADLIRT
KGIEVNVFERLPTPFGLVRFGVAPDHQLTKDVTRTFASALSAREVTCFFN
VAVGRDVTHDELMAHHHAVIYAVGATGSRDLGIPGEQLDGVFAAGDMVAW
YNGHPGHADDEFDLSSPRAVIIGNGNVALDVARVLVMNHDDLAATDIAEH
ALTRLRDSAIDEVIVLGRRGAAHAAFSVGELLGLDNLREVDVAIDGDLGD
RPQDFDGAIKYDIIAEYAGRAPRPGHRRIVLRFGARPVEVVGADRVEGLE
IADSEGTTIIGTSLVLRSIGYRGSAVDGLPFDDEAGIVPNDGGRVIRDGH
PVPGVYVTGWIKRGPHGVIGTNRLCARETVANLLADARGGLLPPAVSTTT
ELATLLTSRDVTVVDWAGWRSIDAAERRHGEAVSRPRMKIVGLDALLTTA
RLVDAGLPHHD
118467236YP_881432.1 transposase- Mutator family protein [Mycobacterium avium 104]MSVMDVKRPPRDPSSQPSTESSRSPTMTAPHIVDPAGLLGEALAEASPDL
MRSLLQTVINALLSADADAVVGAEWGQPTPGRRAQRNGYRHRGLDTRVGT
IDVAVPKLRKGTYFPDWLLERRKRAESALITVVADCYLAGVSTRRMDKLV
KTLGIDSLSKSQVSRMATDLDEHVEAFRHRPLDSAGPFTFVAADALTMKV
REGGRVVNGVVLLATGVNGDGHREVLGMRVVTSETGPAWNEFFADLVARG
LAGVRLVTSDAHAGLREAIAANLPGAAWQRCRTHYAANLMSICPKSMWPA
VKAMLHSVYDQPDAPAVAAQFDRLIDYVTDKLPAVADHLATAREDILAFT
AFPKDVWSQIWSNNPAERLNKEIRRRTDAVGIFPNRDAIVRLVGAVLAEQ
NDEWAEGRRYLGLDILTRCRLTTITDDNPDIGANDMPALTA
118467235YP_881073.1 amidohydrolase [Mycobacterium avium 104]MTTQFTEAPIFDADQHMYETPDALTKFLPDKFRPKVQFVQIGRHTRIAIR
NKITDYMPNPTFERVAAPGAHEKFYSGQNTEGLSMREMSGRGIETPPAAR
NPEDRIAELDRQGVDACLNYPTLANLVEHASAEDPDLTVAIIHALNQWML
EHWGFTYANRIYSTPVLNLGLVDEARRELEYILENGAKVALIKPAPVYGY
KGWRSPALPEFDPFWRDVEDAGLPIVLHASQPPLQEYIEKWEPADTANAF
EMSAFKWTALGHREIADMITSLICHGTLTRFPKLRIASVENGSAWIKPLF
DDLEMTYKKMPQNFPEHPHDVFRRNCWVSPFWEGSVADVVETVGWDRVLF
GSDWPHPEGLAEPKRYWQYAEGMDKRRTYDFMGDNARRFMGLPIANPDPD
AVKPPALVNA
118467234YP_879448.1 hypothetical protein MAV_0154 [Mycobacterium avium 104]MSDPITYNPGAVADFATDVASRAGQLQSIFDDTSNRTHALQEFFAGHGAS
GFFEAQAQMLSGLQGLIDTIRQHGQTTSHVLDSAISTDQHIAGLF
118467233YP_881616.1 nitrilase/cyanide hydratase and apolipoprotein N-acyltransferase [MycoMLSQVDGARWLSLEGRSNVNSDVDAVRDAELRYAQRYRTPRPNPRRGGF
118467232YP_880871.1 cytochrome P450 superfamily protein [Mycobacterium avium 104]MNVNAATAACGDDPAERGLAMTTAAVDLSDFSLWCNGFPDELFTELRRTR
PLFHHDLTPGVAATVHRDFWVATKHRHAVRLHRDTESFTAADGPLIQPVA
MFSSSPTIITMDPPELNKRRKLISNAFNPRAIAKLEDGIRARAARMIDNL
LAHGGGDWIEDVADALPMTVIGDILGIPERDRPRIFDLFDRILKALAPDA
HPRGGVELELFASVFDYAMQLTADKRRNPTGDIWSTLATAVITGEDGEEF
RLPANELEFFFFVLAFAGSDTTKNALAIGLQAFLANPGQVERYRADEALR
PTAVEEVLRWASPVAYWTRTAKVDVEMDGQRIAKGERVVSMLRSANRDEE
VFDAPFTFDIGRQPNPHVAFGGGGPHHCLGAMLARAELRAVFDELLLRCD
DIEIGPAKAAYPNLITNMSIYDEMPISLRRR
118467231YP_881722.1 TrnB1 protein [Mycobacterium avium 104]MVESPGTPRLAVAGKPLREVGSYFALTLDIFVQLVHPPFAWREFVHQAWF
VARVSIAPTILLSIPFNALSVFIINVLLVEIGAADASGAGAALASVAYIG
PITTVLVVAGTGATAICADLGARTIREELDAMRVMGINPVQRLLVPRVLA
LCLNGLLLNSINTIVGLVGSFFFSVYFQHVTPGAWAASLTLLVKIADVAI
AFFKAALFGLVAGTIACYKGVTVGGGPQGVGNAVNETVVYTFMALFVINV
VLVAVGTKVTM
118467230YP_884308.1 LysR family transcriptional regulator [Mycobacterium avium 104]MLFRQLEYFVAVASERHFARAAEKCFVSQPALSAAIAKLEKELNVTLINR
GHSFEGLTPEGERLVVWARRILAEHDAFKAEVDAVRSGVTGTLRLGTVPT
ASTTASLLLSAFCSAHPLVKVQILSRLSAGELYRRLREFELDAAIAHTAP
DDIPDVNLVPVYRERYVLLAPADLLASGAATMTWVQAAQLPLALLTPDMR
DRQIIDRAFADHGITLHPQVETDSVASLFAQASAGSWASIVPHTWLWASP
LGPGIRAVELVDPVLTADVVLAIKSHGPGSPIARALAASAGRLQLNDFFD
AQLLGVTRRR
118467229YP_883653.1 RNA polymerase ECF-subfamily protein sigma factor [Mycobacterium aviumMADLDGVFRREWGPAVAALARWSGDLTVAEDAVQEACAEALRAWPRDGMP
ANPGGWLVTVARNRARDRLRRESARPGKELAAVLDDIRARTDAADPHPVR
DDELRMMFTCAHPALDRPSQLALTLRLVSGLTVAEIARALLQSEAAISQR
ITRAKNKVRHANIPLRVPPAELLGERTPHVLGCVYSVFTEGYWSTAGPSA
IRDDLCDEGIRLGAELCALLPHEREAHALSALMLLHDSRRATRVDAHGVP
VPLEEQDRTRWDRRRITAGLDRLRYAEGSSGAYLPQAVIAALHATAPSWE
ETDWVTICAAYDRLWQLTRSPVVAANRALAIGLRDGPDAGLAALEEVDEP
KLERSNLIATLRADLLRRAGRPAEALPWYRIASQSNGSEPGREFLRRRIA
ECTSAAESATGDAFPENGRR
118467228YP_879879.1 acyl-CoA dehydrogenase [Mycobacterium avium 104]MDLDLDEGTLAFRDEVRQFLSANAEAIPTKSYDNAEGFEQHRRWDRVLYD
AGLSVITWPKKYGGRDAPLLHWVVFEEEYFRAGAPGRASANGTSMLAPTL
FAHGTEEQRDRILPKMASGEEIWAQAWSEPESGSDLASLRSTATPTDGGW
LLNGQKIWSSRAPFAERGFGLFRSDPSAERHHGLTYFMFDLKAEGVTVRP
IVQLGGDTGFGEIFLDDVFVPDRDVIGTPHQGWRAAMSTSSNERGMSLRS
PARFLATAERVVRLWQDRGSPAEFADRVADGWIKAQAYRLQTFGTVTRLA
AGGELGAESSVTKVFWSDLDVELHQTALDILAADGELAGPWTEGLLFALG
GPIYAGTNEIQRNIISERLLGLPREKSGSKK
118467227YP_883360.1 mannose-6-phosphate isomerase- class I [Mycobacterium avium 104]MELLRGALRTYAWGSRTAIAEFTERPVPAAHPEAELWFGAHPGDPAWLET
DNGEITLLDALRADPEGQLGPGSRARFGDVLPFLVKVLAADEPLSLQAHP
SAEQAAEGYLREERLGIPLNSPVRNYRDTSHKPELLVALYPFEALAGFRP
ASRTVELLRALAVSDLDPFIELLGDQSDADGLRALFTTWITAPQPDIDVL
VPAVLDGAIAYLSSGATEFAAEAKTVLELGERYPGDAGVLAALLLNRVSL
APGEAIFVSAGNLHTYLRGFAVEVMANSDNVLRGGLTPKHVDVPELLRVL
DFAPTTEDQLRPRVRREGFGRIYETPTDEFAVALLELEDEYVGHEVDATC
SHDGPQILLCIQGCTTVHGKSGSLRLKRGMAAWVAADDAPIRLVAHEPTK
LFRATVGL
118467226YP_883033.1 tRNA-specific 2-thiouridylase MnmA [Mycobacterium avium 104]MSGGVDSSVAAARMVDAGHDVVGVHLALSTAPGTLRTGSRGCCSKEDASD
ARRVADVLGIPFYVWDFAEKFQADVIDEFVSAYARGETPNPCVTCNQKIK
FSALSAKAVALGFDAVATGHYARLSGGRLRRAVDKDKDQSYVLAVLSAEQ
LRHAAFPIGDTPKPQIREEAARRGLAVAEKPDSHDICFIPSGNTRAFLGE
RIGVRRGAVVNADGTVLAEHDGVHGFTIGQRKGLGIAGPGPDGRPRYVTA
IDADTATVRVGEAADLDVREMLGRAVVFTSGTAPSGPFECAVQVRAHGET
ADAVAELVGDELVVRLRAPLRGVAPGQTLALYRHDPDGDEVLGSATIAGT
SR
118467225YP_879584.1 hypothetical protein MAV_0295 [Mycobacterium avium 104]MLLGLLHLQRNLHQGIESRGVSTGGHHQDMSDENDLEMTDAERASLAASR
AAIGDLAHALVEGADPEEAEAALAAVRQASSQLDREALLNKIHMPDDAAG
FEDDLRAIMRRIPPNWGRWVGCSRGWYPIIIALDQALAAIDPAYELHQVK
EKFGGLRFYFHASESITEADRQRMEQLVDEAEEKCERTCELCGEPGVRHV
TPRGWYRTLCSTCAAAEGKGYERVGELVNNLTAGTTGVWRVGCYADAPES
IWDLDRGEVTVGSDRHRDFEVLAYPSVLRTWRIRLADGTEVESGVIAAIE
RVR
118467224YP_883658.1 (3R)-hydroxyacyl-ACP dehydratase subunit HadC [Mycobacterium avium 104MALKTDIRGMIWRYPDYFVVGREQLRQFALSVKNRHPAHFSEDAAAELGH
DAIIAPLTFATIFAKLVQLDFFRHVDIGMETLVIVQVDQRFVFSKPIKAG
DKLWARMDIVSVDERFGADIVVTKNICTNDDGELVLEAYTTLMSQFNGDQ
SAKLRWDSESGQVVRTA
118467223YP_883542.1 dTDP-4-dehydrorhamnose 3-5-epimerase [Mycobacterium avium 104]MSARELKIPGAWEITPTVHGDARGHFFEWLTDKGFRSFAGHRLDVRQANC
SVSAAGVLRGLHFAQVPPSQAKYVTCVRGSVFDVVVDIRVGSPTFGQWDS
VLLDDAEHRTIYISEGLGHGFLALQDNSTVMYLCSAEYNPGREHTICATD
PALGIDWPLVAGAAPTLSERDAAAPSLEEVRASGLLPTWAETQAFIEGLP
R
118467222YP_883727.1 hypothetical protein MAV_4598 [Mycobacterium avium 104]MEILASRMLLRPADYQQSLTFYRDRIGLAIAREYSGGTVFFAGQSLLELA
GYGAPDHSGGPFPGALWLQVRDLEATQAELRGRGVAIAREARQEPWGLHE
MHVVDPDGITLIFIQIPADHPLRRDTRGERQAKPG
118467221YP_879601.1 thiopurine S-methyltransferase (tpmt) superfamily protein [MycobacteriMTQPDTDWDAAYRQAAPPPWSIGRPQPELERLIDEGKFRSDVLDSGCGHA
ALSLRLAALGHTVVGLDASATAIAEATAAAAAQGLTTATFARADVTDFAD
YPPGSEGRFATIVDSGLFHALPPQRRQDYLRSIFRAAAPGAALYILAFAA
GALAPAHPDRPGPQGFTETELREAVSVLWHIDDLRAARVYGNDDSAGAPD
SPLAHLERDGEGHFMAPGFLVSAHKRD
118467220YP_880039.1 phosphate ABC transporter permease [Mycobacterium avium 104]MTSMLDRPLKSRTFSPLSRRRRAANSVATVLVSVSLLVAVTPLVMVLCSV
VVKGFRAITSTVWWSHSQAGMTAFVTGGGAYHALVGTVLQGLVCAAISIP
IGLMVAIYLVEYGGGTPLGRLASFMVDILSGVPSIVAALFVYALCVATLG
LPRSEFAVSLALVLLMLPVIVRATEEMLRIVPVDLREASYALGITKWKTI
ARVVLPTGLSGIVTGILLAMARVMGETAPLLILVGYAQSMNFDIFSGFMG
TLPGMMYNQASAGAGINPIPTDRLWGAALTLILVIATINIVARVITKFLG
ARKS
118467219YP_883264.1 hypothetical protein [Mycobacterium avium 104]MTVPHTMPKTTAAFFVQAAVAFAISFVAALGGIYFLPLDPWPRLFLGVTF
LFLVSSAFTLAKVIRDQQEAATVRVRLDEARIERLLADYDPLNTAN
118467218YP_881669.1 sugar ABC transporter permease [Mycobacterium avium 104]MTALDTEAGRRTPKNPSPWRRHAWAGRLFVAPNMVAVAVFMLFPLGFSLY
MSFQRWDVFTPPKFVGLKNFTDLFSSDPLFLIAIRNTVIFTLGSVVPTVA
ISLAVAGVLNQKVRGIGIFRTIVFLPLAISSVVMAVVWQFVFNTDNGLLN
IMLGWVGLGPVPWLVEPRWAMASLCIVSVWRSVPFATVVLLAAMQGVPET
VYEAARIDGAGEIRQFFAITVPLIRGSISFVVIISIIHAFQAFDMVYVLT
GPSGGPESATYVLGIMLFQHAFSFLEFGYASALAWVMFAVLLVLTVVQLR
VSHRRSLETSRGLK
118467217YP_880104.1 hypothetical protein MAV_0831 [Mycobacterium avium 104]MTDEDEWRAAVADMSEMDRAVTEYECRRALGLCGDREDARYE
118467216YP_884026.1 hypothetical protein MAV_4905 [Mycobacterium avium 104]MTGASSAGYSYKHESTTLKFQLAVRRQRTINHSRSCEL
118467215YP_879893.1 AclJ protein [Mycobacterium avium 104]MNSPMTGFFIKWMSRVNTWMYRVSRGKWGGTFQKRPVALLTTTGRKTGQP
RVSPLLYLREGDRVILVASQGGRDKHPLWYLNLKANPKVSVQIKDEVLQL
QARDATPEEREQYWPKLVAMYPSFDDYQSWTDRVIPVVICDP
118467214YP_881259.1 hypothetical protein MAV_2041 [Mycobacterium avium 104]MRTARLLAVLAALLTVGLSAGLLAPPAGAQPPLRLSDYLTDTAGVLSDSG
RKAITTAVDKLYTDRHIRLWVVYVDTFSGQTATRWAQDTLRTSDLGDYDA
LLAVATTDRAYAFLVPPTIRGVNQSRVDALRHNKIEPALHDGDWSGAAVA
AATGLDTAPGSSGRVILLATLAALLVAVMGLLLVMRYRGRRRRAAALAAA
RRLDPTDLDALAALPLPTLDDLSRALVVDVDNALRTSANELDLAVAEFGD
QRTQPFTQAVTNAKAALSQAFTVRQQLDDGMPETPAQRRELLTQVIVSAA
RADRELESQTEAFEGLRDLVINAPSRLDGLTQQYVELTARIGPAEQQLAA
LHNEFSAAALTSVSGNVTAAKERLAFADRNIGTARELAGQAVSGQQGRLV
DAVRAAESALGQARSLLDAVDHAAGDIRHAIDQLPSAMADIENDIKRAAE
LLAATRDTKSGHAAELAAARDAATRAVEGARAGAPDDPLGAFGQLTKADA
GLNAVLAAVAQERAAAERLARSLEQALFTAQSRVRAVSDYIDTRRGSIGP
EARTRLAEAQRHLHAAADRRATDPADAIAHANAASTLAAEAQSLANGDVQ
AARRAYPRGGGGDMGAMLGGIIIGDLLSSGMRGGFGGWSPASFGGSTSSS
GGGVLGGGGRF
118467213YP_880094.1 hypothetical protein MAV_0821 [Mycobacterium avium 104]MTLVNLWSQDFKEHIARTVATVEPQQIPLLPVSDLAGNIIRAAELVDGIH
LTITGLTPEFRCKLVAGLNGVLTIEEHPAFAFVYTQAHWDGATMHITAVP
YVTYLRRSCLPDWYVPDERFC
118467212YP_879927.1 hypothetical protein MAV_0648 [Mycobacterium avium 104]MNGAQALIRTLVDGGVDVCFANPGTSEMHFVAALDSVPRMRGVLALFEGV
ATGAADGYARIADRPAAVLLHLGPGLGNGLANLHNARRARVPMVVVVGDH
ATYHKKYDAPLESDIDALAGSVSGWVRRTSDASQVSADAVEGIAASRWGS
QISTLILPADVSWSDGAQLFSTMDARPAGADPLLAPEVVEVLRSGEPTVI
LVGGDATRRAGLAAAARIAAATGARVLCETFPTRLERGAGIPAVERLAYF
AEAAAAQLDGAKHLVLAGAKSPVSFFAYPGMPSDLVPAGCEVHVLAGHTG
AADALSALADQLAPGTAAPVAAASRPALPTGPLTSVSAADVIGALLPERA
IVVDESNTSGVLLAQATAGAPAHDWLTLTGGAIGYGIPAAVGAAVAAPDR
PVLCLESDGSAMYTISGLWTQARENLNVTTVLYDNSAYDILRIELQRVGA
GSAPGPEALSLLDLSDPAMDFVKISEGMGVPARRVSTAEEFADALRAALA
EPGPHLIDAVVPSIAG
118467211YP_883636.1 DNA-directed RNA polymerase subunit beta' [Mycobacterium avium 104]MLDVNFFDELRIGLATAEDIRQWSYGEVKKPETINYRTLKPEKDGLFCEK
IFGPTRDWECYCGKYKRVRFKGIICERCGVEVTRAKVRRERMGHIELAAP
VTHIWYFKGVPSRLGYLLDLAPKDLEKIIYFAAYVITSVDEEMRHNELST
LEAEMMVERKAVEDQRDADLEARAQKLEADLAELEAEGAKADARRKVRDS
GEREMRQIRDRAQRELDRLEDIWNTFTKLAPKQLIVDENLYRELVDRYGE
YFTGAMGAESIQKLIENFDIDAEAEQLRDVIRNGKGQKKLRALKRLKVVA
AFQQSGNSPMGMVLDAVPVIPPELRPMVQLDGGRFATSDLNDLYRRVINR
NNRLKRLIDLGAPEIIVNNEKRMLQESVDALFDNGRRGRPVTGPGNRPLK
SLSDLLKGKQGRFRQNLLGKRVDYSGRSVIVVGPQLKLHQCGLPKLMALE
LFKPFVMKRLVDLNHAQNIKSAKRMVERQRPQVWDVLEEVIAEHPVLLNR
APTLHRLGIQAFEPMLVEGKAIQLHPLVCEAFNADFDGDQMAVHLPLSAE
AQAEARILMLSSNNILSPASGRPLAMPRLDMVTGLYYLTTEVEGDKGEYR
PAAKDTPEVGVYSSPAEAIMAADRGVLSVRAKIKVRLTQLRPPAEIEAEL
FGANGWQPGDAWMAETTLGRVLFNELLPVGYPFVNKQMHKKVQASIINDL
AERYPMIVVAQTVDKLKDAGFYWATRSGVTVSMADVLVPPRKKEILDQYE
ERAEKVEKQFQRGALNHDERNEALVEIWKEATDEVGQALREHYPADNPII
TIVDSGATGNFTQTRTLAGMKGLVTNPKGEFIPRPVKSSFREGLTVLEYF
INTHGARKGLADTALRTADSGYLTRRLVDVSQDVIVREHDCETERGIVVE
LAERQPDGTLIRDPYIETSAYARTLGTDAVDEAGNVIVARGEDLGDPEID
ALLAAGITSVKVRSVLTCTTGTGVCATCYGRSMATGKLVDIGEAVGIVAA
QSIGEPGTQLTMRTFHQGGVGEDITGGLPRVQELFEARIPRGKAPIADVT
GRVRLEDGERFYKITIVPDDGSEEVVYDKLSKRQRLRVFKHEDGSERVLS
DGDHVEVGQQLMEGSADPHEVLRVQGPREVQIHLVREVQEVYRAQGVSIH
DKHIEVIVRQMLRRVTIIDSGSTEFLPGSLIDRAEFEAENRRVVAEGGEP
AAGRPVLMGITKASLATDSWLSAASFQETTRVLTDAAINCRSDKLNGLKE
NVIIGKLIPAGTGINRYRNIQVQPTEEARAAAYTIPSYEDQYYSPDFGQA
TGAAVPLDDYGYSDYR
118467210YP_883433.1 thymidine phosphorylase [Mycobacterium avium 104]MRPGFDAPTVIRTKRDGGRLSDAAIDWVIDAYTRGLVAEEQMAALLMAIL
LRGMDGGETAAWTSAMLASGDRLDFSDLGVPTVDKHSTGGVGDKITLPLV
PVVAACGAAVPQASGRGLGHTGGTLDKLDAIAGFSAQLPSRRVREQLREV
GAAIFAAGDLAPADAKLYALRDITATVESLPLIASSVMSKKLAEGAGALV
LDVKVGSGALVKTEEQCRDLAHTMVGLGAAHGVPTRALLTDMNRPLGATV
GNALEVAEALEVLAGGGPPDVVELTLRLAAEMLALAGVGDRDPADTLHDG
TAMDRFRRLVAAQGGDLSVPLPIGRHSETVTAPRGGTMGDIDAMAVGLAA
WRLGAGRSRPGERVQAGAGLRIHRRPGEPVAAGEPLFTLHTDTPERFGAA
LAELDGGWNVGDGAPAPRPLIIDRIVT
118467209YP_882125.1 hypothetical protein MAV_2938 [Mycobacterium avium 104]MSVSSELEPETAWKLASDLDRFGEWMTIFAGWRGPVPDTIGEGTRVASCV
KVKGFRNVIHWTVTRYDQPKSIELQGRGRGGIRLTVAMTVTDDHPGSVFH
LTADIDGGVLSGPIGGLVARVLRSDVHKSVHNLAALQPSGPSAPGG
118467208YP_881752.1 GntR family transcriptional regulator [Mycobacterium avium 104]MEVTSLREPKMADRVATVLRRMFIRGEITEGTMLPPESELMERFGVSRPT
LREAFRVLESESLIQVQRGVRGGARVTRPRRETLARYAGLILEYEGVTVK
DVYDARVTLEVPMVEQLAKDRNPKVIAELEQIVERESQLNPGSEAVDQLT
DFHAAIARLSGNSTLQIVSDMLHHIIEKANRSLQPTKGTRAEQAVRRSAK
THRMVLDMIKEGDAEKAGELWKRHLQKAEEFVLTGAELSTVVDLLE
118467207YP_880554.1 TetR family transcriptional regulator [Mycobacterium avium 104]MQRTLPAAVVRLLRREAADRNAHGYYQEMPQLTDRTGSRSRRRGEVLERA
LYEATLAELTEVGYGGLTMEGIAARAHTGKAALYRRWDTKCELVHAALVF
ALPPVPELRSGRSARENLLAMFTAQRDLLAGKTAFPGIEVIQQLLHEPEM
RAIFADAVVRPRLKIVESILQSAVQDGDLDPKSITPLTARIGSALINQHF
LLNGSPPNRRELALIVDTVIPPRGSDRAAD
118467206YP_881941.1 Fur family transcriptional regulator [Mycobacterium avium 104]MADLRVTRPRVAVLEVVDANPHADTETIFSAVRMALPDVSRQAVYDVLNA
LTAVGLVRRIQPLGMVARYESRVGDNHHHVVCRSCGTIADVDCAVGEAPC
LTPSDDDNVLDGFVLDEAEVIYWGLCADCSTAGS
118467205YP_884080.1 hypothetical protein MAV_4959 [Mycobacterium avium 104]MTNPPAPPGGSPEWQGQQPEWQQPEGQGQQPPWQGQPPPAWQAPQPGGWP
GQQPGAWPPPQPGWQVAPEPENYLVWAILCTVLCCLPLGIVSIVYSTKVS
GLWAQGRYAEAQEAANNAKKWAIIGAIVGAVAAVIFVLIYVVAGVFVVSH
LPSTTTTTYSGF
118467204YP_883665.1 enoyl-CoA hydratase [Mycobacterium avium 104]MSGPVHYSTKGPVAVIRMDDGKVNALGPTMQQALGEAIDRAEADNAGALV
ITGNERVFSGGFDLKILTSGEVQPAVNMLRGGFELAYRLLSYPKPVVMAC
TGHAIAMGAFLLSSGDHRVAAHAYNIQANEVAIGMVIPYAAMEIMKLRLT
PSAYQQASGLAKTFFGETALAAGFVDEIVLPEVVVDRAEEAAAEFAELNQ
RAHAATKLRARADALAAIRAGIDGIEAEFGL
118467203YP_882723.1 amidohydrolase [Mycobacterium avium 104]MATTWDTLDRYIVISTDTHAGADLYGYKPYLPARLHDEFDAWAKAYASPF
DDLIVATANRNWDHELRIGEMDADGVAAEVLLPNTVPPFFPTTPNITISL
PRTRAEFEKRWAGVQAHNRWQVDFCSLAPDRRRGLIQIFPNDVELAMEEI
RWGARQDCFGGVLIPPVSPGDSQVAPLFHTRYEPLWALCAELDLTVVQHA
GAGSPEMPMDQPASNAVLITEMALWAQRTLGHLILAGVFERYPTLRFVPT
EQGTLWVPAQLGVLDAMVPTMKSDAHNRTYGMFGGSSVDALTLTPSEYVQ
RNCYLASELMPYDGAMIDFMGPDHIMWGSDYPHEEGFAPHSKLAIRWALH
DRPEDACRKILGGNAARLYRFDLDKLIPVAAKIGPTVEEVRTPVPDTGYR
APAAFGYRPFEGGLALKRLAPQRG
118467202YP_883814.1 hypothetical protein MAV_4686 [Mycobacterium avium 104]MLRTLTPQTIAAALGGLATGYVLWLLAISNGDNATVGQWGPLVLVASVVL
GGAAAVWGAWQRRRGSRPRAAFAFALPVLPVLLTLAILADVYL
118467201YP_881035.1 3-hydroxyacyl-CoA dehydrogenase type-2 [Mycobacterium avium 104]MTIKQFEGASAIVSGGAGGLGEATVRRLHADGLGVVIADLAAEKGKALAD
ELGNRAEFVSTNVTSEDSVLAAIEAANQLGRLRYAVVAHGGFGVAQRIVQ
RDGSPADMGGFTKTIDLYLNGTYNVARLVAASIAAAEPRENGERGALVLT
ASIAGYEGQIGQTAYAAAKAGVIGLTIAAARDLSSAGIRVNTIAPGTMKT
PIMESVGEEALAKFAANIPFPKRLGTPDEFADAAAFLLTNGYINGEVMRL
DGAQRFTPK
118467200YP_881230.1 erythronolide synthase- modules 1 and 2 [Mycobacterium avium 104]MTPMSENGFDAAGIDPVVIVGMGVEAPGGIETAEDYWELLAHGREALGPF
PTDRGWAVSELLAGSRRSGFKQIHDRGGFLSGAATFDPEFFGISPREAVV
MDPQQRVALRVAWRALENSGINPDDLAGEDVGCFVGASATGYGPEMARFS
EHSGHLLAGTALSVISGRIAYTLGLTGPALTVDSSCASALVAFHVAVRAL
QNGDCDLALAGGVNVLGSPGFFVEFSKQHALSDDGHCRPYSAQASGTVWA
EGAAMFVLQRKSAALQAGRRVVAEVRATAINQDGRSAGLSAPSGDAQVRL
FRRALGESGVKPAEVGMIEGHGTGTRLGDRTELRSLAQTYGDTEPGAGAL
LGSVKSNLGHSLAAAGALGLAKVLVSAEHGAVPPTLHATEASGEIDWEHQ
GLRLAQTLTPWPAIDGQRTAAASAFGIAGTNAHLIVSMPEVA
118467199YP_880227.1 enoyl-CoA hydratase/isomerase [Mycobacterium avium 104]MVDLEIDDGLAVLTIDRPHARNAIALDTMDQLEKALDAAAGAQALVITGA
GDRAFVSGGDLKELSALRTEEDAAAMARRMRAICDQLADFPAPVVAALNG
HAFGGGAEVAVAADIRVAADDIKIAFNQVALEIMPAWGGAERLAALVGQS
RALLLAGSGTALDAVEAERIGLVDRVLPRDVFDSAEQGWRSIARSLARRP
AAEIKRVIRGVSPEEAIASFARLWVADPHWQAAERVMARNTKPRPAAGGA
S
118467198YP_881536.1 UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase [MycobacterMIDLTVAQIADIVGGTLADITAPDAARRRVTGTVEFDSRAVGPGGLFLAL
PGARTDGHDHAESAVAAGAVAVLAARPVGVPAIVAPPVDAADALAGVLEH
DADGSGAAVLAALAKLARAVAAELVAGGLTIVGITGSSGKTSTKDLVAAV
LAPLGEVVAPPGSFNNELGHPWTVLRATADTDYLVLEMSARHPGNIAALA
EIAPPAVGVVLNVGTAHLGEFGSREAIARTKSELPQSVPASGVVVLNVDD
PTVAAMAEVTAARVVRVSRAEHTEAGPSDVWAGPVSLDELARPGFTLYHS
HAGGTRQARVQLGVSGDHQVGNALCAAAVALECGATVEQVVAALAGAGPV
SRHRMQVSTRGDGVTVIDDAYNANPDSMRAGLQALAWIARGGAEPGAPAR
RSWAVLGEMAELGDDAIAEHDRIGRLAVRLDVSRLVVVGTGRSVSAMHHG
AVMEGSWGSADKGAVNVPDAEAALELLRAELQPGDVVLVKASNAAGLGAL
ADALARDDREGGAAGRSGSSPLARDDSAGGTRR
118467197YP_882294.1 Pks10 protein [Mycobacterium avium 104]MSVIAGVFGALPPHRYPQRELTDFFVSIPEFEGYEDIVRQLHASAKVGSR
HLVLPLEQYPTLTDFGVANRIFIDHAVTLGCAALSGALDEAGLKPEDLDV
LITTTVTGLAVPSVDARIAARLGLRDDVRRVPLFGLGCVAGAAGVARMHD
YLRGAPDAVAALVSVELCSLTYPGYKPSLAGLVGSALFADGAGAVVAVGE
RRAEQLDAAGPSVLDSRSHLYPDSLRTMGYDVGATGFELVLSKDVAAVVE
QYIEDDVTGFLGAHGLTTNDIGAFVSHPGGPKVIEAINAALGLPPEALEL
TWRSLGEIGNLSSASVLHVLRDTLAKPPPSDSPGLMLAMGPGFCSELVLL
RWH
118467196YP_882910.1 acyltransferase domain-containing protein [Mycobacterium avium 104]MRARIGYPEFMSNPDHRPTQVRAQAQRHAAETRAAMQERRNGQRGGLSGW
VAERAARWDLSGQDEDTLQRQKYLWNALVDYWFRMEIDGWENLPDTPPAL
LVGVHSGAPFVWDAWTVGLQWWRRFGPDRPLHGTAHDALMAIPLFGRYFR
SMGVLPAAPDAIATALAEGRDVALWPGGEVDSLRPWTERDRANLAGRTGF
VKMAIRAGVPIVPIATVGGADAMPVLIRGDRLSKALRLDRLLRLKVFPLA
ISLPWGIAPAALPQLPLPAKIRTRFMPPVELDNDPARVQDDEYVERKYRE
VQDSIQQGMDALARRRAFPVFG
118467195YP_881342.1 transferase [Mycobacterium avium 104]MTFNPFEELTLDQLRLRTSMKWRAHPADVLPLWVAEMDVKLAPTVAQALR
TAIDHGDTGYPCGTAFAEAVSEFAARRWQWHDLDVSRTALVPDVMLGAVE
VLRLVTDPGDAVVVNPPVYAPFYAFVSHDGRRVVEAPLDDGGRIDLGALE
EAFAHARAGNTAKVAYLLCNPHNPTGSVHTAAELRGVAELARRFGVRVVS
DEIHAPVILPGSRFTPFLTVAGAENAFALTSASKAWNLSGLKAALAIAGP
EAAADLNRMPEEVSHGPSHLGVIAHTEAFRSGDGWLDATLQGLDQNRALL
GELVAEHLPGVKYQWPQGTYLAWLDCRELGFAEDAAQGLAVVADLSGPAR
WFLEHARVALSSGHVFGTGGAGHLRLNFATSRAILTEALSRMGRALAARS
G
118467194YP_883381.1 two-component system response regulator [Mycobacterium avium 104]MTTAGRAIDILLVEDDPGDELITREAFEHNKLNNRLHVAHDGEEGLNYLY
RRGEFADAPRPDLILLDLNLPKYDGRQLLEKIKSDPDLAQIPVVVLTTSS
AEEDILKSYKLHANAYVTKPVDLDQFMKAVRQIDEFFVQVVRLPSA
118467193YP_882419.1 2-nitropropane dioxygenase- NPD [Mycobacterium avium 104]MRTRVAELLGVEFPICAFSHCRDVVAAVTNAGGFGILGATAHSPQRLDNE
LNWIEQQTGGKPYGVDLLLPPKYVGAEQGGIDAGQARTLLPDEHRAFVDD
LLARYGVTAPAADIRAGGLNISPKTYQPLLDVAFAHDIRLIASALGPPPP
DLVERAHDRDVLVAALAGTTAHAQRHAAAGVDLIVAQGTEAGGHTGEVAT
MVLVPEVVDAVAPVPVLAAGGIARGRQIAAALALGAEGVWCGSVWLTTEE
AETVPVVKEKFLAATSSDTVRSRSMTGKPARMLRTAWTDEWDRPENPDPL
GMPLQTALITEPQLRINAAATQPGAKARELATYFVGQVVGSLDRIRPARA
VVLDMVEEFIDTVGRLDGLIEN
118467192YP_884069.1 TetR family transcriptional regulator [Mycobacterium avium 104]MPTTKQQAPAKRGGTRTKMLASAAEVMRERGAAGVTIDAVLARSGAPRGS
VYYHFPDGRNQILAEALRYSGDSITALIDQAAGRGGRALLREFVEYWERL
LTEGGFTAGCPVVAAAIGCSEDEGPKLSAEAGAILGRWCTALTRAFVNDG
FDDADAASLAVMSIAALEGGIVLSRSTRNAGPLHQVGEQLEFLIKAREFV
VRNKIPGKQPGSR
118467191YP_879992.1 phosphoribosylamine--glycine ligase [Mycobacterium avium 104]MRVLVIGSGAREHALLLALRKDPQVTGLAIAPGNAGTARLAEQHDVDITS
APDVVALARAVRADLVVIGPEVPLVLGVADALRAAGIVCFGPGKDAARIE
GSKAFAKEVMAAAGVRTAASEIVDTPAHLDAALDRFGPPAGEAAWVVKDD
RLAAGKGVVVTADREVARAHAAALLEAGHPVLLESFLDGPEVSLFCIVDG
ETVVPLLPAQDFKRVGDADSGPNTGGMGAYAPVPWLPDRVYRDIVHRIVE
PVAAEMVARGCPFSGLLYAGLAITSNGPAVVEFNCRFGDPETQAVLALLE
SPLGQLLYAAGSGTLADFGELRWHNGAAVTVVLAAENYPGRPRVGDVITG
SEAEGVLHAGTARREDGEIVSSGGRVLSVVGTGPDLAAARAKAYQILGSI
RLPGSHFRTDIAQSAADGKIRV
118467190YP_883991.1 PE family protein [Mycobacterium avium 104]MTLRVVPEGLAATSAAVEALTARLAAAHAAAAPAITAVVPPAADPVSLQT
ALGFSAQGQEHSAVAAQGVEELGRAGVGVGEAGASYLAGDTAAAATFGIA
GA
118467189YP_883645.1 FabD2 protein [Mycobacterium avium 104]MSGHPVATVAGVPVSSVEVDAAEARLRGGRGAAALPPPGTSEGRQLRRWL
TQLIVTRRVIAAEAAARGLTPAGAPNEAELLPDVTARLEIGSVAAAVLAD
PLARALFADVTAAVDVAERELAAYHARNPLRFAPSQPVQNVWRTTALVAP
PLDEVRPAIREQLRGAARRRAFRLWLDERRAALVRLAPGYEHPGDPRQPD
NTHRH
118467188YP_880264.1 hypothetical protein MAV_1005 [Mycobacterium avium 104]MSGRRQGDPGRVAAKPGRRPGNSAAAPHPGAANYPAGDTGDRRTRRPPPM
PSANRYLPPLGHQPQPDRGAGAPPRGPVAGERITVTRAAALRSREMGSRM
YWMVQRAATADGADKSGLTALTWPVVANFAVDAAMAVALANTLFFAAATG
ESKGRVALYLLITIAPFAVIAPLIGPALDRLQHGRRVALAASFVLRTALA
AVLIMNYDGASGSYPSMVLYPCALAMMVLSKSFSVLRSAVTPRVMPPSID
LVRVNSRLTMFGLLGGTIVGGAIAGGVEFVCTHLFKLPGALFVVVAVTVA
GASLSMRIPRWVEVTAGEVPATLSYRRDSEPLRRRWPEEVKNVPKKATAT
LRQPLGRNIITSLWGNCTIKVMVGFLFLYPAFVAKAHQANGWAQLAMLGM
IGAAAGVGNFVGNFTSARLKLGRPAVLVVRCTVAVTAVALAASVAGNLML
AVIATLVTSGASAIAKASLDAALQDDLPEESRASGFGRSESTLQLAWVLG
GALGVLVYTELWVGFTAVTALLILGLAQTLVSFRGNSLIPGLGGNRPIMV
EQEGARRGVGRPAVVAE
118467187YP_879820.1 dioxygenase [Mycobacterium avium 104]MRLDHVVLWTRNPRVSMDFYTRVVGLEPVRFAEFEAGEAPFPSVRICADS
IIDLMPLEMVSGAASSGVAEGSAGNPVNHVCIALSKAEYDALEARLQAEG
VDTGVRLSRSFGARGWSPHTYYFADPDGNVVEARYYE
118467186YP_881262.1 DNA primase [Mycobacterium avium 104]MSSPAGSRAPGDGRARGRGRIPDRDIAAIRERVRIDEVVGDYVQLRRAGA
DSLKGLCPFHDEKSPSFHVRPNHGHFHCFGCGEGGDVYAFLQKIEHVSFV
EAVELLADRIGHTITYSGPATSVQRDRGSRSRLIAANAAAAEFYAAALES
DEAAPARQYLTERNFDAEAARHFGCGFAPSGWDTLTKHLQRKGFEFKELE
AAGLSRQGRRGPMDRFHRRLLWPIRSSAGEVIGFGARRLFDDDPMEAKYI
NTPETLLYKKSNVMFGIDLAKRDIAKGHQAVVVEGYTDVMAMHLAGVTTA
VASCGTAFGDEHLAMLRRLMMDDSFFRGELIYVFDGDAAGRAAALKAFGG
EQNLAGQSFVAVAPDGMDPCDLRLRSGDAALRDLVARRTPLFEFAIRSAL
AELDLDSAEGRVAALRRCVPMVAQIKDPTLRDEYARQLAGWVGWSDVAQV
IDRVRSQSKHSAGAGRGGSGGRVSRRAEQSAAPAGPAASRPDPRDPTLWP
QREALKSALQYPALAGPVFDSLTVESFTHPGYAAVRAAIEAAGGTSSGVT
GGQWIEAVRDRASSPLTAGLISELGVEAIQVDDEKLPRYIAGVLARLQEV
WMGRQIAEVKSKLQRMSPIEQGDEYHALFGDLVAMEAYRRSLLEQASGDD
118467185YP_883298.1 alpha/beta hydrolase [Mycobacterium avium 104]MTATLHVHRYGPPGPARILALHGLTGHGQRWQHLAGLLPEFAWAAPDLVG
HGRSSWSAPWTIDANISALADLLDAQAGAPVLVVGHSFGAGLAMHLAAVR
PDRVAGLLLLDPAIGLDGAWMREIAEAMLASPDYPDAEEARLEKLHGSWS
DVEPALLDAEIDEHLIELPNGRYGWRVCLPAMMSYWSELARDPVLPPAQT
ATILVRAKRTAPPYVGDELIAALQDRLGSRFRLLDFDCNHMVPYAKPDDV
AALARELLKAR
118467184YP_883213.1 flavin-containing monoamine oxidase AofH [Mycobacterium avium 104]MSGPPRIVDVVVVGAGFAGLAAARELNRQGHDVVVFEGRDRVGGRSFTGS
VAGLPADLGGTFVGPTQDAVLALAAELEVPTTPTHHEGKNLIHWRGWTHA
YHGTIPKLSLTGLLDIGRLRWQFDRIARSIPLAAPWEARRAAELDGLSLG
GWLRSVRATASSHALLAMVARVTWGCEPDEVSMLHAARYAHAAGGLDRLL
DVEDGAQQDRFPGGTQQIAAAAAAELGARVVLGAPVRRIERHGAGVTVRT
DLGDTEAGFVIVAIPPAHRAAIEFAPPLPAEYEQLARHWPQGRLSKAYAA
YSTPFWRADGFSGQALSDEGPVFITFDVSPHPDGPGILMGFVDARAFDSL
PADQRRRDALRCFATLFGDDALKPLDYVDHRWGAEEFAPGGPTAAVPPGS
WTRFGRWLREPVGPIHWAGTETADEWTGFLDGAIRSGRRAAAEVTALL
118467183YP_883174.1 zinc-binding dehydrogenase [Mycobacterium avium 104]MRAARVTRLDGPDAIEVTDVDEPTGDGVVVDVHAAGVAFPDALLTRGLYQ
YRPELPFVLGAEIAGVVRSAPEGAHVRSGDRVVGLTMLSGGMAEVAVLAP
DRVFKLPDNVSFEAGAGLLFNDLTVYFALTVRGRLQRGETVLVHGAAGGI
GTSALRLAPALGAARTIAVVSTTDKADIATAAGATDVVLADGFKDAVKEL
THGRGVDIVVDPVGGDRFTDSLRSLAPGGRLLVVGFTGGEIPTVKVNRLL
LNNIDVVGVGWGAWTGTHPGALAEQWAGLERLLTSGELAPPEPVVYPLDE
AAAAVASLENRTAKGKVVLRVRG
118467182YP_883044.1 hypothetical protein MAV_3882 [Mycobacterium avium 104]MEKLGRRCGRLAGASALAVILLWAAPGHATADPAVTASPGMEIHQGHAVC
MVGLVEPRLRVAITSGQCDGGQSAVTDRDHHPIGEVVLGRRQLDTDSADA
STLPVEYEVIALARDVTASDLLPTGRRLLAAPGLRAVPGLPVCQLRRSTG
QHCGSVGTVIGGRFAIADMVVDGRDVGGPVYALTDDGNAVIVGLFEGMVR
SSPQFESWQAVMAQVYVDGRSPGAQQQLPALHMINWRTGSFAAA
118467181YP_879647.1 hypothetical protein MAV_0361 [Mycobacterium avium 104]MNTTHHRKPIVAGALLAGGIAAAGLGIASAAAQPSAPHLIGPLPTDNFTV
PHDWCPGQPLPMPDVRWDMNVCHHWYWVPVGGMGNVGQFVWEGDAPRQPL
GGPPCYGAPICLPGL
118467180YP_879424.1 hypothetical protein MAV_0129 [Mycobacterium avium 104]MADITMLILADHDWFREQFARLDYLQAQAADDRDALQRVWRPLADKLDVH
AYIEEKIFYPQLLKRGSADAEGETLDAIGDHNDIRDGVRATNAAQPGTEQ
WWAAVGRTREANDDHMAEEEREGLSDFRRTAPIGLREALGRQYAEFMAEH
PTTEGLPIIDRDPAGYVEQVQNAQPPKPAEFSLRIGSLKGQ
118467179YP_881933.1 mosc domain-containing protein [Mycobacterium avium 104]MMDESTAARAAVPMRVEALLRYPVKSMLGETLDRLAVDEHGAQGDRRLAL
VDDETGHVASAKNPRLWRDLLTCTARADASGVRISLPDGMDVAADDPGVD
ELISRLTRRRVRLIARRPDGATLVRPDPEQLLERGLDAEVDGRILRISAA
TPGHSFTDEAPLHAITTATLQHIGVEALRYRPNLVIATPPGYPPYAENDW
AGSEITVGEARLRVLTATSRCVVPTLEHGRLPRAPHALRIPAAENRLDTG
GHGPQPCAGAYLAVLAEGVITVGDPVTVES
118467178YP_882742.1 alpha/beta hydrolase [Mycobacterium avium 104]MVGMSRPHPCATILVAVTALLAGCVPGLAADPRFATNSGARPQGAATSKP
APGGPPPLAAPKNDLAWHDCTSRVFADAAVPPAPGIQLDCANYDADLDPV
NGGGGALSIGVVRARSNQTPRDAGPLVFTTGSDLPSSAQLPVWLSRAGAD
VLAAHPIVAVDRRGIGMSSPIDCRDKFDRQQMRDQSQFQAGDDPVANLSE
VANTATTNCTDAIAPGASAYDDAHAASDIERLRSTWDVPALALIGIGNGA
QVALAYAGSRPDKVARLILDSPVALGVNAEAAAEQQVKGQQAALDAFAAQ
CIAVNCALGPDPKGAVSALLADARAGKGPGGVSVAQVANAITVALGFPSG
GRVNATTDLANALASARSGDTNALNNLINHANAMQDSDGQFVNVCSDAVN
RPTPDRVRELVVAWGKLYPQFGTVAALNMVKCVHWPTGSPPPSPKSLKVD
VLLLGVQNDPIVGTDGVAATAAGIINANAASKRVMWQGIGHGASIYSGCA
VPPLIGYLGSGKLPNTDTYCPA
118467177YP_879869.1 hypothetical protein MAV_0589 [Mycobacterium avium 104]MMRLVSGFAVAAALPMFLPAGVCAAASNTATTLFPLDGPNQLETRALLNC
FKSDGHCDFTAGADMLTPDGVTGFPPGLWARQTSEIRSSNRLAYLDAHAD
GQYERVHKSMGSDEITTIYMGEGPPDKYETHGRIDSTDWQTGQPKTDNNV
ILCTHIQVVYSGVNITSPSTCAVTTFS
118467176YP_880238.1 hypothetical protein MAV_0978 [Mycobacterium avium 104]MAVQASSEIVIDAPPEVIMEALADMDAVPSWSSVHKRVEVIDKHPDGRPH
HVRVTIAVVGIHDTELLEYHWGPDWMVWDADRTAQQHGQHGEYNLSRLGD
DKTRVRFTITVEPWVPLPEFWVRRARKKILHAALEGLRKRVMVPEAFGRA
D
118467175YP_881278.1 virulence factor Mce [Mycobacterium avium 104]MSKQSSSGLIRRGGNQRNGIDPIWWAPTLFIVIGGLVALTAASFSGKFQT
FVPLTLVSDRAGLVMEDGAKVKLRGVQIGQVASIGTDVKTARLQLKIQPG
PFRYLPSNLEAEIKSTTAFGSKFVDLIVPERPSASPLKPGAVLRSRNVTV
EVNTVFENLQAVVQALDPAKLNAILSAFAQSVRGKGERIGEAITDANSLL
RTVNSRMDTIGEDWRLFGATTAVYSDAAQHILSILDSASTTSNTITDNQR
SLDSLLLSAVGFSQTGINVIGANESNIVRAMNLLDPTIALMQKYSPTYTC
LFQGAQWYVDHGGRDALGGNGYSVILDAALLFGDDPYRYPKHLPKVNATG
GPGGRPSCGSLPDPSANFPVRALVTDTGWGAAPNEIRTNVAAGNPWWANW
FPTTKNPPEAPRYFWRGGQPPP
118467174YP_882192.1 hypothetical protein MAV_3006 [Mycobacterium avium 104]MVDAESAARVGTVAASATGEVNQRDWQRWAAAVGDHNPLYFDPDYARANG
FRDIICPPLFLQYAILGVSRLDSLRPDGSSGAVSGSLAFPRAPKRMAGGE
SFTFHLPAYHRDRVDMVRTIASIVEKQGRSGRFVLVTWHTVYRNQHDELL
AEASTSMIARP
118467173YP_881137.1 amidohydrolase [Mycobacterium avium 104]MIWTNSGDSHFLEPDDLWQSRLPKRLADLTPRAEKDPDGEYETVFVDGQI
FRRKLPSSAMEAFFEESMKPKGIRDAKARIGDLDKEGVWGEVIFPSLGMW
ASTFRTPELLKACMRASNEWALEEICAVSPRYVVTAQVSTLVVDDAIEEL
RWAAEQGFKAVFLPTTPHPSAPDWHRKEWEPFWAAAEDAGMVIAFHIGTD
PVDMTVGGASGGAGMVYRGPGGAVLNYAETTFSGQRAAMKMVASGALDRH
PDLKVLISEGGATWVPFLGDRMLEGYRQHHMAVRPKLSRSPKEILFSQVY
ASFQHDETAVAAFDHMGYKNVMFGSDYPHMEGTFGHTQDTLKGLFDGVSD
ETRLRITQGTFYELFPDVPPIPAEKL
118467172YP_883374.1 hypothetical protein MAV_4233 [Mycobacterium avium 104]MRQSSTLSAAILDPMLRADPVGPRITYYDDATGERIELSGVTLANWAAKT
GNLLRDELGAGPASRVAILLPAHWQTAAVLFGVWWIGAEAVLAGPADLAL
CTPPRLDEADATGAGEVAVLSLDPFGRPVSDPPIGVTDYATAVRVHGDQI
VPEPRPGPALNGRSVDQVLQQCRSSAAARGLTAADRVLSSASWPDPDALV
DGLLAILAVGGSLVQVANADPAVRQRRIESEKVTRVL
118467171YP_881034.1 enoyl-CoA hydratase/isomerase [Mycobacterium avium 104]MTETRNGGPRPPDGDWLGTPYLKFTREGAFAVCTLDRPAARNAMTPAMYF
GIRYAINRVNADPDLAGLLITGTGDVFAPGGDLGQGGEDDWMDFASTMGM
DVTPFDVLRQSAKPVVAAVNGLCQGGGLQIAMCSDIAVVSHRATFRVPEL
FRGIADTYYSQMLARLIGPVRTRDLMFTGRTLSAAEALDWGMVARVVPHD
ELLDVSRELLAQCCRTAPAARGVIKASLDNYMGLYDRIGMHSSLFGPETR
EGYVAFKEKRSPSWVHPDLRVDGRL
118467170YP_881886.1 acyl-CoA thioesterase [Mycobacterium avium 104]MIRSPASAVRSASSTSSKADWSRAIAMFLSVVILGRFTTETHAMALLRQG
PTRRHHLHHSPGRSPVDFEVVDLQEGRTFSARRVTARQDDKILMEAMSSF
KVVNSAAAQVVYQPIMPEAPSPESLPWVAPHLAEADEGSRGRWASLRWFE
RRTIETETVPPARAPMWWRPDGRVPDDPVLTASLVAYMSAVTLTEPAFAA
RGGVGASAQRDHSVWFHGRAVLSDWLFYDRSSPSSAGSLALASGTMFNRT
GELVCTVKQEMYFPPQTA
118467169YP_881923.1 hypothetical protein MAV_2734 [Mycobacterium avium 104]MESDMSEPDKDPLSRAQELENIVDQLEEKVADDREAEGVPGKPSDREDAA
VRGSDDEPPD
118467168YP_881483.1 leucyl aminopeptidase [Mycobacterium avium 104]MMRMSTEPGYASPVVNVASSLPRRAAASTVLIVPVVSTGDDDKPGAVVAP
AGSFLSSDAVAEIESGLRALAATGGAEQLHRLVVGSLPVSSVLTVGLGKP
RSEWPADTVRRAAGVAARSLSNTETVFTTLAALPGEGVASAAVEGLILGS
YRFTEFRSAKTAPKDKGLQKITVLATAKDAKQEVAHGAAVATAVATARDL
VNTPPSHLFPDEFAKRARALGESVGLEVEVIDEKALQKGGYGGILGVGQG
SSRPPRLVRLIHRGSRLAKKSKQAKKVALVGKGVTFDTGGISIKPAASMH
HMTSDMGGAAAVIATVALAARLQLPIDVIATVPMAENMPSGTAQRPGDVL
TQYGGTTVEVQNTDAEGRLILADAIVRACEDNPDYLIETSTLTGAQTVAL
GARIPGVMGSDEFRDRVAAISQRVGENGWPMPLPDELKEDLKSTVADLSN
ISGQRFAGMLVAGVFLREFVADGVGWAHIDVAGPAYNTGSPWGYSPKGAT
GVPTRTMFAVLEDIAANG
118467167YP_880864.1 acyl-CoA dehydrogenase [Mycobacterium avium 104]MVAEFAAWLAAFLPNDYYENYRRYRWDLTLRRDYQRAAFEAGWIQPTWPR
EHGGRSLGLRDAMEVRLEAALRSAPKLPNIAGPNVAAPGIRQFGTPAQIE
RLLVPLLRGDEWWALGMSEPEAGSDFAGLRTRAVRDGDVFRVNGHKIWTT
QAHESRWCTLYARTDPEAPKHRGISCLILDLHSPGVRIEPIRMASISDET
FCEVFLDDVEVPTENLLGPLHGGWDVALSSLHHERQMIWIMNWVEINRGL
DAVRTANGAGPGHDIHTELGSLLADAEALRATGYRALANELAGRPSPEAD
TMKLLGSLTLQRVWELAAAAAGPDSATDPDLLFERQDALAATIYGGTSEV
QRNIIAERLLGLPKG
118467166YP_883289.1 ABC transporter [Mycobacterium avium 104]MSDIKRGRAARNAKLASIPVGFAGRAAIGFGKRLTGKSRDEVQAELLEKA
ANQLFTVLGELKGGAMKVGQALSVLEAAVPEEFGEPYREALTKLQKDAPP
LPAAKVHRVLDAQLGTKWRERFSSFDDTPVASASIGQVHKGVWSDGREVA
VKIQYPGADEALRADLKTMQRLVGVFKQLAPGADVQGVVDELIERTEMEL
DYRLEAENQRAFAKAYQDHPHFAVPRIVASAPKVVIQEWMQGIPMAEIIR
HGTTEQRDLMGTRLLELTFDAPRRLGMLHGDAHPGNFMLLPDGRMGVIDF
GAVAPLPDGLPVELGMTIRLARDKNYDLLLPTMEKAGFIQKGQQVSVRDI
DDMLRQYVEPVEVEVFHYTRKWLQKMSAIEIDRSVSQIRTARQMDLPPKL
VIPMRVIMSVAAILCQLDAHVPIKALSEELVPGFAEPDNAVV
118467165YP_883486.1 glycoside hydrolase 65- central catalytic [Mycobacterium avium 104]MIADESFPVDPWHVRETQLNLNLLAQSESLFTLSNGHIGLRGNLDEGEPY
GLPGTYLNSFYEIRPLPYAEAGYGYPEAGQTLVDVTNGKIIRLLVEDEPF
DVRYGELLSHERTLDLRGGTLTRSAYWRSPAGKEVKVVSTRLVSLAQRGV
AAIEYVVQAVGDFVRVTVQSELVTNEDQPQTSGDPRVSAILENPLEEVDH
ENTDTGALLIHRTRSSALMMAAGMDHEVEVPGRVEVSTDSRADLARTTVI
CGLRAGQKLRIVKYLAYGWSSMRSRPALRDQVAAALHSARYTGWPGLLES
QRKYLDNFWDCADVEVEGDPESQQAVRFGLFHLLQASARAERRAIAAKGL
TGTGYDGHAFWDTEGYVLPVLTYTAPHTVADALRWRASTLDLAKERAAEL
GLEGAAFPWRTIRGQECSAYWPAGTAAWHINADIAMAFERYRIVTGDDDL
EAECGLPVLVETARLWLSLGHHDRHGVWHLDGVTGPDEYTAVVRDNVFTN
LMAAHNLRVAAEACNRHPDGAKALGVTTEETAAWRDAADAVKIPYDSGLG
VHQQCEGFTTFAEWDFEHNTTYPLLLHEAYVRLYPAQVIKQADLVLAMHW
QSHAFTPEQKARNVDYYEPRMVRDSSLSACTQAVMCAEVGHLELAHDYAY
EAALIDLRDLHHNTRDGLHMASLAGAWTALVSGFGGLRDDEGVLSLDPQL
PDGISRLRFRLRWRDFRVTVDVNHADVTYTLRDGPGGELTIQHAGAELEL
STQSPTTVAVRPRKPLLPPPQQPPGREPTHRRAVSRSSPGQ
118467164YP_881920.1 hypothetical protein MAV_2731 [Mycobacterium avium 104]MAPGPVATRDYTAGIEGYFLAMPRASRTPVIPR
118467163YP_884283.1 hypothetical protein MAV_5166 [Mycobacterium avium 104]MTHESTTAWRELLAALGELDRSFLEGDRAVSDDRHIADGYRMLATTLGVA
FDTYLFPEPDRPQFVAVNTPFRRDRRWGGDNTDAYYFICPVDPKRRYRIS
GNKGDSVYFSVTAYNEPSLGAWSDRVVAIVRDSDLDVDADGNFSFEFPPT
PDAAVLMTRDYQADPLTGRPVTWRIEALDEPAPIRHGDAETAARLRAVAT
WLRTMFAIVPLAVGNRVDDQHALGHETAHAANAFADPYQVPDANFGWSAR
DACYSYGSFVLDDDEALVITHRPPSCRFWNMVVWNQFMATYGAAEGPDAR
CSINGHSAVANSDGTVTIVLSRDRTPHPNSVTTLGYPRGNLAFRWFLADG
VPARPEVELVKASDAPTAVR
118467162YP_883257.1 GAF family protein [Mycobacterium avium 104]MTGNRFDELAAARDQTEKLLRVIAEIGAGLDLDATLHRIISAARELTSAP
YGALAVRDWHANLISFVHEGMDAETVRRIGHHPVGKGLLSLSLLDTPALR
MDDLTAHPAAAGFPEHHPAMRAFLAVPITIRGAVFGNLYLTHVDEARVFS
DADEMAARALAFAAAVAIDNAQVFERERMSVKWIEASREITTALLSRTEP
HRRPMQLIAERACALTDAEQAIVLVPADPEQPGNPEVDTLVVSAAVGLPA
ADVLGQRVPVRGSTSGAVFKSGEPLITDEFRYPIQAFTDAGRRPAIVMPL
RARDEVVGVIAIARGTEQPPFDESYLDLVRDFATHAAIALVLAAAREDAR
QLAVLAERERIAHDLHDHVIQRLFAAGMDLQGTLARARSPEVADRLNRTL
DDLQTIIEEIRTTIFALRSPAAVAGDFRHRIQRVIAELTENRDLVTTVRM
DGPMTAVGAELAEHAEAVTAEAVSNAVRHSGASRLTVQIGVADMFTLDVI
DNGRGIAAGNTRRSGLANMTRRAEQLGGSCEISSPPGGGTRVHWTAPLLD
H
118467161YP_880056.1 hypothetical protein MAV_0783 [Mycobacterium avium 104]MVAVIGLLGVLFQAKKNHQASLEQIDTLKEQANAATIQANAALEAARAST
KTAEATAQAAINDTFTKAYAAASENWARYTDAIEKRLQEQGEEIVENAKR
IDKAERLAEADRHARDVAEKKFRIAEAWMRRTIRWIKENLPGADYPPIPP
ELDIEL
118467160YP_883582.1 50S ribosomal protein L30 [Mycobacterium avium 104]MSQLKITQVRSTIGARWKQRESLRTLGLRRIRHSVIREDNPQTRGLIAVV
SHLVEVAPADASSAGTGGSKK
118467159YP_882435.1 hypothetical protein MAV_3253 [Mycobacterium avium 104]MSVMDVKRPPRDPSSQPSTESSRSSGSSPSAHVRRRGDGPRPQEWLLFLG
ADDALDQPDTLARVAAFIDDHETCDLVYGDVVMRSTGTRHAGPFDLDRLL
FETNMCHQSIFYRRKLFEGIGPYNLRYPIWADWDFNIRCFSNPALVTCYM
DIVVARYNDMTGLSMRESTDREFRKRLPMYFWVAAWETGRRMMGFFKQRE
NRRLALRAFVIRTRAASHARARR
118467158YP_880880.1 MerR family transcriptional regulator [Mycobacterium avium 104]MAEQLLIGDVTALTGIASGRIRHYEKIGLLHADHLSNGYRVFDVEQVLDL
LRIDLMRSLGVGINDIQRLLHGGHSTLADLLDEHRALLIQQRDRLDQLIR
ALDESCAQSRAAADGTDVSEHLLRQLATTHRDSIGVIGRLSAPLPAPVAA
MYADLFDEWDLPVPALFGQMRLPSAASTLLAQLAETPGRQVLFDRLRRLA
ADVIALGESVSAATELAHNWIEQQLADPLPDDVVTVLRGVQPLLGQDPVI
VQGFRAWAGSISPAAARFIEEIARQTARRGLAAVSVIVLPAADRAQTADA
TP
118467157YP_879697.1 ATPase [Mycobacterium avium 104]MTQPTQPVTASPTAESAREALLALRAELAKAVVGQEGVVSGLVIALLCRG
HVLLEGVPGVAKTLLVRALAAALQLEFKRVQFTPDLMPGDVTGSLVYDAR
TAAFVFRPGPVFTNLLLADEINRTPPKTQAALLEAMEERQVSVEGEAQPL
PEPFIVAATQNPVEYEGTYQLPEAQLDRFLLKLNVTLPPREAEIAILHRH
AHGFDPRDLSVVQPVAGPADLAAGRDAVQQVRVADEVLGYIVDIVGATRS
SPALQLGVSPRGATALLATARSWSWLSGRNYVTPDDVKAMARPTLRHRVM
LRPEAELEGATCDGVLDGILASVPVPR
118467156YP_883076.1 hypothetical protein MAV_3914 [Mycobacterium avium 104]MFTEDSVEIDAPPRLVWDVFTDVERWPEWTASVTSLTGLDGPALAVGRRF
AIKQPGMAKLVWQVTELIPGASWTWVQRSPGARVAATHHVSARPGGGTLV
RQQLDQRGALGALVGRLMAKKTKRFLALEARGLKARAEQLSRADGAHP
118467155YP_883256.1 ANTAR domain-containing protein [Mycobacterium avium 104]MTWNLDGQTANVEQALAGGHTQPAGWFRFYFADQRWEWSEQVQRMHGYEP
GSITPTTELVLSHKHPDDRARVAATIDEIVTNHQAFSTRHRIIDAAGNVR
HVVVVGDRLTDEQGEVIGAQGFYIDVSIPHQQVQEEMMSARLAEISRNRA
RIEQTKGMLMLIYGISDSAAFELLKWLSQEGNVKLRPLAEQIAEDFRGAD
VPLPTRSEFDHLLLTAHQRLKASDTRS
118467154YP_881391.1 transcriptional regulator [Mycobacterium avium 104]MTALETTDEFTDRITAAIDGASLALLLSIGHQTALLDTMAGLPPATSDRI
AEAAGLNERYVREWLAGMTTGRVVDYHPATAEYSLPAHRAKVLTRAAGPD
NLALVALFLPLLAEVEQKIIGCFRTGGGLPYTEFPRFHALMAEQSGVVFD
TALVDVVLPLVDGLVPWLRRGADVADFGCGSGHAINVMAQAFPASRFTGI
DFSEHAIAAGIAEAAERGLANASFESHNLADLDRADAYDLITVFDAIHDQ
AQPARVLANIHRALRPGGVLLMADIKASSRLEDNVGVPMSTYLYTTSLMH
CMTVSLAADGAGLGTAWGTQLAVAMLGEAGFADVRVAEIESDPINNYYIA
RKS
118467153YP_880353.1 regulatory protein- FmdB family protein [Mycobacterium avium 104]MPTYSYQCTECDDRFDIVQAFTDDALTTCKHCSGRLRKRFNSVGVVFKGS
GFYRTDSRESGKKPAGSTNGSSSSDSSSSTSDSSGSSAKSGSGEKAASSP
APAAAAAG
118467152YP_881060.1 amidohydrolase [Mycobacterium avium 104]MPLQPWMEMISVDDHLIEHPKVWSDRLPRKYLEAGPKIIEWERPDTGQMC
QVWEYEGRIYPYIGLNAVAGKKPEEYGIEPVRYDDMIPGCYDPKARVADM
DIDGVQAMTCFPSFPRFAGAVFAEGEDKELAVLCSKAWNDFHLDEWAATA
PDRFIPVAMLPFWDIEESVKEIHRVAGKGAKCVTFPDLPDKLGLPSVHSD
HWDPVLSAMEETGMVLAQHFGSGGFPPPIAPDAPFAVFITLMGTMSMTAL
TDWLFSHTLYRHPNLKIGLSEGGIGWIPYILERADSVWRKHRFYNNINQD
HPPSYLWKKHFHGCFIEDDFGVEMRHSVGVDQITWECDYPHSDSFWPQSR
ERAAQALEKVPDDEVHKIVELNARQFYNFPRAA
118467151YP_884254.1 homoserine dehydrogenase [Mycobacterium avium 104]MAIRVAHVGTGNVGGLALAELITNPRYELTGVCVSTPEKVGKDAGELCGV
GLDAGVVTGVAAVGDLDAVIAAKPECVVYCAMADTRLPEAMADVMRILAA
GINVVGSSPGLLQYPWGVMPEKYIARVEDAARQGNSSIFISGVDPGFAND
LIPLALAGTCQRVEQVRCMEIHDYASYNGAEVMGYMGFGRPLDEIPMLLQ
PGVLSIAWGTAIRQLAAGLGIQVDEITESYQREPAPEDFDIAVGRVAKGT
LAVLQFEIRGMVNGHPAIVIEHVTRLRPDLRPDLPQPAAGDGSYRVEITG
EPSYAVDIVPSSRKGDHNHAAIAGAAGRIVNAIPAVIAAPPGIRTTLDLP
LVTGKGLYAPSTLVTT
118467150YP_879504.1 PAP2 superfamily protein [Mycobacterium avium 104]MLTVARALSHFGEHSIGWVAAAALGALCSPRRRADWLAAGAGAFVAHAAA
VVVKRIVRRERPHHPAVVVNVGTPSRLSFPSAHATSTTAAAILLGRITGL
PLPAVLVPPMALSRMVLGVHYPSDVACGIALGAGVAAVARRAPQLARGDQ
118467149YP_879498.1 acyltransferase [Mycobacterium avium 104]MAEGFYRLGEWVVPPLVAMQGTKFTYQGLENIPAHGGALLAQNHTSYLDW
LPTLMAVRERHRRAYFMIKAEMADVKAVNYVIKHARLIPVDRRSGHDAFD
VAVQRMREGELIGMHPEATISRSFELREFKTGAARMALAAQVPIVPIIVW
GAHRIWPKDHPKKVFRNKVPITVAAGRPLPPRGTPEQLNAALREAMNALL
YRVQEEYPHPKDEFWVPRRLGGGAPTQEDSRALRLSELQERMRKYGTDGV
TRPGQRQSGLH
118467148YP_883788.1 hydrolase- nudix family protein- putative [Mycobacterium avium 104]MTPVPDFIVELRRRIGHAPLWLPGITAVTIRGRKVLLVKRSDNGAWTAVT
GIVEPGENPADCAAREVREETGVSARATRLAWVHVTRPAIHANGDHAQYL
DHVFRMEWLSGEPFPADDESTAAAWFDLDKLPPMTADMRRRITLSANDDE
RTVFDTDGPPPARPSG
118467147YP_881865.1 hypothetical protein MAV_2674 [Mycobacterium avium 104]MAMDMYAPVIEIYGNDARAWSDVIVSLVPEEGPAEMSFVGRYHDHLRREN
GRWLLSKHITVKTGDALPDDERLPSGLYADDRTRQE
118467146YP_883331.1 FadA6_4 [Mycobacterium avium 104]MNRDAVIVGAVRTPIGKGKASGALHDVLPADLLAHSLRELVARTGVDPAQ
VDDVIAGAVTQVGDQAVNIARNALLGAGFPESVPGVTIDRQCGSSQQAIS
FAAQGVIAGAYDVVIAAGVESMGRVPMGSQVLPGSNPFGEAMNARYPEGL
VPQGISAELIAAKWGFSRTQLDEFSAASHEKAARATKDGLFDNELIPIAG
LATDEFIRPGTTVQTLAGLQPAFYSEATEARFPQINWEITAGNSSPLSDG
SAAVLITSSETAARLGLRPLARIHTTAVVGSDPLYMLTGVIPATEKVLSK
AGLTLADIDLFEVNEAFAPVVLAWAQDTGADLDKTNVNGGAIAIGHPLGA
SGARIITTLVNALEQRGGRYGLQTMCEGGGMANATIIERLS
118467145YP_884108.1 sugar transporter family protein [Mycobacterium avium 104]MTAETANAAARTWTPRIAAQLAILAAAAFTYVTAEILPVGALPAIARNLQ
VSLVLVGTLLSWYALVAALTTIPLVRWTAHLPRRRVLVASLTCLTASQLI
SALAPNFAVLAAGRVLCAITHGLLWSVIAPIATRLVPPSHAGRATMSIYV
GTSLALVVGSPLTAALSLMWGWRLAVVCVTVAAAVVTVAARLMLPEMVLT
EHQLAHVGPRSRHHRNGRLITVSLLAMVAVTGHFVSYTFIVEIIRNVVGV
RGPTLAWVLAAYGLAGLLSVPLVARPLDHRPKSAVILCMTGLTAAFAVLT
ALAFGGPTGATTALIGTAAIVLWGAMATAVSPMMQSAAMRNGADDPDGAS
GLYVTAFQVGIMAGSLLGGLLYERSVILMLSASGVLMAVALVGIAANRRM
LDVAPTSSRDS
118467144YP_879778.1 transposase [Mycobacterium avium 104]MRMVRTLRAELGTEHGTVHRVARQLGYGIESVRAWVRQADIDDGYAPGVS
TAESKRIKDLEQENRELKRANEILKRAASFFGAELDRQHRK
118467143YP_883775.1 hypothetical protein MAV_4646 [Mycobacterium avium 104]MTVPKEAEGLIGSHYRAPDYFEVGREKIREFALAVKDDHPAHFDESESAA
AGYPDMVAPLTFLAIAGRRVQLEIFTKFSIPINIARVIHRDQKFKFHRPI
LAHDRLYFDTYLDSVIESHGTVLAEIRSEVTDADGKPIVTSVVTMLGEAA
HQEADAAATAAAVASISAGKLGAI
118467142YP_883412.1 hypothetical protein MAV_4272 [Mycobacterium avium 104]MIPRLLAGMACVAIALGPPVGAAAPAGADPGPFAHLNCACDQPDPPGGAT
PRDAMNQGIRQGLSAPPAAE
118467141YP_882237.1 hypothetical protein MAV_3051 [Mycobacterium avium 104]MMKMPGSKRDRIASRDITFQLIQLTAAQRPRNPCPQKRIAGQVSSSDHDR
DYRNLAVNRLRPSEIQWALNHDAVHGIAYAFKNPVAVAEATEDPGDDRKT
YLIRVKRDDLANALDKINEWILDNPGPSGMQAYGFVRALSREGLTDRAIG
DDDPR
118467140YP_884310.1 ErfK/YbiS/YcfS/YnhG family protein [Mycobacterium avium 104]MVAITVMALVAPVGRGGASVPLPQPVPGIASILPANGAVVGVAHPIVVTF
TAPAADRAAVERSIHVVSPAGVRGHFEWADDNTVVRFVPNRYWPAHGHVS
VGVQALTTGFDTGDALLGVASISKHTFTVSRNGEVLRTMPASMGKPSRPT
PIGNFTALEKQRSVVMDSRTIGIPLSSPEGYKITAQYAVRVTWSGVYVHS
APWSVDSQGYANVSHGCINLSPDNAAWYFNEVNVGDPIQVVA
118467139YP_879742.1 hypothetical protein MAV_0460 [Mycobacterium avium 104]MSKVEGKNGVPSTLTTIPLTDPHAKPAEPTIGDLIKDATTQVSTLVRAEV
ELARAEITRDVKKGLTGSVFFIAALVVLFYSTFFFFFFVAELLDTWLWRW
VAFLIVFGVQVVVGAVLALLGFLKVRRIRGPRQTIESVKETRTALTPGHD
KAAGARALTESHGKHAKPGDGAAADPSGW
118467138YP_882602.1 ABC transporter permease [Mycobacterium avium 104]MLGYVLARIGQSAIVLLAVFSLVFWGVSILPADPAAIFVAKGEGYFNPDI
VAQVKAFYGYDRPLWVQYFAQLNQVLHGHFGFSLSSGQAVTDRIGGVIGE
TLKLAATATAFAVLFAVSVTALATTCAPVRSVLRAIPPLFGAVPTFWLGL
VVLQVFSVQLGLISLFPDGSVTSLLVAALVLAVPVSAPIAQVLGKNIDAT
LALPHVNTARAKGGTPGWVIRKHVVKNAAGPALTVTATTVGALLGGSVVT
ETVFSRSGVGAVLLQAVSSQDISLIQGLVLLTAVAIVAANLAVDLIYPLL
DPRVTRVQRRGFTTRLGRFG
118467137YP_880823.1 hypothetical protein MAV_1589 [Mycobacterium avium 104]MVDVKSGPVELVQGIVDDVLGRAKQVIGIIIGHNGLIEQGKAQQDKADAQ
RSAGKKEAAAEKARGKAKAYEQRERAEQQQ
118467136YP_883255.1 Hsp20/alpha crystallin family protein [Mycobacterium avium 104]MLMRSDPFRELDRLTNQVLGTATRPAVMPMDAWREGEHFVVEFDLPGIDA
DSLDIDIERNVLTVRAERPALDPNREMLASERPRGVFSRELVLGDNLDTD
KIEASYRDGVLSLHIPVAEKAKPRKIAVGRGEAPRAVTETAREVVNA
118467135YP_882749.1 hypothetical protein MAV_3571 [Mycobacterium avium 104]MAKLDYDALNSAIRYLMFSVFAVRPGALGDQRDEVVDDASRFFKQQEERG
VVVRGLYDVAGMRADADFMIWTHAETVEALQATYADFRRTTALGRVCSPV
WSSVALHRPAEFNKSHIPAFLAGEEPGAYICVYPFVRSYEWYLLPDEERR
RMLAEHGMAAREYKDVRANTVPAFALGDYEWILAFEAPELHRIVDLMREL
RATDARRHTRAETPFFTGPRVPVEQLVNSLP
118467134YP_880032.1 integral membrane protein [Mycobacterium avium 104]MPSSNTTTQPDLVDVRGPRFAAWVTTAVLVLALAVSAVSPPAAAVILAVQ
AVVFAIGAVGGPRKHPYGRVFAAVVAPRLGPVREREPIPPLKFAQLVGLI
FAVLGAAGFAAGASLFGLVATAAALAAAFLNAAFGICLGCQLYPLVARFR
RPARST
118467133YP_879473.1 hypothetical protein MAV_0179 [Mycobacterium avium 104]MGLFRKRKSRATRRAEARAIKARAKLEAKLAAKNEARRAKSALRAQDKAL
KAQIRAQRDSDRNALKVAEAELKAAREGKILSPTRIRRILTVSRLLAPIL
TPLVYRAAVSARALIDQRRADRLGIPLAKIGQFSGHGAQLSARIAGAEKS
LRMVQERKPKDGETKQFVAAISERLTDLAAAVTAAENMPAARRRAAHAAI
SSQLDGIEADLMARLGLS
118467132YP_883647.1 hypothetical protein MAV_4513 [Mycobacterium avium 104]MADERSALCEFLAYHQSAYFAVSHGLTDEQARSAPSVSALSIGGLIKHAT
GMQRSWMARVAAAPGAPPKDTRPFEQVAAEFADQHVMRPDETLQELLDAF
EAQNAESLRLAQTADLDAAVPVPHDIPWFPKDLQAWSVRWVILHVINELA
RHAGHADIIRETIDGATMYELIAAREGWAIEGWVQPWTGGGDRR
118467131YP_880209.1 virulence factor Mce [Mycobacterium avium 104]MTQNVPAGRGAIAGRPPRPGHAHPPAGRNYLPPLLGLATILIIGLIFAVA
VGLFQGSFTETVPVTVISQRAGLVMNPDAKVKMRGVQVGKVASIESLPNG
QAAIHLAMDPSQMHFIPSNVLVDIASSTVFGAKSIQLVEPAQPSAQRLRA
GQTLQGQHVMVEINTVFQELVSVLSHIDPPKLNESLGALAQAFSGRGPQL
GQSLSDLDSFLARLEPSLPAFRHDLSVLPTVSNAYADAAPDLVKTAANAT
RISKTLVDEQHNLDALLISAIGLADIGNDVLSTNRQPLTNVLHLLVPTTD
LTNEYAPALTCSFGGLITIAHGPPLSEPSINISASLTWGGERYRYPTNLP
KVAATGGPKCMGLPTLPFNTNPPQFITDIGANPVGYGNPQLLINSDLLKQ
LLYGPIAGPPRNSAQVGMPG
118467130YP_879545.1 hypothetical protein MAV_0256 [Mycobacterium avium 104]MTDPNENHDENLQRIWTPDPNAPRVPPGDPFGVYAGKTDGNPETDADI
118467129YP_879508.1 antigen 85-A [Mycobacterium avium 104]MTLVDRLRGAVAGMPRRLVVGAAGAALLSGLIGAVGGSATAGAFSRPGLP
VEYLQVPSAAMGRDIKVQFQSGGANSPALYLLDGMRAQDDFNGWDINTPA
FEWYNQSGISVAMPVGGQSSFYSDWYKPACGKAGCTTYKWETFLTSELPQ
YLSAQKQVKPTGSGVVGLSMAGSSALILAAYHPDQFVYAGSLSALLDPSQ
GMGPSLIGLAMGDAGGYKAADMWGPKEDPAWARNDPSLQVGKLVANNTRI
WVYCGNGKPSDLGGDNLPAKFLEGFVRTSNLKFQDAYNGAGGHNAVWNFD
ANGTHDWPYWGAQLQAMKPDLQSVLGATPGAGPATAAATNAGNGQGT
118467128YP_880586.1 hydrolase- alpha/beta hydrolase family protein [Mycobacterium avium 10MAIEIARPKLEGNVAVGEDRQIGFAEFGDPQGRAMFWLHGTPGARRQIPV
EARLYAENHKIRLIGLDRPGIGSSTPHRYQNIRAFGEDLRTIADTLGIDK
MAVIGLSGGGPYALASAAVLPDRVVAAGILGGVAPFLGDEGITSGLMNLG
KRVAPLLKLGGDPLRIGASLVVRAIRPVANPALYLYAAISPEGDRRLLTR
PEFGAMFLDDLLNGSRKQLAAPFNDIILFTQDWGFRLDQVKVPVRWWHGD
SDHIVPFAHGQHVVSLLPDAELFVLPGESHLGGLGRGEEILSTLTKIWDE
QN
118467127YP_882385.1 hypothetical protein MAV_3203 [Mycobacterium avium 104]MVHSIELVFDPDTEAAIRQTWKALAAAGIPSQAPASRPHVTLAVAEAIAA
DVDALLAPLCTRLPLPCLIGAPVLFGRGSVVFARLVVPTGELLDLHAQVH
RLCAPHLRPAPMPNSLPGQWTGHVTMARRVGGAQLGRALRIAGRPTQIEC
SFVGLRRWDGNKKVEHPIG
118467126YP_881071.1 enoyl-CoA hydratase/isomerase [Mycobacterium avium 104]MAAHSRDLGVVRYERDGAIARIVLDWPERANAQSSEMVSQVDSCLDEARQ
DYGVKVVIVKGSGKGFCAGHVMAPDAYPEFADSQLHMGSNYQGSKELFLW
PTLRYWEFPKPMIAQVHGYAIGGGTYWALLPELTIASEDAYFQMPLVPGL
GFAGGETMIEPWVFMNYKRAAEYLYTAQTLTAHEALRMGLVNRVVTRDEL
EPVTEALATKIARAPLSTLMATKTMLVRAWEQMGMRQHLQLSADVMSVLE
NTSDAQALRAELVARGRLPRDQAGDG
118467125YP_881248.1 GTP-binding protein Era [Mycobacterium avium 104]MTEFRSGFVCLVGRPNTGKSTLTNALVGTKVAITSMRPQTTRHTIRGIVH
RDDFQIILVDTPGLHRPRTLLGKRLNDLVRDTYAEVDVIGLCIPADEAIG
PGDRWIVEQIRATAPKTTLVAIVTKIDKVPKDRVAAQLVAVSELVGDSAE
IVPVSAVTGAQVDIVIDVLAAALPPGPAYYPDGELTDEPEEVLMAELIRE
AALEGVRDELPHSLAVVIDEVNPREDRDDLIDVHALLYVERDSQKGIIIG
KGGARLREVGTAARAQIEKLLGTKVYLDLRVKVAKNWQSDPKQLGRLGF
118467124YP_883227.1 hypothetical protein MAV_4075 [Mycobacterium avium 104]MGLGQLVGGVVGFLRAGYPRQAPAVGYAPALALLPRRTPDDDIATVARIL
APQGITGTARIDAAEIGAQIVRIADELPAPGDVERVLAAMSRHTRCRSTT
NGR
118467123YP_882646.1 GTP pyrophosphokinase [Mycobacterium avium 104]MSIVAEENSAAQALDAPAESPPNPVIETPEPPTESLKTSSSASRRVRARL
ARRMTAQRSTLNPVLEPLVAMHREIYPKANVQLLQRAFEVADQRHASQLR
HSGDPYITHPLAVATILAELGMDSTTLVAALLHDTVEDTGYTLAQLSEEF
GEEVGHLVDGVTKLDRVVLGSAAEGETIRKMITAMARDPRVLVIKVADRL
HNMRTMRFLPPEKQARKARETLEVIAPLAHRLGMASVKWELEDLSFAILH
PKKYDEIVRLVAGRAPSRDTYLAKVRAEIINTLNASKIKATVEGRPKHYW
SIYQKMIVKGRDFDDIHDLVGIRILCDEIRDCYAAVGVVHSLWQPMAGRF
KDYIAQPRYGVYQSLHTTVVGPEGKPLEVQIRTRDMHRTAEYGIAAHWRY
KEAKGRNGVPHPHAAAEIDDMAWMRQLLDWQREAADPGEFLESLRYDLAV
QEIFVFTPKGDVITLPTGSTPIDFAYAVHTEVGHRCIGARVNGRLVALER
KLENGEVVEVFTSKAANAGPSRDWQQFVVSPRAKAKIRQWFAKERREEAL
EAGKDAMAREVRRGGLPLQRLVNAESMSAVARELHYADVSALYTAIGEGH
VSARHVVQRLLAELGGIDQAEEDLAERSTPTTMLRRPRSSDDVGVSVPGA
PGVLTKLAKCCTPVPGDQIMGFVTRGGGVSVHRTDCTNAASLQQQSERII
EVHWAPSPSSVFLVAIQVEALDRHRLLSDVTRVLADEKVNILSASVTTSG
DRVAISRFTFEMGDPKHLGHLLNVVRNVEGVYDVYRVTSAA
118467122YP_879348.1 hypothetical protein MAV_0048 [Mycobacterium avium 104]MAIFGRMTARQRLRRATRESLSIPAFSSPVDCTPWVTGGLWPAELSTVTP
ETATLAEYLKADLQRIADGANDELRKLKRAGMTDTARQAAEARVIEQART
RAVRRVESTIRYLHAVQSGARPPAPPRPTLDAPGADLERTQVLPAVGDAE
HTAGPPAQQTPEARPRPTRRRAAEDEPAQLEETRVLPAIRDDAAAADASV
PETPASETPVPEAPAAEAPVPEAPAPEAPAAEVPEAPAPEAPAAEVPEPL
GEPTTRGRHHAPVPEPVAERVEPDIAAPAEAADLEQTQVIPVVRRDEPVP
EPPVVAPPEPAEEPADSGRHHAPADRDEPATEGRTAVADTDTAQPRVEKP
APTTVFDNNRLNRLLEFVVRQEPRLNWAIGDRADGTTILVTDLAHGWIPS
GIALPAGVRLLEPERRSGDVVALIGETVRRVTYTPGDTLRRSADFAATQS
SSQPRELPPIDDLATAISRAIRGRAGLPKIVPRLADAAAAGAVIVDQEVD
VLRVHLDTARYQLLVQYPNVNPALLLKCLLMATTEGIASGDPVSANYHLA
WYRTLAAPSPGG
118467121YP_880683.1 hypothetical protein MAV_1441 [Mycobacterium avium 104]MTMPVMEPDLDATVLETWARTIDEGPFSSLCWGERIAFDNPDSLTLLGAL
AAWTERVRLLTTVIVPQLHDPVLLAKGLATGDLLSGGRLSVGIGVGGRQE
DYHAVGADPATQTMRGMAERVAVMKRVWAGEKLTESVRPVGPAPVQPGGP
PLFVGSIGPKTIRSAAAWADGLAGTTLDLDVAKQRELFDVTRDAWARAGK
PAPHLITSFWFAFGSARGAREQIHRHLRRYMNWIPADYVDAMAPTTGWAG
DEDELAEVLRKFAEIGADEVQLIPTSSDVGQLRRAADVAARL
118467120YP_881784.1 acyl-CoA dehydrogenase [Mycobacterium avium 104]MQTADWRPRLELLLAEFRRRQADVARSGVEPDRIEVARAWHAELVDHQLA
APGWPREVGGLDLSLADQLDYYRMTTDAGVPPHPCPLSFILAPTLIAHGT
QQQKDRFLIPLLRADEFWCQGFSEPGAGSDLSSLSTRAVRDGDVYRVTGQ
KVWTTMADRADWMFALVRTGSGGKPSDGITYLLIPMKSPGITVRPLRDIS
GAAHFAEVFLDDVAVPVENVVGDEGAGWSIMRTSLGHERATAFLADEFKY
RRTADRVIDLVVAQRLDDDPLVRQDVARLESGVRTIAANSARALAAVLRG
EDPGGMASVNRLVKSEFEQHMHALALRAAGPYAALGSRAPDAVDKGRWTF
GYLMSRATTIGAGTAEIQRNTIAESVLGLPSHRGEGTREAAVTPGAPLAV
PEEDERELREVLAATLQAKVDEAALLDRKRPVDAAEPEVWSALVEFGLPG
LAVDETLGGAGARPRLLYTAVEEAAKALAPAPLVPTVIGLDVALHCGAKA
LVQRITGGATAAFAVPVNDSGWVTSGPELPEWDGTGLSGVVPIVAGAPHA
EVLVALARVAAGVGEVLVAVDASADGVEVTAQQPLDLTGTVGAVTFSGAA
GEVLADGTDVPRMLAAARRRAALAVAADSVGVASRALAMAVQWARERHQF
GRPIGSFQAVSHRCADMLVALEGARSQILEAAESDLEESGYLADLAAAAA
LDAGAAATEGALQIHGGIGFTWEHPIHLLLRRARANSVLVGRADALRDRA
AGELLAPYRQQRSE
118467119YP_880369.1 M42 glutamyl aminopeptidase [Mycobacterium avium 104]MAHRDRDSTDELLQELLWTYGPCGQEDAVRAVIARELEPIVDDLWTDDAG
NLIGYIAADASRGDAGAPDHRHRTAAIPGTATRVMAHMDELSMIVKRVEP
DGTLHLTQLGTMYPGNFGLGPVAVLGDNETLTAVLTLGSEHTTKESSRIW
ETKPDQGDRSLDWHHVYVFTGRSTDELAAAGVHAGTRVCVDRSKRSVVEI
GDYVGAYFLDDRAAVTALLNAARMLRERGQRPADDVYLVFTTNEEIGGVG
GAYASGTLPGDLTLALEVGPTEREYTTSVAGGPIVGYSDALCVYDKSVAD
RLLKIATDRGLSPQPAALGAFESDASHAKASGLTARAGLLCLPTLSTHGY
EVVARSAIDDMAAIVVDFVLQPGRPNG
118467118YP_879999.1 hypothetical protein MAV_0724 [Mycobacterium avium 104]MTPRFLPYSTRPGRLAAQLFSDLAVVIWTGLWILVGLAVYDAIATIADAG
RQVESGAHGVAGNLASAGHGAQHIPVVGDTVSKPLNSASQAALDMAGAGH
DLDVAASWLAVLLAMAVVALPILVAVGPWLFLRLRFFRRKLTVTALAATP
AGAQLLALRALANRPPRKLTAVSADPVGGWRREDPATIRALAALELQSAG
IAIRGM
118467117YP_882217.1 oxidoreductase- short chain dehydrogenase/reductase [Mycobacterium aviMITGAGSGLGAGLARYACGLGMTVVLADIDRDAVAALRDELAAGGGAAHD
AACDVRDPAAVQDLADRAYDIGPVRLLVNNAGIEQFGYLWDTPVVNWQRV
MDVNVSGVFYGVRAFLPKMMAAGQQAWVWNIASVGAVVAMPLQAPYIVSK
HAVLSLTECLHLEVQATGHDDHVHVQAVLPGPVRSNIFESAGGVDPDAAT
DAAAAEAHRSAMLGIKAASMDALEAAEMIFRQSTEGHFYLHTHPESVGAA
MRERAKVLAAQQAPRLRTETRFDSAPD
118467116YP_883341.1 acyltransferase- ws/dgat/mgat subfamily protein [Mycobacterium avium 1MVSRLSPADASFYRLENTATPMYVGSLAILRRPRAGLSYETLLHTIEQRL
PQIPRYRQKVREVPVGTARPVWIDDGDFDITYHVRRSALPSPGSDEQLHE
LIARLAARPLDKTRPLWEMYLVEGLSKNRLALYTKSHQALINGMTALEIN
HVIADRTKRPPAFPEDIWVPERDPGNTRLVLGAIGEWLVGPSAQLQAVGS
AIGGLVTNYGELVDAGRRVFDFVRNVARGTAPSSPLNATVSRHRRFTVAS
GSLEDYRTVRARYDCDVNDVVLAVIAGALGSWLMSRGVAVSPTATVRAMA
PLSVYADGDLDVSGPGQAISQVMPFLVDLPVGEPNAVVRLSQIAHATESN
PTAAHLVDARTIVTLSGFAPPTLHAMGIRVATSFPSFSKRTFNLLITNAP
GAQSQMYVAGTKLLETYSVPPLLHNQALAIGVTSYNGMLYYGINADREAM
SDVDLLPALLNQALEELVEAARS
118467115YP_883844.1 hypothetical protein MAV_4718 [Mycobacterium avium 104]MERLPYIDEHAITIEANRDDTWAALLRVLCRDPRDPSTVPLGFALDEARP
PVRFALKGRHPFAVYRWVFELDALDGPARTRLRAATWAAFPGVHGKAYRA
LVIGTGGHRIVVRRTLNRVARAAARADYTDVFEAPLPQGDSRSAEETFRD
AVGRPGAGGDAVRWVHRHVLRLGGWTIVRSARDEVVLAARGPLLCGELTL
RRHDDRRAALTTRVRYRRPIAARAVWALVGPLHRRAAPRLMRRAAVMAPA
AAPTPTTAAR
118467114YP_882883.1 chelatase [Mycobacterium avium 104]MKPYPFSAIVGHDRLRLALLLCAVRPEIGGALIRGEKGTAKSTAVRGLAA
LLSAATGSDANLVEMPLGATEDRVIGSLDLQRVLRDGEHAFSPGLLARAH
GGVLYVDEVNLLHDHLVDVLLDAAAMGRVHIERDGISHSHDARFVLIGTM
NPEEGELRPQLLDRFGLTVDVHASRDVEVRAQVIRQRMAYEADPDGFAER
YADADAELARRIAAARALVDDVVLPDNELRRIAALCAAFDVDGMRADLVV
ARTAVAHAAWRGAPTVEEQDIRVAAELALPHRRRRDPFDDPGIDREQLDE
ALAQAGSEPDPDPDPPGGGQAGQTEQQPPQRDSAQDAKPRPPTTKPSAPP
SKTFRTRALRVPGVGEGAPGRRSRARNASGSVIAATDGADTGCGGHGLHL
FATLLSAAERAGAGPLRPGPDDVRRAVREGREGNLVIFVVDASGSMAARD
RMAAVSGATLSLLRDAYQRRDKVAVITFRQQQARLLLPPTSSAHIAGRRL
ARFDTGGKTPLAEGLLAARELIVREKARDRARRALVVVLTDGRATAGPDP
LGRSRIAAARLVAEGAAAVVVDCETSYVRLGLAEHLARQLGAPAVRLEQL
HADSLTRAVRDAA
118467113YP_879355.1 leucyl-tRNA synthetase [Mycobacterium avium 104]MRNATETNLWPAKPPRRPLYPVQVTESPTTSPATGSGAAAPDSDAPPYRY
TAALAGRIEGSWQDTWAKLGTFNVPNPVGSLAPTDGTPVPEDKLFVQDMF
PYPSGEGLHVGHPLGYIATDVYARYFRMTGRNVLHALGFDAFGLPAEQYA
VQTGTHPRTRTEANVVNFRRQLGRLGLGHDSRRSFSTTDVEFYKWTQWIF
LQIYNAWFDPAANKARPIAELVAEFDSGARSLDDGRNWSELSAGERADVI
DSHRLVYRADSMVNWCPGLGTVLANEEVTADGRSDRGNFPVFRKRLRQWM
MRITAYSDRLLDDLDLLDWPEPVKTMQRNWIGRSTGAKALFAATGADGAA
LDIEVFTTRPDTLFGATYMVLAPEHELVDELVAPAWPDGTDPRWTYGAAT
PGEAVAAYRRAIASKSDLERQESKAKTGVFLGSYATNPTNGKPVPIFIAD
YVLAGYGTGAIMAVPGHDQRDWDFAHEFGLPIVEVIAGGDISEGAYAGDG
LLVNSGYLDGLDVAAAKEAITARLEAEGRGCARVEFKLRDWLFARQRYWG
EPFPIVYDSDGRPHALDEAALPVELPDVPDYSPVLFDPDDADSEPSPPLA
KATDWVHVELDLGDGLKPYSRDTNVMPQWAGSSWYELRYTDPHNSERFCA
KENEAYWMGPRPAEHGPQDPGGVDLYVGGAEHAVLHLLYARFWHKVLYDL
GHVSSREPYRRLVNQGYIQAFAYTDSRGSYVPAEEVVERDGRFFYRGPDG
EIEVFQEFGKIGKSLKNSISPDEICDDYGADTLRVYEMSMGPLEASRPWA
TKDVVGAHRFLQRVWRLVVDEQTGETRVVDGAGRDLPTGTLRLLHRTIAG
VSEDYAGLRNNTAVAKLIEYTNHLTKEHRDAVPRAAVEPLVLMLAPLAPH
MAEELWLRLGHTTSLAHGPFPVADPAYLVEDTVEYPVQVNGKVRGRVTVA
ADADRDTLEAAALADEKVLAFLAGAQPRKVIVVPGRLVNLVV
118467112YP_881466.1 transposase [Mycobacterium avium 104]MALSTYYDAKARVPSARALRDAVLGPALCQLWKDNYCVYGARKLWKTARR
DGHDVGRDQVARLMRAAGIEGVRRGKRVRTTKADPAAARHPDLVHRNFAA
AAPNQLWVTDLTFVPTWAGVAYVCFIIDAHSRMIVGWRVASHMRTSMVLD
ALEMARWSRGTTLQDLICHSDAGSQFTSIRYGERLAEIGAVPSIGTVGDS
FDNALAETVNGYYKAELIYGPARSRPWKTVEDVELATLSWVHWHNTSRLH
SYLGDIPPTEFEAAFYDAYRTDQPLIGIQ
118467111YP_879984.1 cytochrome P450 51 [Mycobacterium avium 104]MTTSTVVPRVSGGEEEHGHLEEFRTDPIGLMQRVRDECGDVGWFQLVDKH
VILLSGAQANEFFFRSADEDLDQAEAYPFMTPIFGKGVVFDASPERRKEM
LHNSALRGEQMKGHASTIEGEVKKMIADWGDEGEIELLDFFAELTIYTST
ACLIGLKFREQLDHRFAEYYHDLERGTDPLCYVDPYLPIESFKRRDEARV
KLVALVQEIMDQRLANPPKDKADRDMLDVLVSIKDEDGKPRFSADEITGM
FISLMFAGHHTSSGTSAWTLIELIRHPDVYAEVLAELEELYADGQEVSFH
ALRSIPKLDNVVKETLRLHPPLIILMRVAKGEFEVEGFPIHEGDYVAASP
AISNRIPEDFPDPDAFKPDRYNKPEQADIVNRWTWIPFGAGRHRCVGAAF
AQMQIKAIFSVLLREYDFEMAQPADSYRNDHSKMVVQLARPAKVRYRKRN
A
118467110YP_883271.1 AMP-binding enzyme [Mycobacterium avium 104]METLIDYLHLWEERRPEQTLFRFVDVDGRELEHYTYRSFAERTRELAAYL
STEAGLRAGDRALLVYPPGLEMVAALYACARIGVIAVPVSPPLPMSFESG
LAKLGFIARDCQARAVLSTKQFEYDFRMLLGQRHGGQPWSDAGLPELPWF
ATDGAQEFGGAPVPDTPGDVLFLQYTSGSTSDPKGVIVSHKNVIANVSAF
TGGSEVLVSWLPQHHDMGLISAYMFILLQGGTTHAMSPLDFLARPSAWLR
LISDVRATHTPVPNFALEYCLREDKVPAAELAGIDLSSLECIVVGAEPLR
ANTFHQFRERFAPYGLRPEALTGAYGMAESTLIVSIRGRQTLTVNKRGLE
KNVARVEKALPENSNQVPLVSCGKPLEETVVRVVDPQTRQALGEGRVGEV
WLAGPSKGRGYWNRPQLTAEMFEARLAGDDEHSYLRTGDLGFLYEGELFV
CGRSKDLIIVRGVNCYPSDIEAVVERSAKQVRGGCVAALSVEQDDQEALV
VVAEVRDEHNLPDARALARAIRRHCHIDPHTIVFAPPRSIPKTTSGKIRR
ASTRQLWLDGALPTFSSWVNPAATRGHDGTAAGAGPLERFANLIESYDLT
GDEDCSFADLGIDSLALAELRNDMQALLAEHGAAELADEVNTRLLQRLTV
AEFFSLIRQFGEGSGQPLDALRRALDQISAEYEAHEAAQMRADAALPLPD
PAPARAGTPTDILLTGATGFLGPFLLSSLLARTPYTVHALVRATDPGHGL
DRIVASLRKAQLWTPALEAEVRARVRVICGDLAEPALGIGEPAFARLARD
VDAVVHNGALVNYVRTYDALRPTNVEGTRELLRLAMTDHAKTFHLVSSTF
IYGWSTQPVVGEWDANEKMAGLDFGYSQTKWVAEQLALAAQRKGLDVRIY
RPSLISPTRSGFGSQDDILVRLTAFMIEHGLAVNALNQISLLPADLIADH
IVALMDLPDESGSVFNMTADDYYNLTDVTRILSERYGYRFDYHDIDSFAE
QLNRRCTPDDQMYPLVDFLTRSADKIAAMRDKRYDNTQYRHRRGLVPVRL
REPALTETVDHLVRFLRTERMITEVEDEAQRSA
118467109YP_879962.1 hypothetical protein MAV_0683 [Mycobacterium avium 104]MFDAVRWRLSAGAMAVAVTVAACCAPSEPADPCMVASGAADESQGMDAMA
MATEACPLVRLTENDPDPPLYPYLGSAHWHVPWAQEYFDQGLRFYFGFNN
REAYRAFKKAARDAEDNDIACSACYWAQALVLGVDLNMPRELEPDRDAAN
NALRRAARQKPNGEDDKIIAALTGRYRDCPKTDDPRKCQAGRNQAYYDGM
KAVVDEFGRDDPNVITLFADAAMNMTPWAYWKDGNPVSPRTTQAREYLEK
ALELSQYPPNEGPIHWYIHLMEQSRTPGAAGKYADRLAALAPNSGHLVHM
PSHIYYRMGDMPKAIRANKEAIDADERYFATEPHLYRPDGDRYRYGYYLH
NIHFVIAAAALSGDDDEHDVNRYADKLLQWLPDNASGFRADVYRSAYYLA
KINFSSTADIRGFDPPSPFNQQPLATIAYDFARLMADIWDKNNSPHWLDT
LDGDVARYRQHATASGKQNADCDPRLELPKPELCLAAILRDLGHARASAA
KADWGAAADVANEAVDIQDKLPYDEPPLWPYPVRQTLASILIRRAIAAGN
PMERVLHLAAAKELLLKSLNEGKGDDPEQTPIGTYPGNGWAYYGLLEIAT
RDGSPPEVVKAADAELARHWFGGTGYRNLDRL
118467108YP_880654.1 HIT family protein [Mycobacterium avium 104]MGDMSCVFCAIVAGEAPAIRIYEDDDYLAILDIRPFTRGHTLVLPKRHSV
DLTDTPPETLAGMVTLGQRIARAARSTELADATNIAINDGSAAFQTVFHI
HLHVLPRRNGDKLSVAKGMLLRRDPDRDATGQILRLALARIDANQPD
118467107YP_879993.1 gamma-glutamyltransferase [Mycobacterium avium 104]MNQPFGWDFPYAWPRKPVLADNVVCTSQPLAAQAGLRMLAEGGSAVDAAI
ATAITLTIVEPVSNGMGSDAFAIVWDGEKVHGLNASGRSPAAWTPEYFGG
NAVPVLGWNSVTVPGAVSAWTELHARFGKLPFERLFAPAISYGRNGFPVS
PVVAEQWVAQVPLFAGQPGFAEAFAPEGRAPRPGERFRLPAHADTLEAIA
ASRGEAFYRGALAARVAEHAAANGGAMTADDLAAHRADWVETITGDYRGY
TVHEIPPNGHGIVALIALGILERFDMASLPVDSADSVHLQIEAVKLAFAD
AQAYLADIEHMPLRPEHLLDTEYLERRAALIDPARAKPVSAGAPAGGTVY
LTAADAAGMMVSMIQSNYMGFGSGVVVPGTGISLQNRGANFTAGLGHPNS
VGPNKRPYHTIIPGFVTKGGAPVMSFGVMGGMMQPQGHVQVMVRIADHGQ
NPQAACDGPRFRWVQGTQVSCENGFPAATLDELRRRGHDLVAVDDYNQFG
SCQAIWRMDTGYVAASDPRRDGQAAAF
118467106YP_883406.1 aldehyde dehydrogenase (NAD) family protein [Mycobacterium avium 104]MTLPTADELRARAADALRSLGAHVELGAPDAHGLPASTPITGEVLFTVAP
TTPDQAEHAITQAAQAFSEWRRTPAPVRGALVARLGELLRAHRDELAALV
TLEVGKITSEAAGEVQEMIDICQFAVGLSRQLYGRTIASERPGHRLSETW
HPLGVVGVITAFNFPVAVWAWNAALALVCGDTVVWKPSELTPLTALATQA
LIARAAADVGAPPGVSAVVLGDRELGELLVDDERVALVSATGSVRMGRAV
GPRVAARFGRVLLELGGNNAAVVTPSADLDLAVRAVVFAAAGTAGQRCTT
LRRLIVHHSVADEVVARVVSALRRLPIGDPFEPGTLVGPLIHETAYRDMV
GALESARADGGEVIDGDRRHPFAVEHPSSYYVAPAVVRMPAQTPIVATET
FAPILYVLTYDRLDDAIALNNAVPQGLSSAIFTTDLREAERFLDESDCGI
ANVNIGTSGAEIGGAFGGEKQTGGGRESGSDSWKAYMRQSTNTVNYSGAL
PLAQGVEFG
118467105YP_883881.1 TetR family transcriptional regulator [Mycobacterium avium 104]MGQPQSQMEPESKLRQRTEGRLDRSRDPAILDAALAALAEHGYDATNMND
IAARAGVGKAAIYRRWSSKAALMTDALIYWRPELLNDDAPDTGSLAGDLD
AIVKRAKRNDNALISNDLVLRVALEAAHDPELATALNDLILFKGRRVLSA
VLAQAADRGEIDPNRDWSLVADVLTAMGLLRAISGQRVDGKFVRRVIDTL
ILPAVRAAPE
118467104YP_880761.1 F0F1 ATP synthase subunit C [Mycobacterium avium 104]MALDPQVAAAALIGGGLIMGGGAIGAGIGDGIAGNALVSGIARQPEAQGR
LFTPFFITVGLVEAAYFINLAFMALFVFATPVGT
118467103YP_882767.1 hypothetical protein MAV_3590 [Mycobacterium avium 104]MWVPWWWWPPAFALAGIIAFEFNMGVTRQSSWWPYAALFAVAAAALLWLG
RIEVRVTANPAVPGEVELWAGPAHLPVTAIARSAPVAPSAKSAALGRQLD
PAAYVLHRAWVGPMILVVLDDPDDPTPYWLVSCRHPERVLSALRG
118467102YP_879813.1 LpqG protein [Mycobacterium avium 104]MPVATNAPKCVRSAIAAAAAGLAVVAISACDKHGPPPSGAAPRQVTVVGS
GQVQGVPDTLTADVGIEFTAPDVTTAMNQTNERQQAVINALVGAGIDHKD
ISTTEVALTPQYSNPEAGGSAAITGYRASNAVAVKIHPPDAASRLLALIL
GTGGDATRIRSVSYSIADDSQLVKDARTRAFNDAKSRAEQYAQLSGLHLG
KVLSISEATGNAPPPGGPPPSPRAMPMAVPLEPGQQTVKFTVTASWELD
118467101YP_881104.1 enoyl-CoA isomerase [Mycobacterium avium 104]MNPGISIEREGGILRLTLDRPDKLNAVDTPMLNELLGRLDESADDASVRA
VLLTGAGRAFCSGGDLTGGDTEGAAQAANDVVRAITELPKPVVAGVHGPA
VGVGCALALACDLVVATRAAYFQLAFSKLGLMLDGGASVLLPAAIGRARA
ARVAMTAEKITAATAFEWGLISYVVDDDAYETDLAELTSTLANGPTHSYR
WIKRALSAATLSDLESVQSLEADGQRLLVRTSDFAEGVRAFRERRPTEFR
GE
118467100YP_879987.1 hypothetical protein MAV_0712 [Mycobacterium avium 104]MLPSARPSKPARQASGQLSDIVRSNHSLPPTGGARGDRGKPPETARKQLI
NRCLSGSGLLRGEPVR
118467099YP_881739.1 acyl-CoA synthetase [Mycobacterium avium 104]MEIRDHISSGKPALVLARTGTVIDFAELEKRANRLAHFWYAAGLREGDTV
AALLENNEHVHAVMWAARRSGLYYTLINTHLTAAEAAYIVDNSSAKALIG
SRATRDVCEGLAEHSPGGLPELLLIADDDLDGWYRYPECVADQPETPIPD
ESEGDLLQYSSGTTGRPKGIRRELPHLPPSEAPNILMPLMNAVGITSESV
YLSPAPLYHTAPSFWSMVVQSLGGTTVVMEKFDPEHALECIQRYGITHGQ
FVPAMFVRMLRLPEAVRMSYDVSSLQRVVHAAAPCPVDIKKQMIAWWGPI
IDEYYAASEAVGASFIRAEDWLIHPGSVGRPLVGVPHILDESGHELPPGV
PGEIYYEGGHSFQYLKDDAKTAAAHDAHGWVTVGDIGYLDVDGYLYLTDR
RHHMIISGGVNIYPQEAEDLLITHPKVLDAAVFGIPDDEMGQAVKGVVQT
VDPADANDGFAAELLEWLRNRLAHYKCPRSLSFEAQLPRTDAGKLYKQEL
VGKYSAKG
118467098YP_879855.1 glycerophosphoryl diester phosphodiesterase [Mycobacterium avium 104]MSSLGSRWAVAAAVALLMAVLLSAAPVYGQPATFDLQAHRGGRGETTEES
LRAFAKAIQTGVSTLELDIVVTRDGQPLVWHDPTIQADKCSDTGPAFPGD
PGYPYVGKLVHQLTVAQIHTLDCGHRLKEFPDAEVVRGNKIATLPEVFAV
ADSHRADAIRYNIETKVEPDDTGASAPPQEFVDVILAAVRSADKLARVEI
QSFDWRTLPLVRRAEPSIPLVALYDERAAGDPVLGARAAGADIVSPDYRL
VTGKPYVDRAHALGLKVIPWTVDDAENMRRQIDYGVDGLITDFPTLARGV
LAELGVPLPPAVPG
118467097YP_882539.1 hypothetical protein MAV_3357 [Mycobacterium avium 104]MAMTTEVKDELSRLVVKSVSARRAEVTSLLRFAGGLHIVGGRVVVEAEVD
LGNVARRLRKDIFELYGYNAVVHVLSASGIRKSTRYVLRVANDGEALARQ
TGLLDNRGRPVRGLPAQVVGGSIADAEAAWRGAFLAHGSLTEPGRSSALE
VSCPGPEAALALVGAARRLGVSAKAREVRGADRVVVRDGEAIGALLTRMG
AQDTRLIWEERRMRREVRATANRLANFDDANLRRSARAAVAAAARVERAL
EILGDTVPDHLASAGKLRVEHRQASLEELGRLADPPMTKDAVAGRIRRLL
SMADRKAKIEGIPDTESAVTPDLLEDA
118467096YP_881051.1 hypothetical protein MAV_1828 [Mycobacterium avium 104]MRLSPFVLNAGFYRPALLARDVAAIDLLTDHRFELGLGAGYVKEEFEAAG
LAFPSARERVDHLTHMVGYFREHVPNVPIMIAGSGDRVLTLAARHANIIG
LSGGRANSMAADPLADLVGFIREKAGERFDDIELNLMITALPHDDSGAPK
VLRTSGFGQSLSEEQILASPTTLAGPPRAMADTLLRYAEDYKITYISVPQ
LHAEAFGRVIGELR
118467095YP_882559.1 alpha/beta hydrolase [Mycobacterium avium 104]MPRLDNPADEKPGIDPILQKVLDAVPFRLSTEDGIDAARQRFRDLPRRPL
HPELRVEDRTIPGPQGAIAVRIYWPPIHSESRPAPVVLYFHGGGFVIGDL
DTHDGTARQHAVGAGAIVVSVDYRLAPEHPYPAAVEDAWAATLWAAENAA
GLHGDPGRIAVAGDSAGGTLAAVTAQRARDRGGPPVRFQLLWYPSTMWDA
SLPSFAENATAPILDVKAVAEFSRWYAGDVDLSDPPADMAPGRATDLSNL
PPAYIGVAGYDPLRDDGIRYGERLAAAGVAAQVHNAETLVHGYLGYAGVV
PAATAAMERGLVALRTALQG
118467094YP_882970.1 nudix hydrolase [Mycobacterium avium 104]MRTDYYNDPNAPRPNSVVPSASAIVADERGRILLIKRRDNTLWALPGGGH
DIGETIEQTAVREVKEETGLDVEITGLVGVYTNPRHVVAFTDGEVRQQFS
LLFTTRVLGGELAIDHESTDIAWTDPDDIADLDMHPSMRLRIEHYLQHRD
SPYLC
118467093YP_881811.1 acyl-CoA dehydrogenase [Mycobacterium avium 104]MDLLPGAEQLEIITAAGEFLADRMPVDRIRANRHAEAPIPESLWRECAEL
GLLTLGLDEASGGSGRRLDDEALLFVELGKRLAPGPFLACTLGARVAARC
GDDALAQRIGSGAASVALAVLRGDGDVRPVKGTFDLFDPAGVSHALLVAR
SGAALVGIDSFGPLKSVTAADPGTRISSATVESAEPLHWLPAEDEWIWGR
ATVLAAGYLTGLAAAAAASATEHAKTRVQFGKPIGVHQAIKHACVNMEIA
AEAAQAQTFFAAIAVGSGRADALMQVLSALTVAGSAAVENAAAGIHVFGG
MGYTFENDMHLYLKRAHVFRHLFGEPTDVLAELLAQDRAQ
118467092YP_880426.1 hypothetical protein MAV_1178 [Mycobacterium avium 104]MATRFMTDPHEMRAMAGRFEVHAQTVEDEARKMWASSMNIAGAGWSGQAQ
ATSYDTMGQVNQAFRNIVNMLHGVRDGLIRDANNYEQQEQASQQILSS
118467091YP_883013.1 NAD(P)H:quinone oxidoreductase- type IV [Mycobacterium avium 104]MTKLAIIYYSATGHGTTMARRVAAAAESAGAQVRLRHVAETQDPESFAHN
PAWTANYQATKDLPAATGDDIVWADAVIFGSPTRFGSPAAQLRAFLDSLG
GLWAQGKLADKVYAAFTSSNTLHGGQETTLLSLYITLMHFGGIIVAPGYT
DPSKFVDGNPYGASLVTTHDNIHEFDEPTANALDHLARRVVETAGRLAS
118467090YP_882622.1 hypothetical protein MAV_3440 [Mycobacterium avium 104]MATWYDVARIVGELALTSEPSPHDWRVGKKLLAWERPLRPSEREALARTG
AEPAPGDVLGVRVADEGVKFALIDDAPQTFFTTPHFDGYPAVLVNLAAIS
VRDLEELITEAWLTQAPRKLVQEFLADSR
118467089YP_883522.1 hypothetical protein MAV_4387 [Mycobacterium avium 104]MDPTLSYNFGEIEHSVRQEIHTTSARFNAALDELRARIAPLQQLWTSEAA
TAYQAEQLKWHRSATALNEILVQLGDAVRDGAEEVADADRRAAGVWAR
118467088YP_881201.1 hypothetical protein MAV_1982 [Mycobacterium avium 104]MHRIHAERRDELEPTAGQQNWRHRLMTLGHDPLKQAR
118467087YP_880173.1 hypothetical protein MAV_0911 [Mycobacterium avium 104]MRYRLDVVAATAVDVVRFAGGWIFDRSMAGWDVTVLLMDLAEEPDPRPLQ
IVGAQVLDLEEALASVHARPRPQALAAGADLFGCDARVRQGVLQALDHGV
TEVTLWGETWPSELDDSVGLVQHRLSMAAQTFKAKALAAASGVDGAPQVA
VDRVETFRSGLLAWPSVAADLVPAS
118467086YP_880106.1 hypothetical protein MAV_0833 [Mycobacterium avium 104]MVWPASRIGCSFAGLLFFQPVVRCAEPSAETPSQLALKTALMPPSWDSHA
VR
118467085YP_882026.1 alkylhydroperoxide reductase [Mycobacterium avium 104]MPLLTIGDQFPAYELTALIAGDLSKVDAKQPGDYFTTITSEDHAGKWRVV
FFWPKDFTFVCPTEIATFGKLNDEFEDRDAQVLGVSIDSEFVHFNWRAQH
EDLKNLPFPMLSDIKRELSLATGVLNADGVADRATFIVDPNNEIQFVSVT
AGSVGRNVEEVLRVLDALQSDELCACNWRKGDPTLNATELLKASA
118467084YP_881637.1 dienelactone hydrolase [Mycobacterium avium 104]MIHDAFGYGRDKQSINDRIARAGYLALTPNMYARGGLVRCITRVMKELAA
QRGRALDDILAARDHLQAMPECTGRVGIAGFCMGGRFALVMSPKGFGASA
PFYGTPLPGNLDEVLEGACPVVASFGGRDLTGKGAPEKLRKVTADKNITA
DIKVYPEAGHSFANELPAQPLLRIAGFGYNEEATEDAWRRVFSFFGEHLA
ATP
118467083YP_882246.1 hypothetical protein MAV_3061 [Mycobacterium avium 104]MPSEPAPPPPKSAPGWYPDPAVGHGLKRYFDGTSWTGEWAFFTEQRKNGT
SGKAALALAALGVVVLLLIFAKSWAFDPEKAARATATSAATGSTEPAPPT
PAGPKKPDGVTFTTAAAPDGDVVDARFAIRDNYSEEMIRDGARSDTIQIL
KYAHATYPNASAVNVQGTFPMTDPYGNTSTQVAIDLTYSRATLNKINFDG
VRANTIWEIRDSGTVLPAFQP
118467082YP_880737.1 low molecular weight phosphotyrosine protein phosphatase [MycobacteriuMTDSPASLAAHVRRDISIDQQLALRTASTRLHDDFAEHFGVETIERFLHS
SYDQFAGRATVPNFLPLLAERWARQRLTALARVEGKVTDTKPTVLFLCTH
NAGRSQMALGYFNHLAGDQGVAWSGGSEPGNEINPAAVQAMAEVGIDITR
EFPKPWTDEIVQASDVVVTMGCGDACPFFPGKRYENWDLTDPAGQGVDVV
RPIRDEIESRVRRLLAELHITPVS
118467081YP_882069.1 TetR family transcriptional regulator [Mycobacterium avium 104]MLLGLLPDGLATLDPTARTIVTAARTCFTERGFSNTTMQDIADAAGVGVA
TVYRRFRHKRNLVRLTIIDESVRLSTLISDVAGRAASAEEGIAEVFAAFV
HEASAPKLLTRSIRESPAAGELSAFLTDEHLIAISRTYIASWLRRWQERG
ELADDLDTEVVGEMIGRLIISLIETPKSVIPVYNLAEARDFARRYLVPLV
LPAPAALPG
118467080YP_881457.1 hypothetical protein MAV_2253 [Mycobacterium avium 104]MNAVNAAIGVTAAAFTARTQETVGGVTAAAGGYTAQEATSAADIAAITGV
TVV
118467079YP_879882.1 short chain dehydrogenase [Mycobacterium avium 104]MSLSEAPKEIAGHGLLEGKVVIVTAAAGTGIGSATAKRALAEGADVVISD
HHERRLGETADQLAALGQGRVESVLCDVTSTAQVDALFASAHARMGRIDV
LVNNAGLGGQTPVVDMTDDEWDRVLDVTLTSVFRATRAALRYFRDAPHGG
VIVNNASVLGWRAQHSQSHYAAAKAGVMALTRCSAIEAAEYDVRINAVSP
SIARHKFLEKTSSADLLDRLSAGEAFGRAAEPWEVAATIAFLASDYSSYL
TGEVISVSSQHP
118467078YP_879629.1 malyl-CoA lyase [Mycobacterium avium 104]MTQLLRRSELAVPASNDNMFDKAAGCGADLVFLDLEDAVPPAFKEESRGK
AISALNDLDWGRTARAVRINGLDTPWCHDDLIEVVTAAGRNLDTVIIPKA
RRARDVWWVDVLLSQLEAKLNLGNKIRLEVLIEEVEGLANAEEIAVASPR
LDALIFGVGDFSLSQGARVDTNFVPLGEYPGDFWQYARNKVIVAARIAGI
DAIDAPYPDYRDLAGYERDARRAALMGYTGKWAIHPDQVPVANRVYAPTA
DEIARAEANLAAYREAESNGRGAVGVNGVLVDAAHVKMAQQTLARAALIN
GTGGSNDR
118467077YP_883403.1 L-lysine aminotransferase [Mycobacterium avium 104]MTAALERLARARSCTGPDRVHEVLSRSILTDGFDFVLDLDRSRGSVLYDA
RDGRRYLDMFTFFASSALGMNHPALARDAEFRAELTAAALNKPSNSDVYS
VPMARFVETFVRVLGDPALPHLFFVDGGALAVENALKVAFDWKNRHNERR
GVDPALGTRVLHLRGAFHGRSGYTLSLTNTKPVTVARFPRFDWPRIDAPH
LRCGADIDALEAESLRQARAAFAAHPHDIACFIAEPIQGEGGDRHFRPEF
FAAMRRLCDEHDALLIFDEVQTGCGLTGTAWAYQQFGVQPDVVAFGKKTQ
VCGIMAGRRVDEVADNVFAVSSRLNSTWGGNLADMVRARRILEVIEADEL
FEHAARQGAYLLRGLHDLAREFPGLVLDVRGRGLMCAFSLPTTADRDELI
GRLWRGGVIVLPTGDDGVRFRPALTVSRGEIDAAIGAVRDALPTLG
118467076YP_880801.1 ABC transporter ATP-binding protein [Mycobacterium avium 104]MIRTWLSLVPADRRNKVVAYTVLALLSVAVRAVATVLLVPLVGALFSGAP
HRALVWLGWLTAATAIGWAIDTATARIGFNLGFAVLDHSQHDVADRLPGV
RLDWFTVEHTATARQAIAATGPELVGLVVNLLTPLISAVLLPAAIAVALV
PVSWQLGLAALGGLPLMLGALWASARLARRADSTAAEANSALTERIIEFA
RTQQALRAARRVEPARSLVGDALAAQHGATMRLLAMQVPGQLLFSLASQL
ALILLAGAATALTVNGTLTVAEAIALIVVIVRYLEPFTTISELAPALEST
RATLDNIRAVLTAPQMNAGSASLPGTAAPRIEFDDVVFRYDGASVPVLDG
VSFSLEPGSTTAIVGPSGSGKSTILALIAGLHEPTRGRVRIDGVDAATLD
AESRRAASSVVFQHPYLFHGSIRDNVLAGDPGAGDDAYARAVALARVDEL
VARLPDGADSVVGEAGSALSGGERQRVSIARALLKPAPILLVDEATSALD
TENEAAVVDALTADPRSRTQIIVAHRLASIGHADRVLFLDHGRVVEDGTV
DELRAAGGRFAEFWRQQHEAAEWRIPAG
118467075YP_879596.1 metallo-beta-lactamase [Mycobacterium avium 104]MDHKPPSPVIEAAHHACVLPFSDDADFRDADRGFIAALSPCVVRGADGRV
VFDNDAYAFLDGPAPTSVHPSLWRQSTLAAKHGLYEVVPGIYQVRGLDIS
NVTFVETDTGIIVIDPLVSTEVAAAALTLYRTHRGGDRPVVAVIYTHSHV
DHFGGVLGVATQADVDAGRVAVLAPEGFVEHAVQENVYAGPAMLRRATYM
YGTLLPRGLFDHVGCGLGQAASMGEVALIVPTVDIRETGETHTIDGVEIE
FQMAPGTEAPAEMHFYFPQFRALCMAENATHNLHNLLTLRGALVRDPRAW
SGYLTEAIDTFADRADVVFASHHWPTWGRDGIVEFLSLQRDLYAYLHDQT
LRLLNQGHTGVEIAEMFRLPPALERAWHARGYYGSVSHNVKAIYQRYMGW
FDGNPARLWPHPPEALGPRYVAAMGGIDRVVDLAQQAFDSGDYRWAATLL
DHAMFTDGEHVGARELYADTLEQLAYGAENATWRNFFLSGATELRDGNFG
TAGQVTSPTMLAQLTPEQIFDGLAIRVNGPRSWGLDITVDVTLADTAVNH
RLALRNGVLVQRKVPADPTTATVTVRLANKIRLLALAAGDFASPGLELTG
DRGALQSLVGALDAPDPDFNIVTP
118467074YP_882533.1 hypothetical protein MAV_3351 [Mycobacterium avium 104]MVEPFIGSEAVADGEVVKSALRTRYKRLFRDVYIHPGAELSALTRARAGW
LWSRRRGVIAGLSAAAVHGARWVDATAPLEILHSNRNPLPGLRIHSDRLE
SDEYALVDGVPVTTPARTAVDLGCWHPVNDAVAVIDDLLRATDCKVAECQ
LLADRYPGRRGMQSARAAIGLADAGAQSPKETWLRLLLIRAGLPRPQTQI
PVSDEFGGVTYYLDMGWEDFMVAAEYDGEQHRRDRWQYTWDIRRRETLER
LGWIVIQVVAGDRPADIVSRVSAALARRGVTLA
118467073YP_880553.1 extracellular solute-binding protein- family protein 5 [Mycobacterium MVGRAAVRLLDTLISVPRRVRRVFMVLGGLVSVVGLVLSACTVNPPPAPQ
STDTPHNSVPPPPRVSQIIMGIDSIGAGFNPHLLSDLSPVNAAISALVLP
SAFRPVPDPNTPTGSRWEMDPTLLVSAEVTSQNPFTVTYKIRPEAQWTDN
APIAADDFWYLWHQMVSQPGVVDPAGYDLITGVQSLEGGKQAVVTFSEPY
PAWKELFNNILPAHIVKDVPGGFAAGLARALPVTGGQFRVESIDPQRDEI
LIARNDRYWGPPAKPGLILFRRAGAPAALADSVRNGDTQVAQVHGGSAAF
AQLSAIPDVRTARIVTPRVMQLTLRATQPKLADTQVRKAILGLLDVDLLA
AVGAGSDNTVTLDQAQIRAPSDPGYEPTAPPAMTTPAALALLEGAGYKVE
PNTSASPATPAPGPPNTGPPEVIRGRISKDGQQLSLAIGVAANDPTAVAV
ANTAADQLRNVGIAATVLALDPVTLYRDALNDNRVDAIVGWHQAGGNLAT
RLAARYGCPALQSTQVPASTEPTPTSPAPGGPAPSTGPATRSATPTSTPP
PSRPADPNALVQAPSNLTGICDRSIQSNIDAALNGTKNINDVITAVEPRL
WNMSTVLPILQDTTIVAAGPSVQNVSLSGAVPVGIVGDAGQWTKTGP
118467072YP_883279.1 immunogenic protein MPT64 [Mycobacterium avium 104]MRSFSVAAFAAALVLAGPAGAAAAAPKDYCADLKGANTGQTCQIQMADPG
YNVDISFPANYPDEQPVADFISKQRDDFLNAAKSSAPRDQPYQLTITSAK
YGSAIPPRGTEAVVLKVVQNTGAGPHTTYKSFNWDQAYRKEIVWTAAADD
KKNTPLWRVDDPLATVAPIVQSELQKQTAPPANPNQPAPPANQPASPTPT
APPVTVASAAAYDPANYQSFAITNDGVIFFFDQGRLLPDSAGAPQVLVPR
SAIDPMLA
118467071YP_880711.1 hypothetical protein MAV_1469 [Mycobacterium avium 104]MRMSSGTALSVELYLTVAQAGAELDVTEEAYKAGWDYPPRMGALGVISPR
TCPRCPVNRILWWAIAGSVPGSGVSDGGVSVPDVRGPSRESLW
118467070YP_883295.1 superfamily protein I DNA and RNA helicases [Mycobacterium avium 104]MSDRYSPRELACALGLFPPTEEQAAVIAAPPGPLVVIAGAGAGKTETMAA
RVVWLIANGYAHPGQVLGLTFTRKAAGQLLRRVRSRLARLAGVGLGAASP
NHGAVDPEAAPVVSTYHAFAGSLLRDYGLLLPVEPDTRLLSETELWQLAF
DVVNRYRGPLRTDKTPAAVTSMVLRLWGQLAEHLVDTSQLRETHLELERL
VHALPAGPYQRDRGPSQWLRRLSGTQSERAELVPLLEALDERMRAVKVMD
FGMQMASAARLAAAFPQVGADLRGRYRVVLLDEYQDTGHAQRIALSALFG
GGVDDGLALTAVGDPIQSIYGWRGASATNLPRFTTDFPRSDGTPAPVLEL
RTSWRNPPRTLRVANAISAEARRRSVAVHALCPRPDAPPGTVRCALLPDM
VAEREWIADHIDAHYRRARADGVSPPTAAVLVRRNADAAPIADALRARGI
PVEVVGLAGLLSVPEVAELVAMLRLVADPTAGAAAMRVLTGPRWRLGARD
LAALWQRARALGGAGTAGGPATAEAIASAADPRNVEADAVCLADAIADPG
PAEGYSAAGYARIAALAAELSALRAHLDHPLGDLVAEVRRVMDLDCEVRA
AAAAGWAGTEHLDAFADVVAGYAERADTGGTDASASASVAGLLAFLDVAE
SVENGLPAAPLAVARDRVQVLTVHSAKGLEWQLVAVAHLSGGVFPSTTAK
TTWLTDAAELPPLLRGDRARPGALGIPVLDTSDVTNRKQLSDKISEHRRQ
LEQRRVDEERRLLYVAVTRAEDTLLVSGHHWAATGIKPRGPSDFLCEIKD
VIDASAAAGDPCGTVEQWAPAPADGERNPLRDNAVEAVWPADPLASRRGE
VERGAALVRQAMAAEPGDPGADVEGWAADVDALLVERARVTGPPPQVLPG
QLSVSSLVGLARDPARAAQRLRHRLPSRPEPHALLGNAFHAWVQKFYGAE
CLFELGDLPGAADSDVGDTAELAELQAAFLESPWAARTPVAVEVPFEMPI
GDTLVRGRIDAVFAESDGGATVVDWKTGAPPDSPEAMRQAAVQLAVYRLA
WAALAKVPESSVRTAFHYVRARTTVVPEALPTSDQLAGLLAPTAPV
118467069YP_881495.1 cytochrome C oxidase- subunit 2 [Mycobacterium avium 104]MLRPLALAVTLGVLAIVLSGCSSWADALALGWPKGITPQAHLNRELWIGA
VIASLVVGAIVYGLIFWASAFHRKKATDTELPRQFGYNMPLELVLTVTPF
LIISVLFYFTVVVQEKMLHIAKDPEVVVDVTAFQWNWKFGYQKVNFKDGT
LTYDGADPERKKAMVSKPEGKDAHGEERVGAVRGLNTSDRTYLNFDKVET
LGSSDEIPVLVLPTGKRIEFDLASADVVHTFWVPEFLFKRDVIPNAEANN
SIHVFQVEEINSPGAFVGHCAEFCGTYHSMMNFEVRVVSPNDFKAYLQQR
MDGKSNAEALQAIGQSPVAVTTHPFDSKRGQLAGSQ
118467068YP_880063.1 PPE family protein [Mycobacterium avium 104]MLGLAASWRGPSADAMTASALAYAAWLTTTAAQAEHTANAARAAAAAYES
ARAATVPPALVAANRAQLRVLVATNLLGQNTAAIAALEAVYTEYWAQDIA
AMAEYQVASAASTRGLQPFDSAPRVTDSLDVPDAQDATGGAGSILSLLNP
NDIPLWGLDNGSLLGQYLQSFLSSGPYAFPVAVLSMFNVLWALAPATPVM
QALNRLSAAAEATAPAAGPAVAVSSVRAAFGNATRVGPLSAPQQWWTQPP
NNTVPAAPAAARPLPATETPTPLPLPTPIPARGGTPPKQPRPEPEYGGLV
RFVTRPPAGG
118467067YP_884268.1 TetR family transcriptional regulator [Mycobacterium avium 104]MLPRGNRRPGRPPAAKADETRQRIIQAARLVFSERGYDGATFQAIAARAD
LTRPAINHYFSSKRALYQEVMDETNEFVIGVGIKEADRETTLVGRLTAFI
SAAVKANAENPAGSAFIIGGVLESQRHPEWNTAENDSVRIAREFLIRVVN
DAIEHGEVAADIDASALVETLLVVMCGVGLYAGYVETYQEMLAVTGMLRQ
LLEGALWRPGS
118467066YP_881143.1 hypothetical protein MAV_1923 [Mycobacterium avium 104]MFVLAGMKVFLSETGAGHIDCDHESHPPTLVFMTRRPLAELRHVLERRGA
VFRADEVVEGFPVDADGVRAGRNAEFLWFYDLDGNKMEFCRVLAKS
118467065YP_882593.1 elongation factor P [Mycobacterium avium 104]MASTADFKNGLVLVIDGQLWQIVEFQHVKPGKGPAFVRTKLKNVLSGKVV
DKTYNAGVKVETATVDRRDTTYLYRDGSDFVFMDSQDYEQHPLPESLVGD
AARFLLEGMPVQVAFHNGSPLYIELPVSVEMEVTHTEPGLQGDRSSAGTK
PATVETGAEIQVPLFINTGDKLKVDTRDGSYLGRVNA
118467064YP_883115.1 cobalt transport protein- putative [Mycobacterium avium 104]MAGLTVPTTGTCLLDGRPAAEQVGAVALQFQAARLQLMRSRVDLEVASAA
GFSPDDHDRVSAALATVGLDAGLAERRIDQLSGGQMRRVVLAGLLARSPR
VLILDEPLAGLDAASQRGLVELLAERRRETGLTVVVISHDFAGLEQLCPR
ILHLRDGSLDANPVAAQPVPVPVAPPTKRPAARRRPVVLLRPVPGSSPIH
ELWAGTKLLVVFAMSLLLTVFPGWVAIGLATALAAAGLRLAHIPRGVLPS
VPRWLWIFLGVVGVTAALAGGAPTIHLGTASLGLGGLLDFLRATALTVVL
LGLGALVSWTTNVAQIAPAVAALGRPLRVLRIPVDDWSVALALALRTFPM
LIDEFRVLYAARRLRPRRPAQTRWARLRRPATDLIDVVVAVITVTLRRAD
EMGDAITARGGTGQISAAPSRPKRNDWIALSIASAVCAAAVAAELALLAG
H
118467063YP_884045.1 integral membrane protein [Mycobacterium avium 104]MSWFSAPDYWVGRLVLERGVAVIYLLAFVAAAAQFRALIGEHGMLPIPRF
LAGQSWRRTPSIFHLHYSDRLFAALSWFGAALSAAIVAGAADAVPLWAAM
LMWLTLWVLYLSIVNVGQTWYSFGWESLLLETGFLMIFLGNAEVAPPLLT
LWMARLLLFRVEFGAGLIKMRGDPCWRDLTCLYYHHETQPMPGPLSWFFH
HLPKPLHRIEVAGNHFAQLIVPFGLFAPQPVAGVAAAIIVVTQLWLVASG
NFAWLNWVTILLACSAIDDSSVALLLPKSVLPGQGEPSASPLWFVVVVVA
VTAAVLVMSYWPIRNMLSSRQRMNMSFNSFHLVNTYGAFGSIGRVRREVV
IEGTADDDITDQTVWWEYEFKGKPGGVRRLPRQWAPYHLRLDWLMWFAAI
SPGYAQPWLSPFLQRLLENDRPTLRLLRHNPFPDAPPRYVRARLYEYRFT
TPAELRRDRDWWHRTLIGGYVPPLTLSKLTPQDHG
118467062YP_883152.1 hypothetical protein MAV_3997 [Mycobacterium avium 104]MLVGLRNNDGLNVYVADDGSYHFTFYERGQLGFDRVGNLDDLLYWYTQSV
VTGQAAKSVGDRAERFKYEYQVLSALNSEWAKRNVRETAELFRRERPGEW
CK
118467061YP_880442.1 3-hydroxyisobutyryl-CoA hydrolase [Mycobacterium avium 104]MTDGSDEVLTQVDGNVGLITLNRPKAINSLNQPMIDALSAVLTDWARDDK
VRAVLLSGAGERGLCAGGDVVSIYHSARKDGVEARRFWRDEYQLNAQISE
FAKPYVAVMDGIVMGGGVGVSAHANTRVVTDTSKVAMPEVGIGFIPDVGG
VYLLSRAPGGLGLHAALTGAPFSGADAIAMGFADHYVPHADVEAFRRAVV
ADGVESALAKYAVEPPPGELAAQRDWIDECYAGQTVEDIVAALRAHGAGP
AHDAADLIATRSPIALSVTLAAVRRAADLPTLKDVLVQDYRVSSASLRSH
DLVEGIRAQLIDKDRNPQWSPARLADVTAADVEAYFAPVDDDLSF
118467060YP_883695.1 galactose-1-phosphate uridylyltransferase [Mycobacterium avium 104]MFDIMGPTRAKLADGRDLLFFSLPGHRASPVEDRRPLPPRTAETVAPGGQ
SQLRFDRSTGQWVIIAALRQDRTYKPPPDACPLCPGPTGLTSEVPAADYD
VVVFENRFPSLSGAAPGLPAAGADGFVSAPAHGRCEVVCFSADHTGSFAG
LPPAHARLVVQAWRHRTAELMATPGIEQVFCFENRGEEIGVTLTHPHGQI
YGYPYLTPRTAAMLGQADDHRKRHGGNLFGDLLAREVADGSRIIARDDLF
TAFVPFAARWPVEVHIYPNRFVPNLTALRDDEVDGFVAVYLDVLRRFDRM
YDAPLPYISALHQYTGTGAQAHGYFHVELMSIRRSATKLKFLAASESAMD
AFISDVTPESVAQRLRELR
118467059YP_880696.1 transposase [Mycobacterium avium 104]MALSTYYDTKARVPSARALRDAVLGPALCQLWKDNYCVYGARKLWKTARR
EGHDVGRDQVARLMRAAGIEGVRRGKRVRTTKPDPAAARHPDLVKRNFTA
TAPNQLWVTDLTFVPTWAGVAYVCFIIDAYSRMIVGWRVASHMRTSMVLD
ALEMARWSRGNMLPGLRCHSDAGSQFTSIRYGERLAEIGAVPSIGTVGDS
FDNALAETVNGYYKAELIYGPARTGPWKTVEDVELATLSWVYWHNTSRLH
SYLGDIPPAEFEAAFYDAYRTDQPLIGIQ
118467058YP_881145.1 hypothetical protein MAV_1926 [Mycobacterium avium 104]MADAPISLTFDVSESIGTGEQLTQAAWVFLPERPSDASAVLLCLAGGTYD
KHYWHIDIDGHPGYSFGQHLADSGFVVIAVDHLGIGESTDPIASGPLGLE
LLARGDADVARQVEELSRPVDWGVSGDLRFG
118467057YP_881385.1 hypothetical protein MAV_2175 [Mycobacterium avium 104]MSKHLAGSSLLVAVGFGFANACGVAHALPQMPQVRYEVNGPAVAEFIYYQ
TDTGQLHQVNAPLPWSAQFTGFGGEVFTVSAQGPGPISCKILVDGNVVSA
ATASVGTPARTVCTH
118467056YP_882482.1 invasin 1 [Mycobacterium avium 104]MRRNRFRLIVFAWITAMVTGLMFSVAPTPAALADPGEWDPTLPAQISAGA
PGDPLAVANASLQATAQATQTTLNLGKQFLGGLGINLGGNDAPAAAATPS
NPGGKIPRVYGRQAIEYVIKRMGSQMGVPYSWGGGSLDGPSKGVGDGANI
TGFDCSGLMRYGFAGVGVLIPRFSGDQYNAGRHIPQDQARRGDLIFYGPG
GSQHVTMYLGNGQMLEASGSAGKVTVSPVRKPGMTPFLTRIIEY
118467055YP_881693.1 hypothetical protein MAV_2501 [Mycobacterium avium 104]MSDRLRDIRELAGDTDAYRDELYRRWTGLLSYRYIGRKHSSMNLGETDDT
VTIRRDMRNEAGGIMVAPLAISSPEGCQTDMVAVPNPVIASVQIIDPGYD
VKRVEIVGSGIVHQGRTMGYGRCTIVDADNPGRVIAFNEGQGAIIGVPPE
GLDRMDVSGTELVIEDSDELPPLWRAFGASRRGDGHWTLPELSTELASPD
AALHIGPQHVVLETAAIDLAAEVAGTRKLQVVSWHVMFMSRGKVGPFRVE
GTAHAGGSGRVGVRMLLHDEGNADKAVTSAAAVFEVVG
118467054YP_882073.1 MerR family transcriptional regulator [Mycobacterium avium 104]MSAPDSSALAGMSIGAVLELLRPDFPDVTISKIRFLEAEGLVTPQRAASG
YRRFTAYDCARLRFILTAQRDHYLPLKVIRAQLDAQPDGELPAFNTPYTA
PRLVSVAGTDAGANAGLGSDTSAVAPAHVRLSREELLRRAGVDDELLTAL
LKAGIITTGPAGFFDEHAVVILQCARALSDYGVEPRHLRAFRSAADRQSD
LIAQIAGPVGKAGKAGARDRADDLAREVAALAITLHTSLIKSAVRDVLDR
118467053YP_883074.1 hypothetical protein MAV_3912 [Mycobacterium avium 104]MTNTAASQTVNFCRSVLRWLRAGYPEGVPGPDRVPLLALLRSTPLTEEQI
AEVVREITKDGSPAIADGVINRDEIAEFISGMTHYDAGPENIIRVAARLA
AAGWPLAGIDVSEVIPGDDFAESAEIAARGQAPGVAS
118467052YP_882799.1 hypothetical protein MAV_3622 [Mycobacterium avium 104]MSKVDVAALIALCAALASAVGDVIRQRSAHEITDKPVGHLELFRMSLRDT
RWWLGGLAAITNYSLQAAALAWGSVVLVTALQVTALLFALPLYARLAHQR
IKPREWAWALILAAALAVVIIVGDPASGKQRAPLHIWVIVALVMVPVLVA
CVVAARRWAGSPFAAVLLAVVAGSSLALFAVLTKGVVEMSEHSLVGVLTS
PEFVPWLLVALTGMIFQQSAFRAGALTASLPTMTVAKPVVAGLLGVLVLD
ETLNAHGPKAFVLVGAVAVVIVATIALARGEAASINRPEPGPGSAPRKAR
DATADVAADDDDTGPFSGRLLVADSSRW
118467051YP_884330.1 alcohol dehydrogenase B [Mycobacterium avium 104]MIRGVGRDWEIAEIELDPPRSGEVLVRMAVAGICHSDDHLFTGDVVPTPE
VVAASGQPAPDWFPLLGGHEGAGVVAEVGPNVTSVRPGDHVALSFIPACG
SCRFCVNGQSYICDVGASLFVREMPTDGTCRRHLGAENLLAYGQLGTFAE
YAVLSERSVIKIDEAIPFHAASLVSCGVSTGWGSATVSAGTEPGDTVVVI
GAGGVGMNALQGARAVGAKYVVAVDPIAAKRDSAKIFGATHTAASARDAI
PLVREITAGLMADRVVVCPGVVHVDSIPLALALLRKGGVCVLTGITPFTE
PPVPLVLQEMTLSAKQLRGALYGGMNPRTSVPMLLSLYQAGDLKLDELVT
RHYRLDEINEAFADLREGRNIRGVIDFAGR
118467050YP_884133.1 mce-family protein mce1c [Mycobacterium avium 104]MRTLEPPNRVRIGLMGIVVTVLVIGVGQSFTSVPMLFAKPSYYGQFTDSG
GINTGDKVRIAGMDVGKVEGLKIDGDHIVVKFSIGTNTIGTESRLAIKTD
TILGKKILDVEARGSQQLRPGSTLPLGQSTTPYQIYDAFFDVTKAAQGWD
IETVKQSLHVLSQTIDQTYPHLSPALDGVAKFSDTIGKRDEQVKHLLAQA
NQVASVLGDRSDQIDRLLVNTKTLLAAFNERGQAINALLGNIAAFSEQVK
GLINDNPNLNHVLEQLRTVSDILVQRKDDLANGLTEVGKFLPSLNEAIAS
GPFFKVVLHNLALYQISQPWVDAAFKKRGIDPEDFWRSAGLPAYRFPDPN
GTRFPNGAPPPAPPVLEGTPDHPGPAVPPGSPCSYTPAADGLPRPDNPLP
CAGAVTGPFGGPGFPAPVDVMTSPPNPAGLPPTPGIPIAGRPGDAPPDVP
GTPVPLPTQAPPGARTENLAPAGPVPPPSTFAPGLPPGPPAPPGPGNQLP
APFINPGGTGGSGAAGGGSQN
118467049YP_881913.1 hypothetical protein MAV_2724 [Mycobacterium avium 104]MQLLVTGRHVANRCLPGFFPRRRSRVPGNDRTGSRIPVMHRPECDHKTSS
ELRRNYRKAAA
118467048YP_883316.1 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit [MycobaMKMAEDVRAEIVASVLEVVVNEGDQIGKGDTLVLLESMKMEIPVLAEVGG
TVSKVSVSVGDVIQAGDLIAVIS
118467047YP_882262.1 hypothetical protein MAV_3078 [Mycobacterium avium 104]MSIDPDQIRAEIDALLARLPQPGDTEDPDKAPSLDELEEIARRLSEAHDV
LLAALESAEKG
118467046YP_879434.1 hypothetical protein MAV_0139 [Mycobacterium avium 104]MMKYIAAAAIALSVLLSSACSASQVINTGGDTKCKDFTTQDEKKQNDEVS
KMLKDKSGTDPSNVEISATRLSAMTYCQTVGKPDTKISEAPHG
118467045YP_882133.1 dehydrogenase E1 component superfamily protein [Mycobacterium avium 10MTQSAKPSPDIHRRLYALMVLMKTADDRLSRGIGTGEFLCVYWPSRGQEA
IAAAMGVSLRPDDQLVTTYRGLHDLIGKGVGLEEIYGEMMGRTIGAGRGK
GGTMHIAKPEVGVMLSTGIVGAGPPVAVGLAMAARRKGLDRVTVVSFGDG
ATNTGSFHEAANMAALWDLPIVFVCQNNRYAEMTPTTDTMKLEHVADRAA
GYGMPGVRVDGNDPLAVTAALEEALRRARAGSGPTFLECETFRFRGHYFG
DRMPYIPADQLQAALAADPVPRFRRRLAETGVCGEAELARIDDDAAAAVE
AALRTVLGADSPAADELDRDVYAAPIPFPT
118467044YP_883924.1 hypothetical protein MAV_4798 [Mycobacterium avium 104]MAERVSSLLRRSVEHLHDEVPASYRLLAAELGAMVVGLDVDGEAFTLCGG
DRLDVSDGAPREAAVRIVTSRNTILALLDAEVGLGEAVQAGAVRVRGSLD
DVQRAHDALRAYVHAAVRAATQPALLSELRAGA
118467043YP_880316.1 hypothetical protein MAV_1061 [Mycobacterium avium 104]MRFTYAEAMTDFRYYIPLAKAAEAAGYHAMTIADSIAYPFESDSKYPYTP
DGSREFLDGKEFIETFVLTSALGAVTSKLRFNFFVLKLPIRPPALVAKQI
GSLAAMTDNRVGFGVGTSPWPEDYELLGVPFARRGKRMDECIEIIQGLTT
GEYFEFHGEFYDIPKTKMTPAPTKPIPVLVGGHADAALRRAARLDGWMHG
GGDPEELDHLLAKLKRFREEAGKTGPFEIHVISADAYTPDGIKRLEDKGV
TDVIVGFRIPYIKGKDTEPLDTKIRNLEMFAENVIAKV
118467042YP_883456.1 hypothetical protein MAV_4320 [Mycobacterium avium 104]MTTETKVTQKISPADGREGAGVVEQSVRPQRRRITCPATDFRAGQ
118467041YP_880887.1 alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergeMTETTRLAPGDKAPAFSLPDADGNTVKLSDFKGRKVIVYFYPAASTPGCT
KQACDFRDSLAELNGAGLDVVGISPDKPEKLAKFRDAEKLTFPLLSDPDR
KVLTAYGAYGEKQMYGKTVTGVIRSTFVVDEKGRIAVAQYNVKATGHVAK
LRRDLSV
118467040YP_884242.1 hypothetical protein MAV_5125 [Mycobacterium avium 104]MVAPTFDISKSSAARVTRANDEGLRYRLDVVAASAVDVVQSAGGWLYDRA
MAGWEVTVLLPHGCNTRSLRILGVRAADLDSGLAGLGQGAAGLAVSADAF
TADARVRDTVLESLHNRLTAVALWGDGWPLGVSRATTRAQHLLSGAARRF
KGYALAAEGISDGGIAPAESLLCDVCSAADSELVRLD
118467039YP_882888.1 transition metal uptake transporter- Ni2+-Co2+ transporter (NiCoT) famMTSTEIDRWPARATRFLGALAPAEWWRLASMLGAILALHLIGWLTLVLLV
APAQYSLGGKAFGVGVGLTAYTLGLRHAFDADHIAAIDNTTRKLMNDGQR
PLAVGFFFSLGHSTVVFALAVLLACGVRTVVGPVRDDSSALHHYTGLIGT
SVSGVFLYAIALLNVVVLVGILRVLARVRRGDYDPHTDAAELERQLDNRG
LMNRWLGRFTKSITQSWHCYPVGLLFGLGFDTATEVALLVLAGTSAAAGL
PWYAILCLPVLFAAGMCLLDTIDGSFMNFAYGWAFSNPVRKIYYNIIITA
LSVAVAWVIGSIELLVLFADEFGWRGSFWDWLGGLDLNTVGYVVVGMFVL
TWAVALLIWRYGRIEERWAGADPRAGTGREA
118467038YP_884271.1 hypothetical protein MAV_5154 [Mycobacterium avium 104]MKSSARTVVFPGAVSFGHTLAPLRRGLGDPCFLAPGDGSIWRTSLLPTGP
VTARISRAGTNAVQCVAWGAGAAQFVDMLPAMLGSEDDASDFVPRHPTVA
AAQRRVPHLRLGRTGLVLEALIPAIIEQRVPGADAFRSWRVLVSKYGTPA
PGPAPERMRVPPSAQAWRSIPSWEFHRANVDPRRAQTVVTCARRAASLER
LVSRPAAQARAALTSLPGVGEWTAAETAQRAFGDADAVSVGDYHIPKMVG
WTLLGRPVDDAGMLELLEPMRPHRQRVVRLLEASGLAREPRRGPRLPVQQ
IHSL
118467037YP_880491.1 hypothetical protein MAV_1246 [Mycobacterium avium 104]MAAEHWAEPPEESERRSDALDQREKALARREADVRRREWLAGRRGRVADQ
REQIADEREQLADEREGTAAERERARLRRIDERVKRTRARANREQAEVDR
EIAESERDDA
118467036YP_879614.1 hypothetical protein MAV_0327 [Mycobacterium avium 104]MTRKAEIVAVFAICTAFMTASGAFGGFAARADDPGVLYNGINQLRQACGP
IAEDPRLTEAAQQHADDMLRNGVNGHIGSDGSSPQARIAAAGYRSRYSGE
IVFWATGSAATPGEALDMWMQSPPHRAIILNCGFTAGGFATARDGNKMTA
VGDFAAS
118467035YP_880779.1 methylmalonyl-CoA epimerase [Mycobacterium avium 104]MTTDQVDARQVLATALVTAIDHVGIAVADLDAAIAWYHDHLGMILVHEEV
NEEQGIREAMLAVRGAPAGTAQLQLMAPIDDSSTIAKFLDKRGPGIQQMA
MRVSDLDTLIERLREQGVRLIYDAPRRGTANSRINFIHPKDAGGVLIELV
EPAA
118467034YP_884198.1 hypothetical protein MAV_5080 [Mycobacterium avium 104]MSSGLLSYASYLPRYRLSGQDIGVRHGNRVVASYDEDSTTMAVAAASSAL
MHSAVSPRALYFATSSPAYADKTNATAIHAALGLPADMPAADMCGTARSA
FAALTLAASSGGLVVAADVRVGRPGSADEKLGGDGAAALIFGEGDVIAEY
LASRSLTAEFLDRWRDPTSRTGQQWEERFGAQHYTALIRDAAREALDAAG
IADPDHVVVACPNSGVVKRAATLVKGQKTVATSVGFGGSADALIALCGTL
DVAEAGDTILVLSATDGCDAMVLRATSRLPRARQPRPLNDQRAEGTPVEY
VTYLAWRGLVTMEPPRRPEPERPAAPPASRARLWKFGMTGARCRACGFMH
LPPVRVCRSCNAIDEMDPQSAAGLRGTVVTYTVDRLAYSPSPPMVQAVVD
VDGGGRCTLEVADARVEDLRVGTRVRFSFRRLFTASDVHNYFWKVVQDDA
E
118467033YP_880327.1 M23 peptidase domain-containing protein [Mycobacterium avium 104]MRVGRAPGARSAEPHRTEVTEILPLDGFDFDDLDFCDDAGDHGDLDFSTD
SPFDNEAQVLLAPELDDLNETDDLRPLWLAAPVTEVLPRTTVAARTERRP
ERPRGADVVGVARRGGQHRKQPTSAARGRLLISAMAAGAAAAAAHTATSH
ADTPKTDAVLTANASSLTGGAGGSNTVRGPQVIAAEPAATAALHNQELAK
GVAFANDRAQREARLQQPLYVMPTKGIFTSNFGYRWGVLHAGIDLANSIG
TPIYAVSDGVVIEAGPAGGYGMLVKLRHADGTVTLYGHINTALVSVGERV
MAGDQIATMGNRGNSTGPHLHFEVLQGGTERIDPVPWLAKRGLMVGNYAG
118467032YP_880141.1 hypothetical protein MAV_0874 [Mycobacterium avium 104]MAVAGDAELERVRAVHQMRSYRIGSVLRVGVVGLMVAAMIIGTARSEWPQ
ESVLILLYGIIALGAVALAFAPFRRWIGIGRLAGVGRLEPFAFTVVDILA
LTIFQLLSTNGIYPLLIMAMLPVLLGLDVSSRRAAVVLIFSMLGFAIAVL
QDPVMSSSVRLPEAGFRFLLYGFLCCAAFLVVRIEERHTRSVAGLSALRE
ELLAQTMNASDVSQRRISEFIHDGPLQDILAVRQELVELDAAVPDDERIG
RALAGLQLASERLRQATFELHPAVLEQVGLGAAVQQLAEFTAQRSGIEIS
TDIDYSGRSAIDAVVFGVVRELLSNVVQHSRARTAAIMLGRTDGTCVLHV
VDDGVGFNQETVARRLGEGHIGLASHRARVEAAGGELVFLDVPVGTHVCV
EVPLRN
118467031YP_881985.1 amidohydrolase [Mycobacterium avium 104]MRIIDADGHVAENSSLAIEAIQRWPEHVKPGRHGRLGLMIEGRNYPEDGG
PGAGCPPEHGISDAPDINCRSAEGVLGDADRDHIDTMVLYPSLGLCAPSL
RDPEFAAGFARLYNRWIADYCAQSGGRLRGVAVTPIEHGQLAIDVMREAK
DLGLVATLVPPALQSRNLDHPDLDPFYAAAVELGMPLGVHGAPGIHLPKI
GVDRFTNYIQVHCISFPFDQMTAMTAMVSGGVFERHPKLRVAFLEAGAGW
VPFFIDRLHEHYEKRGDWVERGWRRDPHEYLKAGNIFVTCEPEEPILPGV
IDVLGADFIMFASDYPHWDGEWPESTKHLRTRADISEETREKIGGLNAQR
FYNLN
118467030YP_883768.1 porphobilinogen deaminase [Mycobacterium avium 104]MIRIGTRGSLLATTQAGGVRDALIARGHPAELVTITTAGDRSSGPIESLG
VGVFTTALREAIEEGRVDAAVHSHKDLPTADDPRFAVAAIPARNDPRDAV
VARDGLVLGELPPGSLVGTSSPRRAAQLRALGLGLEIRPLRGNLDTRLNR
VSSGDLDAIVVARAGLARLGRLGDVTETLEPVQMLPAPAQGALAVECRAG
DSRLAAVLAELDDADTRASVTAERALLAELEAGCSAPVGAIAEVVESIDE
DGRIFEELSLRGCVAALDGSDVIRASGIGTPGRARELGLSVAAELFELGA
RELMSGARHDPARGN
118467029YP_883038.1 electron transfer protein- beta subunit [Mycobacterium avium 104]MTNIVVLIKQVPDTWSERKLTDGDWTLDREAADAVLDEINERAVEEALQI
REREGGEGSVTVLTAGPERATEAIRKALSMGADKAVHLKDDGMHGSDVVQ
TGWALARALGTIEGTELVIAGNESTDGTGGAVPAIIAEYLGLPQLTHLRK
LSIENGKVTGERETDDGVFNLEATLPAVVSVTEKINEPRFPSFKGIMAAK
KKEVTVLTLAEIGVEPDEVGLANAGSSVLSSTPKPPKTAGEKVTDEGEGG
NQIAQYLVGQKII
118467028YP_884419.1 R3H domain-containing protein [Mycobacterium avium 104]MADADTTERELDTAAPAEPEPADGDEADDLEERLVAEGEIAGDYLEELLD
LLDFDGDIDLDVEGSRAVVSIDGSDDLNKLVGRGGEVLDALQELTRLAVH
QKTGVRSRLMLDIASWRRRRREELAALGDKVARRVLESGQREELAPMTPF
ERKIVHDAVAAVPGVHSESEGVEPSRRVVVLHD
118467027YP_880422.1 potassium-transporting ATPase- F subunit- putative [Mycobacterium aviuMGVAVYLVLTVAVFAALGVAQKLVERL
118467026YP_884172.1 ABC transporter transmembrane protein [Mycobacterium avium 104]MTDTLTLRLPFGEVIVQAWTLLKVTALPAVLMAIPFGAMVAVQLSGLVNE
VGANSLVGSATGVAVLRQGAPVTAGLLMGGAAASAIASDFGARAIREELD
ALKTLGIDPVRRLVVPRFLGLLLITPSLVVIVIAMGVGAAFVIATVVNGV
TPGSFWLSFGSFAKMVDLWFTMGKGFIFAGIVAVISSQRGMEAKGGPRGV
ADAVNASVVLNVIFIVVVNLAITQLQTMFFPMAVA
118467025YP_880745.1 gp2 protein [Mycobacterium avium 104]MTAMTDRPRTPIAAMTAARATASARARRRPDTPAELARRLIPGYVVTPAI
KLLSDELVRAVETPDARLIVTMPPRTGKSVQTSQVFPVWLLSRDPDAEVI
VKSYGDALAEEHSAAARRLIAENPAVVGIELAADKQAVGRWRVAGHRGGM
LAGGILSSTTGFGASVLLVDDPVKGAQEADSDAYRKRLYAEMRASLMTRL
MPGASAIIVLTRWHPDDLAGSLLAEPGSRWRCVNIPAISTAGVPDALGRE
RSGVAMTSAVGRTAEQFREIKTEVGSRAWAAMYLGTPSTPEGGLVKAAWI
DTWRLPAAPPGTVKIVVGVDPADSGQGDETGIIAAALTADGVVALIADVS
GRMTSDAWAVRAVQLAADVGASEIAVEAFAARATYTRLVTEVLARFRVDR
PIRVTGWPPKGTDRGKGDAVARSTGLLAALEVGRCRVAGFLPDFEAQAVT
WEAGQHQPDRVAAAVVAYDVLAHSIGQGMHVVTPMDTARRAREGKISPPP
AWMTRRVGGR
118467024YP_879733.1 translation initiation inhibitor [Mycobacterium avium 104]MSAAPSWKARLAELGLTLPEVVAPLASYVPAVRTGNLVYTAGQLPMQDGK
LATTGKVGAHITPDEGRALARICALNALAAVDALVGIDAVTRVVKVVGFV
ASAPGFNGQPSVVNGASDLLAEVFGEHGAHARSAVGVGELPLDAPVEVEL
IVEVGARP
118467023YP_882086.1 hypothetical protein MAV_2900 [Mycobacterium avium 104]MSTRYEEPNRAARAANVVVRWLADAGVSIAGTRALRVRGRKTGKLRAVVV
NLLTVDGTDYLVSPRGDTQWARNVRAASVVELGPRWRRRRMRISEVDDAA
KPQLLRRYLDRWYWQVKDYVAGLTPDSSDEQFRAAAPTIPVFALTKAG
118467022YP_883559.1 acetolactate synthase [Mycobacterium avium 104]MVDHIVGHLAAIGTDHLFAVDGANIEDLYDAAHFRPELTAVLAKHEFSAA
AMADGYSRSGAGLGVVAATSGGGSLNLVAGLGESLASRVPVLALVGQPAA
ALDGRGSFQDTSGANGSLDAGALFSAVSVFCRRVQTPDDIVSLLPQAISA
ARAGGPAVLLLPKDIQQARVGVGERNGHGAPGGRDPIAAQWRPPAGDPHP
IAAQLRRVTGEIAIIAGEQVARDDARAELEELRALLGARVATVPDAKDVA
GAPGPDGRTLGVTGVMGHRNVAEAVAGSAVCLIVGTRLAVTARSGLDDAL
AAVRTVSIGSAPPYLACTHVHTGDLRGSLRLLIRALRGHRRPVAPAGQGG
GRPTELTPPPCTGPGVRYRDAMAVLDGVLPRGVDIVVDAGNTGAAAIHYL
PVRRDGRFVVALGMGGMGNSFGAGIGIALGRNNSGRPGGRTVVIAGDGAF
FMHGMEVHTAVQYRLPMTFVLFNNNAHAMCVTREQLFYGDRYSYNRFRPS
RLGAGLAAMFPGLTSVEVGDVDGFAAAMAAALDVDGPAVVSVECAADEIP
PFAPFLTTSAVKDAAVKQNSVTKEIRTNVAASA
118467021YP_883515.1 hypothetical protein MAV_4380 [Mycobacterium avium 104]MARIRKLVAALHRRGPHRVLRGDLAFAGLPGVVYTPEEGLNLPGVAFGHD
WLTGTARYANLLEHLASWGVVAAAPDTQRGLAPSVLNFAFDLGTALDIVS
GVRLGPGKISVHPAKLGVAGHGFGASAAVFAAAGMPAKPAAVAAVFPSVT
SPPAEQPAATLRMPGVIFTAPGDAKTLNSNALALAEVWDAATVRVISKAE
PGGLIEGRRLTKVVGLAGAHRRTQRSVRALLTGYLLYTLGGDKRYRDFAD
PHVQLPGTAAPDPEAGAVPLEEKIVALLK
118467020YP_882014.1 transposase- Mutator family protein [Mycobacterium avium 104]MKRPRITTERNIAMALDQSALLEVLDALRTADAGERITQAAETIYQALID
AELTAFIGASPHERTETRSNQRNGSRPRTLSTVAGDLELRIPKLRTGSFF
PALLERRRRVDQCLFAVVMEAYLHGTSTRKVDDLVKALGTDTGISKSEVS
RICKDLDTEVAAFRDRPLGDQRFPYVFLDATYCKARVNHRVVSQAVVIAT
GVAADGRREVLGFEVGDSEDGAFWTAFLRSLKSRGLAGVQLVISDAHAGL
RSAIDAVLIGAAWQRCRVHFLRNVLAQVPKGSAEMVAAAIRTVFAQPDAE
HVREQLDTIAGMLGRQFPKVETMLREAAADITAFADFPVAHWKKIWSTNP
LERLNKEIKRRTDVVGVFPNPAALLRLAGSVLVEAHDEWQVADKRYLSET
SLALLDVSDQSAETIAPTAALTA
118467019YP_881754.1 acyl-CoA dehydrogenase [Mycobacterium avium 104]MRNAPAPDESWQMVEEAVFRLFEELAGKNAGEHLAIGGRLAELGWSEIEA
EYPVQAGELLFRAQGRSLALTDCLDRIVLAELAAVLDGPADHVLLPDLST
GCVAGSDADRVSGIVLGPLEGRIVVPVSGSTGTVSVGVVDAARLDGQRLD
TFDVSAHWTRASGSLDVPLIEASTEWKQAVTAAHRALATELVELAERALR
IAVEHVSVRVQFGAPIGSFQSPRHALADASAVLAGARALLGESWRDGGEL
LALAAKAAAGRAHRAVSDVALQVCGAIGLTAEHDLHRYVTRGFQVDALCG
SHDQLEGLLAERLFEDSDEGWATGRALPAVVTWADETAE
118467018YP_879563.1 hypothetical protein MAV_0274 [Mycobacterium avium 104]MEYTLKDYQVGAVAGVLDNLTQARTLYKQFGSKSRFALSAVTGAGKTVMA
AAVIEALFFGSDEFDFAADPGAVVLWFSDDPSLNEQSRRRIQAAGGEQLD
SRLRIIESTFNEPKLRPGNVYFLNAQKLSKGARLVRGDRNGDTDEMALVP
RPDEVQSNIYDVIAETIADERLTLYFVQDEAHRGWNNSAGDRTTIVQRLV
NGHGTTPPMPIVWGISATTQNFEDAFKDAPHGRVALPAVEVDSALVQASG
LLKDDIVLSIPSESGTFDTVLLKRAVRKVIASTKAWAQYAKEQGETDPVV
PLLVVQVRDGDTAATQTAVARAVEAVFEEWTDLPTQSFANVFGEHQDLSV
NQVPVPYVAPETVQEETWIRVLFAKTAISTGWDCPRAEVLVSFRPAVDPT
HITQLLGRMVRTPLARRIPGNQVLNSVECLLPFFDRKTATAVAEELMRGA
TGGGDGDSGGGPGRRVLFDPVTLLPNPEVPEEVWERFDMLPAQTIPKRAA
KPIKRLTAIAKALSDDDLITDAGKQAHAHLHAVLDGRRVQYKDKIDAAVK
DVMTMEGEELRGKLHSNTAISRKAFTDTADHRAIQDAYRAAGRVFSADLA
RTYVGHLAGDDADDDELRDATVQLAAAALVPEVAEAIDDEANKLAADWLQ
QTRVQRKGLTDERQAVYDELESMTTQPQPILLTRPRTGQADTKVRDAAGN
ESDLPTHKHHLLCDENGDVPANLNDWETLVLKQEMNAAGFVAWWRNPSRT
AKDSLSIAYRDMSSGAFKALRPDFLFFSRRADGTIAANIVDPHGHHMSDA
MPKLRGLADFAETFGAEYGRIEAVAKVGDTLRVLDLTKESVRKAVRDGAD
AKALYESDAAVDY
118467017YP_882462.1 hypothetical protein MAV_3280 [Mycobacterium avium 104]MVSVDALELASWGTPYSPARTVALPLGALVLAVLAVLGFLPGRAERRRKP
ATGAFPATDVLPPRPRTHTTVLTLAAVCSITALVAAVCLLPSAATPAQQP
TPPPVLAPIDLPAASAIGPGAGIYVDYTDGSGGMGCTAGFLVHTSSGQAG
ILTAGHCNRSGEPSKVTMNLGGVLPYATLGTFSQTISEGVHDEQHDIGLI
TLDGDNVPQSPAIAASVPVSGVAANLQVGQQLCKFGMGSGADACGQIVEI
TGSKVKFLAGGQCGDSGGPVYRYENDGTVSAVGILIRGGDPYTRKAGCAA
RAKFSVAELVRPWLDTWRLTMVTAASAPR
118467016YP_884100.1 LysR family transcriptional regulator [Mycobacterium avium 104]MLLAVSAVGGPESRCVMATLLQLKAFLAVVDQGGFTAASRSLGMSQPAVS
RAVAGLERELGSPLLIRHRDRILLNAPGKRALAHARSAVRHLDQMRAEVS
AAAKLRGTLRIASLPYTTELLIAPQLQKFSERHPSVEIRVLEGGEPEIRD
WLDLGAADAGVISLPATGLSAAFLAAQDMVAVLPSEHRLAAFSEVHYADL
AKEPFIRSTGGCAHVFMAVADQVGVEFDVAFEAHGLMAVLEIVTAGLGVS
IVPVAAVARPRAGIAVKRLVPKTTRNLAVAVSASAGSAARAFLEQIAALD
GSERAGA
118467015YP_882443.1 methyltransferase MtfC [Mycobacterium avium 104]MTDHDTRFAYLDLLRRDLTRYGSDELVPVGLYRLGRPLFSTRNLMLVRKR
PFNKQARDLGLDWPADALTMIGMKRLTSLQHCVETVLEEDVPGDLVECGV
WRGGASILMRAVLAAYGDEKRCVWLCDSFAGVPPPDTVNYKADKGIRLHR
HARILGVPLENVKANFERYGLLDDQVRFVPGWFKDTLKDAPIDRISVLRL
DGDLYESTIQALDALYPRLSPGGFCIVDDYHAIKACAQAVTDYRTQHGVT
AEIVEIDGTGVLWRKP
118467014YP_879757.1 amidohydrolase [Mycobacterium avium 104]MNGHAISADSHVTEPIELYAERVDARFKDRVPTISNQDGWRMLHAEGMAP
RKLMTASELELAVVAGPDPEQRLREQRQDGVVGEVVYPNWALQTCFVGDP
ELQNAICKAYNDWAHDALMTTDWSLPVAMIPMANIDDAIAEAQRAASLGF
RALSLPARVEQREYNSEDNDPFWACASELGLPLTFHSGTGYDPRLVRGQG
ANVINYVLGAQLDGPRVLLHLAAGGVLDRFPTLRIVAVETGASWLGWVMT
QADAVYADHAFFAKKKLSAPPSEFIRRQCHATFMVDPVAVQNRNITGVEC
LIWGNDYPHPEGTWPQSATQAAPQFDGVPDEEVDAIVGGNAAAVFGFDRT
RL
118467013YP_883048.1 phytoene synthase [Mycobacterium avium 104]MMRSEWAAAGIEDPLLREGYRRCRELNAAHGRTFFLATRLLAPDQRPPVH
ALYGFARYADDILDDLDPRVAPAVRARRLQRLSERLFSGGAHTDDPLVAA
VTHTARRYRISSQLFADFLASMRMDLTVTDYPDREALNRYMRGSAEAIGL
QVLPILGTVTPVDEAAPYAAALGRAFQLTNFLRDVDEDLARGRVYLPADE
LAADGVDRELLMWCHEHRRTDPRVRRALIAQHHIARQTYRFATAGIAVLQ
HRSRPCVAAAAALYSEILDCIEKSDFAVFGHRATVGTARRLRVGAVGLIR
SWRARNSGRGIRSGAA
118467012YP_880848.1 alcohol dehydrogenase B [Mycobacterium avium 104]MKSRAAILHDVGGPWSVEEFELDPPRAGEVLVQMAAAGLCHSDDHILKGD
MSAPNEVMRSLGLPTMFPTIGGHEGSGIVREVGEGVTDFAPGDHVVMSFV
AVCGQCRWCASGMEYLCDVGIGTMIPGMPTDGTFRHHTAGGGNLGHIAKI
GAFAEHTVVSTNSLVKIEQQLPLAPSALLSCAIPTGYGSAANRAGVCGGD
AVVVIGAGGIGTGAIQGARISGAAQIVAVDPVEFKQKSALRFGATHSVAT
IAEALDLVRDLTYGVMADAVVVSPSLITADDVRDALKLTRKGGTCVLTGM
TSQLTRSVNIELQDFILMNKTLAGTIFGSCNPRADIARLARLYQTGQLQL
DEMITKRYRLDEVNDAYDDLLNGKIVRGIIDFGIA
118467011YP_882458.1 arginine/ornithine transport system ATPase [Mycobacterium avium 104]MSGRTVTELAEAIRSGDRAALPRAITLLESTRADHQEQAQQLLLELTPDA
GDAHRVGITGIPGVGKSTSIEALGMHLIGLGHKVAVLAVDPSSTRTGGSI
LGDKTRMARLANHPDAYIRPSPTSGTLGGVAKATRETVVLLEAAGFDVIL
IETVGVGQSEVTVANMVDTFVLLTLARGGDQLQGIKKGVLELADIVVVNK
ADGEHLAEARSAARELSGAIRLIHPRETLWRPPVLTMSAAQGTGLPELWE
TIERHRQVLSKAGEFEARRRSQLVDWTWQMVRDTVLDRLLSNPAVRTMRA
DVERRVKAGELTPALAAQEILAAASR
118467010YP_882413.1 lipoprotein signal peptidase [Mycobacterium avium 104]MPEEPTGSTAPQDRPPRRLRLLLSVAATVLALDIVTKVLAVKLLPPGQPV
PIIGDTVTWTLVRNSGAAFSMATGYTWVLTLIATGVVVGIFWMGRRLVSP
WWAVGLGMILGGAMGNLVDRFFRAPGPLRGHVVDFLSVGWWPVFNVADPS
VVGGAILLVVLSIFGYDFDTVGRRKKADQSRD
118467009YP_880899.1 permease of the major facilitator superfamily protein [Mycobacterium aMVAWALWDCGSTGLNAIVATFVFAVYLTSSVGVGIGGSTTPASWLGRAAA
IAGLTVALLAPAVGVWVESPHRRRVALSVLTALAVTLTGSMFFIRDRPGY
LWAGLVLLGATAACGDLASVPYNAMLRQLSTPRTAGRISGFGWAAGYVGS
VLLLLVIYTGFIAGSGSGPDATRGLLRVPLRDGLYVREAMLVAAAWLALF
ALPLLFVAHRLTESAEGYRPTSMLGGYRKLWTEVREEWRRDRNLVYFLFA
SALFRDGLAAIFAFGAVLGVNVYGISQADVLVFGVAASVVAAVGAVLGGF
VDHRVGSKPVIVASLLAIVVLGLTLMALSGPVAFWACGLLLCMFIGPSQS
SSRALLLQMAKHGREGVAFGLYTMTGRAVSFVAPWLFSVFVDAFGAVRAG
LGGISLVLTAGLLAMLAVRVPRRAPVAVEAA
118467008YP_883911.1 hypothetical protein MAV_4784 [Mycobacterium avium 104]MPNPPEPGRGGPPKRPGFDPRASRASDEWTPETGEEPDGGFDSEDATESV
PMVPSDAETETVVINKPDPPSGPQETPDGPQRERRFTAPGFDAKETTIIA
TTPEPATEAFVPPGQDNTTQFGVPPKAAVPQSIPPRLGGKLRTSRQINWG
WILALVVIVLALAAIAILGTVLLTRGRHTNVSQEDQVRHTIGNFDAAIQR
GDLTTLRSITCGTTRDGYADYDEHAWAETYRRVSAAKQYPVIASIDQVVV
NGQHAEANVTTFMAYDPQVRSTRSLDLQYRDDQWKICQSASG
118467007YP_883159.1 peptide chain release factor 2 [Mycobacterium avium 104]MEPDRQADIAALDSTLTTVERVLDVDGLRARIEKLEHEASDPQLWDDQAR
AQRVTSELSHAQGELRRIEELRARLDDLPVLYELAAEEGEGAAEALAEAD
AELKALRADIEATEVRTLLSGEYDEREALVTIRSGAGGVDAADWAEMLMR
MYIRWAEQHKYPVEVFDTSYAEEAGIKSATFAVHAPFAYGTLSVEQGTHR
LVRISPFDNQSRRQTSFAEVEVLPVVETTDHIDIPEGDVRVDVYRSSGPG
GQSVNTTDSAVRLTHIPTGIVVTCQNEKSQLQNKISAMRVLQAKLLERKR
SEERAELDALKGEGGSSWGNQMRSYVLHPYQMVKDLRTEYEVGNPAAVLD
GDIDGFLEAGIRWRNRKDDE
118467006YP_881167.1 3-(2-3-dihydroxyphenyl)propionate dioxygenase [Mycobacterium avium 104MTTHRLVVCASHSPGKERDVAQAFGLEFRSALAQAADQVRAFDPELVIVF
GGDHRRAFTTVVPTFGVALSASIIAEGAHPAGAMSVPSAWARALCEHLLA
EEFDLAVCRDVALDHAFAQPIRDLVGELDAKPVIPVAVNCATAPLPTGRR
VAGFGAAVGRFLDSVDQRVLLIGTGGLSHSPPSLEVDAYKLSDDERARII
ADGMADARNKIRPDWDAEVLEAMSIWDAEALIRLVDSAHTRAGAGANEIR
TWVAAGAAGGGRPVAALAYEPVPEWITGMAVATSAAGASWQDRRTRV
118467005YP_879519.1 EmbR protein [Mycobacterium avium 104]MANAGLGFGVLGPLSVTAGGAQLPLGAPKQRAVLAMLLIHRNRPVSVDAL
IDGVWGAAPVPAARTSIQSYVSTLRRLLRSALPNPNGLLASVPPGYQLNV
ADADCDLGRFRGHKTAGVQAASRGRFEEASGHLAAALREWRGPVLDDLHN
FAFVDAFANLLLEERVAAHTARAEAEIACGRADGVIGELEALVAQHPYRE
PLWAQLITAYYVTERQSDALGAYRRLKTALAEGLGIDPGPTVKALQQRIL
RQEPLGPGQPGKAARRAMLSTHKQSTVRSESAAAVVDNPVVARLRDKAGR
HYQLNGVTTRIGRLDDNEIVLDDTEVSRHHAVIIDTGTDFLITDMKSTNG
VQVRGRRVQRSATLVDGDHIRIGNSEFVFEIRPA
118467004YP_880558.1 hypothetical protein MAV_1313 [Mycobacterium avium 104]MKRRIDDDRFPEWRPFCDAAQRRGPDAGTWCEAWTVRDVVVHQAGNAEEL
ARVLGAHLAGEPVATRGFEEREGPLRVLNDADLWGALADRMATLNEVAEA
AEAIPADTDVAWTGRTMKVPWFAEHMREELVLHGWDITGDSDGGGAFQAG
LAEPWMTTHSVLAVGRPLLVKGARQLQPGERVEARLRVDGTDDVVLDADP
ERISIGFAEPQGPATLETDAAARVLLLWGRRPADPSRIRSRVGPQVLGRV
RCLLGGY
118467003YP_883495.1 hypothetical protein MAV_4360 [Mycobacterium avium 104]MQANVDGSVDRLLAEAAFGDRPDRWPLPAAGTPAQLWLRAVAAGGQGRYG
AALHDLARLRRTATAGRLASLAHSTQGSFLRQLGWHALARGWDGRALALA
GDDPEAGADALIGLAADALGVGRFAAAAALLARVEPLLDSENIVPQRISV
RRGWVAAELAMARGDGELAVRRAGEAVEAAAATALGAAGAAARHQVKSEV
VLAAALCSAGDIERARAVADTALHTTARLRLVPLRWALACLLIDIGSVEF
SSRQLHEIREVCAGQVRRAGGTWRSA
118467002YP_882832.1 3-ketoacyl-(acyl-carrier-protein) reductase [Mycobacterium avium 104]MTSQDLTGRTAIITGASRGIGLAIAQQLAAAGANVVLTARKQEAADEAAA
QVGPQALGVGAHAVDEDAARQCVQLTLERFGSVDILVNNAGTNPAYGPLI
EQDHARFAKIFDVNLWAPLLWTSLAVKSWMGEHGGSIVNTASIGGLHQSP
AMGMYNATKAALIHVTKQLALELSPRVRVNAIAPGVVRTRLAEALWKDHE
DPLSSSIALGRIGEPIDVAAAVAFLVSDAASWITGETLVIDGGTVLGAAQ
GFRSAPTPS
118467001YP_882113.1 hypothetical protein MAV_2927 [Mycobacterium avium 104]MSFVTTAPEALAAAAVHEVFVHTLSTSSGSYAMTEAANAAAAG
118467000YP_880626.1 LpqZ protein [Mycobacterium avium 104]MRIGRLVAPLLTALLAVTGCTTDTGDRRAHAEVVVGSRPDASSTLLAGIY
VAALRSYGFAARPATAGDPTAQLDSGAFTVVPAFTGRVLQALQPGATAMS
DKDVYRAMIAALPEGIVAGDYTTAAEDKPVLLVSRSTAQAWGGSDVSADL
STLPRHCDGLVVGTVAGRPAPPAVGSCRLAAPREFPDAATMFAAVRAGQL
TAGWTTTADPGTPADLVALADGKPALIRAENVVPVYRRNALSERQLLAIN
EVAGVLDTAALVDMRRQVDTGADPQAVAGGWLAEHPLGR
118466999YP_880344.1 acyl-CoA dehydrogenase [Mycobacterium avium 104]MNLWTTPEREQLRKTVRSFAEREILPHVDEWERSGELPRELHRSAGAAGL
LGAGFPESVGGGGGDGADAVIICEEMHQAGAPGGVFASLFTCGIAVPHMI
ASGDQRLIEEFVRPTLAGEKIGSLAITEPGGGSDVGHLRTSAVRDGDHYI
VNGAKTYITSGVRADYVVTAVRTGGPGAAGVSLLVVEKGTPGFEVTRKLD
KMGWRSSDTAELSYTDVRVPVSNLVGAENTGFAQIAQAFVSERIGLAAQA
YSSAQRCLDLTVQWCRDRETFGRPLISRQSVQNTLAEMARRIDVARVYSR
NVVERQLAGETNLIPQVCFAKNTAVEAGEWVANQAVQLFGGMGYMAESEV
ERQYRDMRILGIGGGTTEILTALSAKLLGFQS
118466998YP_884039.1 chloride transporter- chloride channel (ClC) family protein [MycobacteMPAPRSDRNALDFFCAVIIVGVLAGIAGVATTLVLRVVQHATYHYSFGAL
LAGVAASSPIRRVLGPMVGAALAGLGWWLLRRRTDVPPLAETIARSERVP
RLAWSIDAVLQVLLVGSGASLGREGAPRQFASALGDFGIGWLRRLSSRDR
EILLACAAGAGLGAVYAVPLAGALFAARILLRTWRLRAVGAAFLSSGVAV
AVGSAVTGDQPNLRWPVEESTYLLTAHGLLLAPVALAVGLVFNRLMAVAR
PARPMRTWTLIPALAGAGLVTGVCSHWWPELPGNGRSILTVSLASGMTLA
SALAILLLKPVLTALFLRAGGAGGLLTPSLATGAAAGTALVLTINWATGS
QLHVPAVSLAGAAGVLAVTQGSPIWAAIFVWELARPPLWLFLLFLLTATA
AHGLKVLAQGRTTTHAG
118466997YP_879428.1 hypothetical protein MAV_0133 [Mycobacterium avium 104]MSGRPLPGGVVHKLPADLRESLIGNATALAAWNDITPLARNEFICWVEDA
KQQATRERRIRRTVEELEEGKRRPCCWPGCKHRERTGK
118466996YP_880991.1 acyl-CoA dehydrogenase domain-containing protein [Mycobacterium avium MQLALTPEEAAFRDELRTIYTTKIPEELRERVRRGSAEVNRDDIVTSHKI
LHEHGLAVPNWPVEWGGKDWTPTQHQIWADEMQLACVPEPLNFNTKMVGP
VIAEFGSEEVKQRFLPPTASLDIWWCQGFSEPDAGSDLASLRTTAVRDGD
HYIVNGQKTWTTLGQYADWIFCLVRTDPQAPKRQAGISFLLFDMKSPGIT
LRPIKTIDGGHEINEVFFEDVRVPADQLVGEENQGWTYAKFLLGNERTGI
AGVGRTKVRLAEVKKHAAATGVLDDPLFAARLAEAENELLALELTQSRVT
TDSANGQPNPASSVLKLRGSQLQQVATELLVEVAGPDALPAKADDIASPS
WAQSSAPHYLNYRKTSIYGGSSEVQRNIIASTILGL
118466995YP_880854.1 anti-anti-sigma factor [Mycobacterium avium 104]MVAEKDWDRIVGAADDVRRVFDNVPALLVGLEGPDHRFVAVNAAYRALSP
PVDPIGLLAREVYPELESQQIFQMFDRVYQTGEPQSGTEWRVQADFEGVG
KAQEHFFDFIVTPRRGDDGSIEGVQLAFVDVTDRVRNRMAAEARLEELSE
RYRNVRDSATVMQQALLAPSVPVTPGADVTAEYLVAAQDTAAGGDWFDAI
PLGDRLVLIVGDVVGHGVEAAAVMSQLRTALRMQILAGYPIAEALEAVDR
FHKHVPGSSSATMCVGSLDFGSGEFSYCTAGHPPPLLVTADATARYVEPS
GAGPLGSGTGFPVRTEFLDVGDSILLYTDGLIERPGRPLGASTAEFADLA
ANIVSGQGGFVIESSVRTVDRLCAETLELLLRSTGYSDDVTLLAAQRRTP
PPPLNLTLDATIHAARTVRTRLRQWLSDVGADADDISDIVHAISEFVENA
VEHGYATEVPDGVVVEAMLAGDGNLHASVIDRGRWKDHREGETGRGRGLA
MAEALVSEAHVSHGPEGTTASVTHRLSRPANFVADSLVSRAGDHGVRSAE
FVSTVTEPGRIVVSGDVDSNTASTLDRQIAVESRSGVAPLTVDLSAVTHL
GSAGVSALAAARERALRQGSDYVLVAPPGSPAHHVLSLVQIPVVSGLAEN
VVAEG
118466994YP_880006.1 hypothetical protein MAV_0731 [Mycobacterium avium 104]MIVSVSGIGERTLPDVEAFCAQMDARNVPVSLLVAPRLSGDYRLDRDPRT
VEWLTGRRAGGDAIVLHGYDDAATKKRRGEFAMLRAHEANLRLMAADRVL
EHLGLRTRLFAAPGWVVSPGVVKALPGNGFRLLADLHGITDLVRHSTVRA
RVLGIGEGFLSEPWWCRMVVLSAERIARRHGVVRVAVAARHLRKPGPLQA
MLDAVDLALMHNCEPTVYRWRPDRAALDAA
118466993YP_883592.1 hypothetical protein MAV_4457 [Mycobacterium avium 104]MTKKRDRPRIAIGVCILAGVVIVYVLSLFGVHFLQRSEGPLPPLDLSQGG
GDATIVQLRLEELKPVANRLSVNVLVYPGVAQYDNRFDVLANDVAVRLYP
TSDLGDLHYPKGKAPAQLSTTVEAHGDPGNWPFDSYRTEPISADAFVGSG
DNLKKVPARVEVTGALDGWQITVDRVRDPAALPTQRGSDNGDVVITLKRA
KGPLIFDLGICLVLISLPTLALLVAIPMAMGRRKFLPPFATWYAANLFAI
VPLRNILPGAPPPGSWIDQAIVQWVLIALVTAMTLYIIAWVRQGD
118466992YP_883222.1 hypothetical protein MAV_4071 [Mycobacterium avium 104]MTSGDARADTAAAAPRLREALRAAASALKEKGPRFALAGSYALWAYGAPE
PSHDADLVVAEADVETAVTTLASAGFEIERPPEDWLFKARTGDMRVDVLH
RLNGVPVDAQTLDRAEHHDVLAIGMPVLPPTMVLVQQLRSLGEHHCDFAK
LLPAVRAVRERLDWDEIRAQTADNDYAVAFLVLAERLRLTR
118466991YP_881386.1 dihydrodipicolinate reductase N-terminus domain-containing protein [MyMAARMSEHGSKRVVVWGTGFVGKMVIAEIVKHPLFELVGVGVSNPAKVGR
DVADICGLPEPTGVIATDDVDALIALKPDALVHYGPTAMHAKENIALITR
FLRAGIDVCSTAMTPWVWPTMHLNPPNWIAPITEACELGESSCFTTGIDP
GFANDLFPMTLMGLCSEVRRVRASELLDYTNYEGDYEVEMGIGREPEYSP
MLENRDVLIFAWGATVPMIAHAAGIMLDEITTTWDKWVTPTERTTAKGVI
KPGHVAAVRFTINGVYRGETRIQLEHVNRIGLDAAPDWPSGHDNDVYRVD
IEGTPSIFQETAFRFTDGSGRDAAAAGCLATGLRALNAVPAVNELRPGWV
TPLDLPLIPGTGTIR
118466990YP_881558.1 LppL protein [Mycobacterium avium 104]MLSGCSSNPLRGAPPTIEPAGAAVSPPSAQQPAGSVRPLAAHAAAAVFDA
GTHQLAVLAAASDPASVTLFGDPQVPPRVAALPGPATALTGDGRGTVYLA
TRGGYFVLDLGTGRVVRVGVADAAQTEFTAVAQRADGALVLGSADGAVYT
LASPTPAVPTTGPTTRSITGSTAAVANRSKIFARVDSLATQGNTTVVLDR
GQTSVTTIGADGRAQQALRAGRGATTMAADAAGRVLVADTRGGQLLVYGV
DPLILRQAYPVPQAPYGLAGSRALAWVSQTVSNIVIGYDLSTGIPVEKVR
YPTVQQPNSLAFDEASDTLYVVSGSGAGVQVIDHAAGKR
118466989YP_882170.1 cytochrome P450 [Mycobacterium avium 104]MTASTDSDVRFDPYDVGLIADPYPMFARLREEAPLYYNAEYDFYAVSRYA
DVSKALVDHETYSSARGAILELIKANLDIPSGMLIFEDPPIHDVHRKLLS
RMFTPRRIAALEPMIRDFCAQCLDPLVGTGHFDFVTDLGAQMPMKVISML
LGIPEDDQEYIRDRGNAQLRTEAGKPMKAAEQGLSVGEQFEAYIDWRAEH
PSDDIMTELLNVEFVDETGTTRRLTREEILVYLNVVAGAGNETTTRLIGW
TGKVLAEHPDQRRDLVENPALIPQAIEELLRYEPPAPHVSRYVTRDVVVH
DQTVPEGSVMMMLIGSACRDEAQFGSDAGEFNIHRAVRPHLTFSMGTHFC
LGSALARLEGRVALEEILKRFPEWEVDLSRATLSPTSTVRGWECMPALVP
118466988YP_883993.1 ATPase AAA [Mycobacterium avium 104]MERGDTGMLTAQPVNSRVDARVDGDVVSRFATCCRALGIVVYQRQRPADL
AAARSGFAALTRIAHDQCDAWTGLAAAGDVSLRVLEAVARTAATAGVLQR
QVDLAPGALGFRYDTGLYLQFRATTTDDFQLAYAAALATAGRFADADRIV
AALTAARPGWREARWVSVVINYRAERWSDVVKLLTPIVNDTDLDDAYAHA
AKIALGTALARLGMFAPALSYLEEPDGPVAVAAVDGALAKALVLRAHVDE
ESASEVLQDLYAAHPENEQVEQALSDTSFGIVTTTAARIEARTDPWDPAT
EPSAEDFVDPAAHERKAVLLAEAERQLAEFIGLDEVKNQVSRLKSSVAME
LVRKQRGLAVAQRAHHLVFAGPPGTGKTTIARVVAKIYCGLGLLKRENIR
EVHRADLIGQHIGETEAKTNAIIDSALDGVLFLDEAYALVATGAKNDFGL
VAIDTLLARMENDRDRLVVIIAGYRADLDKFLDTNEGLRSRFTRNIDFPS
YAPSELVEIATKMAEQRDSVFEQAALDHMEELFTKLARESTPDANGISRR
NLDIAGNGRFVRNIVERAEEEREFRLDHSEHAGTGEFTDEELMTITDDDV
ARSVEPLLRGLGLSVPA
118466987YP_882088.1 C-5 sterol desaturase [Mycobacterium avium 104]MSALSGYLTALPPQLRDPVLVAIPFFLLLLTLEWTAARKLEHLTARPAPG
AHRTRDSLTSISMGLVSVATTAGWKTLALFGYAAIYAYLAPWHLPATRWY
TWAIPILGVDLLYYAYHRIAHRVRLIWATHQAHHSSEYYNFATALRQKWN
NSGEILMWIPLPLLGIPPWMVFFSFSLNLIYQFWIHTERIDKLPRPFEFV
FNTPSHHRVHHGMDKVYLDKNYGGILIVWDRLFGTFQAELFRPHYGLTKQ
VDTFNVWKLQTREYVAIARDWRSASRLRDRLGYVFGPPGWAPRSAGRTAA
GAPVVTSL
118466986YP_881533.1 hypothetical protein MAV_2329 [Mycobacterium avium 104]MKAERETAKRRGGSDRRGARDGSARRGRRPAADAGAARRARGGPASAPTR
ESRAPKPGPQTSPVARPAERSARPKNTSQAKARAKARKAKAPKVVRPRLT
ERLAARLAAIDLRPRTLASKVPFVVLVIGALGVGLGLTLWLSTDSAERSY
KLSHARERTRLLQQQKEALERDVREAEAAPALAEAARKQGMIPTRDTAHL
VQDPSGNWVVVGTPKPADGVPPPPLNSKLPDEAPQPPKPAPPAAEVPIRV
ELAPGGPVPARSGPEALLRAPDGASTLGGQHLAPAVPPVPGTPPGVPGGP
VAAPPALPGGPVAAVPPASPAMPTGPATGRPPGLTPGLPMPGLPMPAGPA
VAPAPAEVSIPLGGLPVPAPGQLPAPLPPEVPVPVQLGRPGAAPQPVVPA
APLPQPVNGAQPGAAPVASPGAPR
118466985YP_883158.1 transporter- small conductance mechanosensitive ion channel (MscS) famMVLIAAVLAARFVNWVALQVSRQLTTGFVESDALVRSEASKHRQAVASVI
SWVSVVIIGIWVMLQIASILQFSVGGLVAPATVVGAALGFGAQQLVKDLL
SGFFILAERQYGFGDLVTLTVVAATEASGTVENVTLRVTRLRSPDGEVLT
IPNGQIVKVVNLSKDWARAVVDIPVSTSADLNRVNEVLHQECDRAMDNPV
LGQLLLDSPTVMGVESIEVDTVTLRLVARTLPGKQFEVGRQLRVLVIRAL
ARAGIVTAADARVGLVEDASVPAAQAAEQQSDDDVQGAVQKR
118466984YP_880539.1 base excision DNA repair protein- HhH-GPD family protein [MycobacteriuMPKLQLVQEPAADALLDENPFALLVGMLLDQQVPIETAFAGPKKIADRMG
GLDAATIADYDPDKFAALCSERPAIHRFPGSMAKRIQALAQLLVDRYGGD
AAALWTAGEPDGKELLRRLKGLPGFGEQKARIFLALLGKQYGVTPPGWRE
AAGEFGKAGTYLSVADIVDARSLGQVRSYKKQMKAAAKAAK
118466983YP_882913.1 ChaB family protein [Mycobacterium avium 104]MPKTTKGGAPKKGELPSTLQRSSAKAQRTFAKAHDAAAQEYGSEERAHRV
AYSAVKHSFEKVGDHWEPKAKKGPSDPRARSGGPRASGASAEGVDANASK
KHLLDVARRLDVRGRSTMTKSELVDAIKKHNRRARAR
118466982YP_884131.1 virulence factor Mce [Mycobacterium avium 104]MGALRVIRRRSWQGLTLLVAAMVLTSCGWKGISNVSIPGGPGSGPNSYNI
YVQVPDTLAINGNSKVMVADVFVGSIKAIQLKNWIATLTLGINKNVKLPK
NATAKIGQTSLLGSQHVELAAPPNPSPELLKDGDTIPLKNSSSYPTTEQT
LASLSLILRGGGIPNLEVLQNEVYNIFNGRGEAIRALLGKLDTFTNQLNQ
QRDDITHAIDSTNRLLTYVGGRADVVDRLLTDVPPLIKHFADTKQLLINA
VDSVGRLSQAADQYLSEARGPLHTDLQALQCPLKELGKASPYLIGALKLI
LTQPFDIDTVPKIFRGDYINISLTLDLTYSAVDNAFLTGTGLSGALRALE
QSYGRDPETMIPDVRYTPNPNDAPGGPLVERGDRNCDSLRPTPTGRLRDP
DRHLAARARHLLPADPELGGDRPVHAQGRAAGVGRPVPDGQRHLSRHHHR
QGHRRRAHRARRRGDHEHRQPLQDPDRRGGQRALGVGGRRAVPGPGVERK
PGQVPVVRADHHQGHGAGRDRAGPGHREPRAGGAAQGEDRPVARRDGAVR
RRVGPQPAAAGRRHPGHRRRLQEPDHRRQRHHRALRAGDRQPGQIR
118466981YP_883068.1 molybdenum ABC transporter ATPase [Mycobacterium avium 104]MPENDSAAADPDLLIELRDVSLRRGGNVLVGPLDWAVELDERWVIVGPNG
AGKTSLLRIAAAAEHPSSGVAFVLGERLGRVDVTELRSRIGLSSSALAQR
VPSDEVVRDLVVSAGYAVLGRWRERYEDVDYRRAVDMLESLGAEHLADRS
YGTLSEGERKRVLIARALMTDPELLLLDEPAAGLDLGGREELVARLADLA
ADPDAPALVLVTHHVEEIPPGFSHCMLLSEGRVVAAGLLTDVLTSENLST
AFGQAIALDVVDGRYFARRVRTRAAHRRQL
118466980YP_881132.1 acyl-CoA synthase [Mycobacterium avium 104]MGAAPLSIDVADTRSMLEAAAAIHGDTEAYVEPGARITFADWVGRARSVA
TQFADLGVGKGDVVALWLPSGIDYATCYAAAAMIGAITTGLNPRLGRREV
ESILQQADPALIVADDRLGLLPDLGRRILSRTALATDVSGSRVPTVDLTR
RDLVAVIFTSGTTGTPKGAVFDADRLAAGAAAAGVMSAPYDRRLTSTPFA
HAGYMFKLWDQLVWGSTLVVPPTPWSAQGMFDILRAERITVAGAVPTQWA
KLLEVDGVSPSALPDLRIGIAATAPASPELVRRVADRVGVPLVVRYAMTE
CPTICGTDPNDSPEVQFRTVGRPATGMDVRIAPDGVVEVHGPCVMRGYWR
NPEVTAEVLRDGWLRTGDVGTLDGDGNLTLVGRSGDMYIRGGYNIHPGEV
ERTLAGHPGVKQAAVIGRSAPVIGEIGVACVVPADRTAPPTLADLRAHVT
SELADYKAPDELLIVDELPLTAMLKPDRIALRELITMRHDEIQRRQPTR
118466979YP_884235.1 alpha/beta hydrolase [Mycobacterium avium 104]MTALDGAERLDPALRAVATTRTDFSPAAIELTRAPFNERRRLAAAQTDTA
GVRIVDDDANGVDVRIYRGGPEPAPAVIYCHAGGFALGNLDTDHRQCVEL
ARRGRCTVVSVDYRLAPEHPYPAALQDAGTVLRWVHAEAAALGVDPARLA
VAGSSAGAALAACLAHPDGSLPAVVFQLLHQPVLDDRATGSKARFRTSPA
FDGEAAELMWRYYLGPTVGSAAAVPARRPELAGLPPALITCAEIDPFRDE
AIDYARRLLDAGVCTELHVFARACHGFDSLLPDWPGSQRLFALQGEVLSA
ALHRGSTH
118466978YP_884044.1 hypothetical protein MAV_4923 [Mycobacterium avium 104]MWLVGAIALALTFAQSPGRISPDTKLDLTANPLRFLARATNLWNSELPFG
QAQNQAYGYLFPHGTFFLIGHALGVPGWITQRLWWALLLTVGFWGLLRVA
EALGIGSPGSRVIAAAAFALSPRVLTTLGSISSETLPMMLAPWVLLPTIL
ALRATGPRSVRALAAQAGVAVALMGAVNAIATVAGCLPAVIWWACHRPNR
LWWRYTGWWLVALVLATLWWVVGLVMLRAISPPFLDFIESSGVTTQWSSL
VEMLRGTDSWTPYVAPTATAGAPLVTGSAAVLGTCLVAAAGLAGLAGPTM
PARGRLVTMLLIGVVLMAAGYSGGLGSPAAHAVQAFLDAGGAPLRNVHKL
GSVIRIPIVLGVAQLLGRIPLPGSAPKSLWLSAFAHPERDKRVATAVVVL
TALMVSTSLAWTGRLTPPGTFTAIPPYWQQTADWLTQHNTGSPTPGRVLV
APGAPFATQVWGTSHDEPLQVLGASPWGVRDSIPLTPPQTIRALDSVQRL
FAAGRPSLGLADTLARQGISYVVVRNDLDPDTSRSARPILVHRAVDGSPG
LHKVAQFGAPVGPGTVAGFVADSGLRPRYPAVEVYRVDAGGDAGTPYFVD
TDRMARIDGGPEVLLRLDERRRLLGQPPLGPALLTADARAAGLPLPAGAG
VTVTDTPVARETDYGRVDQHSSAIRAPGDARHTYNRVPDYPVPGADPVLG
AWTGGRITVSSSASDSTAMPDVAPATSPAAAIDGDPATAWVSNSLQSAVG
QWMQIDFDHPVTNAALTLTPSATAVGAQVRRILIETATGSTTLRFDQPGK
PLAAALPYGETPWLRITAAGTDDGSPGVQFGITDLTVTQYDASGFAHPVD
LRHTVRVPGPPPESPITRWELGPELPGRPGCARAPDSVRCAPSMELAPEE
PVTFSRTLTVPAPTSVTPTVWVRPRQGPKLADLITEPNTTVAHGDSDTVD
VLGSAYAATDDDPATAWTAPQRVVQHKTPPTLTLTLPRPTQVAGVRLVPS
RAALPAHPTMVAVNLGDGPQVTAVKPGQAQTIPLKPRVTDTVTISLLDWE
DVIDRNALGFDQLKPPGLAEVAALGADGNPIAPADAGRNRAREVSVGCER
GPVIAVAGRFVHTAIHTTVGALLDDQPVAAVPCERDPIALPAGEQELLIS
PGAQFVVDGAELSTPAAAEAAQPVRVASWRGWGPDRREIAAGPSNISRIL
VIPESINPGWVARTGSGARLTPIAVNGWQQGWLVPAGAPGVITLSFASNS
LYRAGLAVGLALLPVLALLACWRTRKRGTQDPPARPWRPGVWAAVPALAA
GAVIAGAAGVAVLGAALGLRYALGARRWARLGMAGSAGGLILAGAALSRQ
PWRSVDGYAGHAGYVQLLALISLAALTASVVAVPRRRGGARHE
118466977YP_879529.1 O-antigen ABC transporter permease [Mycobacterium avium 104]MTFLDAAAQSRTLRRARSDLVDGFRRHELWLHLGWQDIKQRYRRSVLGPF
WITIATGTTAVAMGGLYSKLFHLELSVHLPYVTLGLIIWNLINAAILEGA
DVFVANEGLIKQLPTPLSVHVYRLVWRQMILFAHNIVIYVVIAMIYPKPW
SWADLSVIPALALIVLNCIWVSLCFGILATRYRDIGPLLFSVVQLLFFMT
PIIWNDDTLRQQGAGRWSSIVELNPLLHYLDIVRAPLLGSHQELRHWAVV
LVLTAVGWLLAAFAMRQYRARVPYWV
118466976YP_881449.1 bifunctional glutamine-synthetase adenylyltransferase/deadenyltransferMVVTKPATQRPRLPSVGRLGLVDPQAAERMAQLGWYDHDDQAHVDLLWAL
SRAPDPDAALLALVRLAETPDAGWDELGAALLTERPLRGRLFAVLGSSLA
LGDHLVAQPRSWKLLRGNVSLPTHDELCAMFTGCVDEALADPGSAMVRLR
TLYRDRLLVLAALDLAATVEDEPVLPFTVVAAHLSDLADAALAAALRVAE
HNVCGDRTPPRLAVIAMGKCGARELNYVSDVDVIFVGERADTVTTRVASE
MMRLASEAFFQVDAGLRPEGRSGELVRTVESHIAYYQRWAKTWEFQALLK
ARAAVGDAELGRRYLDALMPMVWVACEREDFVVEVQAMRRRVEQLVPADV
RGREIKLGSGGLRDVEFAVQLLQLVHGRSDESLHVASTVDALAALGQGGY
IGREDAANLTASYEFLRLLEHRLQLQRLKRTHLLPEADDEEAVRWLARAA
HIRPDGRHDAAGVLREELRHQNLRVSQLHAKLFYQPLLESIGPAGLEIRH
GMTSEAAERQLAALGYEGPQSALKHMSALVNQSGRRGRVQSVLLPRLLNW
MSYAPDPDGGLLAYRRLSEALAGESWYLSTLRDKPAVARRLMHVLGTSAY
VPDLLMRAPRVIQDYGDGPSGPRLLETDPAAVARALVASASRYSDPVRAI
AGARTLRRRELARVASADLLGMLEVTDVCKALTSVWVAVLQAALDAMIRA
NLPDDGPQRGKAPAAIAVIGMGRLGGAELGYGSDADVMFVCEPAPGVDDS
AAVRWAASVAEQVRTLLGTPSVDPPLDVDANLRPEGRNGPLVRTLASYAA
YYEQWAQPWEIQALLRAHAVAGDAELGQRFLLMADKTRYPADGVSPEAVR
EIRRIKARVDAERLPRGADPNTHTKLGRGGLADIEWTVQLLQLLHAHEVP
ALHNTSTLECLDAIAEAGLVPADEVDLLRQAWLTATRARNALVLVRGKPT
DQLPGPGRQLNAVAVAAGWPTDEGGEFLDNYLRVTRRAKAVVRKVFGS
118466975YP_883707.1 carbonate dehydratase [Mycobacterium avium 104]MQDIQRADDALPTASRAERLRGVIRHDLPSSLVVFLVALPLSLGIAIASN
APVLAGLIAAIVGGIVVGALGGSPLQVSGPAAGLTVVVAGLVSDFGWGVT
CFITVAAGAVQVLLGLSRVARAALAISPVVVHAMLAGIGITIALQQTHVL
LGGKSKSTAWHNLIGLPGQIIGAHRPGVLLGVLVIVILVAWRWVPAKVRR
VPGPLVAIVAVTVISVVFPFHVRRIDLDGSPLDALQLPDLPHGNWSGVAV
GVITVALIASVESLLSAVSVDRMHNGPRTDFNRELVGQGAANMISGAVGG
LPVTGVIVRSSTNVNAGARSRASAIMHGVWILLFTIPFAGLVDEIPTAAL
AGLLIVIGIQLLKPAHIETAMKHGDLAVYVVTAVSVIFLNLLHGVMIGLA
LAIALTGWRVIRAKIEAAQLDGEWRVTIEGAACTFLALPRLTRVLASVPR
GATVTVAIAVHYLDHAAHQAITDWQRQQEATGGTVRIEGAVVATGRRDEP
QVEAEMPGAAA
118466974YP_882226.1 hypothetical protein MAV_3040 [Mycobacterium avium 104]MRATWEAFANPKAMAGLEILISTKRLRGALEGQPMQRLGAALANMMARLN
AATDGKHAVALGMLLWTTPVAMMIAEMFAARPLSAEDARKAVADLIDAHH
118466973YP_884290.1 acyl-CoA dehydrogenase [Mycobacterium avium 104]MWDFETDPEYQAKLDWVEKFMAEELEPLDLVALDPYDKKNAEMMAILRPL
QQQVKDQGLWAAHLRPELGGQGFGQVKLALLNEILGRSRWAPSVFGCQAP
DSGNAEILALFGTDEQKARYLQPLLDGEITSCYSMTEPQGGSDPGQFVTA
ATRDGDYWVINGEKWFSTNAKHASFFIVMAVTNPEARTYDKMSLFIVPAE
TPGIEIVRNVGVGAESSSRASHGYVGYTDVRVPADHVLGGEGQAFMIAQT
RLGGGRIHHAMRTIALARSAFDMMCERAVSRKTRHGRLADFQMTQEKIAD
SWIQIEQFRLLVLRTAWLIDKHHDYQKVRRDIAAVKVAMPQVLHDVAQRA
LHLHGALGVSDEMPFVKMLVAAESLGIADGATELHKMTVARRTLREYEPV
STPFPSAHIPTRRAEAQARLAERLEHAVAEF
118466972YP_883820.1 hypothetical protein MAV_4693 [Mycobacterium avium 104]MSAQRIELTLLATGLIFILVSAAQARYRFINDRRAGRRFYWATSVIGIVC
FAFGTGRLWPNGVLAVAIFAAVVAFSAYLTTPYLKINGRIYASSPENREP
DP
118466971YP_883856.1 hypothetical protein MAV_4729 [Mycobacterium avium 104]MTDTGGDPLVSSFASVLKVPLVELYALLWRVGVVEIRDDDRTRAAAAGPI
CPDPSAHRADRVAV
118466970YP_882420.1 hypothetical protein MAV_3238 [Mycobacterium avium 104]MPTARLPKLPLDEAKAAADEAAVPNYMAELSIFQVLLNHPPLARAINDLL
ATMLWHGALDSRLRELIIMRIGWLTGCDYEWTQHWRVASRLGVPGDDLLG
VRDWRNYPGFGPTERAVLAATDDVVRHGSVSAASWAQCEHEFKRDTTVLV
ELVTVIGAWRMVASILQSLEVPLEDGVASWPPDGREPAS
118466969YP_879527.1 nucleoside diphosphate kinase regulator [Mycobacterium avium 104]MTNKRQSPADAARKNLEAELDRLRQRRDRLEVEVKNDRGMVGDHGDAAEA
IQRADELVVLSDRINELDRRLRAGPPDADTSATLPGGTEVTLRFADGEVV
TMHVISIVEETPVGREGETLTARSPLAQALAGRQPGDTVTYPTPQGEKQV
ELIAVKLP
118466968YP_883413.1 PPE family protein [Mycobacterium avium 104]MDFGILPPEVTSALIHAGPGAWSWIEAAGVWQQLSMELEQSASSYTAELA
ALSTTWQGPSALAMTRALEPYVDWLRITAQQCQEIATSVQTATAAFELTH
WTVVHPSLVAANRARLAMLLATNFFGINYPAIAETEAEYHAMWVNNSAAM
YRYAATSATAVRLPRFTEPPQVANPSGVSTQAAMVPATNAADSGTQTGVA
GTLQAASTAFFDPNTGWFKYWSTWGNQFLAASGFPINLIGVLAQLQTASG
FQSLGADVAGGLAEGTAALSAAEVRLVSAVGAAGSSLAPRAALGVGISLG
NLTMPPATVGMLGSQAPVQLASAASPLATGAGQPPMLPMTPMRPGGNGTR
RRNGRDYDDIEYGAELPGTVMQRPPSAG
118466967YP_882321.1 universal stress protein family protein- putative [Mycobacterium aviumMRAVERAAQIAGPDAKLIVASAYLPQHEDARAADALREESYKVSGTAPIY
AILRDAKERAHQAGAKNVDERPIVGAPVDALVHLAEEEQADLLVVGNVGL
STIAGRLLGSVPANVSRRAKTDVLIVHTTS
118466966YP_884120.1 dihydrodipicolinate reductase N-terminus domain-containing protein [MyMYKVGVWGPGSMGVIALRGVIDHPQLELVDLVVHSDAKAGRDAGELCGVA
PVGVVATQDPAAMLAGDADAVVYAAGANLRPLEAVEDMVSILRAGKNVVS
CSVVPLVFPDAVDSAFTEPLRAAALEGQVSFFTTGIDSGFANDVLPLVLT
GVSRVIESVRVTEMFNYATYPDASAVYEILGFGQPPDHPAFAAQPGIFTF
GWGPVLHQLAAGLGVEIDHIEESNERIPAPESFDTPTGHIAAGTIAAMRS
TLTGYVGAKPTFVLDHVTRMRDDLAPDWPQPRIAIAPKDLGYGLASGRGL
YRVEIEGSPSMRCEFEMAEDHDHDLGARIAGSSRMVNAIPAVCAAPPGLL
SALDLPLITGAGLVRPVPGPPPDSRLF
118466965YP_883139.1 hypothetical protein MAV_3983 [Mycobacterium avium 104]MSVAPETTVALQDRFFRELPELAVRWQAETFPELRLLALNEPLATQLGLD
TGWLRGPDGLRFLTGNLVPTGAAPVAQAYAGHQFGGFVPRLGDGRALLLG
ELVDDEGRLRDIHLKGSGATPFARGGDGLAAVGPMLREYVVSEAMHALGV
PTTRSLAVVGTGRPVYREATLPGAVLARVAGSHLRVGSFQYAAATGNRDL
LRRLADHAIARHHPGAADAEQPYLALFEAVVAAQASLIAQWMLIGFVHGV
MNTDNMTISGETIDYGPCAFMEAYDPDTVFSSIDFWGRYAYGNQPVIAGW
NLARFAETLLPLFSENTEEAIALAERSFGVFQTRYDAVWAAGMRAKLGLP
AQVDAEFAAALIDELLALLKANHVDYTSFFRQLGRAARGDDRSAAEPARE
MFMDLPGFDAWLARWRALGPDADAMDRVNPIYIPRNHLVEEALAAATDGD
LDPLDQLLAAVTAPYTERPGFERYASPAPEDFGKYQTFCGT
118466964YP_881211.1 hypothetical protein MAV_1992 [Mycobacterium avium 104]MIAQAVPHIGARKYSGALRTAVPVEADPADWAEQQQLVPLPDDEYPHLGG
DRRVLVTSGLGID
118466963YP_883162.1 hypothetical protein MAV_4008 [Mycobacterium avium 104]MVSGLTMPDLRDRADVEALLRRFYGRALDDEVLAEPFARLRATGLDDHVP
TMCDFWETVLFRAGRYRGSALQAHRDIHRRAPLSDRHFRRWLTLWHITVD
EMYRGPAADRAKIQAARIAWAMHRRLTGADSPELLVTQRVRDDRAPDRTG
SDDR
118466962YP_880391.1 TetR family transcriptional regulator [Mycobacterium avium 104]MTTHSTDGRADATRQQILRAASHQFARRPYHDVGLDDILAEAELTKGAMY
FHFKSKHALAVAIIESQTASGAVAVQDLLTRGLSGLETLIDFSYLIAVKD
IKTDLVRSGLNLMESVGLSDGLQEKLFDRWIKALARVAEQAKGEGDINEH
CDPQDIGRLMVSLHMGLRKTSNLDDPERFLRDLEKCWSLLLTGILQPDRT
EYFQQFLRRRAALAINTSATDDDES
118466961YP_883170.1 inositol monophosphatase [Mycobacterium avium 104]MSNDDLALALLLADRADAVTSARFGALDLRIDTKPDLTPVTDADRAAEAE
LRAVLARQRPHDSIVGEEFGGDTAFTGRQWIIDPIDGTKNFVRGVPVWAT
LIALLHDGVPVVGAVSAPALARRWWAAHGRGAFVAVNGAAARRLSVSSVA
QLDSASLSFSSLSGWAQLGLRDRFLALTDAVWRVRAFGDFLSYCLVAEGA
VDIAAEPEVSVWDLAALDILVREAGGTLTGLDGTPGPHRGSAVASNGLLQ
RQVLERLAL
118466960YP_879708.1 polysulphide reductase [Mycobacterium avium 104]MSTSEFDSFRPPEPAGGKRRKGKRGGRRGAGDGSREMPMVPEAEFSSYYG
RPVVKPAPWGHEVGAYLFLGGVAGGSGLLAAGAQLTGRDTLRRNTRLTAL
AAVLLSLVALVKDLGRPERFLNMLRTVKLTSPMNLGSWILSAFSAGISVA
AAAEVDRMTGQRLPLGPLRPVLRAAEGPAGLQAAVLAPPLAVYTAVLLAD
TATPTWNAAHEDLPFVFVSSASLAASGLAMVTTPVHQAGPARTLAVLGAL
GDLAASKVMERRMDPVAAEPLHTGGPGRMLRASERLVIAGGLGTLLGGRH
RAVAVVSGLALATASALTRFGVFEAGLESARHPRYTIEPQQRRLAARRAA
GITSDSITTAG
118466959YP_880961.1 cytochrome P450 124 [Mycobacterium avium 104]MAVLTGESGTDRSRRAYDEIDLSSRAFWSGTAAERERSFAALRAERPVSW
HPPVEDSLLPDPTDPGFWAVTRRADIVTVSRNNDVFLSGHGVMFESIPAE
LLEASQSFLAMDPPRHTKLRKLAHAALSPRQVRRIEDSIKANAKAIVEEL
RAAGSGCDFVDHCAKELPIRTLSDMMGIPESERERMAHATDALVSWADPE
FLNGRPALEVLLENQMYLHQVVGDLATQRRERPGDDLISSLVTAEVDGDR
LEDAEVAAFFVLLSVAGNDTTRQTISHTLRALTVFPDEKSWLLEDFDHRI
GTAVEEFIRWASPVMTFRRTAAADVELGGQTILAGEKVVMFYPSGNWDTE
AFDHPERLNLGRDPNPHVGFGGGGLHFCLGAHVARAQLRAIFSELFRQLP
GIQAGEPTYLAGNFVHAIRAMPCTF
118466958YP_882623.1 hypothetical protein MAV_3441 [Mycobacterium avium 104]MRGSAVPSLVRTAARAGGKRLGAVWFNLLQTSLAAGLSWYLAHDVLDHPQ
PFFAPIAAAVSLSTSNVLRAQRAVQMMIGVTLGIGLGTVVQGMLGPGALP
IAVAALVALGAAVFIGGGFIGHGMMFANQTVVSALLVLALYRGGAGPERI
FDALIGGAVAIVVAVLLFPADPRTVLGAARAGVLAVLHDVLSRAADVSSG
RRAAPPDWPLSAVDRVHEQLSGLLEARTTARHVVAIAPRRWGLRDAVRAA
DHQAVHVALLAGSVLQLARAVAPGPGDRQGQPVSTVLLVLAAATALADRD
PAGACVYLGSARRHAARLRSGDGGDREPHVALADAVGACVDDLQRVIDLR
PG
118466957YP_880024.1 hypothetical protein MAV_0749 [Mycobacterium avium 104]MGRGRAKAKQTKVARELKYSSPQTDFQRLQRELSGTGSDDSNDLDTDGSD
QPWDDQDGWRG
118466956YP_884090.1 hypothetical protein MAV_4969 [Mycobacterium avium 104]MSANVDDASVEPIVRKTAAWAWRLLVILAAALALFWVLAKLEVIVVPVLV
ALLLSALLVPVVDWLDRHGLPRGGAVALVLLGGFAILGGILAFVVLQFID
GLPGLTEQVTQSIESTRRWLINGPAHLRSEQIDSAGNAAIEALHNNQAKL
TSGALSTAATVTELVTAAVLVLFTLIFFLYGGRNIWRYVVQIVPAHARER
VHEAGSAGYGSLIGYVRATFLVALTDAAGVGAGLAIMGIPLALPLASLVF
LGAFIPLVGAVVAGFLAVVVALLAKGIVYALITLGLLVAVNQIEAHLLQP
LVMGRAVSIHPLAVVLAISTGGVLAGIVGALLAVPTVAFLNNAFQVLLAP
NPSAEAVKQEEESDEQNTILQAEPDKPENGSG
118466955YP_882686.1 3-carboxy-cis-cis-muconate cycloisomerase [Mycobacterium avium 104]MTNLLWPGDHRAGEHMTDAALLDAMVAVESAWLAALTGAGLAPADCAAAG
LRNLVAGNDFETLAVGAEDGGNPVIGLVRLLRERADPAVAPWIHRGLTSQ
DVLDTALMLGVRALADDLIAELREQIRVLSGLTDRHRATHMVARTLTQHA
APTTFGAKAAGWLNGVLDAFDNVIALVTPVQIGGAAGTLAASTELAALRT
GTVDPAAVSVELARGTAAALGLAPRPPWHTARAPITAAADALVGCTDSWG
RIAADVVTLARPEIGELGEPATATRGGSSSMPHKRNPVLSVLIRRAAIAG
PPLAATLHTAAALAGDERPDGAWHAEWDTLRTLGRRTAVAASQCTELLAG
LSVHAARIAENLAAADVLGEQRAIAELAGGAPSPTYFGAVDRVIDETLRR
AARVRPER
118466954YP_881579.1 hypothetical protein MAV_2378 [Mycobacterium avium 104]MTPPDGPPYGAPSGQAALPELHHTVVVAAFEGWNDAGDAASDALEHLEAI
WEADPILEIDDEAYYDYQVNRPVIRQVDGVTRELVWPAMRISHCRPPGSD
RDVVLMHGVEPNMRWRTFCAELVAIADKLNVDTVVILGALLADTPHTRPV
PVSGAAYSPESAKRFGLEESRYEGPTGIAGVFQDACVAAGIPAVTFWAAV
PHYVSQPPNPKATVALLRRVEDVLDIEVPLADLPTDAEEWEQAVTEMTAE
DEDLAEYVQSLEQRGDAEVDMNDALGKIDGDALAAEFERYLRRRRPGFGR
118466953YP_880373.1 cyclic nucleotide-binding protein [Mycobacterium avium 104]MAGLTGARADELATMDIFAGCPAEDLAPLARRLRPLRAPAGQVLMRQGEQ
AVEFLLISSGSAEVKHVGDDGVVITEHTSPGMIVGEIALLRDIPRTATVT
TAQPLTGWTGDTEAFASMVHIPGVMPRLLRTVRQRLAAFITPIPIQVRDG
THLLLRPVLPGDSERTVHGHIHFSSDTLYRRFMSPRLPTPALMHYLSEVD
YVDHFVWVVTDGADPVADARFVRDENDPTVAEIAFTVADAYQGRGIGTFL
ISALSIAAEVDGIERFSARMLSDNVPMRAIMDRYGAVWQREDIGVITTVI
DVPHRRDLPFRKHEADEIRRVARQVIETVG
118466952YP_879832.1 aspartate alpha-decarboxylase [Mycobacterium avium 104]MLRTMLKSKIHRATVTQADLHYVGSVTIDADLMDAADLLEGEQVTIVDID
NGARLVTYAITGERGSGVIGINGAAAHLVHPGDLVILIAYGTMEEAEARA
YQPRIVFVDADNKPVDLGHDPAFVPDFEIAGAAELLDPRIVAR
118466951YP_881314.1 aldehyde dehydrogenase [Mycobacterium avium 104]MSTTIPVFNPSTEEQIAEVPDSDQAAVDAAVARARETFESGVWRKAPASH
RANVLFRAARIIEERKDELAALESQDNGMNLTAAGHIIPVSVDMLKYYAG
WVGKIHGESANLVSDGLLGTWETYHTFTQLEPVGVVGLIIPWNGPFFVAM
LKVAPALAAGCSAVLKPAEETPLTALKLEEIFREAGLPDGVLNVITGYGE
TTGAALTAHPDVDKISFTGSTEVGRLIVKAAAGNLKRLTLELGGKSPLIM
FDDANLDKAIMGAGMGLLAGSGQNCSCTSRIYVQRGIYDQVVEGLAEFAM
MLPMGGSDDPNSVLGPLISEKQRQRVEGIVNDGVAAGAKVITGGKPMDRK
GYFYEATIITNTTPDMRLIREEIFGPVGCVIPFDDEDEVIAAANDTHYGL
AGAIWTENLSRAHRVVNELRAGQIWVNSALAADPSMPISGHKQSGWGGER
GRKGIEAYFNTKAVYIGL
118466950YP_883896.1 TetR family transcriptional regulator [Mycobacterium avium 104]MAVDYSELPAEEAVRAARAGARRRQVLDAAVKVMGRNGFHRMSMHDLAAE
ADVSVGLLYKYFGGKQDLLLATIVRILDVFRDQLAPVIDAAGDDVVDQLS
AGIRRYIQIVDENLDGVVLTYRESRTLGAAGRAQIKDLEIATAAPLRAVI
ETGIAQGVFRSVDVDLAVFDIMLLAHGWALKHWHFGPIYTLDEYIALQTR
HLLNGLISDERRADYADVLK
118466949YP_880784.1 DeaD/DeaH family protein helicase [Mycobacterium avium 104]MPELLATAVAALGGSEREGQQQMAAAVAQAFDTGRHLVVQAGTGTGKSLA
YLVPAIVHALRDDSPVVVSTATIALQRQLVDRDLPRLIDSLAAALPRRPQ
FALLKGRRNYLCLNKIHNGGPADGEEAADRPQEELFNPMAVSALGRDVQR
LTEWASSTDSGDRDDLKPGVPDRSWSQVSVSARECLGVARCPFGAECFSE
RARSRAGQADVVVTNHALLAIDAVSDSAILPEHALLVIDEAHELVDRVTS
VATAELTSAALGIAARRIGRLVSPELVQRLEATTATFAAAIHDGTPGRID
RLDDELATYLAALRDAASAARSAIDTTSDPKAASARAEAVAALSEISDTA
SRVLASFGPAIPDRTDVVWLDHEDNRGAMRPVLRVAPLSVADLLRDRVFS
RSTVVLTSATLTIGGSFDAMAAAWGLKGPDGDDPPWRGLDVGSPFQHAKA
GILYVAAHLPPPGRDGVGSAEQLTEIAELITAADGRTLGLFSSMRAARAA
AEAMRDRLSTPVLCQGDDSTSALVEQFSAEPQTSLFGTLSLWQGVDVPGP
SLSLVLIDRIPFPRPDDPLLGARQRAVAARGGNGFMAVAASHAALLLAQG
SGRLLRRVSDRGVVAVLDSRMATAGYGGYLRASLPPFWQTTNGAQVRAAL
QRLRTAATASGPG
118466948YP_880629.1 hypothetical protein MAV_1386 [Mycobacterium avium 104]MRARRNRFPNRFFSTSSAAARTDSGRPKVSARALAQVIERSSRIQGPAAE
AYVTRLRNAHPDAGPAEILAKLQKRYLAIVTAGGVAVGAAATIPGIGTLS
ALSAAAAETVTFLEATAFFVLAAAVVYDIPADHRERRRALVLAVLVGDNS
ERAVAQLIGPGRTQGGWVSESLAAVPLSSMSRLNSRLLKSWVRRYTLRRG
ALLFGKLLPVGIGVVVGAVGNYLAGKKIIRNANRAFGAPPARWPRALHLV
PPIHEAG
118466947YP_882302.1 N-acetyl-gamma-glutamyl-phosphate reductase [Mycobacterium avium 104]MADVMRVAVAGASGYAGGEILRLLLGHPAYAQGRLTIGAVTAAASAGSPL
GEHHPHLTPLAQRVLEPTDAAVLAGHDVVFLALPHGHSAALADQLGADTL
IVDCGADFRLTDAAAWERFYGAPHAGSWPYGLPELPGARERLRGARRIAV
PGCYPTAALLALLPAMAEDLIEPAVTVVAVSGTSGAGRAAKTDLLGSEVI
GSARAYNIAGAHRHTPEIAQGLAAVSGRDVTVSFTPVLIPTSRGILATCT
ARTTAPLSALRAAYEKTYDAEPFIYLMPEGQLPRTGAVIGSNAAHIAVAV
DEAAGVLVAIAAIDNLVKGTAGAAVQSMNLALGWPETQGLSVIGVAP
118466946YP_882509.1 transketolase [Mycobacterium avium 104]MTTLEEISALTQPHLPDDWSELDSAAVDTIRVLAADAVQKVGNGHPGTAM
SLAPLAYTLFQRVMRHDPSDTHWLGRDRFVLSAGHSSLTLYLQLYLGGFG
LELSDIESLRTWGSKTPGHPEFRHTKGVEITTGPLGQGLASAVGMAMASR
YERGLFDPDAAAGTSPFDHFIYVIASDGDIEEGVTSEASSLAAVQQLGNL
IVFYDHNQISIEDDTNIALCEDTAARYEAYGWHVQRVEGGENVVAIEEAI
AAAKAVTDRPSFIELRTIIGYPAPNAMNTGKAHGAALGEEEVAAVKKILG
FDPDKTFQVRDKVIAHTRKLVDRGREAHQKWQTDFDAWAQREPERKALLE
RLTAEKLPDGWDADLPHWEPGSDAIATRKASGAVLNAVAPKLPELWGGSA
DLAESNLTTINNADSFGPPSISTKEFTASWYGRVLHFGVREHAMGAILSG
IVLHGPTRAYGGTFLQFSDYMRPAVRLASLMDIDTIYVWTHDSIGLGEDG
PTHQPIEHLAALRAIPKLSVVRPADANETAYAWRTILARGNGSGPVGLVL
TRQGLPVLEGTDADGVARGGYILGSDGEEAGQEPDVILIATGSEVQLAVE
AQKLLADKDIVARVVSMPCVEWFESQPDDYRDSVLPPSVSARVAVEAGVA
QSWHKLVGDTGKIISIEHYGESADYKTLFREFGFTAEAVAAAAEEVVDN
118466945YP_881243.1 16S ribosomal RNA methyltransferase RsmE [Mycobacterium avium 104]MVATLFYTDELPDAGSLAVLGGDEGFHAATVRRIRPGERLVLGDGAGGLA
RCEVEHAGRDGLRARVLERWTVAPPNPPVTVVQALPKSERSELAVELATE
AGADGFLAWQAARCVANWHGPRVDKGLRRWRAVAKAAARQSRRPHIPTVD
GVLSTASLTSRIRDEVAAGAVVLALHESATDRLTDVPVAQAKSLFLVIGP
EGGIADDELAALRQAGALSVRLGPQVLRTSTAAAVALGALGVLTPRWDDA
ASP
118466944YP_882311.1 translation initiation factor IF-3 [Mycobacterium avium 104]MRIEDALRVAADADLDLVEVAPNARPPVCKIMDYGKFKYEAAQKARESRR
NQQQTVVKEQKLRPKIDDHDYETKKGHVIRFLEAGSKVKVTIMFRGREQS
RPELGYRLLQRLGADVAEYGFVETSAKQDGRNMTMVLAPHRGAKTRARAR
HPEGPGGAASDSDAAADAEPSSS
118466943YP_881050.1 hypothetical protein MAV_1827 [Mycobacterium avium 104]MLFVVDDLEGTAASLRAAGVVVGDAVNGLISGTKSVLMFDPDGAVIEIAE
SAGGVEASKGALFSGIRIGAIDAHATGDFLTTIGFDEIEAPASISVSDEQ
LAPGGSAESAECVVARYALPEDGHQFSVTVVAHPRTEPRPVPWGGNQQGL
YRCALRVESVEKALSVLPTWIEPQGDPVWCPLPGTKIDGLYIAFLRSPDG
VVFEFVERPLKHFR
118466942YP_881460.1 gp108 protein [Mycobacterium avium 104]MLSESERAGALDQELMAAVARGGRVEARMPTSAVVATGKPVNHVLHLLVT
VLLFGLWLPVWIILAIDGGEKRTTVSVDESGHVQRTKGAPASPTANWLGR
MSENQATLVVIGALVGGCMLVGFIVSLFH
118466941YP_882455.1 hypothetical protein MAV_3273 [Mycobacterium avium 104]MFVLGMARSGTSALTRVLSLCGSTLPAGMCGADGNNPRGYWEPRTAIMLN
ETILRRHDSNWYDPTLRLQQEAAFGAAERAACIAEITAYLSTLPAAPLVV
IKEPRITALSDLWFEAARRVGFDVAAVIAVRHPQEVIASAAKYVSTSPEL
SSALWLKYNLLAERHTRGVPRVFVDYANLLDDWHREMKRIAGALEIELDT
AEEGAIEEFLTADLRRQRHCGPVTDLFGADWMSAVYAALRGAAHDDPLDT
ATLDRVFESYRASERDFRTAFTDFQARTNSVVRRVFRPFLVKWILEVAAV
LHRRRGAWA
118466940YP_880605.1 ABC transporter transmembrane protein [Mycobacterium avium 104]MSATTLTRPSASASPAPLGGAHFSGTLQMLRLYLRRDRISLPLWVLLLSV
PLSTVYVGSIEKVYPTAAARAGFAASIMASPAQRALYGKVYSDSLGAVGI
WKAGMFHVLIAIAVILTVIRHTRADEENGRTELVDSTAIGRYAGLTAALT
LSFAASIATGAIGAAGLLGTDVPAGGSLAFGAALAWSGLVFTAVAAVTAQ
LSPSARFARGAAFAVLGTSFTVRAVGDAGPGGLSWLSPLGWSLLVKPYAG
DRWWVLVLHLVTTAGLTVLAYRLLAGRDVGAGLIAERPGPATAAPRLGNA
FGLAWRLDRAALLLWTAGLALYGLLIGSVVHGIGDELGDSGQARDIVARM
GGTSALEDAFIAVAFAMMGMVAAAFAVSLTLRLHQEESSQRAETVLASAV
SRTRWLASHLVIALAGSGVAMLASGTVAGLVYGIAAGDVGGKLAMVVASA
AVQLPAVWLLSAVTVCVFGVAPRFAPVAWGVLIGFVALYLIGSLAGFSQW
LLDLEPFAHIPRVGADFTAVPLLWLLAIDIGLTILGAMAFRRRDLRC
118466939YP_884002.1 hypothetical protein MAV_4880 [Mycobacterium avium 104]MAIHEPVHQPTAHVEPTGHVEPTSHVERRVTDPPRPRRRKPLRTLGIDEG
LMGVALLAGPANVIMQLANPGVGYGVMESRVESGRVDLHPIKRARTTFTY
LAVATSGSEAQKDAFRRAVNRAHAQVYSTPESPVSYNAFDPNLQLWVGAC
LYKGGLDIYRMFIGELDGDDADRHYREGMTLATTLQVPPAMWPPDRAAFD
RYWEESLAKVHIDDAVREYLYPIAANRIRGVWLPGPVRRLTEGFALFITT
GFLPQRFRDEMRLPWDSTKQRRFDRLIAVLATVNRYLPRFIRQFPFNVLL
YDLDRRIRKGRPLV
118466938YP_881456.1 hypothetical protein MAV_2252 [Mycobacterium avium 104]MCNAISSKVHTEHLIDPQGGVMSESQGPTDQPPPPPPPPPPPPPPPVLLT
YDEVRSLGREDVEGIERFER
118466937YP_879319.1 serine/threonine protein kinase [Mycobacterium avium 104]MTTPQHLSDRYELGEILGFGGMSEVHLARDVRLHRDVAVKVLRADLARDP
SFYLRFRREAQNAAALNHPSIVAVYDTGEAETPSGPLPYIVMEYVDGVTL
RDIVHTDGPLPPRRAIEIIADACQALNFSHQNGIIHRDVKPANIMISTTN
AVKVMDFGIARAIADSGNSVTQTAAVIGTAQYLSPEQARGDAVDARSDVY
SLGCVLYEILTGEPPFTGDSPVAVAYQHVREDPVPPSQRHEGISADLDAV
VLKALAKNPDNRYQTAAEMRADLVRVHNGEKPEAPKVLTDAERSSLLSSG
AGAAGPSRTDPLPRQVLADSGEDRTVGSVGRWIVAVAALAVLTIIVVIAF
NTFGGGARDVQVPDVRGQVSADAIAALQNRGFKTRTLQKPDSAIPPDHVI
GTDPGANASVSAGDEITINVSTGPEQREVPDVSSLSYSDAVTKLKAAGFS
KFKQANSPSTPELLGKVIGTNPPANQTSAITNVITLIVGSGPETKQVPDI
AGQTVDIAQKNLTVYGFTKITQVQVDSPRPAGEVIGTNPPKGQTVPVDSV
IELQVSKGNQFIMPDLSGMFWTDAEPRLRALGWTGILDKGPDVDAGGAQS
HRVVYQNPPAGAGVNRDGIITLKFGQ
118466936YP_881059.1 hypothetical protein MAV_1836 [Mycobacterium avium 104]MSRNEDGGERIEQLPVSDWTDQDLLTKDEARERLVDEIGRTRTRLDELIA
KNTDDPEIDLLARRLNAMESIRDEYADNRGGGK
118466935YP_881058.1 acyl-CoA dehydrogenase protein [Mycobacterium avium 104]MPVASERTEDTAALRSRIQTFLENAPKPAGLRNYGPTPTAADVEPGRTWH
KYLAEHGYVCLHWPVEYGGADASVAFQAIFAEECARAGVPRQLGITAIDL
VGPVLIKFGTDEQKARYLEPIRLGDDIWTQLFSEPGAGSDLASVRTKAEK
TETGWRINGQKVWSSAAKSAKYGLLLARTGPHKHRDLSVFVLPMDTPGVS
VRPLTQMDGESKFNEVFFDGVEIRDDALIGEVGQGWTIAIMTLGRERLTL
GSQAVAMFRLHERMVEAAREHDLLDPVLARSMTKLWARMWLLRFTWQRAI
DSGDTSSAAFSVLKLMTSETDRDLGDMATEVLGTDACADPGDEELVQHML
VGRAQTILGGTSEIQRNILGERVLGLPKEPR
118466934YP_883043.1 hypothetical protein MAV_3881 [Mycobacterium avium 104]MNVFELATAPFGWGSAIRGKRFFHPDGVLAGGVAERVAPAGRGLPIPPSR
IVARLSKATGTPGALPDFIGLALRVSAPQPAGTPWDILLVSAGSGVLSRA
VALRPATSWNAQTLTTLMPLRYQDANWWLRARTASDIGGAGLALDDVRRR
LERGGIEVSLDQACGRGDFTPLARVSLTAVIDDDVSFDPVVNTAPGVSLH
PRWLADLRARAYRHSRDGRDADQ
118466933YP_879610.1 prephenate dehydrogenase [Mycobacterium avium 104]MCVLGLGLVGGSIMRAATAAGREVFGYNRSIEGAQAATADGFDADTDLTA
TLSRAADSDALIVLAVPMPALPSMLAHVKETAPQCPLTDVTSVKKAVLDE
VVAAGLRDRFVGGHPMAGTAHSGWTAGHAGLFTGAPWVVSVDDHVDPVVW
AMVMTLALDCGAVVVPARSDEHDAAAAAISHLPHLLAEALAVVAGDVPLA
FALAAGSFRDGTRVAATAPDLVRAMCEGNSDQLVPTADHVIELLRRARDS
LAHHKSVADLIEAGHAARTRYDSFPRTDIFHVVIGAENWRQELAAAGRAG
GVIRSALPTLDSPR
118466932YP_880973.1 ATPase [Mycobacterium avium 104]MSVPARPRPLFADIDDVSRRLAETGYLPDTATATAVFLADRLGKPLLVEG
PAGVGKTELARAVAQATGSGLVRLQCYEGVDEARALYEWNHAKQILRIQA
GSGDWDQTKTDVFSEEFLLQRPLLTAIRRTEPTVLLIDETDKADIEIEGL
LLEVLSDFAVTVPELGTLTAERPPFVVLTSNATRELSEALKRRCLFLHID
FPSPDLERRILLSRVPELPAHLADELVRIIGVLRGMQLKKVPSIAETIDW
GRTLLALGLDTIDDAVVAATLGVVLKHQSDQQRATGELRLN
118466931YP_879537.1 beta-lactamase [Mycobacterium avium 104]MTTPTLDGKIRLPADLDAVTTIGAEDHSEIDAAAVDRIWAAGRHWYQGGF
HPAIQLCIRRHGRVVLNRAIGHGWGNAPTDPPDAEKIPVTPDTPFCVYSA
AKGIAATVVHMLVERGVFSLDDRVCDYIPTFTSHGKHRITIRHVMTHSAG
LPFPTGPRPDVTRADDHEYAQQKLGELRPLYRPGLFHMYHALTWGPLVRE
IVYAATGKEIREILATEILDPLGFRWTNFGVAKQDVPLVAPSHATGRTLP
PVVAQIFRKAIGGTVHEMIPYTNSPMFLTTIIPSSNTVSTAHEMSRFAEI
WRRGGELDGVRVISPETMYHAVAECRRLRPDFAVGLQPARWGTGFILGTN
RWGPFGRNAPHAFGSLGLTNIAIWADPARGLAAGVISSGKPGRDPEARRY
TALMDTITAAIPRD
118466930YP_882376.1 secretory lipase [Mycobacterium avium 104]MAELGNLAGTHGAEWIARPPHEELQRKVRPLLPSDDPFYQPPLGFQHAEP
GTVLRSRDVELAFLGLIPQPIKAVQLLYRTMDMNGEPEATVTTVIVPADA
VPGRPCPLLSYQCAIDAVSSRCFPSYALRRRAKALGSIGQFELFLITAAV
AEGWAVSVPDHEGLRGLWGAPYEPGYRVLDGIRAALGSERLGLSPSAPIG
LWGYSGGGLASAWAAETCAEYAPELNVVGAVLGSPVGDLGNTFRRLNGSF
LSGLPALVVAALAHIYPDLDRVIKEHANEEGRALLDSLEKMTTVEAVIRM
AGKNMGDYLDAPLEQILSTPEVTYVFDHIRLGAAVPTPPVLIVQAVHDYL
IDVHDIDVLADAYSAGGAQVTYHRDAFNEHMMLHPLSAPMTLRWLTDRFE
GRPVTEHLIRTTWPTMFNPMTYVGMARLLKIAAKVVTGRKIHRRPL
118466929YP_879324.1 FHA domain-containing protein [Mycobacterium avium 104]MLRILRTDIYAPTGAVMVRRGLALRSTLLPSRQRRHAARYLVVTEGALAG
GRITLSGQPVLIGRADDSTLVLTDDYASARHARLTQRGSEWYVEDLGSTN
GTYLDRAKVTTAVRVPIGTPIRIGKTAIELRP
118466928YP_880489.1 glyoxalase [Mycobacterium avium 104]MKFVSTRIITADVQRLVGFYEIVTRVSAVWANELFAEIPTPAATLAIGSD
QTVPLFGAGSAEPAANRSAIVEFIVDDVDAEYERLREQLTEVVTEPTTMP
WGNRALLFRDPDGNLVNLFTPVTPEARAKFGI
118466927YP_882064.1 CBS domain-containing protein [Mycobacterium avium 104]MNVTVTVVSIVAIAVLIFGNAVFVAAEFSLTTLDRSTVEANARTGGRRDR
WIRRAHHRLSFQLSGAQLGISATTLAAGYLTDPMVEDLPHPWLDAVGIPD
RVGDAIMAFLALLIVTSVSMVFGELVPKYLAVARPMSTARAVVAAQLLFS
ALLTPAIRLTNGAANWIVRRLGVEPAEELRSARSPQELLSLVRSSARSGA
LDAATAALVRRSLQFGTLSAEELMTPRSKIVALQTDDTVADLVTAAAESG
FSRFPIVDGDLDETVGIVHVKQVFAIPRAARAHTLLTTVAQPVPVVPSTL
DGDAVMAEIRANSLQTALVVDEYGGTAGMVTVEDLIEEIVGDVRDEHDDA
TPDVVPAGTGWRVSGLLRIDEVAAATGFRAPEGPYETIGGLVLREIGHIP
AAGETVKLPALDPDGLLDPVLRWQARVIRMDGRRIDVLELTEIDAHAEAP
GGRR
118466926YP_882439.1 hypothetical protein MAV_3257 [Mycobacterium avium 104]MELKWVKRGGRIAGLPRRLPPAARKSGIESSARGTDKLGALPLAEAYGQP
GAARKPKQVRAASWQGDLYAYLVRWRDPGIVVEFGSAFGVSGMYLSSELR
RGWLYSFEINPSWADIAERNIKSVTDRCTLTRGAFEDHVDDIPAPIDMAL
VDGIHSYDFVARQWQLLKPRMAPGGWVLFDDIDFNPGMGKAWQDICAEPH
VVGAVEVSKRLGLIELAP
118466925YP_882561.1 MmcJ protein [Mycobacterium avium 104]MKLGIGLPNHIADVPGPAVAQWSRRGEELGFESVATIDRLFSSGVDSLIA
LATAAGATNELTLVTNVLLAPMYPVIPLAKQLVSLARVSGGRLTVGLGVG
NRSDEYAGTGADFHRRGRALDAQVERLRSLWAGEPLADGTALCGAPVRIP
LLFGGRSAATVRRVVTTGDGWAAGAVRLYDEQADVAARIRSGWQDAGRPA
RPYLQASVNFALGPAETVAAGRDHLARYYAFAPGYAQVNVADMVCSAADA
RDTVRRYRDLGFDRLLFHPTSASVEQLDYLADAILGCL
118466924YP_882974.1 TetR family transcriptional regulator [Mycobacterium avium 104]MSAPTAAPRDRVRHPRRPADSVLVRREAILDAAWAVASAQGFDGVQMRAV
AAQAGIAASSLYRHFRSKSHLLVTVLAREFERLDTEFDCTTGELAPQARL
GRLTTHLHMAWQANPHLTEAMVRAFVVADSEAAGAIEHAVAVIEDMLARA
LGGPTPSAHDRDVASLIADVWLANLIAVIGGRIDADLARERIDRTTRQLV
HGTDTTT
118466923YP_880155.1 peptidase- M24 family protein [Mycobacterium avium 104]MTTLAHLDTKTGEGLVIPETPDLTRLRRDTGTRLRAAMAERGVDAMILLG
NNAVVYATGASWPLGDAGLSYVERPVAVVLADDEWPHLFLPFREGAAHES
DLPADHLHGPVYLEFDEGVAAFARTVADLIPANAVIAVDECTGAMSRAAA
TLFPRGAPVDAAAIVGAAKAVKTPDELSCIRTAIRITDEAMVEVQKRLAP
GIRQIDLSASFLRRAFELGATASMLEPIWQVMPPSKAEGVWTTHGDLALP
LLSTARELDEGDVLWTDVSITYQGYCSDFGRTWIVGRDPSPRQQAQFDKW
FEIMTAVLDVAKAGATAADLGRAAIGANGGAKPWLPHFYLGHGIGVNAAE
MPMIGTDLGQEFDENFVLQAGMVLVLEPVVWEDGTGGYRSEEVLVITEEG
WIRLTDYPYDPYGRHVS
118466922YP_881121.1 dioxygenase large subunit [Mycobacterium avium 104]MTTLETAPTLDEFDVSKIVRSDRVHGSVYTSPEIFRREMDTIFKTGWVYV
AHESEVSERGDYLTRMIGYDPVVVVRGKDGVVRVVLNRCTHRANKLCNAE
KGNANSFRCPYHGWTFNNTGALQGVPMREGYGEAFNEIRAELGLAQAPRV
DSYGGFIFASLAAEGVSLREHLGNATHAIDRLLNLSPNRQIDLRANWMKH
LHHANWKMVVENNVDGYHALFTHASVYDAIKPAKVSHVPTKVDVLVRDLG
NGHSEIDYSDEYRKLDEEFVWYGRIPRAKLAKYVDALEKAYGPEQAHDAL
VVGPPHTLIWPNLFLAEMNVMFVEPQAPDRTIAYTTAVLIPGQDELNERT
LRRSEGAMGPAGFLIADDGEIGMRNQAGLAAELPEWLVLARGTENDITDD
SGIINRDKSAETPQRGFYAQWAAVVGGGVRA
118466921YP_881380.1 acyl carrier protein [Mycobacterium avium 104]MATGETGFDDVTYDLISVQYHSLKAGHDYGQYVRDAKNAGMEEIASFFSE
VMAQDSERARRCHEFLGQLQGTPAAGPATR
118466920YP_881709.1 2-hydroxy-6-ketonona-2-4-dienedioic acid hydrolase [Mycobacterium aviuMTTSNMADHAVTVNGKSIFFAEKGTGAPVLLLHGGGPGASGVSNYSRNID
PLAEKFRVIVPDMPGYGRSAKGVDQSDPFGYLADTMRGLLDELGIDSAHL
VGNSYGGSCALRLALDNPRRVGKLVLMGPGGIGTTRGLPTAGLNSLLAYY
GGRGPSRDKLEAFIRNYLVYDGASVPDELIDLRYQASVDPEVVADPPLRR
PSGPMALRTLWRMDLARDRRLKRLRTPTLVLWGRDDKVNRPAGGPMLLNL
MPNAELVMTSRTGHWVQWERADLFNKLVTEFLHNTSVFAQ
118466919YP_881263.1 hypothetical protein MAV_2044 [Mycobacterium avium 104]MIRYVVVLGLGYVLGSKAGRRRYEQIVGTYRALTSSPVAKSVIEGGRRKI
ANRISPDAGFVTLAQIDDRTAIMEREAEPADEALAPSNRPR
118466918YP_883798.1 carbon-nitrogen hydrolase [Mycobacterium avium 104]MRIALAQILSGTDPAANLALVGEYTRRAAGAGARLVVFPEATMCRFGVPL
APIAEPVDGPWADGVRRIATEANVTVIAGMFTPSGDGRVKNTLLVANSDD
QAVTHYDKIHLYDAFGFTESRTVAPGREPVVVGVDGVRVGLSVCYDIRFP
ELYTELARRGAQLIAVCASWGAGPGKLDQWTLLARARALDSMSYIAAAGQ
ADPGGSLSASGAPTGVGGSLVASPLGEVVASAGAQPQLVLADIDVDRVAQ
ARKTIAALSNRSDFAQVGRAESVG
118466917YP_881663.1 DoxX subfamily protein- putative [Mycobacterium avium 104]MAFIGQGVNSLLNPKSAAEAAAPAVDGLQALPDPVSGNIPSDPETVAQIT
AAVQIGGGLLLATGKLPRVASAALALTVLPANLGAHSFWNESDPVAKAQK
RQQFLTDLSLLGGLLIASADTAGKPSLGWRGRRAAERLSERVSSAWPGSD
DSGFEADLSELGERIAHGLQIGAERGRELASTAAERGAPYAEAALERGRE
LASTAAERGAPYAEAALERGRELASTAAERGRPLAKKARKRGEELADEAA
ERAAYLAQKARKRSEELAEEAAERGKPLAKKARKRSEKLAKKARKRSEKL
AGTARVRGEELAETARQRGSLLADTARERVGGQVGTGRRKLSW
118466916YP_881028.1 3-(3-hydroxyphenyl)propionate hydroxylase [Mycobacterium avium 104]MPVVIVGAGPTGITAATLLAQHGIRCLVLERWDDVYPQPRAVHLDDEVRR
ILARLGINDEFAAISRPALGLRLLDPEFGVLAQFNRDPAESVHGFPQANM
FDQPEFEALLRRNLKNFPGAVMRGNSEVTDVTQTEVGRVRVTFADRATGE
GHVVDADYVLGCDGANSVVRSAIGAAMDDLHFEQRWLVVDVATDVDLNQW
DGVYQVCSPVRAATYMRIGATRYRWEFRLLPGETADDYRSCAALRSLISP
WVGDVADEDLELVRVAEYTFRAQLANRWRDRNVFLLGDAAHLTPPFIGQG
MGAGLRDAMNLAWKLAGVLGEDLPEEVLETYEQERKPHARALIALALGMG
WAMTAGGGIGDAIRRTVVPRLHLVPGMRGRIVNSRTPALRRSALVVKSRL
RRDLAGTLCPNPLLDNGARFDNVVGNRFALIASLPLTKGQRIELDHRGAV
VLSVKPGCELDRWLRRGRVTSRGVV
118466915YP_881719.1 repressor protein [Mycobacterium avium 104]MHTRMGDIARRAGVHRSTVYYYFPSKDALLAASFMRVLTVTLHAVEQCWQ
TDEPFLTQLVAACMRGIDIARGSPVMRSLVDDHQAVGAAYHAAEGSELWR
AKLADALVRRIEAAAAAGDIRRDVPADTLARWIVRINFSLIAEPADPDDG
GDEGVLRDLLVASLTPRR
118466914YP_882516.1 general stress protein 69 [Mycobacterium avium 104]MKTITFGKTGLEVSRLAFGTWEFCSDWGHADEDAAITMIRSARDLGINFF
DTAQQYGFGASERLLGKALRDDLARARDEVVIATKGGLRATDSGLVRDAS
PQWLRKGVESSLTALGIDHIDVYLVHWPDPRMPAAETAGALAELVSEGKI
RHVGVSNYDTAQVEEFSATLPVEVVQPPYHLFRRDIEDTLLPYAREHDIG
VMVYGPLAHGLLTGTVKPDTRFAPQDWRAKSDIFSGDGFLRNLEVVAQLQ
ELASDLGVTISQLAIARVLAQPGVHVAIVGAQHLHYLQESARAADVTLSD
ADLAAVDNVLAAATPVGGPYPEMHQKAS
118466913YP_884116.1 hypothetical protein MAV_4996 [Mycobacterium avium 104]MSDDKMLARIAALLRQAEGTDNSHEADAFMSAAQRLATAASIDLAVARSH
SAQRSAAQAPTQRTITIGAAGSKGLRTYVQLFVLIAAANDVRCDVASNST
FVYAYGFAEDIDASHALYASLVVQMVRASDAYLASGAHRPTPTITARLNF
QLAFGARVGQRLAEARDQARQEATKDRRRTPGTAIALRDKEIELVDFYRS
ASKARGTWQASRASAGYSSAARRAGDRAGRRARLGSSPELPGARSALSG
118466912YP_883089.1 cytochrome p450 [Mycobacterium avium 104]MTATISTPQYLLDQARRRFTPTLNTIPGMGAIEKRLLAHEWQTKVLAEPP
AGSGLKPVLGDAGLPILGHIIELFRGGPDYALFLYRNHGPLIYLDSPIMP
AVTALGPDATQAVFSNRNKDYSQKGWHPVIGPFFNRGLMMLDFDEHMYHR
RIMQEAFTRSRLTGYVEHIDRVATDIVADWPTNDARFLFHPAMKELTLDI
ASLVFMGHEPGTDHDLVTKVNQAFTTTTRAGGAIIRQPIPPFKWWRGLRA
RQLLEDYFSERVKERRNATGNDMLTVLCHTEDDDGNSFTDDDIVNHMIFL
MMAAHDTSTSTTTTMVYNMAAHPEWQERAREESTRLGDGPLDIEALEKLE
TLELIMNESLRMVTPLPFNMRQAVRDTELLGHYIPAGTNITIWPGMNHRL
PELWTDPDKFDPERFAEPRAEHKKHRYAFAPFGGGAHKCIGMVFGQLEVK
TVVHRLLRRYRLELARPGYQPRWDYGGMPIPMDGMPIVLRPL
118466911YP_879743.1 hypothetical protein MAV_0461 [Mycobacterium avium 104]MAMVALLVAVTGSHPRAAAADVRIPLGGGAGIVVNGDTMCTLTTIGGDAA
GDLIGFTSAHCGGPGAQVAAEGAENAGILGTMVAGNDNLDYAVIKFDPAK
VTPVANFNGFLISGIGPDPAFGEIACKQGRTTGNSCGVTWGMGQSPGTIV
MQVCGQPGDSGAPVTVNNQLVGMIHGAFSDNLPTCVIKYIPLHTPAVVMS
FNAILADINAKHRPGAGFAPLPG
118466910YP_882314.1 TetR family transcriptional regulator [Mycobacterium avium 104]MRGIAATPLRAVAEAADVSIGLVQHHFRTKAALTAAVDQYVLQVLDEALK
PTMLPEPPEDGLNEAGHRLTTLMAERPDVVMYLGRALAEGGALGSVIFDG
LLRICATQGEQFVAQGNTQLDLDPDWAAINILVLRVGAIILHPYIELHLG
KPFFTEQQLRRWDASVTSLIRHGMFLEDTQHPYGDANAR
118466909YP_880256.1 resuscitation-promoting factor RpfA [Mycobacterium avium 104]MLGGGAIAMAGQAAAATDGEWDQVARCESGGNWGINTGNGYHGGVQFSAS
TWAAHGGGEYAPSAELATREQQIAVAERVLATQGRGAWPVCGGPLSGPTP
RDVPAPAGLDAPGVNGVPQAPPADAPPPAPVQLASFDRPAPPDAPAPDAP
PPAPADLPPAPADLPPAPPADATPPAPPADAPAPDGDFHGFVPAGMPDHV
SEAGYTQRLWEAIRAQDVQGNDALDALVQPAPSA
118466908YP_880949.1 secreted protein [Mycobacterium avium 104]MGFDPNVPAAGPAPDAPPPPAPDAPPAPAPDAPPAPDAPPPPAPDAPPPP
APDAPPAPGPDVPPPPAPKAYSVNWDAIAQCESGGNWGINTGNGYAGGLQ
FTSSTWHANGGSGSPAGASREEQIRVAENVLHSQGIGAWPVCGRRG
118466907YP_884207.1 oxidoreductase- short chain dehydrogenase/reductase [Mycobacterium aviMDLGLVDTRVVVTGGASNIGRAIVHEFASEGARIVLNDIDEPQAEKVRGE
ALERGASAVEVVVADLTLPGSAESAVGRAVESWGGIDVLVNNAGWTAPGF
IATDTDRTKWQRIIEINLFSALAATQAAIGPMKDAGVGAIVFIASDAAFG
QIRQSVYGASKAAMVALARTTAREHGRHGIRSNVVCPGLVVPEGPDAIGQ
SSLWSVGQDNIFNEKQIEFMLKDTPLRRLTTAEDVARAVLWFSSPSAARQ
VTGQIISVSGGYTMP
118466906YP_882263.1 HAD-superfamily protein hydrolase- subfamily protein IIA [MycobacteriuMSGVKTLAQQHDCLLIDLDGTAFRGRSPTEGAVQALARLPGRALFVTNNA
SRSAGEVAAHLTELGFTATADDVATSAQSAAHLLAGQLPAGAPVLIVGTE
ALAGEIAAVGLRPVRRYDDGPVAVVQGLSMTIGWPDLAEAALAIRAGAVW
VAANIDLTLPTERGLLPGNGSLVAAVAAATGATPQVAGKPAPALLRDAAA
RGDFRAPLVIGDRLDTDIEGANAAGLPSLLVLTGVNSARDAVYAKPARRP
TYIGHDLRALHQDAAALAVAPQPGWRVDVGDTAITVSGDGRDDGSGDGLS
VVRAVASAVWGSPDAGTLPIRAGDDRARAALARWSLVRTD
118466905YP_882111.1 PPE family protein [Mycobacterium avium 104]MYAGPGSGPLMAAAAAWDEVAAELGIAASGYHSVIAELTSGPWVGPASLS
MVSAITPYVGWLSAVAAQAEETASQGRAAAAAFEAAFAMTVPPPVIAANR
VLLATLVATNFFGQNTPAIAATEAQYMEMWAQDAAAMYGYAAASQTASTL
SPFAAPPNTTAPEGESDQAAAVAQAAAEPAGNSAQTAAQASSQLATSQAV
TTGSQAVAQASTTTASQPGPFTWLTSALQNLQQSGLPTPTNNWLGLNPSF
YTVMLKQNTGLAYFSNGITSFWSSIAQQLVSGPGGSTAGAGGAWYPTPQF
ASLGLGNLGSVGGASHVSAISAGAGRVGALSVPQQWATLTSAVSPAVSEE
GSAVQAAAGGAPGGAANGLLRGMPVGALGRRGAAAGYVNKYGFRYSVLTR
PPSAG
118466904YP_880942.1 homocysteine methyltransferase [Mycobacterium avium 104]MLLDGGLATELEARGHDLSDPLWSARLLADAPQEIGAVHAAYFRAGAMIA
TTASYQASFEGFAARGISRSDTAGLLRRSVELAKAARDEAGVAGYVAASV
GPYGAALADGSEYRGRYGLSVRQLEDWHRPRLEVLADADADVLAAETIPD
VDEAEALVNLVRSLGVPAWLSYTIDGAHTRAGQPLADAFAVAAGAPEIVA
FGVNCCAPDDVLPAIGPARAVGKPVIVYPNSGEHWDGRAWTGRSKFSAEL
ASQWISAGARIVGGCCRVRPTDIAAVRRACSDGENSAKKSP
118466903YP_883619.1 inositol monophosphatase [Mycobacterium avium 104]MKSMQELFEIAWQATQIGATTLKKTQPSSVQHKGDRDLVSDVDLTIQRDI
ANYLSQTTPDVALLAEESDHQPDIETAEWLWVLDPVDGTSNFVHGLPLCA
VSLALLHAGRTVVAVTHAPLLGKTYHAIESKGAFVNGERITASATDSLSG
AIVSLGDYAVGHDAGRLNAHRLALTAELVPRAERIRMIGAATLDLAFVAE
GALDACVMMSNKPWDTAAGTLVAREAGARLTDAQGNPHTHKSASTVVAAP
GIAEQLATVIRNTEVPSDRYAAAVG
118466902YP_882817.1 antibiotic biosynthesis monooxygenase domain-containing protein [MycobMPVVVVATMTVKPESVDTVRDILTRAVEEVHDEPGCQLYSLHQSGETFVF
VEQWADEEALKTHSTAPAIGKMFSAAGEHLDGAPDIKMLQPVPAGDPGKG
QLRP
118466901YP_883365.1 LPPG:FO 2-phospho-L-lactate transferase [Mycobacterium avium 104]MKVTVLVGGVGGARFLLGVQQLFGLGQFRAQRHTHGRPDTAAGSHELTAI
VNIGDDAWIHGLRVCPDLDTCMYTLGGGVDPERGWGHRDETWHAKEELAR
YGVQPDWFGLGDRDIGTHLVRTQMLNAGYPLTQITAALCDRWQPGARLLP
VSDDRCETHVVITDPDDGSRRAIHFQEWWVRYRAQVPTHSFAFVGAEKAA
ATTETIAAIADADVILIAPSNPVVSVGAILAVPGVRGALRAAGAPIVGYS
PIIGGKPLRGMADACLSVIGVESTAEAVGRHYGARRGTGILDCWLVSQDD
HADIEGVAVRAVPLMMTDPAATAEMVSAGLQLAGVTP
118466900YP_881622.1 cobalt-precorrin-6x reductase [Mycobacterium avium 104]MRLLLLGGTGEARALAKALHPRIDIISSLAGRVPDPALPVGPVRIGGFGG
VDGLRRWLRDEHIDAVVDATHPFASTMTAHAAQACAELGVPHLVLARPAW
DPGAATVVDSDTRAAETVAEQGYSRVFLTTGRSGARAFKDSDAWFLIRAV
TEPDATTLPRRHRVVLSRGPYRYDDELAMLGEHRIDALVTKNSGGQMTRA
KLDAAAALDIPVVMVARPALPAGVSAVGSVAEAAEWVAALAIKD
118466899YP_880502.1 hypothetical protein MAV_1257 [Mycobacterium avium 104]MAAVDAQFYWMSAKIPNDEFLLYAFDGEPADYPAAADQLRRRADAEPALS
IRVRDRGRLRYPHWVPAAVAPEQVVRHELAEHSWDGCLAAVAGLADDQLD
LRRMAWRLHVFGPVDGIPGVRGPGTVAVLQVAHALADGARAAALAARLFG
RAAPVPEVPVPRPGWLPWRAAVAARTHRQLVRDTRAGRLAPGAGPRPLLP
TNARPAGVRSLRTLVRHRAQLPGPTATVAVLGAVAQALSDLLGDQADSLG
AEVPMAKPGAPQAYNHFGNVVVDLHPRLGAQARAERIAAGLAAGRRRFGH
PATRAADRAFAAVPAALLRWGVDQFDADQRPDQVAGNTVVSSVNRGPADL
SFGGARVVLTAGYPALSPVMGLTHGVHGIGDTIAISVHAAASAVPDVDAY
LALLDAAL
118466898YP_882072.1 hypothetical protein MAV_2886 [Mycobacterium avium 104]MLLLRETNGDRYLPIWIGQSEAAAIALEQQGVEPPRPLTHDLIRDVIAAL
GHSLKEVRIVDLQEGTFYADLVFDRNITVSARPSDSVAIALRVGVPIYVE
EAVLAQAGLLIPDESDEEGGTAVREDEVEKFKEFLDSVSPDDFKAT
118466897YP_880682.1 glyoxalase/bleomycin resistance protein/dioxygenase [Mycobacterium aviMGLTNTSIAHVRLTVTDIERSRRFYESVFGWPVLLEVPDNADASTREQLS
FLFGGVIYDLGGTLLGLRPVATDRFDEDRTGLDHIAFRLDSRDELDAAAA
HLDELGVAHEPVKDIGPAYILQFRDPDNIALELTAPK
118466896YP_881186.1 hypothetical protein MAV_1967 [Mycobacterium avium 104]MLINRCHGCGHYFHPPGPACWRCRSTDVAPEPVSGKGTVAAYTINRQPWI
PGLDPPYIVAMVELADEPDVRLITNVVDVSADDIRVGLPVEVFFEDWTAM
SGDEDSRVWLPLFRPVST
118466895YP_883958.1 ErfK/YbiS/YcfS/YnhG family protein [Mycobacterium avium 104]MVVTPVGVSLAAASQSHAFAIASVLPSSGEVVGVAHPVVVTFRAPITDPA
KRHAAEQTIDVKSTPAMSGKFEWLDNRVVQWVPDRYWPAHSTIALTVGGV
STEIKTGPAVIGVASISEHTFTVSIDGVEAGPPTSLPAPHHRPHFGEQGV
MPASMGRPEFPTPVGSYTVLSKERAVTMDSSSVGIPVDDPDGYLLTVNYA
VRITNRGLFVHSAPWAVRSLGLENVSHGCISLSPDDAEWYYDHVNVGDPV
IVQD
118466894YP_879449.1 hypothetical protein MAV_0155 [Mycobacterium avium 104]MLTTTVDGLWVLQAVTGIEQTCPELGLRPLLPRLDTPERALRHPAAAELV
AAGALDEAGNVDPMIREWLTVLLRRDLGLLVMIAVPGREPSRASICRFAT
WWVVLERHDQLVRLYPAGTASSEAAASEIVVGQIERLCGVAEAAPLRPIT
LDTEQLLASVHDTASLRAFLLEQRLDADQLQTVLTAADSARSAHANIVAL
QAGVGPDELARVAVGDSSVSIVDTPGGRVCIESVVSGQRRYQILSPGSRS
DIGGAVQRLIRRLPAGDEWYSYRRVV
118466893YP_881698.1 universal stress protein family protein [Mycobacterium avium 104]MSDPKHRGILVCVDGSAASDAAVAWAAREAAMRGLPITVIHAVAPVVVGW
PVGQLYADMPAWQQDGAQQVIDQARKIVIANQGGGTPPEMRTEIIYSAVT
PTLIDASRDAWMIVAGSQGLGALGRLLLGSVTAALLAHAHCPVAVVHTDD
HAARAADAPVLVGTDGSPASEAAIALAFDEASRRGVGVVALHAWSDVGVF
PILGMDWRDSEAKGEELLAERLAGWQEQYPDVHVKRLVVCDKPSRWLVAE
AERAQLVVVGSHGRGGFPGMLLGSVSSHVAQSATAPVIVVRGR
118466892YP_884284.1 Fatty acid desaturase [Mycobacterium avium 104]MTHNKITLTPEQAEEFGRELDALKERVMADLGEKDADYIRRVIKAQRALE
VGGRALLFLPPAWLLGTTMLGLSKILDNMEIGHNVMHGQYDWMRDPAISG
RSFEWDTACPADQWRHSHNYMHHTHTNIVGMDRDIGYGILRMSEDQPWQP
YFLGNPLYAFLLMVLFQYGVALHELETERIRSGEIRLADKREVLREIWQK
TRRQTLKDYVAFPLLAGPFAPFVFTGNLTANLIRNVWSYMIIFCGHFPDG
TQEFTVEETQDESRGMWYFRQILGSANLTGGKLFHLLSGNLSHQIEHHLF
PDMPARRYAEIAPEVQAICQRYGVAYNRGPLLRQFGTVVRKIVKLSFPNA
WIPGAAKPADREPVAA
118466891YP_879752.1 hypothetical protein MAV_0470 [Mycobacterium avium 104]MLAEPELRAELDRVAAAAGVRVVHAGDAAAVSRKTWAAAAAVVLDAAAAA
RCGRWALPRRDHVTVLTAAEPATTTWAAAVRIGAARVLRLPEHEADLVGE
LAEAAESSRDDGQRGHAVAVIGGCGGAGASLLAVALAQAAGDALLVDLDP
WGGGIELLLGGENTPGLRWPDLALQGGRLNWAAVRDALPRHRGVSVLSGT
RRGHEVDAGPVHAVVDAGRRGAVSVICDLPRRFTDAAQAALGAADLVVVV
SRCDVRACAATGALAPVLAAVNPNVGLVVRGPSPGGLRAAEIAGITGLPL
LAAIKAQPQLGAQVERVGLRLGRRSALAVAARQVLGVLPPAGARRKGKAA
118466890YP_884325.1 hypothetical protein MAV_5209 [Mycobacterium avium 104]MAGTGEPGVAYREGCVEMAREMDMRAGILPSAVGLDAINSV
118466889YP_880999.1 ribonuclease Z [Mycobacterium avium 104]MIEVTLLGTGSPIPDPNRAGPSTLVRAGGQVFLVDCGRGVLQRAAAVGVG
AAGLSTLLLTHLHSDHVGDLGDVLITRWVSTFTPDPVPLPIIGPPGTAEL
VAATLNALRHDIGYRIAHHADLNAPPAVDVREHTDGPVWDRDGVSIRVAP
TDHRPVAPTIGFRVDYQGASVVLAGDTVPCAGLDELAAGAGALVHTVIRK
DIVATIPQQRLQDICDYHSSVEQAAATAARAGVGTLVMTHYVPALVAGQE
EQWRALAAREFAGRVELGDDLHRVQVDAPS
118466888YP_884191.1 hypothetical protein MAV_5073 [Mycobacterium avium 104]MTASSPGTGLMQSTGQTGTQLASVQQFCVITKAIDPDQDSFF
118466887YP_882853.1 polynucleotide phosphorylase/polyadenylase [Mycobacterium avium 104]MFEATATIDNGSFGTRTIRFETGRLAQQAAGAVVAYLDDENMLLSATTAS
KSPKEHFDFFPLTVDVEERMYAAGRIPGSFFRREGRPSTDAILTCRLIDR
PLRPSFVDGLRNEIQVVVTILSLDPNDLYDVLAINAASASTQLGGLPFSG
PIGGVRVALIDGTWVAFPTVEQLERAVFDMVVAGRKVDGADGPDVAIMMV
EAEATSNVIELIDGGAQAPTETVVAQGLEAAKPFIEVLCTAQQELADKAA
RPTSDYPTFPDYGDDVYYSVASVATDELSKALTIGGKAERDARTDELKAE
VLARLAETYEGREKEVSAAFRSLTKKLVRQRILTDHFRIDGRGITDIRAL
SAEVAVVPRAHGSALFQRGETQILGVTTLDMVKMAQQIDSLGPETTKRYM
HHYNFPPFSTGETGRVGSPKRREIGHGALAERALVPVLPSLEDFPYAIRQ
VSEALGSNGSTSMGSVCASTLALLNAGVPLKAPVAGIAMGLVSDDIEVEA
GDGTKSLERRFVTLTDILGAEDAFGDMDFKVAGTKDFVTALQLDTKLDGI
PSQVLAGALSQAKDARLTILEVMAEAIDEPDEMSPYAPRVTTIRVPVDKI
GEVIGPKGKIINAITEETGAQISIEDDGTVFVGATDGPSAQAAIDRINAI
ANPQLPTVGERFLGTVVKTTDFGAFVSLLPGRDGLVHISKLGKGKRIAKV
EDVVNVGDKLRVEIADIDKRGKISLVLVEEDNSAPADAPAAAPADATS
118466886YP_882049.1 molybdate ABC transporter periplasmic molybdate-binding protein [MycobMRRIGILTGLLSVVLIAGMTGCGSKSQPPPTAGKLMVFAAASLRPAFTQI
AERFKAQNPGTGIEFEFAGSSELATQLTQGATADVFASADTAQMDVVAKA
GLLAADPTNFASNTLVIVTAPGNPKRIGSFADLARPGLTVVTCQRPVPCG
AAAHRVEDSTGVHLNPVSEEPSVTDALTKVTSGQADAALVYVTDARTAGS
KVATVNFPEAAGAVNVYPIGVLKQAPLATQARNFVDLVTSPPGQQILAQA
GFAKP
118466885YP_882828.1 dihydrofolate reductase [Mycobacterium avium 104]MGLVWAQSTSGVIGRGGDIPWNVPEDLTRFKEVTMGHTVIMGRRTWESLP
AKVRPLPGRRNVVVSRRPDFVAEGARVAGSLEAALAYAGSDPAPWVIGGA
QIYLLALPHATRCEVTEIEIDLRRDDDDALAPALDDSWVGETGEWLASRS
GLRYRFHSYRRDPRSSVRGCSPSRPS
118466884YP_883722.1 TetR family transcriptional regulator [Mycobacterium avium 104]MVGRSDARRNRQRLLEAATAAFTAHGASVSLESIARDAGVGIGTLYRHFP
NREALVEAVYRAELAEVAAAAAQLLQRHPPKAALRRWMDRYATFVATKRG
MAESLQAIFESGALVPSQTRDSIVGAVETLLRAGADDASLRADVQADDVV
SSLIGIFLVSGSPEQTGRMLDLLVAGVTR
118466883YP_884164.1 hypothetical protein MAV_5045 [Mycobacterium avium 104]MNANTFIRCRTGSYRALVAITVLATLAAGVTAARAQADDDDPGIPPAPVP
LPVVTPTANGWQPKFPFPYDQMKGSVTDAEVNAEREMCQWFNAQYEPLKL
QIERMNDTIIRNNGNFDTNDVPRQLDIVTANIDQSVDFLTPRVQTLTQSY
DHSGDMYFPLYEGDSFYGLWQQLSNVSAGLKGHQRTWFSGPSFLRAQHWG
SKINRSHVCR
118466882YP_880846.1 hypothetical protein MAV_1612 [Mycobacterium avium 104]MDANNEPDDVAPVITAAGLGVDGEHGPLFSGVDLALTPGFHAIQMPGGPG
QTTLLLTLAGRFKPSHGTLTVLGETTPRAIRRHCSIAAFEGIDDLEDSVT
VGTVLAEQRRWLAPWYSSVPLQSGPAELTEVFGDMAPPSDNTYVVELSDL
ELFLLRITLALLSNRPILVVGDLEQVRDNSRRAIAAERLGAIARQRTVVV
GVTNPLGADAPDHELHDHRIPTGED
118466881YP_884189.1 acetyl-CoA hydrolase/transferase [Mycobacterium avium 104]MTETLAALLHRLSRPEVTIALGDGVGGLTTLDSGVSIGETVSRFAADTGA
VSLILGWCPVPPQGLCADAFARIVTLMPGWGMRELLSSHVVHSIPTSMAA
IPGLLAGHLRPDALITRMAHSGDGLQFCSEVSWQQALVDAGVPLWAVLDD
SAPKASAEAPIPLDAVTIIGRAGSGTAEIPVRSADSIHDDLADRVLRFIP
AGARLQYGPGQLGTALLRRTKIPLSIDTGLLTDAVIDLERRGLLVGQPSA
TYLLGSAELYRWADRRPILRGVGYTHDVSRLSRGAPFVAVNTAIEIDPYG
QINVEGIADKVVGGIGGHPDYCVAARLSRNGLSIIAVPARFNGRSPLVER
LSRPASTPAHDVDMIITEHAHVDLRGADWCQRHRLISELFDRAA
118466880YP_882063.1 hypothetical protein MAV_2877 [Mycobacterium avium 104]MAGGGSASGGWSDGPCARTPVACAGACGTSILSLPGGGGRGRARLCCLML
ARAPAPGRRPPGPRQRLTLRPTPRRRLRYAYPYSGRLGALCPTPQPRARQ
PRLTQSRPTRPSSPSCRASGPTSPTPWRAFPVRPCPTWIRRSPCAWRGSA
TPTWWPSG
118466879YP_882536.1 hypothetical protein MAV_3354 [Mycobacterium avium 104]MKLLLALLGVALGIVTAVPAHAVPGEDEAAADDNNEVFIADLHKVGISFQ
DPGQAVSAGKAVCGLLARGVSGLQLLNDLRDNNPALTTNGAAQFATISAK
SYCPRQLESAEAGKGGG
118466878YP_881890.1 hypothetical protein MAV_2699 [Mycobacterium avium 104]MKTTAHRRSAVVGLAAVALITVGCSNGKSVDASAPPHAAASATSTSANPA
QPTEVKLIGESNVEVTLTGPIAAKYASATDDQKKALGKPLTGDRNAGKRE
SGVVFQQFEGGVITAKNDAPGTPAYITLGKIREAWNVPRGADGTPEITGT
NGSAGPLGLPVSDQSSVGDVLVSNFEHGTIQYNPKTDQVAVTVNGKVVPS
GL
118466877YP_881627.1 precorrin-8X methylmutase [Mycobacterium avium 104]MVRLIHTCGQVDVAEHVAFTDDVVERVGTALRAGAPVLCDSSMVAAGITA
ARLPADNEVVSLVADPRSAELAARRQTTRSAAGVELWADRLPGAVLAIGN
APTALFRLLELVDDGVGPPAGVLGGPVGFVGSAQSKQELVDNPRGMSYLV
VRGRRGGSAMAAAAVNAIASDRE
118466876YP_880261.1 glutathione S-transferase [Mycobacterium avium 104]MASYVAGSGEFTRDTDYITTRITADGRDGYPVEPGRYRLVVARACPWANR
AIIVRRLLGLESVLSIGFCGPTHDERSWTFDLDPGGVDPVLKIPRLQDAY
FKRFPGYPKGITVPAIVDVGTGAVVTNDFAQMTLDLSTEWTAYHRDGAPE
LYPERLRAEIDEVNKRVYTEINNGVYRCGFAGSQQAYEAAYDRLFTALDW
VSDRLADRRYLVGDTITEADVRLFTTLARFDAVYHGHFKCNRSKLSEMPV
LWAYARDLFQTPGFGDTVDFVQIKQHYYIVHSDINPTGIVPKGPDLAGWL
TPHGREALGGRPFGDGTPPGPPVEAERVPAGHGA
118466875YP_879664.1 hypothetical protein MAV_0379 [Mycobacterium avium 104]MLSVKWLEAPEAHDFPAAADYLSMLADAQTVKKVIKKLKRATVMQRKAKD
ILRAARLDLLPVDNPHVAADLTKIEKGLPLSPILLVRGDFLAGVPLQIAD
GYHRVCASYHTDENTPIPVLLAVAR
118466874YP_884324.1 oxidoreductase- short chain dehydrogenase/reductase [Mycobacterium aviMVVVSGAGGGGIGTTVTAMAARAGATVIAVSRSKENLDEHIAPLAAQGLA
VLPVAADASTDEGIAAVIDQARRADGQLYGLVNVAGGAEPSTWMPSTRVS
RTDWRKIFADNLETAFFMSQAVAAELLARRLPGSIVSISSISGMNTAPFH
IAYGTAKSAIAAMTRTMALELAQSAIRVNAVAPGVTETAASRTYVADDPD
RDRRAIAMGRRGRPEEQAGAILFLLSELSSYVTGQTLLVDGGLDLRWSHL
GADNTSLFLHDESFRAAIRRM
118466873YP_880382.1 dehydrogenase [Mycobacterium avium 104]MTEVTRSKTHVVVVGGGYAGTLAANHLRQRPDIDITLVNPRPVFVERIRL
HQLVADTGTATADYATLLGEGIELIVDTVDHIDATARRAVLTSGAGLDYD
YLIYAVGSTGAVAEVPGCAEFAHSVADLESAQRLHYALADLPLPAPITVV
GGGLTGIETASELAELGRPVTLICGPVLGPSLSPRGRRSVAKRLRRLGVG
VLESVTVTEVRWNEVVLSDGVVLPSAATVWTAGFSVPDLAARSGLRTDPL
GRLLTDETLTSIDDDRIVAAGDAAAPSGRPLRMSCQAAGPLGAQAANTVL
GRIAGTEPAPLNQAFVGQCISLGRAAATFQLARTDDTPINAYLGGRAAAK
LKEAICRGTLWAIRREAAKPGSYRWLKGGQRVPADERVGV
118466872YP_881589.1 ABC-transporter integral membrane protein [Mycobacterium avium 104]MTASAYQPFAPISVPLARLYRRGKVPVIRLGHLLVFFVRALVAVPLALRQ
YSGEFLRLLSNITWGNGSIVVGGGTAGVAVVLGMTVGALVGIEGYNFLDL
LGLGPATGFVSSLVNTRELAPLMASLAFAMQGGCRFTAQLGSMRIAEEID
AMESIAIRPIPYLVTTRLIASVVAIVPLYAACLAIGYLSTQIVVSIGSGG
STGSYLHYFTLMLAGQDIVYSLFKAVVFVWIASTIQCYYGYYASGGPEGV
GVAAGHGMRASITVVIIVNMLLTMALWGVDSGARFGG
118466871YP_880319.1 precorrin 6A synthase [Mycobacterium avium 104]MGRHIHVIGIGAGDPDYLTVQAIEALNDTQVFFAMDKGEQKSDLVALRRE
ICSRFIRQPGYRFVELPDPKRSDRADYRDAVAEWHAARAQIWADAIAAEL
GPHGVGGFLAWGDPSLYDSTLRILDTVAGHVEFTFDVIPGITAVQALTAR
HRIPLNEVGEPVLVTTGRQLRAHGISGSAVVMLDADCSFQRCAPETRIWW
GAYLGTADELLVAGTVGEVGPRIAALRAQARARHGWIMDTYLLRPAH
118466870YP_883634.1 acyl-CoA dehydrogenase [Mycobacterium avium 104]MSDTHVVTNQVPPLDNYNPAGSPVLVEALIREGGQWGLDEVNEVGALSAS
RQAQRWGELADRNRPILHTHDRNGYRVDEVEYDPAYHELMRTAIAHGLHA
APWADDRPGAHVVRAAKTSVWTVEPGHVCPISMTYAVVPALRFNPELAKV
YEPLLTSREYDPELRVATTKPGITAGMSMTEKQGGSDVRAGTTQAVPNGD
GSYRLTGHKWFTSAPMCDIFLVLAQAPGGLSCFLLPRVLPDGTRNRMFLQ
RLKDKLGNHANASSEVEYDGAVAWLVGEEGRGVPTIIEMVNLTRLDCTLG
SATSMRTGLTRAIYHAQHRKAFGAYLIDQPLMRNVLADLAVEAEAATMVA
MRMAGATDKAVRGDQREALLRRIGLAASKYWVCKRSTPHAAEALECLGGN
GYVEDSGMPRLYREAPLMGIWEGSGNVSALDTLRAMATRPECVEVLFDEL
AEAAGQDPRLGGHVDRLRADLAELDTIQYRARKVAEDICLALQGSLLVRH
GHPAVAEAFLTTRLDRRWGGAFGTMPDGLDLAPILERALVKG
118466869YP_884269.1 chromosome condensation protein [Mycobacterium avium 104]MPAVTANTLTLPRVGGPGPADTERPVRSITTGPRGYEGEGFPVVRAFAGV
STAALDPFVHMDQLGEVDYQPGEPRGTDWHPHRGFETVTYLLDGKFAHQD
SHGGGGLITDGATQWMTAGSGVLHIETPPAELVDSGGLFHGIQLWVNLPR
KDKFTPPRYQAIEGGDVALLASDDGGALLRIIAGEVDGHHGPGVTHTPIT
LAHATIANGARLNLPWRRDFNALVYVLSGDGYVGPVAHPIRQGQLAVLGP
GDRITVGAREVQDSGPDRGAIDVLLLGGRPIREPVFHYGPFVMNTRTELI
EALQDYQAGKFGSIPPNALMPHRRDGTL
118466868YP_881522.1 serine/threonine protein kinase [Mycobacterium avium 104]MAQAESPGSSSGRPGPHRRQAQAESPGSFAGTLLDGRYLIESKIASGGTS
TVYRGVDTRLDRPVAVKVMDPRYAGDEQFLTRFQREARAVARLKDPGLVA
VYDQGLDARHPFLVMELIEGGTLRELLGERGPMPPYAVAAVLRPVLGGLA
AAHRAGLVHRDVKPENVLISDDGEVKIADFGLVRAVAAAGITSASVILGT
AAYLSPEQVRDGAATPRSDVYAAGILAYELLTGRTPFTGDSTLAIAYRRL
DADVPPPSAAIDGVPAQFDDFVQRATARDPADRYADAVEMGADLDAIADE
LALPGFRVPAPRNSALHRSAALHREAGRRAPGAEPPARHPTRHLTRGPEE
WPQPEPPAHVGAEPDDDEDDYEYQSVTGEFAGIPISEFVWARQHNRRMVL
VWLALVLAVTGMVATAAWTIGRNLNGLF
118466867YP_880516.1 hypothetical protein MAV_1271 [Mycobacterium avium 104]MSYESSAEPIKVGYLMDFALPPGFPEEMKADFTRCFDLVFAEAAEQGVLD
RAVQMIYREVEGLPKGSVKAVIDAFGELVDEGCLVVFGPHITDNCVPTRE
AIEERFKVPALSVTGTDDWLGEWTFSFPQGSMTDEPIFIADLVAKRELSE
IGVLVEQNLIGESYLKNLRSACRRKGIRIVAEAAIAQTAQDINEAVRTLH
DAKSEAIVHLGFGFGIVFINPALQAVDWDPPRFTTTAFQNAWVNPIMWNA
FMGWVGVDQYDEDNRIGQDFLDRYAAKYGGRRPEYCVPVVNCDVAATLVR
AFADAHPLSPRGVKEALERVKMMPAASGAPGTRVSFGKWTRRAWMGAGYL
VARTLDADGVNSHLVDRFGEEG
118466866YP_879472.1 nuclear export factor GLE1 family protein [Mycobacterium avium 104]MPPRKRRAPRLLVAVAALCLGSVAWSPIASAHVHAGSDNPVRGAMAVVTF
QVPNESNTGAATTALTVALPNVAAAHTETMPGWTARLDRDAASGTVRSVT
WTAAAGGGIGPDQFALFRLSVKLPDADTVSFPATQTYADGTVVKWDQPPL
PDGGEPEHPAPTLALAAGPAAGHQHPGGPAAADNAARWLGGAALVLAALG
IAIALVRRRA
118466865YP_881399.1 propionyl-CoA carboxylase beta chain [Mycobacterium avium 104]MTITAPETVGESLDPRDPLLRLSNFFDDGSVALLHERDRSGVLAAAGTVN
GVRTIAFCTDGTVMGGAMGIEGCSHIVDAYDTAIEEQSPIVGIWHSGGAR
LAEGVKALHAVGLVFEAMIRASGYIPQISVVVGFAAGGAAYGPALTDVVV
MAPESRVFVTGPDVVRSVTGEDVDMASLGGPETHHKKSGVCHIVADDELD
AYERGRRLVGLFCQQGHFDRTKAEAGDTDIHALLPESARRAYDVRPIVTA
ILDDETPFDEFQANWAPSMVIGLGRLSGRTVGVLANNPLRLGGCLNSESA
EKAARFVRLCDAFGIPLVVIVDVPGYLPGVDQEWGGVVRRGAKLLHAFGE
ATVPRVTLVTRKTYGGAYIAMNSRSLNATKVFAWPDAEVAVMGAKAAVGI
LHKKKLAAAPEHEREALHDQLAAEHEKIAGGVDSAIEIGVVDEKIDPAHT
RSKLTEALAQAPARRGRHKNIPL
118466864YP_881492.1 hypothetical protein MAV_2288 [Mycobacterium avium 104]MAGPHSPNHTVGGQGPTPPSESQPLEFPDHPNAGDTGYAAAPQAPPGSAN
YAGPPPAPAPYPPRRSKRRLIVGLALAVALVAVMTVAIVYGVRTNGANTG
ATFSEGAAKTAIQGYLDALEHRDIDEIARNALCGLYDGVQDKRSDQALAK
LSSDAFRKQFSEVQVTSIDKIVYLSQYQAQALFSMRVSPVSGGPARGQVQ
GIAQLLFQRGQIMVCSYVLRTGGSY
118466863YP_881659.1 phosphotransferase enzyme family protein [Mycobacterium avium 104]MHAETEQVIERPSDLSASWLAAVIGTGPIADFSVERIGTGQMSECYRIRL
RYAQADARGPESVVLKVAATDPVSRQTGLALGLYEREVRFYGDVAPRLGG
PIAPCYHAAVDTSTGVFDLLLGDAGPAVVGDEIAGATIEQARLGVVELGR
LHGPLLGDISLAQAPWLNRDAPLNQAMIAPLYAGFVERYGDQIAPEHRAV
CERLVAAFDGYLAQEPGVRGLVHGDYRLDNMLFGTAGAERALTVVDWQTV
SWGPALTDLAYFLGCALPTEDRREHYDALLRAYHEALGPQPPITLADVAD
GVRRQSFFGVMMAIVSSMLVERTDRGDQMFMTMLRRHCDHVLDTDALATL
PAASAPEPLQPSPEDELAHDPTTEPLWSESWYADFADPAQGLGGWFRLGL
VANQQTAWVHALVCGPDMPTVAVDAQVPLPPDPWTVRTDTFEITHSAGAP
LRSYRVDVRALAQAYADPAALLRGEPGTPVAMTMNLDWHTDGTPYKYAMT
TRYEIPCTVTGSVTIGDTAYRIESVAGQRDHSWGVRDWWSMDWIWSALHL
DDGTHLHGVNIRIPGAPAFSIGYTQGADGEVTELQTVDSRESFGDNGLPL
DATLELNPGEITAQVDVRGQAPVRLVAADGRVSQFPRVWAAVSTGDGRRG
VGWLEWNRNLGERIG
118466862YP_884340.1 DltE protein [Mycobacterium avium 104]MQMTGNTVLVTGGGTGIGRGLAEAFHRLGNRVIIAARRGEQLRAVAEANP
GIQTLSLDLGDPADIRRFATEVTDHYPDLNVVVNNAGMQRVEDLISGNAG
LAEQTVAVNLLGPIRLIATLLPALLRRPHAAILNVTSGLAFMPSALTPTY
CASKAALHSYTQSLRFQLRETPVQVIEIIPPQVQTALQGERGFDPRAMPL
DEYITETMTLLQTQPQADEIVVERVKAFRFAERDGTFDDIYPGFNEAMTA
ASDR
118466861YP_883482.1 Pd2U protein [Mycobacterium avium 104]MHGDEHVVKFTEACYRENALQPDPRFAAAVQTAQRRIAPRALGGAATISS
G
118466860YP_881016.1 salicylate synthase MbtI [Mycobacterium avium 104]MTEVSVETTSAGSESPSIPLPVHIDPADLAAELAVVLSERAGEEYLLYER
GGEWVLATGVRAMIELDSDELRVIRDGVTQRQHWSGRPGPVLGEAIDRLL
LETDQLFGWIAFEFGVYRYGLQQRLAPGTALARVFWPNGRVVVTREAIQL
FGTSTGRRDDVLGVLGDGVPGLRDASAVDVVTDPSNYRDRVASAVAEIAA
GRYHKVILSRCLQVPFALDFPSTYRLARRHNTPVRSFLLRLGGIRAVGYS
PELVAAVRHDGVVVTEPLAGTRAFGRGALHDRQARDDLESNSKEIVEHAI
SVRSSLQEMAEIAEPGTAVVTDFMTVRERGSVQHLGSTVSGRLGTSNDRM
DALEALFPAVTASGIPKAGGVEAILRLDEGPRGLYSGAVVMVSADGALDA
ALTLRAAYEHDGKTWLRAGAGIIEESTPEREFEETCEKLSTLAPYLIARQ
118466859YP_882861.1 metallophosphoesterase [Mycobacterium avium 104]MAGQESSNAGQPTLWAVSDLHTGHLGNKPVTESLHPSSPEDWLIVAGDVA
ERTDDIRWALDLLRRRFAKVIWVPGNHELWTTTRDPVQVFGKARYDYLVN
MCDEMGVITPEHPFPVWTERGGPATIVPMFLLYDYSFLPDGAASKAEGLM
IARDRNVVATDEFLLSPEPYPTREAWCRERLEITRARLEALDWMTPTVLV
NHFPLVREPCDALFYPEFSLWCGTTKTADWHTRYNAVCSVYGHLHIPRTT
WYDDVRFEEVSVGYPREWRRRKPYGWLRQVLPDPQYAPGYLNDFGGHFEI
TPEMRRQATQFRERLRQRQSR
118466858YP_879349.1 hypothetical protein MAV_0049 [Mycobacterium avium 104]MQVSDSGSRANLSDKDLVESVLRELSEAADKWEALVAQAEAVTYSVDLGD
IYAVANSDGRLLKLTLHPGVMTGYGHGELADRLNLAITALREEAEAENRA
SYGGPLH
118466857YP_881114.1 hypothetical protein MAV_1894 [Mycobacterium avium 104]MTATIDEWVDSVVADIEREGLGEIVIVGHSMAGVTVPGVVAKLGSARVRE
MILAAAFVPPQGQAIVDTLGGPLAWFARRAARSGKPTKVPRLAAQYAFCN
GMSPQQREFALARLYPESARIPAESVDRSALPNDVPRTWILTTRDRALSQ
KSQQASIAALGGVQEVIPIDACHDLMISHPDRLAQILVDRCRLYAP
118466856YP_880082.1 hypothetical protein MAV_0809 [Mycobacterium avium 104]MPILEPPGFPTGNLATQDVYSISRYLNDPTTVLRALRLIADQIFIGNKVL
TGQFYTKDGSVIYEQIESIFAANTPQAVQPGDEYPLTPVPTGPAQMANVV
KWGLDTPITDESIARQNFDVVARAFIKIVNSMVAQIDSVVMSAMVAAITQ
SVNAGASTIGGSSPAGGANWNGSGSNAPKILRDVMFAEELMRSLKQGYRA
NTVVLDLQTFAAVMGDPNITAALPREDMGAQGVTKNPIFEGIETGLAVRM
LGKTWLSTPNLPGGPFEPFAAVLDSTIFGAFVDEELPAPGYVGSQSDGSA
NDDGRSMIQVKTMREDKNDRWRIRARRVTTPIIIEPKAIVQIEGV
118466855YP_879682.1 hypothetical protein MAV_0397 [Mycobacterium avium 104]MSQTPEPQAEPTTPEPTPAAAVPPPPPPPERVKPPRLYTAAAWVVIVAGI
VFIISSVFFVGAFIWKHSYYHCHHHHGVFHPGGPGPGNGPWQYGGPGPGN
GPWPGGPGGSGAWYGGPGGPDNGPWPGGPGLIVPMPPGGPGGPGGPVSGP
GVSGPGQPSPVSPAPSTPAPRP
118466854YP_880466.1 hypothetical protein MAV_1219 [Mycobacterium avium 104]MTAPPGGPYGPGSYGSNPYGQEPNWSGQPPGGQPQGGQPQGGPYPQPGQY
PAGGPYPYPPPGGGYPYPGGPYPGGPYPGAPYPGPGQPFGPGGPYSPGPP
PGGPGSKLPWLIVAGLVVLAVIALVATLVVMKGGHGSKPSGATPSSTSTS
VSQPKNSAQNATDCTPNVSGGDMPRSDSIAAGKLSFPANAAPSGWTVFSD
DQGPNLIGALGVAQDVPGANQWMMTAEVGVTNFVPSMDLTAQATKLMQCL
ANGPGYANAMPTLGPIKTSPITVDGTKAVRADADVTIADPTRNVKGDSVT
IIAVDTKPVSVFIGSTPIGDSASAGLIGKIIAALKVAKS
118466853YP_884192.1 citrate lyase [Mycobacterium avium 104]MHDDLASARSLLFVPGDRPDRFTKAASSDADGIIIDLEDAVAPEAKARAR
EAVDRWLATGGVGTVRINGTETPWHQEDLEMAARHGCPVMVPKARSASHL
AQISRRLPTGTALIALIETAAGVLAAADICAVEGVVRAAFGSVDLGAELG
IDPEDHESLRYARSAVVLGSAAAGLAAPLDGVTTAVHDEGAAGADAARAA
RLGFGGKLCIHPCQVAPVNSQFSPSIEEQAWARKVMAAGSGNGARTVDGC
MVDKPVVDRAARILARAQGLTSP
118466852YP_881540.1 undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltMNDTVKKPTGGRGDDPLPAGAALSAVAPHEPVSVVLAGGGTAGHVEPAMA
VADALKALDPNVRITSLGTARGLETRLVPERGYDLELITPVPLPRKPTGD
LARLPSRVWRAVRETRAVLHAVDADVVIGFGGYVALPAYLAARGVSPRKP
RVPVVIHEANASAGLANRVGARTAQRVLSAVADCGLPGAEVVGVPVREAI
TSLDRAAVRAEARRHFGFADDARVLLVFGGSQGAASLNRAVSGAAAQLAA
AGVSVLHAHGPKNTLDLREPQPGDPPYVAVPYLDRMDLAYAAADLVICRS
GAMTVAEVSAVGLPAIYVPLPIGNGEQRLNALPVVNAGGGMVVADADLTP
ELVAREVAGLVGDPPRLAAMTTAAARVGHPDAARRVAQAALDIGRTARRA
RGATGGRP
118466851YP_883258.1 DevR family transcriptional regulator [Mycobacterium avium 104]MVKVFLVDDHEVVRRGLCDLLSSDPDLRIVGEAGTVAEAKARIPAARPDV
AVLDVRLPDGNGIELCRDLLSEHPDLRCLMLTSFTSDEAMLEAILAGASG
FVIKDIKGMELARAIKDVGAGKSLLDNRAAAALMAKLRGSAAQADPLSGL
TEQERTLLGLLSEGLTNRQIAARMFLAEKTVKNYVSRLLAKLGMERRTQA
AVFASKLNQQAGRPPTPPDWPG
118466850YP_883509.1 carbohydrate kinase [Mycobacterium avium 104]MRHYYSVDAIRAAEAPLLASLPDGALMRRAAFGLATEIAAELTARTGGVA
GRRVCAVVGSGDNGGDALWAATFLRRRGAAADAILLNPERAHRKGLAAFG
KAGGRIVESVSPTTDLVIDGVVGISGSGALRPAAAEVFAAVDDAGIPVVA
VDIPSGIDAATGATSGPAVHAVLTVTFGGLKPVHALGDCGRVKLIDIGLD
LPQTDVLGFEAADVAARWPVPGPHDDKYTQGVTGVMAGSATYPGAAVLCT
GAAVAATSGMVRYAGSAHREVLAHWPEVIASPTPASAGRVQSWVVGPGLG
TDDAGAAALWFALETDLPVIVDADGLTMLAAHPELVANRAAPTVLTPHAG
EFARLAGSPPGDDRVGATRKLADTLGVTVLLKGNVTVIADPGGPVYLNPA
GQSWAATAGSGDVLSGMIGALLASGLPAGEAAAAAAFVHARAAASSAADP
GPGEAPTSSSRMVPHIRGALAAL
118466849YP_881205.1 transmembrane protein [Mycobacterium avium 104]MTTKGRDHQRLTGGRGGDAAAELETVHIPLPRILLAHLFGRNPLVRVSDR
VQALIFVLAVAVSLAAVPVAATIGTAVHESRSRVYAEQSQTWRTVTATAV
GDSHPRRDLDSPTVRVPARWQYAGAEHAGDVIAPLNVKAGDRVEIWVDDT
GSPVTPPDRTALDEAVAFAVVSWCAVSLPAAALFAAARAALDRRRYAAWQ
RDFDRLVDQR
118466848YP_879339.1 acyl-CoA dehydrogenase [Mycobacterium avium 104]MTFDLTPTAAQHDLARRTHEFAESVIRPVALEYDQRQEFPWPVLEEAARR
GFYSPLFYRDLIGDPTGISLPMFMEELFWGCAGIGLAIVMPALALSAIGQ
AASPEQMLEWAPECFGTPGDLKLAALAISEPEGGSDVRNLRTRARRDGDD
WIIDGHKMWIGNGGIANVHVVNAVVDEELGHRGQALFVVPGGTPGLKMVR
KLDKLGCRASHTAELLFEGVRVPAANLLGGQEKLEHKLAKAREVVAGGKR
SGSATLGTFEQTRPMVAAQAIGIARAALEYATSYATEREAFGAPIIDNQG
IAFPLAELATQIDAARLLTWRASWMAANNVPFERGEGSMSKMAASEVAVK
ATERAVQTLGGWGYITDHPVEKWYRDAKLYTIFEGTSEIQRMVVSNALGA
AVGTPPLHVVLEPSGGALNRVFGRGTPLRSRAAEAALSMQDRIPEPVMRL
AMKVLRPPGR
118466847YP_883062.1 hypothetical protein MAV_3900 [Mycobacterium avium 104]MNLNIWAGAALLVLDIAVAVVLLVRRKRAFFVPIIGCLAQVALAVAAAAM
ELRAGPV
118466846YP_880614.1 integral membrane protein [Mycobacterium avium 104]MSKSTAVRRLYTPRTSRRYSPRLDPETVGQITESIARFFGTGRYLLLQTI
VVAVWIVVNVFAVRLRWDPYPFILLNLAFSTQAAYAAPLILLAQNRQENR
DRVALEEDRRRAAQTKADTEYLARELAAVRLAVGEVVTREYLRHELDDLR
ELLAELRPQSADGEPVSGADNREQTAKKSR
118466845YP_880672.1 extracellular solute-binding protein- family protein 5 [Mycobacterium MGRCGFRPAALVAAVVLAVAGCSPAINLVPETGQNARIGTTSDINPRDPA
TLQDGGNLRLALTDFPPNFNILHIDGNSADVSAMMKATLPRAFVIGPDGS
TTVDTDYFTSVELTGTAPQVVTYTINPKAVWSDGTPITWEDIASQIHALS
GADKTFEIAGSSGAERVASVTRGVDDRQAVVTFAKPYAEWRGMFAGNGML
LPKSMTATPEAFNKGQLEGPGPSAGPFIVSSLDRTTQRIVLSRNPKWWGT
RPRLDSITYLVLDDAARLPALQNNTIDATGVGTLDQLTIAEHTAGISIRR
APAPAWSHFTFNGAPGSILADRALRVAVSKGIDRQTIAKVVQYGLTSNPV
ALGNHIYVAGQQGYQDNSTTVPYDPAAAGRELDALGWKLHGRFREKDGRQ
LVIRDLFYDAQGSRQFAQIAQHSLAQIGVRLELVARAGSGFFTNYINVGA
FDMAQFGWLGDAFPLSALTQIYKSDGESNFGKIGSPQIDAAIERTLQELD
PDKARALANDLDKLIWAEGFSLPLTQSPGDVAVRSTLANFGAAGLGDLNY
TAIGFTRS
118466844YP_883887.1 phosphate acetyltransferase [Mycobacterium avium 104]MADISAIYVAAPEPETGKSTVALGLLHRLTATVAKVGVFRPITRDGQDRD
YILELLLSRTTAGLSYQQCVGVTYQQLHADGDAAIATIVDAYHAMAELCD
VVVIVGSDYSELGQAIRPAELSTNARIAVNLGAPILLTVSGKGRTAAEVA
TVVQVCLAELDAQHAHTAAVVANRCEPAELDAVAEALRGFPQRCYVLPDE
PLLSAPTVTELEKAVAGSPVSGEESLREREVTGILVAGMTADHVLERLAD
GMAVITPGDRSDVVLAVASAHAAEGFPSLSCIVLNGGFALHPSIAALVAG
LRLRLPIVATALGTYDTASAAAAARGRVTATSQRKIDTALELMDRHVDIA
DLLEQLAIPIPTVTTPQMFIHQLTLQARADRKHIVLPEGDDDRILRAAGR
VLQRRVADLTILGDEARIRQRSGELGVDLSDVKVIDPRTSALRPEFAQQY
AQLRKAKGVTIEQAREIMRDATYFGTMLVYTSQVDGMVSGAAHTTAHTVR
PAFEIIKTVPDVSTVSSIFLMCLPDRVLAYGDCAIIPNPTPEQLADIAIS
SARTAAQFGIEPRVAMLSYSTGDSGTGADVEKVRTATQLVRQRNPDLPVE
GPIQYDAAIEPSVAATKLRDSPVAGRATVLIFPDLNTGNNTYKAVQRSAG
ALAIGPVLQGLRKPVNDLSRGALVEDIVNTIAITAIQAQGLPGGR
118466843YP_881838.1 betaine-aldehyde dehydrogenase [Mycobacterium avium 104]MTLLPESVPMVELAASYAAGKWVSGAHAGTLDVTSPATGELLGTVGIAGP
DDVGAAVAAARGALQSWGRVAPADRGAALGRLADALSARKGELADLTTAE
IGSPRSWSTFGQVITAVGVLRAYASITPHYPFSTTRPSVTGGTVEVRQLP
VGVVGAIVPWNTPLFIAALKLGPALAAGCTVVLKPAPDAPLEFGVLMEAI
EEAGLPDGVVNVVNGGAETGELLTEHPGVDKVSFTGSTAVGARIAASCGS
RIRRCSTELGGKSAAIVLPDAPLETTVPGLVAGVMGNNGQLCAALTRIVL
PRSRYDEFVAALTAAVAELIVGDPADRVTDIGPLINEAARDRVEGFLRRA
RQDGATVLVGGERPNRPGWFLSPAVVAATNDMEIAREEVFGPVAVVIAYD
DTGADDVAEAVAIANDSRYGLVGAVWSADAERAAAVAAQLLVGSVAVNST
AVLDFASPFGGFKQSGIGREGGPEGIAGFVEHQAIIR
118466842YP_884375.1 amidohydrolase [Mycobacterium avium 104]MTEEHGMNKDDLILISVDDHIAEPADMFDAHVPAKYKDRAPRVVVEPDGI
QQWYYGDIRGRNMGLNAVAGKPREMYNIDASRYDEMRPGCFNVDERVRDM
NAGGQLAGLNFPNFTGFSGQVLNQGPDREVNLVMIKAYNDWHIDEWCAAY
PGRFIPCGILPLFDVAEAAKEVNRLAAKGCHAVTFSENPEALQMPSIHTR
YWYPLFEAVCENKTVLCTHVGSASRSPQVSTDAPPSVQMTASSMMSMFTF
TELIWAQFWADFPELKFSLTEGDVGWIPYFLWRAEHVYNRHSGWTLATFP
PGYSGPADVFKRHFYTCFISDKVGVRNMDWFNEDMLCWESDFPHSDSNWP
FAPEDVIDTMGHLDDAVINKITHENAMAAYSFDPFRHIPKEQARAGHLRA
QATDVDVVTHVGHRASQRDRDAWARMTQFALQAQASAQAPVTVEAAGIAS
RATTLGN
118466841YP_880882.1 hypothetical protein MAV_1647 [Mycobacterium avium 104]MLWVTPGFAGGADAANKPAACRWLRSSSYNCADQSSFVIESLCKNFAPRS
AVEPASAAPCGDRRRPRAEKMSERVFAGISKSRPSGRPGGRGDGSRGPGG
G
118466840YP_883936.1 hypothetical protein MAV_4810 [Mycobacterium avium 104]MDRDLTVDPMLPEPPAPHILRSLGIGDDEMRAIGVDEIWWRVHRTAGEHV
LAWNALRTFGPVLRFDPHPLPRGEHARHGVWYGASSPCAALGEAYQVDRT
IDRERGRPYLTGLSFTRPLRVLDLAADSRGAWATRVGGTFAISTARHTVT
QQWARHITAAFPHLDGLRYNSRFAGDPCLALFPPAASAMPARPRLSLPLA
HPDLAGRVAGAAKRLGYGVV
118466839YP_884368.1 NAD dependent epimerase/dehydratase [Mycobacterium avium 104]MTDELRGRRILVTGAATGIGAAAVSVLTDAGADVVATYHATPPPPDLTAH
WLQCDARDADAVSALVHRAAEHLGGLDVLVHAAGLWQPGIPGCIGADDIS
FLLDTNVKATILTNQAAHAAMKAQDPKGGRIINFGSSEAVMGSPISAVYA
ATKGAVQAWTRSAAKAWAADHVTVNALAPAVQTPGADRLRAFLGPDAAAL
IDQQMQMMIPLGGALGEPARDLGPMLVFLAGSGSGFITGQLLAVDGGLMM
VGG
118466838YP_881919.1 citrate lyase beta chain (Citrase beta chain) (citrate(pro-3S)-lyase bMAPTLRPRRSALYLPGNKPRALEKGKSLPADVLIFDLEDAVGPDAKAESR
AAVCEAISSPDYRPREIVVRINGLDTEWHDDDLAAVAGSAADGVLVPKVE
TAQQVQALDRALDTLGASASLQLWVMMETPRAFLRAEEVASASDRLAGLV
VGTNDLVNELHGRHVAGRGPVVPALGLALLGARAAGKVVLDGVFNDITDD
AGFRAEAAQGREMGFDGKTLIHPSQIAPANEVFGPSQHELADARKVVSAY
QQAQAAGTSVITVDGRMIESLHVRDAQRILALADLISERDAAS
118466837YP_881604.1 peptidase- T1 family protein [Mycobacterium avium 104]MSFPYFISPEQAMRERSELARKGIARGKSVVALVYAGGVLFVAENPSRSL
QKISELYDRVGFAAAGKFNEFDNLRRGGIQFADTRGYAYDRRDVTGRQLA
NVYAQTLGTIFTEQAKPYEVELCVAEVAHYGETKPPELYRITYDGSIADE
PHFVVMGGTTEPITTALKDSYAENANLREATRIAVRALRAGSESSNGDQS
ALDVGSLEVAILDVNRPRRAFRRINRPTLENLLRELDSNGSDGNGDAPEL
NGGSSD
118466836YP_881551.1 phosphoribosyltransferase [Mycobacterium avium 104]MRSFRDRREAGRALAGELMGYRNRGDVLVFGLARGGLPVAWEIAAALHAP
LDVFLVRKLGVPNWSELAMGALASGGGVVMNDDVVSSLRITDEQVRAVID
SETAELARREHAYRGDRPMADLRDKVVILVDDGIATGASMLAAVRALRSG
PTGATPRSIVVAVPVGPESACRELGREADEVVCLSTPPGFEAVGQVYGDF
HQVSDDEVRELLATPTG
118466835YP_880575.1 hypothetical protein MAV_1330 [Mycobacterium avium 104]MAGVGLGQLLLALDATMVSLVDAPRGLDQPVASAALIDSDDVRLGLAAAA
GSADVFFLLGVGDDEALRWIDTQARDRVPVAVFVKEPSDALVGTAVAAGS
AVVAVDPRARWERLYQLVNHVLEHHGDRADAADDSGTDLFGLAQSLAERI
HGMVSIENAQSQVLAYSASNDEADELRRLSILGRAGPPEHLEWIGQWGIF
DALRSGTQVVRVAERPELGLRPRLAVGIHQPDPDARRPPVFAGTIWVQQG
AQPLADDAEQILRGAAVLAARIMARLAARPSTQARRLQQLLGVTDSETLA
PVDLTAIAAELGLAADGCAALVGWAAAEGASRHTRLTDVIALSASAFRHD
AHVAGHGSRTYVLLPQPPNRSVSSWVRGTIAALRAELGVQLRAVIAAPVP
GLSGVAAARAEVDRVLDSAERHPLSFGQVTSLAEARTTVLLDEIVTLVGR
DERLVDPRIVALHDREPVLAQTLRTYLDAFGDIAAAAHALRVHPNTVRYR
VRRIEKLLSVSLADPEVRLLFALALRAAER
118466834YP_882785.1 hypothetical protein MAV_3608 [Mycobacterium avium 104]MTHRQDAGDQYQPGQAGMYELELPAPQLSTSDGRGPVLVHALEGFSDAGH
AIRLAAKHLKAALDSELVASFAIDELLDYRSRRPLMTFKTDHFTHYDDPE
LSLYALRDSVGTPFLLLAGLEPDLKWERFITAVRLLAERLGVRQTIGLGT
VPMAVPHTRPITMTAHSNNPELIKNFQPWIAEIQVPGSASNLLEYRMAQH
GHEVVGYTVHVPHYLTQTDYPAAAQALLEQVAKTASLELPLTALSEAAEV
IRAKIDEQVEASAEVAQVVASLERQYDAFIDAQENRSLLTRDGDLPSGDE
LGAEFERFLAQQAEKKFDDDDDQA
118466833YP_883610.1 membrane sugar transferase [Mycobacterium avium 104]MTAPAPRLPDGFAVQVDRRVRVLGDGSALLGGSPTRLLKLAPAAQDLLCD
GRLKVRDDVSAQLARTLLDATVAHPRPAGGPSHHDVTVVIPVRDNLSGVR
RLVSSLRGLRVVVVDDGSFPPIEPEDFVGAHCDIEVLRHHRSKGPAAARN
TGLAACRTDFVAFLDSDVAPRRGWLEALLGHFCDPTVGLVAPRIVGLSHS
ENVVARYEAVHSSLDLGEREAPVLPHSTVSYVPSAAIICRCSAIREIGGF
DETLQSGEDVDLCWRLIEAGVRLRYEPIALVGHDHRTELRDWLARKAFYG
GSAAPLSVRHPDKTAPVVISGWALMTWILMAFGSTLSRLASLLLAVLTGR
RIARAMRSAETSMTDVVTVAGRGLWSAALQLASALCRHYWPLALLAATMS
RHFRRVVLVAAVMDGVVDWLRRRDAVGDDVEPIGLPTYLVLKRVDDLAYG
LGLWWGVLRERNARALRPQIRS
118466832YP_883526.1 hypothetical protein MAV_4391 [Mycobacterium avium 104]MALAVSTTGLCRVSVHWETQAVDVSLPAEIAVAELIPSLVDMLGAGDGGA
GRYRLSAPGAAALDPSTTLAHNHIGDGAILVLSRIDVPLPAPRYRDIADT
VSAALDATARPDVAVRRVAGAAAAASFVAAGGLQLVRNTFSASVVPDSGG
TVAVLVSTTLLTLGAAAVAHRGYRDPGAALALGAIATVFAGLAGFVAVPG
APSLSHVLLAAAAAGLAAVSAIGLSGCGAGLLALACWCLILATAALAGVL
SGAPLPAVASAAGLVSLCLLGMAARASLALAGLSPRPATAPAGGPEPGEA
WVSARARRADRWLTGLLAGLSSSATVGAAVTVLAGAPRLCCLAFGTGTGA
LLLLRSRGGDGTRALVFAAGGIVTTATTFGVAAWSAPLPGPWVAATTATL
VAAALYLGCAPRTCSPVLSRAADLLEWLALAALVPLTCWIAGLYGTVRGL
TLG
118466831YP_883541.1 dTDP-glucose 4-6-dehydratase [Mycobacterium avium 104]MRLLVTGGAGFIGANFVHSTVREHPEDSVTVLDALTYAGRRESLAGVEDS
IRLVVGDITDAELVSRLVAESDAVVHFAAESHVDNALAGPEPFLHTNVVG
TFTILEAVRRHGVRLHHISTDEVYGDLELDDPNRFTESTPYNPSSPYSAT
KAAADMLVRAWVRSYGVRATISNCSNNYGPYQHVEKFIPRQITNVLTGRR
PKLYGTGANVRDWIHVDDHNSAVRRILESGEIGRTYLISSEGERDNLTVL
RTLLQMMGRDPDDFDHVTDRVGHDLRYAIDPSTLYDELCWAPKHTDFEEG
LRETIDWYRANESWWRPLKDASEARYEERGQ
118466830YP_883323.1 short chain type dehydrogenase/reductase y4lA [Mycobacterium avium 104MGLRGLADKVAVVVGGATGIGAATAARLAGEGCRVVIGDVAVDAARQTAD
RIGAAGGTATQVAFDLADPASVATLIDCAATTYGGVDLLFNVGADMSTIR
ADTDVVDIDFDVWDRVMTVSLRGYVAAMKYAIPRMLDRGGGAIVNMSSAA
AFQGEPARPAYATAKAGIGALTRHVASRWGKDNIRCNAVAPGFTATETIR
SVPQWPELEAAALKRIRGPRVGDPADVAALVAFLLSAEGDWINGQVINID
GGTVLR
118466829YP_881303.1 extracellular solute-binding protein [Mycobacterium avium 104]MTRPRFSTLVAGAVALVAALLAAAAVLLDYSGQPHGDKTIVTVRVWGDEL
AEAYRQSFAAFTRAHPDIEVHVNMVAYSTYFNTLRTDVAGGSADDIFWLS
NAYLAAYADSGRLLNILDTLGTNAAADWERPVVEQFTRHGQLWGVPQLTD
AGIALYYNADLLGAAGIDPAQLNSLRWNPAGGDTLRPLLARLTVDADGNR
GDTRGFDPGRVRQWGYNAANDPQGIYLNYIGSAGGVFQRGDEFAFDNPAA
VSAFRYLVDLINRDHVAPPAADTNDNGDFSRNQFLAGRMALFQSGTYNLA
PVARDARFRWGVAMMPAGPVGRVSVTNGIAAAGNAATKHPGAVRQVLAWM
GSRQGNEYLGRYGAAIPAVTSAQPVYFGYWAARGVDVTPFFAVLNGPRIA
APGGAGFAAGNDALRPYFDEMFSGRGDVATTLRRAQAAANAAAARR
118466828YP_883284.1 hypothetical protein MAV_4135 [Mycobacterium avium 104]MANWQRLNDYEIDDTEEVAAGEVFDGLIPKEVATYYDSFVRNGATVRDSD
ALERLMRQPMSDILEQVQWFKRDDVLELSAEGTLLIARHACAANPVPILD
RITAEEAEIREHCKRGREYKALDGSGKDTSPPEREYELYRKHYRPVHELL
RGWCGHRSVTFCERLTAADAEVRRLNILLAEVIDELRQHNAIHAEGYERE
HNDERIRPETVRPVVDRPLAPWEIPAREVRVRAPRW
118466827YP_880074.1 hypothetical protein MAV_0801 [Mycobacterium avium 104]MSSRELLELLAELPETSRFKEAAERTFRVVEYRGPDPNLKDQLLLIPGYG
KLPKDVAVVGEYVDWTLDRKIAARNVRELVMLRNDGRDTTPDLAGLYEPL
HEVLAQRERQKRADLVAKARAHVHRGAYSYERR
118466826YP_883250.1 S-(hydroxymethyl)glutathione dehydrogenase [Mycobacterium avium 104]MKAVTWHGKRDVRVDSVPDPKIEQPTDAIIEVTSTNICGSDLHLYEILGA
FMKPGDILGHEPMGVVREVGTETGDLRVGDRVVIPFQICCGSCYMCGQQL
YTQCETTQVRDQGMGAALFGYSELYGEVPGGQAELLRVPQAQFTHIKVPV
GPPDSRFVYLSDVLPTAWQAVAYADIPDGGTVAVLGLGPIGDMASRIADH
LGYRVIAVDLVPERLGRAAQRGIHTIDLARLDAGLGDAIRDLTDGRGADS
VIDAVGMEAHGSPAAKLAQQVAGVLPDALGKRLMQTAGVDRLSALYSAID
AVRRGGTISLIGVYGGMADPLPMLTLFDKQVTLRMGQANVKRWVDDIMPL
LTDDDPLGVDDFATHVLPLERAPHAYEIFQKKQDGAVKVILKP
118466825YP_880162.1 hypothetical protein MAV_0899 [Mycobacterium avium 104]MSDPQPPRNEFGVASVLLGLVGLVTCWLLLGVPFGIAAVVTGDIARRRVA
RGEASNPRTAMTGIVLGAVAILAGLVAISYYARMDAQNR
118466824YP_879616.1 transposase- Mutator family protein [Mycobacterium avium 104]MVKRPRITTERNIAMALDQSALLEVLDALRTADAGERITQAAETIYQALI
DAELTAFIGASPHERTETRSNQRNGSRPRTLSTVAGDLELRIPKLRTGSF
FPALLERRRRVDQCLFAVVMEAYLHGTSTRKVDDLVKALGTDTGISKSEV
SRICKDLDTEVAAFRDRPLGDQRFPYVFLDATYCKARVNHRVVSQAVVIA
TGVAADGRREVLGFEVGDSEDGAFWTAFLRSLKSRGLAGVQLVISDAHAG
LRSAIDAVLIGAAWQRCRVHFLRNVLAQVPKGSAEMVAAAIRTVFAQPDA
EHVREQLDTIAGMLGRQFPKVETMLREAAADITAFADFPVAHWKKIWSTN
PLERLNKEIKRRTDVVGVFPNPAALLRLAGSVLVEAHDEWQVADKRYLSE
TSLALLDVSDQSAETIAPTAALTA
118466823YP_881773.1 hypothetical protein MAV_2582 [Mycobacterium avium 104]MTDLGSPQFGLHPLHGVHEPTTGNPPRRPRSARRTTSIDMTRDEGSLDPV
YLSGRARDLWTAGDETATELGSATLSATIELVARVVRHVEVTPAVAAMSR
LAGAPAMSGFRAAADKVAPELLQARDLRYTLLDDVPVATLISGHALSASN
LLGDVAKSGYYLPVADQCAGFATGGLLMTSFEAGDPVIVTGPPAPDLDHD
GDPWAWHAMSPLPIHGMRRRRRIDVHQGESPSRVGIDAMFRDTYVRSDGV
ETIIHEYTLDAVVDTETGVIVDSRATPRVLPWQECPGAVASAARITGMTL
QELHFRVRRELHGTSTCTHLNDLLRSMADAEALIHLVTEA
118466822YP_882683.1 SAM-dependent methyltransferase [Mycobacterium avium 104]MAANELRTGSEPPLPGSHRADEAVAGHWLLARLGKRVLRPGGVELTRTLL
SHAQLTGADVVELAPGLGRTATEIVARAPRSYVGAEADPDAANVVRGVLG
DLGAHNAAVRVADAADTGLPDASGDVVIGEAMLTMQGDAAKRAIVAEAAR
VLRPGGRYAIHELALTPDTVSAEVSTDIRRALARAIKVNARPLTVAEWSA
LLAEHGLVVDHVATAPMALLQPRRLVSDEGLFGALRFARNVLVHRDARKR
VLTMRRTFRKHRRQLAAVAIVAHKPTASQTG
118466821YP_883460.1 oxidoreductase- FAD/FMN-binding superfamily protein [Mycobacterium aviMPTPPDVFSPAKLGPITLRNRIIKSATFEARTPDALVTDDLIEYHRLPAA
GGVGMTTVAYCAVSPGGRTEGNGIWMRPEAVPGFRRLTDAIHAEGAAVSA
QIGHAGPVANARSNKAHALAPVRFFNPIGMRFAKKATREDIDEVIAAHAN
AARLAIEAGFDAVEIHLGHNYLASSFLSPLINRRNDEFGGSLQNRAKVAR
GMVMAVRRAVEKEGTPIAVTAKLNMADGVRGGISTEESLTTAKWLESDGG
LDAIELTAGSSLVNPMYLFRGDAPLKEFAGAFKPPLRWGMRMTGKKFLRE
YPYREAYLLRDAKLFRAELKMPLILLGGITNRETMDLAMAEGFEFVAMAR
ALLAEPDLINRIAADGAAHRVHSACTHCNQCMPTIYSRTHCVVTGAPDRH
TSAAT
118466820YP_881158.1 enoyl-CoA hydratase/isomerase [Mycobacterium avium 104]MLSDLTDGIMTITLNRPDAANAVRPDDRDTLIALLEAADADEKVRVVVLR
ANGKHFCSGADVTALADRRGRGEKRVLEPTRRIMNGAQKLVASVLDCNKP
VIAAVHGAATGLGAHIVYASDLVIATENAYFAESFVKRGLVVDGGGCYLL
PRRIGMQKAKEMAFFGERLSAAEALALGLVNRVVGADEFDAAVADFAGRL
AQAPTSAIAFTKRLLNDSPDTDRSGAFVAEAMAQEIQSYAHDSKEGVQAF
VEKRPTEFTGW
118466819YP_881499.1 hypothetical protein MAV_2295 [Mycobacterium avium 104]MGSAARRRRADPVRLSVGCELGRAIDGAWWPRADRITNELPELVAVLTPL
LGQIGAINVNWPPLQRPPDFNWPGWERKRQHVMTLIGGDARINLLIIPYA
TYSALARMVLRCAAGLPVEPRDRGKPAFLTAGSILRAAEQQRVDSAP
118466818YP_879695.1 integral membrane protein [Mycobacterium avium 104]MDVDAFVLAHRPTWDRLDRLVGRRRSLSGAEIDELVELYQRVSTHLSMLR
SASSDSMLVGRLSSLVARARSAVTAAHAPLSSTFVRFWTVSFPVVAYRSW
RWWVATGAAFFAVVVIVALWVAGNPEVQSALGTPSDIDQLVNHDVESYYS
EHPAAAFALQIWVNNSWVSAQCIALSVVLGLPIPLVLFENAANLGVIAGL
MFPAGKGGLLLGLLAPHGLLELTAVFLAGATGMRLGWSVISPGDRPRGQV
LAEQGRAVVSVAVGLVAVLLVSGLIEALVTPSPLPTFVRVGIGVVAEAAF
LCYIGYFGRRGVKAGESGDIEEAPDVVPTG
118466817YP_882060.1 long-chain-fatty-acid--[acyl-carrier-protein] ligase [Mycobacterium avMSELAAALTAAMRTGGSDLVVFDRESAAWRRHRWPEVHGLAEGIAAWLLD
RDRPAALGLVGEPTLEFVAAIVGAWLAGAGVSILPGPVRGAEGRRWADTT
LTRFAGIGVRTVLSHGSHLDALQALDPSRPDEMVVEDLAVAANTGRRCPE
PPAPHANPAILQGTAGSTGTPKTAALSPDAVLANLRGLNARLGVTPADVG
CSWLPLYHDMGLSFLLASALGGMSLWLAPTSAFTASPFRWLAWLSESRAT
ITAAPNFAYNLVGKYARRVSGVDLGALRVAINGGEPVDCAGFERFATAMA
PFGFDAGAATPSYGLAESTCAVSVPAPGTGLRFADVSDETGTRRHAVLGA
PIPGTEIRISPRHDVPDGIGEIEIRGASMMDGYLGHAPIDHQNWFPTGDL
GFFSDGGLVVCGRAKELITLAGRNIFPTEIETVAAQVPGVREGAVVALGT
GENSARPGLIIAAEFAGRDRAGARAEVIQRVASVCGVVPSDVIFMAPGSL
PRTSSGKLRRLDVRRSLEAVD
118466816YP_879488.1 AraC family transcriptional regulator [Mycobacterium avium 104]MSEIGQHGLATSAQTLPPGARIARHRHPLHQIVYPSTGAVSVTTPAGTWI
TPANRAIWIPAGCWHEHKFHGHTNFHGVALDPARYRRGPAAPAVLAVTPL
MRELIIACSRARDTDAGAHHRMLAVLHDQLQATSVAEPLWIPTAVDGRLR
AACALIADNLREPLTLRQIGERIGVGQRTLSRLFRDELAMTFPQWRTQVR
LQHALVLLAERRDVTSVAAECGWATPSAFIDTYRRAFGHTPGRLAPRPS
118466815YP_884420.1 inner membrane protein translocase component YidC [Mycobacterium aviumMFDFFSLDFVYYPVSWIMWVWYKLFAAMLGPSNFFAWALSVMFLVFTLRA
LLYKPFVRQIRTTRQMQELQPQIKALQKKYGKDRQRMALEMQKLQREHGF
NPILGCLPMLAQIPVFLGLYHVLRSFNRTTGGFGQPHLSVVQNRLTGNYV
FTPTDVGHFLDANLFGAPIGAFMTQRTGLDAFTYFSRPAVIAVGLPVMIL
AGVATYFNSRASVARQSPEAAANPQTAMMNKLALYVFPLGVVVGGPFLPL
AIILYWFANNIWTFGQQHYVFGMIEKEDEAKKQEAIQRRAANAPAPGAKP
KRNLKAGAGNGVDADAAQSDAGATEGQAGGGSDAPSRTPRPGARPKKRKR
118466814YP_884038.1 MaoC like domain-containing protein [Mycobacterium avium 104]MMNQPSGLKNMLCAAAGALPVVSRGSALPTRTVTVEDLPIDRTNVAEYAA
VTGLRYRNHVPLTYPFALTFPALMSLVTGFDFPFAAMGSVHTENHITQYR
PIAVTDTVGVRVHAENLREHRKGLLVDLVTDVSVGNDTAWHQVTTFLHQQ
RTSLSDQPKPPPQKQPKLPPPPTVLRITPGLIRRYAVVGGDHNPIHTNPI
AAKLFGFPTVIAHGMFSAAAVLANIEAAIPDAVRYSVRFGKPVVLPATTG
LYIDEHDGGWDIALRNIAKGYPHLTGTVRAL
118466813YP_882365.1 inositol monophosphatase [Mycobacterium avium 104]MDLDALVARASAILDDASKPFLAGHRADSAVRKKGNDFATDVDLAIERQV
VAALVDATGIGVHGEEFGGSAVDSEWVWVLDPVDGTFNYAAGSPMAGILL
ALLHHGDPVAGLTWLPFLDQRYTAVTGGPLRKNEIPRPPLTSIDLADALV
GAGSFSADARGRFPGRYRMAVLENLSRVSSRLRMHGSTGLDLAYVADGIL
GAAVSFGGHVWDHAAGVALVRAAGGVVTDLAGRPWTPASDSALAAGPGAH
AEILDILGNIGRPEDY
118466812YP_879977.1 DNA-binding response regulator PhoP [Mycobacterium avium 104]MTSATPTDAKPEARVLVVDDEANIVELLSVSLKFQGFEVHTATNGAQALD
RAREARPDAVILDVMMPGMDGFGVLRRLRADGIDAPALFLTARDSLQDKI
AGLTLGGDDYVTKPFSLEEVVARLRVILRRAGKGGAEPRSARLTFADIEL
DEETHEVWKAGQPVSLSPTEFTLLRYFVINAGTVLSKPKILDHVWRYDFG
GDVNVVESYVSYLRRKIDTGEKRLLHTLRGVGYVLREPR
118466811YP_884388.1 phosphotransferase enzyme family protein [Mycobacterium avium 104]MKNPVGQAFSFLGLAAHLGRGAGRVSVDAVLGGRFGLPRTVDEIDPAVLS
RVMGTTVRTVRVLSRDAGTSSRARLVLTGKDVPDSVFVKVAAQTAATRLM
GELGRLGCTEVRFYRQLAPQVVGVPYCYGAAFDAWTGRYLLVLEDLPAEA
CEFPDTLHPLSADQAGLVVELLADLHATFWNRLPRDGRGPLGWLYTPSGD
VTSLLTGSLMHSSIKRLAERTSIPVRDGVFIADNYRAVAALIDTAPHTVM
HGDAHPGNMYFHGGKAGLLDWQAVRRGHPSRELAYTLITSLTPEDRRATQ
RDLLDDYRRALAAAGGPQLDRDELWLRFRQAALYAYAAPLITAGMGGMQV
EDIAMEGLRRGVAALEDLETVAALKSSL
118466810YP_882814.1 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase [MyMVGRANIANLANTLTLLRLVLVPVFLLALFAGDGHETGFRILAFLIFAFA
CITDRLDGLLARNYGMATEFGAFVDPIADKTLVGSALIGLSMLGELPWWI
TVLILAREFGVTVLRLAVIRRGVIPASWGGKLKTVVQVFAIGLFVLPWAG
TPGPFRVGAAVVMGAAIVLTVITGIDYVVSTVREVRRTAA
118466809YP_881309.1 hypothetical protein MAV_2094 [Mycobacterium avium 104]MTTGTRSQLRVPAVWVAGVALGASMLGAAVLSAPQASATCNLSDKDDQYI
NLLAQNKMVHNADYSDCHEAAEGRWFADQVRSNPNSFGEAQELVNMITNT
TPLSQAQAEWEVESAIYVYAPDLIPKIKDQASKANWPTEG
118466808YP_884245.1 acyl-CoA dehydrogenase middle domain-containing protein [MycobacteriumMDFSRVELSTQDAAFQESTRAFLAEHVTDEVRRRDRETGENFSEPVHVAL
GEAGYLESDWKLESEGGFDPVRRRIFQLEIGRAHTPWFHWGTTAVVARLV
KQFGAPELADAILPGVLSGKIRLCLGYTEPEGGSDVATCKTRAVRDGSGW
IINGSKMFTSNAQNAEYVFLLTNTDPRRPKHKNLTMFLVPLDSPGIEIQG
IRTVDGDRTNIVYYSDVRVDDLYRIGEVNGGWTVMRFALDAEHGITDPQD
HGLQNISMLSEHGHLMAEAADGVAAILARPDAAGRRPIDDESVKYRLGRG
MARIEAAMSTPGMYGRVALIQTMREVSQELMDLLGTASALPTDTPGSPDD
GAIEFIFRHAVPAGIYGGTMEVFRNMIAQHELGLGRPSYGR
118466807YP_882212.1 hypothetical protein MAV_3026 [Mycobacterium avium 104]MADGAVFVIDRVVTRPGCARRFVDTYLAEYAPGARERGMTLHDVLVSPPI
WFDASEGQVNTVTITWTLPNVRAWWEMTWQGRPDPAVGEWWSRIGELVAE
RSRSFAARAADVDVLCDV
118466806YP_881064.1 cytochrome P450 superfamily protein [Mycobacterium avium 104]MTETRTEAQARAKVDLDHHSPEFREDPYGKFREMRESGCPVAHSDHYEGF
WALVDYASVFEAARDDDLFNSFPSVGVPASELPLPILPIESDPPETQQLR
EVTLKRFSPGSAERFRDAAIEMTNEAIDAFIERGECDLVTELTTPLPARL
ILRLLKFDESRHMDWVHWVHSTVHDRAHDPERAGAAGMEMFGEIVKHMEE
RRAEGLGDDLFSDILRGTLNGKPLDDGQITMYTVLMMLGGMDTTSGFTGN
VLLRLCQDLELRQQFIDDPSLVKKGTDELLRLYTPTLGLARTVSRDAEFH
GQRLCKGDRAILMWAAANRDPAMFEDPDTLDLSRPNAKKQMAFGVGMHRC
LGSHYAKMMFDVMLTQVLKRLPDFELAGEPELFEDAGEVYAVRKLPVKFT
PGPRVG
118466805YP_884354.1 short chain dehydrogenase [Mycobacterium avium 104]MSVITGGAGGMGVATAKVVGRDHTLVLCDVRQDRLTAATAALAELGMTPT
AVNCDVTDRRAVAQLFDTAAGLGTVVSVIHTAGVSPSMGPADYVMRTNAI
GTLNVNEAFYAVAGDGSVIVNVASMAAHMLPAEIVPTAQFPLALSDADAF
MDAMLAACEIAPEQARSGLAYAVSKSFVKWYSQSQAERFNARGLRIVSVS
PGSIDTEMGRLEENAGAGAMVADAAVPRWGKPEEMAELLAFCASDKAGYL
TGTDILNDGGVIASMTERARVTAAG
118466804YP_880405.1 arsenate reductase [Mycobacterium avium 104]MAQGATIYHNPRCSTSRKTLELLRDNGFEPSIVEYLKTPPSRAELVKMIR
DAGIDVRTAVRKRESLYDELNLAEASDEQLLDAMIEHPILIERPFVVTPK
GTRLARPIDAVREIL
118466803YP_883207.1 hypothetical protein MAV_4055 [Mycobacterium avium 104]MGVFLSSEQARQRIGAALDAIDAAHDVLRRTSSDLVGTGFRIDVAERLET
QDRTNRGLMYRFFGEIADPPDEAGSLPVARSMLWARLRVSPGELRRRFAL
AARIRPRRSLTGPPLDPELPALAAAVASGAVGEDHIRAVCAAVDALPCAV
PRSAASDAERTLVRHAAKLDAAVITKLGRRIADYLNPDGEFSDVDRARRR
GLHLGPQGVDGMSRLSGLLDPETRAYFEAVASAVRPGRHQPEGGGDPRAR
DERTPSQRCHDALKLGLEVAIASGGLGVHRGHPVTVIASTTLAELDQAAR
AVADPSIPMPAPALTGGGSRLPMPDLIRMATKAIHYLAVFDEHTGRPLYL
GRQKRVATADQRLICYARDRGCTRPNCLEPGYHCEVHHAPDWADGGRTDA
DKLFFACGPDHGAVSRGEWRTSVGDDGRLAWTDGNGPPQTNRAHHPDELL
RGDPDPPEND
118466802YP_880272.1 hypothetical protein MAV_1013 [Mycobacterium avium 104]MVRRWRRNMEVRDDTDYVNMLATLSEGSVRRNFNPYTDIDWDSPEFAVTE
DDPRWILPATDPLGRHPWYLAQSDERKIKIGMWRQANVAKVGLHFESILI
RGLMNYTFWVPNGSPEYRYCLHESVEECNHTMMFQEMVNRVGADVPGMPR
LLKWISPLIPLVAGPLPVAFFIGVLAGEEPIDHTQKNVLREGKSLHPIME
RVMAIHVAEEARHISFAHEFLRKRLPHLTKRQRFWVSLYYPLTMRLLCNA
ITVPPKQFWREFDIPREVKKELFFRSPESRKWLSDMFADVRMLAHDTGLM
ENRSARLMWRLCKINGKPSRYRSEPQRQHLAAVPAA
118466801YP_882250.1 segregation and condensation protein B [Mycobacterium avium 104]MSENAPDVDLDSELEAGIPEIAEAAPMESGELGSVLEALLLVVDTPVTAE
ALAAATQQPVYRIATKLQEMADELTARDSGIDLRKTSEGWRMYTRARFAP
YVEKLLLDGARSKLTRAALETLAVVAYRQPVTRARVSAVRGVNVDAVMRT
LLARGLITEAGVDEDTGATTFATTDLFLERLGLTSLADLPDIAPLLPDVD
TIEDLSESLDSEPRFVKLSGGQASDAALSFDVDQD
118466800YP_881517.1 hypothetical protein MAV_2312 [Mycobacterium avium 104]MFGHTPYRIDIDVYQMGARAWMDGRPLYRGDVLFHTPIVDLPFTYPPLAA
IVFCPFAWMHMPTASVAITALTLVLLVVSTVIVLARLDVWSTSALLPGPA
WLRRWWLAVVVAAAATIWLEPISSNFAFGQINVVLMTLVIADCLPRRTPW
PRGLLLGLGMALKLTPAVFLLYFLLRRDHRAVLTALASFAGATLLGFVLA
YTDSWEYWTHTVHHTDRIGSASLNTDQNIAGALARLGLAQQPRSLLWVAA
SLLVLAVTVWAMRRVLRADEPTLALVCVALFGLVVSPVSWSHHWVWVLPT
VLVTGVLGWRRRNAALLVLSVVGVALMRWTPIDLLPKHHEASAVWWRQLA
GMSYVWWALAVIVAAGVTVTARAASRDAAPQQLTPVTAIG
118466799YP_880038.1 hypothetical protein MAV_0763 [Mycobacterium avium 104]MRPPQSCRRSLKPRPAGYCNALIAVTSRCLTLSGSGM
118466798YP_880031.1 thiosulfate sulfurtransferase [Mycobacterium avium 104]MARSDVLVSTDWAESNLDTPGVVFVEVDEDTSAYHAGHIPGAIKLDWRSD
LQDPVKRDFVDAQQFSKLLSERGIANDDTVILYGGNNNWFAAYAYWYFKL
YGHEKVKLLDGGRKKWELDGRTLSSDPVSRPATSYTAAAPDNSIRAFRDE
VIAAINVKNLVDVRSPDEFSGKILAPAHLPQEQSQRPGHIPGAINVPWSK
AANEDGTFKSDEELAALYAAAGLDTGKETIAYCRIGERSSHTWFVLYELL
GHRNVKNYDGSWTEYGSLVGAPIELGS
118466797YP_883339.1 hypothetical protein MAV_4194 [Mycobacterium avium 104]MATVYIPATLAMLQRLVADGSLAAVNGTAFALTPALREAYAEGDDDELAE
VALREAALASLRLLAGAEHEAEHGALPPRRAVLAADVDDLTYRPDLDDAV
VRLAGPVRIEDVIAAYVDNAAAEPAVAKAIEAVDAADLGDEDADLIVGDA
QDHDLAWYASQELPFLLELL
118466796YP_881576.1 hypothetical protein MAV_2375 [Mycobacterium avium 104]MARSNLGDLDTYLWHRQGSNQFCWRPVGKPWGGRKKADDAD
118466795YP_880459.1 hypothetical protein MAV_1213 [Mycobacterium avium 104]MSTVSGVSGVTVRPLYDSTDSLLRFAVRADATLTGLCGLAVAVAADPLSS
LTGLTSFQEYIGGAFFVLYGLVVFSLGALPDLRRAGISIVAANAVFTLAA
IVAAGVLPLTGAGVALTLASAAYTAAFAAVQYAGVRRLETA
118466794YP_884366.1 TetR family transcriptional regulator [Mycobacterium avium 104]MESKRRTQEERSAATRDALIAAARKLWGLRGYTEVGTPEIAAAAGVTRGA
MYHQFADKAALFRAVVEAVEQDVMARMAVVVAESGASTPTDAIRAAVDAW
LEVSADPEVRQLILLDAPSVLGWAEFRDVAQRYSLGMTEQLLTEAIRAGE
LAEQPVRPLAHVLIGALDEAAMVIATADDPDRARRETRQVLQRLVDGMFD
AR
118466793YP_883728.1 phosphate transporter [Mycobacterium avium 104]MNIQLFLLIIVVITALAFDFTNGFHDTGNAMATSIASGALKPKTAVALSA
VLNLVGAFMSTAVAATIAKGLIDSNIVTLELVFAGLVGGVVWNLLTWLLG
IPSSSSHALIGGIVGATIAAVGAHGVIWKGVISKAIIPAIVSAILAILVG
AVATWLVYRITRGVPKKRTEAGFRRGQIGSASLVSLAHGTNDAQKTMGII
FLALISYGSVSKTAAMPPLWVIVSCALAMATGTYLGGWRIIRTLGKGLVE
IQSPQGMAAESSSAAVILLSAHFGYALSTTQVCTGSVLGSGLGKPGGEVR
WGVAGRMGVAWLVTLPLAGLVGAVTYWIVHLIGGYPGAIIGFALLVAVSA
TIYLRSRKVKVDHHNVNAEWKGDLTTGLEGADDHSPPPDAGPPFGGPGDR
YQSDDPTLKASAS
118466792YP_879789.1 TrbB protein [Mycobacterium avium 104]MLLHVERNRAGRRRLSEIAVLQRVQERVRSVTVWHADRGMTEAAPLLRRV
LEDRMPS
118466791YP_882549.1 LprG protein [Mycobacterium avium 104]MQTRRRLSAVFASLTLATALIAGCSSGSKQSGAPLPDPTSLVKQSADATK
NVKSVHLVLSIQGKISGLPIKTLTGDLTTTPATAAKGNATITLGGSDIDA
NFVVVDGTLYATLTPNKWSDFGKASDIYDVSVLLNPDNGLGNALANFSNA
KAEGRETINGQSTIRISGNVSADAVNKIMPQFNATQPVPSTVWVQETGDH
QLVQANLQKSSGNSVQVTLSNWGEQVQVTKPPVSS
118466790YP_880432.1 long-chain-fatty-acid--CoA ligase [Mycobacterium avium 104]MDGTMQDFPLTITAIMRHGCSVHGARTVTTATGDGYRRTSYRELGDRAAQ
LANALRGLGVTGDQRVATFMWNNAEHLAAYLAVPSMGAVLHTLNIRLFPE
QIAYVANEAGDQVVLVDASLVKLLAPVLPGLHTVHTVIVVGDGDTEPLRA
SGKTVLRYADVIGAEPAEFDWPRIDENSAAAMCYTSGTTGNPKGVVYSHR
SSFLHTMAACTANGIGIGATDSLLPIVPMFHANAWGLPYAALMAGADLVL
PDCHLDPRSLVRMVEDLRPTVTGAVPTIWNAVLHHLEDDPDHDMSSLRLV
VCGGSAVPVSLMRTFEEKHGVQIRQLWGMTETSPLATMAWPPPGTPEDQH
WAYRGTQGQPVCGVQMRIVDDDGRVLPNDGTAVGEVEVRGPWIAGSYYLG
RDDSKFDSGWLRTGDVGRIDERGFVTLTDRAKDVIKSGGEWISSVELENC
LIGHPDVVEAAVVGVPDERWEERPLAVVVVKDGASVDADQLRKFLADKVV
RWWLPERWTFVDEIPRTSVGKYDKKAVRSRYADGGYRVIEARD
118466789YP_880412.1 phosphopyruvate hydratase [Mycobacterium avium 104]MPIIEQVGAREILDSRGNPTVEVEIALTDGTFARAAVPSGASTGEHEAVE
LRDGGERYGGKGVQKAVQAVLDEIGPAVIGLNADDQRLVDQALVDLDGTP
DKSRLGGNAILGVSLAVAKAAADSAELPLFRYLGGPNAHILPVPMMNILN
GGAHADTAVDIQEFMVAPIGAPSFAEALRWGAEVYHSLKSVLKKEGLSTG
LGDEGGFAPDVAGTTAALDLIGRAIESAGFKLGTDVALALDAAATEFYSD
GTGYKFEGSTRTAEQMAEFYAGLLGAYPLVSIEDPLSEDDWDGWAALTAS
IGDRVQLVGDDVFVTNPERLEEGIEKGVANALLVKVNQIGTLTETLDAVA
LAHHSGYRTMMSHRSGETEDTTIADLAVAVGSGQIKTGAPARSERVAKYN
QLLRIEEALGDAARYAGDLAFPRFALETR
118466788YP_883211.1 hypothetical protein MAV_4060 [Mycobacterium avium 104]MLGPLDEYPVHQIPQPIAWPGSSDRNFYDRSYFNAHDRTGNIFVISGIGY
YPNLGVKDAFFLVRRGDTQTAVHLCDAIDQDRLNQHVNGYRIEVKEPLRK
LRLVLDETEGVAADLTWEGLFDVVQEQPHILRSGNRVTLDAQRFAQLGSW
SGRIVIDGQEIAVDPATWIGSRDRSWGIRPIGEPEPAGRPADPPFEGMWW
LYVPMAFDDFAIVLIIQEQPDGFRSLNDCTRIWRDGRVEQLGWPRVKIHY
RSGTRIPTGATIDASAPDGTPVHFDVESKLPVPIHVGGGYGGDSDWLHGM
WKGEKFTERLTYDMTDPAIIARSGFGVIDHVGRAICRDGDKAPVEGWGLY
EHGALGRHDPSGFSDWLTVAP
118466787YP_879465.1 hypothetical protein MAV_0171 [Mycobacterium avium 104]MDPVVALRQIAYYKDRSRHDPRRVMAYRNAADVIEGLDEATRERHGQANS
WQSLPGIGPKTAKVIAQAWSGREPDMLVELRSAAEDLGGGDIRSALRGDL
HVHSNWSDGSAPIEEMMAAAAALGHEYCALTDHSPRLTIANGLSPERLRK
QLDVIDRLQDTVAPMRILTGIEVDILEDGGLDQEPELLERLDVVVASVHS
KLSMDSAAMTRRMLRAVQNPHADVLGHCTGRLVSGNRGIRPESKFDAEAV
FTACREHGTAVEINSRPERRDPPTRLLNLALEMGCVFSIDTDAHAPGQLE
FLGYGAQRALDAGVPVDRIVNTWPAERLLEWTAG
118466786YP_879857.1 LuxR family transcriptional regulator [Mycobacterium avium 104]MIGGELLIGRDSELAAIRRALNGADHHRGVVIAGAAGVGKTWLARAALRR
AGASGEQIKWIVGTQSAQALPLGAFIGLLGDAMSEPLTSVRRVIETFVAR
QRRGRVVVGVDDAHLLDGLSALVVHQLAQSGGVRLVVTVRTGSHQPDAVT
ALWKDDLLTRLDLEPLSAAATREVIESTLGGPVDARCAARFRRLTGGNTL
FLRQLLSDQMAAGRMRRVAGVWMWDGDVAVSASLSDTVGRQLGRLTPPLA
LVVDTLSQCEPLPVDLLCDLASREDLVAAEAMGLVTVERTPRALMARLAH
PLFGELRRAGAGEMYLSTIRGRLATRLAQDQDADMQATVRRALLTLESDL
DPQPELYLESARHAMTLLDLDLADRLANAAARAGAPGAAGVRAMNLVLLG
RGEQAEEALRAITDGADGDASDRHYWATVRAANLVWMLGRPADAALVLDG
LAARPETPAQAAARCAVQACLDAVAARCQLAAERARAALDSESLPDFHAM
MASLALIMAMGALGQVDDLTAVAEQALRRATTSFEASHMRFWFGAVYGRA
CRLTGRIDEFVSTARRLADSARDVPGLAYANLALLLGNAELARGAAAEAA
RLVQEALAGAQIHEVTSGLRPASYFALAEAHGRLGHPAQANEAIAGARSC
VPPDFLFMHTGLALATGWALAAGGQLREAVATAQAAARLARDRGQPTHEL
ACIQAAAQWGDAAGAVRARALADALSLPLADAIACHAEALRAGNGEALLT
VAAAYRAIGDAAAAADAAAQASAAFVEGQQHQRGRYAAALAGELAEECGG
LCTPALRTPAGLKLSGRQRDVIELAVAGLSNRQIAERLVMSVRTVEGHIY
RACQRVGAQSRDELATIIRSRPAGRES
118466785YP_882393.1 malto-oligosyltrehalose synthase [Mycobacterium avium 104]MGLPVLSSYRLQLRGESSGFAFTFADAEHLLDYLDDLGVTHLYLSPIMTA
TAGSSHGYDVTDPTTVSAELGGRDGLARLSVAARARGMGLVVDIVPNHVG
IDAPRQNPWWWDVLRNGHSSPYATFFDVDWDLDEDGRIVLPVLGSDDDAA
DLTVDGELLRLGDLAFPIAPGTAGGTGPEVHDRQHYRLVGWRNGVCGYRR
FFSITSLAGLRQEDPAVFDATHAEVGRWFAEGLVDGVRIDHPDGLSDPCG
YLARLRELVGPDAWIVIEKILAVDEALEPTLPVAGTTGYDVLREIGGVLL
DPNGAPALTALVDSSGVDYQAMPKMLAELKIHAATVTLASELGRLRRSIA
AAAGVDHPLLPEAIAALLTNIGVYRCDYPGLVALLPTALAETQSAAPHLG
PALQVLAAALARGGEPATRLQQLCGAVTAKAVEDCLFYRDARLVSLNEVG
GEPHRFGVGAAEFHHSAATRARLWPHTMTTLTTHDTKRGEDVRARIGVLS
QVPSLWTEFVARWEVAAPSPDPATGQFLWQNIFGVWPVTGEVTAALRERL
HGYAEKAIREAAWHTSWNDPDAAFEEAVHRWLDTVLDGPVAGQLTELVAQ
LNPHASSDALAQKLLALTVPGIPDVYQGTELWDDSLVDPDNRRPVDYRAR
RAALQALEHPKIRVVTTALRVRRAHPDTFLHGDYAPLLADGDACDHVLAF
TRGADIVVAVTRWTVRLAEKGWGNTVLPLPDGTWKDALTGSVVDGPTSAA
QLFAELPVVLLERHHD
118466784YP_881966.1 hypothetical protein MAV_2778 [Mycobacterium avium 104]MPGRKFSFEVTRTSSAPAATLFRLVADGANWSRWAKPIVLHSSWARQGDP
APGGVGAIRKVGLWPVLVQEETTEYEPDRRHAYKLVGPPSPAKDYTGEVV
FTPNPAGGTDIRWTGSFTEGVRGTGPLMRAAMGGAVKFFAGRLVKAAERE
AGQAR
118466783YP_881641.1 hypothetical protein MAV_2448 [Mycobacterium avium 104]MGRRRQYCRQSCRQRAYEQRSSLNRHGAAAVPEDAVVLSADDAADLSDRV
YQVRCAAEDVATAVDEGAGPAELRQLCDALIQAARAADGWRRAGV
118466782YP_881251.1 amidase [Mycobacterium avium 104]MGRSLHAIHASQPTLNAFRVVLTESALADAAEADRRRAAGDTAPLLGIPI
AVKDDVDIAGVPTAFGTEGSVPPATHDAEVVRRLKAAGAVIVGKTNTCEL
GQWPFTSGPGFGHTRNPWSRRHTPGGSSGGSAAAVAAGLVTAAIGSDGAG
SIRIPAAWTHLVGIKPQRGRISTWPLPEAFNGITVNGVLARTVADAALVL
DAASGNVDGDRHKPPPITASDYVGKAPGPLNIALSTRFPYTGFRPKLHPE
ILAATRAVGKQLELLGHTVVPGNPDYGMRLSWDFLARSTAGLRDWEERLG
DGVVLDPRTVANLRLGHLLGQAILRSARRHEAADQRRVGSIFDIVDVVLA
PTTAQPPPLARAFDRLSGFGTDRAMIAACPLTFPWNVLGWPSINVPAGFT
SDGLPIGVQLMGPANSEGMLISLAAELEAVSGWASKQPQPWWDQSADTPP
APGQPAPTG
118466781YP_882391.1 acyltransferase domain-containing protein [Mycobacterium avium 104]MQTPSPSPAPVAAADPGTSGARTPGSRGFYRYDLDGLRGIAIALVAVFHI
WFGRVSGGVDVFLALSGFFFGGKVIRAALNPAVALSPVAEVIRLVRRLVP
ALVVVLAGCAVLTILVQPETRWETFADQSLASLGYYQNWELANTASDYLR
AGEAVSPLQHIWSMSVQGQFYVSFLVLIAGLAYLFGRPLGARLRTLVLVV
LAALTVASFGYAIVAHQQNQAAAYYDSFARGWELLLGALVGALVPRIRWP
MWLRTLLATVALGAVLSCGALIDGVQEFPGPWALVPVGAAMLMILVGANL
AGDRLPLPNRLLATRPLVELGAIAYSLYLWHWPLLIFWLSYSGHKHAGFV
EGTVLLLVSGVLAYLTNRLVEDPLRHRGSARPAPRPAAPTVPWLARVPRP
TMALGSAIVLLGVTLTATSFTWRQHVTVLRSAGKELSVLNPQDYPGARAL
TEHVRVPTLPMRPTVLEVKQDLPASTRDGCISDFVNPAVVNCTYGDVTAD
RTIALAGGSHAEHWLPALDMLGKLHHFKVVTYLKMGCPLSTEQVPLIMGN
NAPYPQCREWVQRTMTKLVTDRPDYVFTTTTRPWNIKTGDVMPATYIGIW
QTLSDNNIPILGMRDTPWLVKNGQPFDPADCLAKRGSTAQSCAIKRSDVL
SERNQTLDFVGQFPQLKVLDMSDAICRADMCRPVEGNVLIYHGAHHMSPT
YVRTMAPELGRQIAESTGWW
118466780YP_882163.1 hypothetical protein MAV_2977 [Mycobacterium avium 104]MAVIRKFCHQLPGWIDQATRERAEADLANQGTRYRPEQLAALAGTLADCL
NPDGLYRDEDRARRRSLTLDNQHADGMSELRGWLTPELRATLEAVLAKLA
APGMCNPLDENPCVDGTPTEQAIEGDTRSAAQRNHDGLLAGLRALLASGN
LGQHNGLPASIIVTTTLADLETAAGRGLTGGGTLLPMSDVIRLSRHAHHY
LAIFDHGKALALYHTKRLASPAQRIVLYAKDRGCTAPGCTIPGYYAEVHH
CTDYATCHTTNINDLTFACGPHHRLLQPGAWTTHKNAKGETEWIPPPHLD
RNQPRTNTFHHPEKLLQGEEDGDEDEDEP
118466779YP_881429.1 transposase- Mutator family protein [Mycobacterium avium 104]MLTVVHDQDSSNEDACGSRSLLDEIVRDGARQMLAAALAAEVAAYIDAHA
GEVDENGHRLVVRNGYHREREVLTAAGAVTVIAPRVNDKRIDADTAERRR
FSSAILPAWARKSPQMTEVLPLLYLHGLSTSDFGPALEQFLGSGAGLSAT
TITRLTAQWQDEAKAFGERDLSGTDYVYLWVDGIHLKVRLEQEKLCLLVM
IGVRSDGRKELVGLADGYRESTESWADLLRSCRRRGMTAPVLAVGDGALG
FWKAMREVFPATREQRCWFHKQANVLSCLPKSAHPGALAAMREIYNAEDI
DHAQVAIKAFEVDYGAKYPKAVAKIVDDADVLLEFYRYPAEHWIHLRTTN
PIESTFATVRLRTKVTKGPGSRAAGIAMAYKLIDAAQARWRAVNAPHLVA
LVRAGAVFHKGKLLERPVDITPPEPAESAETEVA
118466778YP_881393.1 hypothetical protein MAV_2185 [Mycobacterium avium 104]MEPKEQEMRASNQFADVTTGVVYVHASPAAVCPHVEWALSSTLGAKANLT
WTPQPAMPGQLRAVTNWVGPVGTGAKLANALRSWSVLRFEVTEDPSPGVD
GHRFSHTPQLGLWSGAMSANGDIMVGEMRLRAMMAQGADTLAAELDSVLG
TAWDEALEAFRDGGDAGEVTWLSRGVG
118466777YP_879930.1 acyl-CoA synthetase [Mycobacterium avium 104]MELSDDLTVTELLVPLTEIDDRGVYFEDSFTSWRDHLQHGAAIAAALRAR
LDPARPPHVGVLLENTPFFSAVLVAAGMSGIVPVGLNPVRRGDALRRDIA
RADCQLVLADANSAGTLGDIEHLNVDSAAWADEVAAHRGAPIVFRSASPA
DLFMLIFTSGTSGEPKAVKCSHGKAAIAGVTMTQRFGLGRDDVCYVSMPL
FHSNAVLVGWAVAAACQGSMALRRKFSASGFLPDVRRYGATYANYVGKPL
SYVLATPERPDDAQNPLRAVYGNEGVPADIERFARRFGCVVQDGFGSTEG
GVAIARTPDTPPGSLGPLPAGIDIVDPDTGASCPPGVVGELVNTAGPGRF
EGYYNDEAAEAERMAGGVYHSGDLAYRDEAGYAYFAGRLGDWMRVDGENL
GAAPIERVLLRHPDVTEVAVYPVPDPTVGDQVMAALVLAPGAEFDDEKFR
AFLAEQPDLGPKQWPSYVRISTELPRTVTFKVLKRQLAAQGVDCGDPVWK
IGR
118466776YP_882940.1 N-acyl-D-glutamate amidohydrolase [Mycobacterium avium 104]MPYDVIIRDGLWFDGTGGAALTRTLGIRDGVLVDVAESLDEAGCPEVIDA
AGKWVLPGFIDVHTHYDAEVLLDPGLRESVRHGVTTVLLGNCSLSTVYAD
SQDAADLFSRVEAVPREYVYGALSSNRTWSTAADYVKAVDALPLGPNVGS
LLGHSDLRAAVLGLDRATDATVRPTDAELEKMAALLDEALDAGLLGMSGM
DAAIDKLDGERFRSRALPSTFATWRERRKLIEVLRRRGRILQSAPDLDNP
ALALMFFLTSSRIFGRGRGVRMSMLVSADAKSMPLAVHTFGLGTRILNKL
LRSSVRFQHLPVPFELYSDGIDLPVFEEFGAGTAALHLRDQLQRNELLAD
TDYRRRFRREFDRVKLGPSLWHRDFHDAVIVECPDKSLIGKSFGAIADER
GLHPLDAFLDVLVENGERNVRWTTTVANHRPKQLDKLAADPSIHMGFSDA
GAHLRNMAFYNFALRMLKRTRDAQAAGAPFLTIERAVHRLTGELADWFGI
DAGTLRPGDRADFVVIDPAGLDESVDAYHEEAVPFYGGLRRMINRNDDAV
VATGVGGVVVFGGSHRKGEFRDGYGHTVKSGRYLRAGQRVRAKGGAPRVT
A
118466775YP_883426.1 secreted acid phosphatase [Mycobacterium avium 104]MAAVALAASPLTPRTSLAAAAIPQPSHIVIVVEENRSESGIIGNKSAPFI
TALAASGANMTQSFAETHPSEPNYLALFAGNTFGVTKDLCPVNAGAAPNL
GSELLAAGYTFAGYAEGLPSPGSPVCSAGKYARKHVPWANFTNVPAASSL
PFSAFPMGNYASLPTVSFVIPNNDNNMHDGSIAQADAWLNRQLSGYANWA
LANNSLLIVTFDEDDNSNVGASRNQIPTVFYGAHVRPGNYAEQINHYNVL
ATLEQMYGLPKTGYAAGAAPITDIWG
118466774YP_881978.1 malonate semialdehyde decarboxylase [Mycobacterium avium 104]MPLLYIDLIEGRTPSEVSALLDAIHDTVVEAFGVPPRDRYQVVHTHPAHE
IVTLDTGLGIDRSSRQVVLHVVSRRRPRELKQKFYELLASRLAGRCGLDP
ADLIVSITENDDEDWSFGHGRAQFLTGELT
118466773YP_881870.1 transposase [Mycobacterium avium 104]MAFIDANRDEFGVEPICTVLRSAGLQVAPSTYYANKTRTPSARAQRDAVM
RPVITQLWEDNYRVYGARKLWKAARRAGHDIGRDQIARLMREAGIAGVRR
GKRVRTTKPGPGAPRHPDLVGRDFTASAPNQLWVTDLTFVPTWAGVAYVC
FLTDAFSRMIIGWRVASHMRTTVVLDTIEMARWSRGKMLAGLRCHSDAGS
QFTSIRYSERLAEIGAVPSIGTVGDSFDNALAETVNGYYKAELIYGPARP
GPWKTVEDVELATLSWVHWHNTSRLHGYLNDVPPAEFEAAFYATKRTDHP
LVEIQ
118466772YP_883938.1 hypothetical protein MAV_4813 [Mycobacterium avium 104]MPVRAYTESYLLASIMGDNRYLYPGFQQSVDPNQSINHPIGTQSLWPKTN
APQQQWIGTVQVHILSVTTAGRDVTVVACEYTFGSAQPARHGYEPNIGKP
PPYSGIDPLRITMETPAKPGPQSPQRGPARSPSVDVFNGWRITSHQGGYF
AQSGVGDEWPNAIEDRNTCLAKASQHPDLQRGGEYPRTDFPTLPPSPGWP
APSAAS
118466771YP_883920.1 chaperone ClpB [Mycobacterium avium 104]MDSFNPTTKTQAALTAALQAASAAGNPEIRPAHLLMALLTQADGIAAPLL
EAVGVEPATIRAEAERMLARLPQASGASSQPQLSRESLAAITTAQHLATE
LDDEYVSTEHLMVGLATGDSDVAKLLTGHGASPQALREAFVKVRGSARVT
SPDPEATYQALEKYSTDLTARAREGKLDPVIGRDNEIRRVVQVLSRRTKN
NPVLIGEPGVGKTAIVEGLAQRIVAGDVPESLRDKTVIALDLGSMVAGAK
YRGEFEERLKAVLDDIKNSAGQIITFIDELHTIVGAGATGEGAMDAGNMI
KPMLARGELRLVGATTLDEYRKYIEKDAALERRFQQVFVGEPSVEDTVGI
LRGLKDRYEVHHGVRITDSALVAAATLSDRYITARFLPDKAIDLVDEAAS
RLKMEIDSRPVEIDEVERLVRRLEIEEMALAKEEDEASKERLEKLRSELA
DQKEKLAELTTRWQNEKNAIDVVRELKEQLETLRGESDRAERDGDLAKAA
ELRYGRIPEVEKKLEAALPQAEARENVMLKEEVGPDDIAEVVSAWTGIPA
GRMLEGETAKLLRMEDELGKRVVGQKRAVQAVSDAVRRARAGVADPNRPT
GSFMFLGPTGVGKTELAKALADFLFDDERAMVRIDMSEYGEKHSVARLVG
APPGYIGYDQGGQLTEAVRRRPYTVILFDEIEKAHPDVFDVLLQVLDEGR
LTDGQGRTVDFRNTILILTSNLGSGGSEEQVMAAVRSAFKPEFINRLDDV
IIFHGLEPGELVQIVDIQLAQLQKRLAQRRLTLEVSLPAKQWLAHRGFDP
VYGARPLRRLVQQAIGDQLAKQLLAGQVHDGDTVPVNVSPDGDSLILG
118466770YP_884309.1 isochorismatase [Mycobacterium avium 104]MLSADHRFQQTMTVRFGRRGRVPITGWVQSRRGVGMAGEDHYTRPCADSA
ALVLIDVQRDFYADDAPMRVEGTSAALGAMAELARAFRRRELPIVHVVRL
YRADGSNADPVRRRFIEDGARVAEPGSPGSQIAPELLPKAVELDHQLLLS
GGFQQIGPAEHVMYKPRWGAFYGTKLEQHLRESGTDTLVFAGCNFPNCPR
TSIYEASERDFRIVLVTDAISGLYDRGAQECRAIGVAVRDTAQTLDWLGG
118466769YP_883434.1 cytidine deaminase [Mycobacterium avium 104]MPDIDWNALRDKAIDASAGAYAPYSRFRVGAAGLVDDGRVVTGCNVENIS
YGLGLCAECAVVCALYASGGGRLVALACVDGRGSVLTPCGRCRQVLAEHG
GPELLIDHPGGPRRLGELLPDAFGPDQLAAGRD
118466768YP_881441.1 hypothetical protein MAV_2236 [Mycobacterium avium 104]MNARRCRAALLVLCGLAAVPAILVAVPGADRADATVCVGAGRRVTVSGCT
NIGDNIARYAPPPAVYAPLPEDDTSTPPPPPPP
118466767YP_881327.1 hypothetical protein MAV_2117 [Mycobacterium avium 104]MSVARRERAALVETLRGVGPDAPTLCEGWTTRDLAAHLVIREYRPDATPG
IMIPFLASHTAKVQSQVTAQNDWDELLDKVAAGPPVYSPFKLLDPVANVG
EMFIHHEDVRRAQPDWTPRALEPALARTLRRTLPLMARLTLAKVPARVAL
RTPEGKTVLTAGRGPAVTLTGAPEELLLFAVGRAARVDFEGDAAAVQAVR
DAPKGL
118466766YP_879806.1 hypothetical protein MAV_0526 [Mycobacterium avium 104]MTEISASQGPVARGSMARVGTATAVTALCGYAVIYLAARDLAPSGFSVFG
VFWGAFGLVTGAANGLLQETTREVRVMPYLEVAPVKRTHPLRVAMLLGAA
AAVVIAGSSPLWSGRVFVEARPLSVLLLSVGLAGFCVHATLLGMLAGTNE
WTRYGALMVTDAVIRVMVAAATVVLGWRLVGFLWATVAGAVAWLILLAAS
PATRATARLLTPGGTATFLRGAAHSITAAGASAILVMGFPVLLKLTSAEL
GAQGGVIILAVTLTRAPLLVPLTAMQGNLIAHFVDERSDRVRALIGPAAI
VGAIGAVGVLAAGVLGPWVLRVAFGPQYQAGSALLAWLTAAAVAIAMLTL
TGAAAVAAALHRAYALGWVGATVASGLLLALPLSLQTRTVVGLLCGPLVG
IGVHLVALSRAARLTG
118466765YP_880980.1 MmpL4 protein [Mycobacterium avium 104]MSDASNKTQPDLSAADTGPINVKGLSKAERGHRPYLPHAIRIFAVPIILG
WLFVTVLVNVIVPTLEKVGEAHSAPMTPLDAPSMKAMMRLGHNFHEFDSN
STVMIVLEGQQPLGPDAHKYYDNLIRQLRQDPKHIQHIQDFWGDRLTAAG
AQSADAKGAYVQVNLAGNQGTTLANESVDAVRKVIDENKAPPGVKAYVTG
PAALSDDMHIIGNASLAKITLFTLGAIAIMLLLVYRSIVTTLVQLFMTFV
ALACSRGVVAVLAYHNAFGLTTFAANILTMLAIAAGTDYGIFLIGRYQEA
LAAGEDRESAYYTTFKGVAPVVLGSGLTIAGATYCLSFSRLPWFNTMGAP
VAIGMLVVVLAGVTLGPAVVFVGSRFHFFERQAKRGRLWRRVGTAVVRWP
APVLAVSAAVVLVGMIALPSFHTSYNDRHYLPLSAPSNQGQEAANRHFSE
ARMNPDLLMIESDHDMRNPADMLVLDRVAKNEMRTLGIAMVQDITRPLGI
PIQHSSIPFQNSVQSQTTMQNMGFLKERMNDILKMADDLQTQIDTTQRQY
EVSMDLANAADDSAKTTAVTSQITDSLRDHIADFDDTFRPIRTYFYWEKH
CYDIPVCIGLRSLFDTFDGFDQLAEQFHYLTTDIAHTAKASRDLTALFPT
LITTLKTTRGITLTLYQTFKAMIDQMEAMSNTAVVMGQSFDASKNDDFFY
LPPEAFDNPDFQTGLRMFLSPDGKSARFFITHQGDPMSPEGIKRVDAERT
AAQEGLKQSSLSDARVYLGGTAATFKDMADGEKYDLMIAVVSALTLIFMI
MLLLTRSVVAALVIVGTAASSIAASFGLSVLIWQDLFGIRIHWIVAALSV
IILLAVGSDYNLLLVSRFREEIHGGLKTGIIRSMAGTGGVVTAAGLVFAF
TMAAMLGSELRVLGQFGSTVCIGLLLDTLIVRTLLMPSIATLLGRWFWWP
MVVHPRGDNARRPVPASS
118466764YP_880791.1 metal-dependent hydrolase of the beta-lactamase III [Mycobacterium aviMLGCSGSVVGPDSPASGYLLRAPDTPPLVIDFGGGVLGALQRYADPSSVH
VLLSHLHADHCLDLPGLFVWRRYHPTRPLGKAMLYGPGDTWSRLGAASSP
YGGEIDDCSDIFDVRHWVDGEPVTIGGLTVTPRVVAHPTESYGLRVTDHT
GASFVYSGDTGACDQLVELARGADVFLCEASWTHSPDRPPALHLSGTEAG
RAAAQAGVHELLLTHIPPWTSREDVISEAKAEFDGPVHAVVCGETFDVRR
SERV
118466763YP_881285.1 virulence factor Mce [Mycobacterium avium 104]MNRRTWIQLSILALVTVVSCGAMAFNFMKLPATLFGIGEYRVTVDLPQSG
GLYQTSVVTYRGTDVGQVKSVDVTATGVRAVLAMRSGIEVPFDVQASVHS
RSAIGEQYIELTPRPGTGDHQSRTLRDGDVITAGRVEVPVDIGRLLDMTN
RALQAIPRDNLRTVIDETNRAVGGLGPELSRIVDGSTALAVAGGHTVDPL
ATLIDQSPAVLNSQVQTSGAIATWAERTAALMAQFKAQDAAVRDLLAHGA
SGVEEGRALLDRVTPALPVLFANLVSLGDIAVVYRHDIEQLLVLLPQGIA
AMAAIIVPSSNTKQEYRGAQLDFNLNLNLPPPCTTGYLPPAQRRSPASVD
APDRPAADLYCRVPQDSEFNVRGVRNIPCESKPWKRAPTVELCESDEEYV
PLNDGYNWKGDPNATTSGQGVPQYPPGQDPRLPPPRGTAPAPPPVAVAPY
DPATGDYIGPDGRRYTESDLAHPRAKSWQSLLVPQP
118466762YP_882571.1 carbamoyl phosphate synthase large subunit [Mycobacterium avium 104]MPRRTDLNHVLVIGSGPIVIGQACEFDYSGTQACRVLKAEGLQVSLVNSN
PATIMTDPEYADHTYVEPITPAFVERVIAQQAERGNKIDALLATLGGQTA
LNTAVALYENGALDRYGVELIGADFDAIQRGEDRQRFKDIVAKVGGESAR
SRVCFTMDEVRETVAELGLPVVVRPSFTMGGLGSGMARSVEEVDRMAGAG
LAESPSANVLIEESIYGWKEFELELMRDGNDNVVVVCSIENVDPMGVHTG
DSVTVAPAMTLTDREYQRMRDLGIAILREVGVDTGGCNIQFAVNPKDGRL
IVIEMNPRVSRSSALASKATGFPIAKIAAKLAIGYTLDEIVNDITKETPA
CFEPTLDYVVVKAPRFAFEKFPGADPTLTTTMKSVGEAMSLGRNFIEALG
KVMRSLETSRAGFWTKPDPDGGLDDVLARLQTPTEGRLYDLELALRLGAP
VERVAQASGVDPWFIAQIGELVALRGELIGAPVLDADLLRRAKHHGLSDR
QIAALRPELAGENGVRSLRERLGVHPVYKTVDTCAAEFEAKTPYHYSSYE
LDPAAETEVAPQPQRPKVLILGSGPNRIGQGIEFDYSCVHAATTLSQAGF
ETVMVNCNPETVSTDYDTADRLYFEPLTFEDVLEVFRAEQQSGAGGPGVV
GVIVQLGGQTPLGLAQRLADAGVPIVGTPPEAIDLAEDRGSFGDVLTAAG
LPAPKYGTATTFAQARRIAVDIGYPVLVRPSYVLGGRGMEIVYDEETLRD
YITRATELSPEHPVLVDRFLEDAVEIDVDALCDGTEVYIGGIMEHIEEAG
IHSGDSACALPPVTLGRSDIEKVRRATEAIAHGIGVVGLLNVQYALKDDV
LYVLEANPRASRTVPFVSKATAIPLAKACARIMLGATISQLRAEEMLAAS
GDGAHAALNAPIAVKEAVLPFHRFRTVEGAGIDSLLGPEMKSTGEVMGID
RDFGSAFAKSQTAAYGSLPAQGTVFVSVANRDKRSLVFPVKRLADLGFRV
LATEGTAEMLRRNGIPCDEVRKHFEDPQPGRPEMSAVDAIKAGEVDMVIN
TPYGNSGPRIDGYEIRSAAVSVNIPCVTTVQGASAAVQGIEAGIRGDIGV
RSLQELHSQIASDKGPR
118466761YP_881172.1 cytochrome P450 [Mycobacterium avium 104]MNGTANINDLPFAEDRSRAWRELREAGEAVLSGEEIVLTSAEAVEFAAKR
PDIFSSAKAFDRLGSPVPLIPIAIDPPDHTRFRRMLDPFFSPKKMAEREP
ELRKQAGELIDAILAKGHSDVVADLATPFPSQVFLTLFGLPMADRDRLVQ
WKDSILEFTDPSSTEATPEVLAHAMELFTYLTEHIAARRADTTGSDMLTQ
LMQNSEEGGMDDNEILGLCFMFVLAGLDTVTSAVGFALAKLAGDPELRRR
ISNDYSLIPAFIEELLRVDGPVPFAPRVTTQEVEVAGRVVPKDTTVMLSY
GSADRDPLRYEDADNVHLDSKAVHFAFGRGPHRCLGSHLARLELRIILEE
WHKRIPEYSLADGKDPQMPWPTGTMGLKSVPLTFPT
118466760YP_884217.1 hypothetical protein MAV_5099 [Mycobacterium avium 104]MGFKDSAEVTKYIGGIFETAFEDPEIGHKLVATGLVVAFQFTDPQAVVVV
DMANKKVREGLDGGPAPTATMSMTADTGNGYWQGKVNLPLAMAKKKIKVE
GNVASLLKLAPLGKKLYPGYIERLKNDGRDDLLV
118466759YP_881501.1 ubiquinol-cytochrome C reductase- iron-sulfur subunit QcrA [MycobacterMSDGDVRGSDTDKGAGAPNEPDEAALAAMSQQELVTLGGKLDGVETVFKE
PRWPVEGTKAEKRAERGVALWLLLGGGFGLALLLIFLFWPWEYKPKEAAG
SFLYDLATPLYGLTFGMSILSIGIGTILYQKRFIPEEISIQERHDGASRE
IDRKTVVANLADAYNGSTIGRRKMVGLSLGVGLGAFGLSTLVAFAGGLIK
NPWKPVVPTANGKKAVLWTSGWTPRYPGETIYLARATGTYTGAPFVKMRP
EDLDAGGMETVFPWRESDGDGTTPESQEKLRAINQGVRNPVMLIRIRPTD
MPRVVKRQGQESFNFGEFFAYTKVCSHLGCPASLYEEQSYRILCPCHQSQ
FDALHFAKPIFGPAARALAQLPITIDTNGYLVANGDFVEPVGPAFWERTT
T
118466758YP_879384.1 hypothetical protein MAV_0086 [Mycobacterium avium 104]MTVIAAIGALATAAFLGYHVGRRAGSPRPTWAKRTSRPALGRLAITLIAM
IAARRIQQRLRAERGRAATHASRLVAPLGILRAGVTRIRCY
118466757YP_880691.1 hypothetical protein MAV_1449 [Mycobacterium avium 104]MAEAMINAKRILLYLPLYLVWAVTIDVLFDSASPPGSKSVPAWMTIGFVV
SAVVVAGVVLWYLSRHAAGKVPQQRQHVYTALLVAIIVSGFVDDALKGAA
WLLLGRHPWWVLVPIYTLGYAACWAVLMLMLNWLERRADDRTGSPRA
118466756YP_879478.1 hypothetical protein MAV_0184 [Mycobacterium avium 104]MRPGAAPPPRRGRRPLGPTPRYAVIPRWGLADRVEPPPAVAAASAHPGPP
AQLVRSTSFVGVLVLGIAALVYVVRYLLLVINRDTLLYSWVAIGADWLGV
LASVGAVGAVIASGVALIRWMIARRAAVFAHHGLPDPRSARALGAGCVVP
LANLLWAPVFVIELALLEEHYHRLKGPILQWWITWVCSYAVSVSAIATSF
VTDAQGIANNTILMVFGYLFAAATLAAATRIFEGFQRKPVARPAHRWVMV
PDDGPPPPAPGAPVEFKGQEPAA
118466755YP_884027.1 Hsp20/alpha crystallin family protein [Mycobacterium avium 104]MSNLALWTRPAWDTDRWLRDFFGPAAAADWNKPATSAFKPAAEIVKDGDD
AIVRVELPGVDVDQDVQVELDRGRLVIRGEHRDEHAEEKDGRTLREIRYG
SFHRSFQLPGHVTDDDITASYDAGVLTVRVTGAYAGNQAKRIAITK
118466754YP_880688.1 hypothetical protein MAV_1445 [Mycobacterium avium 104]MLCIPAVVAAALTVGSGIAVADDDGYLAQLKKIGVAWQPGGDTTLIQLGH
AICSDRAAGKTPDELAADVHSGLNSSFNYADATAIVSAAESNYCP
118466753YP_883315.1 sensor histidine kinase [Mycobacterium avium 104]MSTLGDLLAEHTMLPGNAVDHLHAVVGEWQLLADLSFADYLMWVCRDDGM
LVCVAQCRPNTAPTVLQTDAVGTVVASERLTLVAETFASGAAKADDVAAQ
QDSWLPGTHVEASPVRYGGHVVAVLTRHQTAVAADRASGQLEIAYRECAA
DLVHMLAEGTFPDVGDVAMSRSTPRAGDGFIRLDVNGVVAYASPNALSAY
HRMGLTTELEGHNLIEITRPLISDSFEAQEMAEHVKDLLAGGKSMRMEVD
AGGATVLLRTLPLVVNGASAGAAVLIRDVTEVKRRDRALISKDATIREIH
HRVKNNLQTVAALLRLQARRTTNPEGREALIESVRRVSSIALVHDALSMS
VDEQVNLDEVIDRILPIMNDVASVDRPIRINRVGDLGVLDSDRATALIMV
ITELVQNAIEHAFDPAAAEGSVTIRAERSARWLDVVVHDDGRGLPEGFSL
EASDSLGLQIVRTLVSAELDGTLGMSEASERGTDVVLRVPIGRRTRMLL
118466752YP_882847.1 short chain dehydrogenase [Mycobacterium avium 104]MTVTSTITADDGVTLAVHRYTDIDPARPTILAIHGFPDNHHVWDGVADEL
TGAPYNFVAYDVRGAGESSCPATRSGYGFAQLARDMGAVIDSLGVGRVHL
LAHDWGSIQAWAAVTDQAIMGESVMDKVASFTSISGPHLNYAGAFLRSAR
TPRAVARVVRQLIASGYIGFFLCPGAAELSFRAGIGVKVIAALERIGHTS
TRSQRRDTQRSLRDYLNGLQLYRQNMPAPMLAPGPRLPETTVPVQTLVPR
RDVFVTPALQRFTGAIPQRARVIEIEGGHWVVTSRPDVIARLTTEWVDLQ
SAGAVAPQLTGERRELPGERREVRGRLALVTGAGAGIGRATAVELARQGA
RKVVIVDRDRAAADQTADAVRAAGAGAAVYQVDVSDEAAMNDLAAQVRNE
HGVVDILVNNAGIGMAGRFLETSPANWDAIMGVNVRGVIWGSRAFGAQMV
ERGQGGTIINVASAAAYLPSKSMVAYGTTKAAVLALSESLRADFADEGIT
VTAVCPGFVNTNIAKSTIYAGMSAQQQERARDRADAAYRRRNFTPEATAK
AIVKAIKTGPAVVPIAAESRIGYALRRISPGAIRLLARWDIRQT
118466751YP_881367.1 TetR family transcriptional regulator [Mycobacterium avium 104]MTSTRTAEFVRRLTEPDPVVLAQVDNPDEITARILAATLEQAELVGMRRT
TMEDVARRSGVGRATLYRRFPTKAALVDAVVLAEARRYLEGDAQAWAHGA
TFEDRMVNSTVFSVTFMREHALLKKLLRTEPETILPSLTVDAGVILDYAT
EYTIGLLRRELYGTETTPSQERHLRTVAELHTRLTLSFIVTPHTSINLAT
VDDTRSYVRNYLMPMVVGPR
118466750YP_884203.1 enoyl-CoA hydratase [Mycobacterium avium 104]MTNVLTSNDGPVRIVTLNRPGVRNAIDIPLRIELAEVLEAADADESVRSI
VLTGAGRVFCSGGDISTMQRMESEDAKHRADLAQRVIRAIWNTAKPVVAA
VEGAAFGAGAALALACDRVVAARDARFATTFTNVGLAGDMGTFVSLPRRV
GIARARQMLLLPQPIGAEEAAALGMVDALTDPGHTLEAATRDAQNLAAGP
AEAFGVIKALLAIAPTLHPLDALEEEASYQARLFGTDDFVEGVAAFRDKR
RPSFGQRQGVRP
118466749YP_879924.1 acyl-CoA synthetase [Mycobacterium avium 104]MAVALNIADLAEHAIDAVPDRVALICGDEKLTYAELEEKANRLAHYLLDQ
GVKKDDKVGLYCRNRNEIVIAMLGIVKAGAILVNVNYRYVEGELRYLFDN
SDMVALVHERQYSDRVANVLPDTPNVKTILVVEDGSDKDYQRYGGVEFYS
ALEKGSPERDFGPRSADDIYLLYTGGTTGFPKGVMWRHEDIYRVLFGGTD
FATGEFVKDEYDLAKAAAENPPMIRYPIPPMIHGATQSATWMSIFSGQTT
VLAPEFNADEVWRTIHEHKVNLVFFTGDAMARPLLDALNKDHDYDLSSLF
LLASTAALFSPSIKERLLELLPNRVITDSIGSSETGFGGTSIVAKDAPHA
GGPRVTIDHRTVVLDEEGNEVKPGSGVRGLIAKKGNIPVGYYKDEKKTAE
TFKTFNGVRYAIPGDYALVEEDGTVTMLGRGSVSINSGGEKIYPEEVEGA
LKGHPDVFDALVVGVPDPRYGQHVAAVVQPRPGTRPSLAELDRFVRSEIA
GYKVPRSLWLVDEVKRSPAGKPDYRWAKEQTEARPADDVHAAHVSA
118466748YP_879916.1 acetyl-CoA acetyltransferase [Mycobacterium avium 104]MAGAGPNIAAVLGTGQTKYVAKRQDVSMNGLVREAIDRALADSGCTFDDI
DAVVVGKAPDFFEGVMMPELFMADAVGATGKPLIRVHTAGSVGGSTGVVA
ASLVQSGKYRRVLAMAWEKQSESNAMWALSIPVPFIKPVGAGAGGYFAPH
VRAYIRRSGAPTHIGAMVAVKDRLNGCRNPLAHLHQPDITLEKVMESPML
WDPIRYDETCPSSDGACAVVIGNEEAAEARLAQGNPVAWIHATALRTEPL
AYAGRDQVSPQAGRDAAAALWKAAGIKSPIDEIDAAEIYVPFSWFEPMWL
ENLGFAPEGEGWKLTEAGETKIGGRLPVNPSGGVLSSNPIGASGLIRFAE
AAIQVMGKGGDHQVPGARKALGHAYGGGSQYYSMWVVGADKPAAEKV
118466747YP_882577.1 beta-lactamase [Mycobacterium avium 104]MTLDANSVSIREVCDAGLLAGAVTMVWQRGELLQVNEIGYRDVEAGLPMR
RDTLFRIASMTKPVTVAAVMSLVDAGKLSLKDPVTRWAPELAGVRVLDDP
HGPLDRTHPLDRAILIEDLLTHTSGLAYGFSVSGPISKAYMRLPFQHGPD
AWLAELAKLPLVHQPGEKVTYSHSIDLLGVIAARIEDKPFHQVLDERVLG
PAGMTDTGFFVSPQARHRAATMYSLDEHSRLQHGVMGPPHVTPPAFCNAG
GGLWSSADDYLRFVRMLLGDGTIDGVRVLSEESVRLMRTDRLTEAQKRHN
FLGAPYWVGRGFGLNLSVVTDPARSIPLFGPGGVGTFSWPGAYGTWWQAD
PTAELILIYLIQNLPDLTVDAATAVAGNTSLAKLRTAQPRFVRTTYRALG
L
118466746YP_882275.1 hypothetical protein MAV_3091 [Mycobacterium avium 104]MLLLGNGGRRRAAGGDGPGEVQQLAERALYDVAHGRFERSLSGLTAMAAL
VTTAEIYFEHYKASFGNKWMWSPIVVTPPVVVAGIGGVFSRRWAKVWLPI
TAAVYTANGLMGEYLHARGVARKPGGWKHASYNVPMGPPIAAPGLMCMVG
GMGLLASILRRERFRR
118466745YP_884013.1 hypothetical protein MAV_4893 [Mycobacterium avium 104]MNHMTRPVSLEVAGRRVTITHPDKVVFPRAGGGETTGSAAGPYTKLDLVR
YYLSVADGALRGVAGRPMILKRFVKGITQEAVFQKRAPANRPDWVDVAEL
RYARGTSAAEAVIHDAAGLAWVINLGCVDLNPHPVLADDLDHPDELRVDL
DPMPGVSWRRIVDVALVAREVLEDYGLTPWPKTSGSRGFHIYAHIARRWE
FRQVRLAAQTVAREVERRAPEAATSRWWKEEREGVFVDFNQNAKDRTVAS
AYSVRATPDARVSTPLRWDEVAGCRPEAFTIDTVPARLAEIGDPWAGMDD
AVGDLDRLLVLAEELGPPERAPKGAGTRSGGRRRSSMPLIEVARTKTRDE
AMAALDVWRDRHPGAAARLQPADVLVDGMRGPSSIWYRIRINLQHVPEDQ
RPPQEELIADYSPWQGYGGRQKPSWG
118466744YP_880119.1 hypothetical protein MAV_0850 [Mycobacterium avium 104]MAIQNWCDAVEIHPSQIRVGDIIGTRRPTELRLTVRMISGPQSGPGQWTF
FSRDDNGQQRTSTFGEGELVRRYAKAS
118466743YP_883809.1 3-hydroxybutyryl-CoA dehydrogenase [Mycobacterium avium 104]MHDKTIGGETVSDAAIQRVGVVGAGQMGSGIAEVSVRADVDVTVFETTEA
LITAGRNRIVKSLERGVSAGKVTERERDRALSKLTFTTDLKDLADRQLVI
EAIIEDDAVKAQVFAELDRVVTDPDAVLASNTSSIPIMKLAAATKNPQRV
LGLHFFNPVPVLPLVELVSTLVTDEAAAARTEEFASAVLGKQVVRCSDRS
GFVVNALLVPYLLSAIRMVEAGFATVEDVDKAVVAGLSHPMGPLRLSDLV
GLDTLKLIADKMFEEFKEPQYGAPPLLLRMVEAGRLGKKTGQGFYTY
118466742YP_882893.1 class I glutamine amidotransferase- putative [Mycobacterium avium 104]MGLTAYLERVQTGIWDIPAGYLPADYFEGVTRAGGIAVLLPPQPVDTGIV
GSLLDGLHALVITGGYDLDPAGYGQRPHPSTDAPRTDRDAWEFALLRGAL
QRGLPVLGICRGAQVLNVAFGGTLHQHLPDVLGHGGHRAGNGVFSTLPVR
TVAGTRLAALLGETVDAPCYHHQAIDKLGDGLVVSAWDPDGVVEAVELPG
DAFVLAVQWHPEQSLHDLRLFTAIVDAARSYAGVAR
118466741YP_883393.1 Maf-like protein [Mycobacterium avium 104]MLASASAGRLKVLRQAGVDPLVVVSGVDEDAVIAALGPDASPSAVVCALA
TAKADRVAGALQAGVAADCVVVGCDSMLFIDGGLCGKPGSADAALRQWRR
IGGRSGGLYTGHCLLRLRDGDITHREVESACTTVHFASPAEADLRAYVAG
GEPLAVAGGFTLDGLGGWFVDGIDGDPSNVIGVSLPLLRTLLARVGLSVS
ALWAAD
118466740YP_882352.1 Acyl-CoA thioesterase [Mycobacterium avium 104]MPAGAESQEPNTTADFEELLATLDLRRVADDLFVGSHPSKNPMRTFGGQL
MSQSFVASSRSLIRDDLPPSALSVHFINGGDTGKDIEYRVTRLRDERRFA
NRRVDAVQDGTLLCSALISYMAGGRGLEHGVDPPRVADPETQPTIVELLR
GYEETVPHFVNALQPIEWRYTNDPAWVMRTKGERLPHNRVWVKALGKLPD
DPVLHTAAMVYSSDTTVLDSVITTHGLSWGFDRIFAASANHSIWFHRQVD
FNDWVLYSTSSPVAADSRGLGTGHFFDRSGQPLATVMQEGVLKYFPSARR
118466739YP_881654.1 hypothetical protein MAV_2462 [Mycobacterium avium 104]MTKVRTSALGLTATAVLVGATVVGCGGDKNPAASSSPAASTPSAASPSAG
APADYSNLLIKPGDVGPNATADGPPSQNPSGITGVGQVFKNPDGKRTIMD
TIAVFPDPATAAQTAANMRDVVGKKVNGPQQPIDIGSNGFMVIGQGSDPA
NPMEISEAVFVEGRAMVDLESDCVIGNPTPADVLLDLARKQDAAVKAGLP
AG
118466738YP_880370.1 D-glycero-D-manno-heptose 7-phosphate kinase [Mycobacterium avium 104]MTRPRIRARAPLRISFAGGGTDVPPFPTTEGGCVLSATIDRYAQGSLAPR
TDRRVSIESVDFKTTHEMTLDSEILYDGSLDLIKAAVRRFGRDGTDGYDL
VLRSSAPPGSGLGSSSTMMVALTGLLAEHYRVPMGEYETAQLACAIERED
LGIAGGMQDMYAATFGGFNFIEFTDRVIVNPLRIRDETAFELELSLLLCY
TGITRDSARVIEDQTRRATTGSDDTLAGLRAQKELAVAMKAALLTGKLND
FGALLGEAWTEKKRMSPYITNERIDDLYELALKNGALGGKLTGAGGGGYI
LLFCDFAKKHRLIEALEGAGAAVTEFAFESKGLTTWQA
118466737YP_880817.1 enoyl-CoA hydratase/isomerase [Mycobacterium avium 104]MAVHRQGAVLRLTLDRPSRRNALTQLMIATLVDALTAAASDDSLRVVHIV
GAGDDFCAGADWVAVNDPGGPRPRAGDLVRRIPHAAHRVIELVAGIQLPV
VCSVRGWAVGFGCNLALAADFTVAAADAVFWEPFVERGFSPDSGSTWLLA
RLVGLARARRMLLLGEKVGGRDAADWGLIHRAVGGAELDDAAEELVGRLA
AGPTAALGLAKQALSFGQHATLSQSLTQELFNLELSCRTSDFKEGLEAFR
QRRDPDFRGR
118466736YP_882433.1 ABC transporter efflux protein- DrrB family protein [Mycobacterium aviMSALAALTERSLKSAARDGEMIFEILSPAAYLAGFSVALHGLIDTGRISY
SQYLLPAVVAQSMIFVGLMTADRAARDHLFGFGERIRTLPVPAAATVTAR
VTATLMRGSFCLVMALVAGYVLGFRLAGGLVYSAAFVFISLLLCLAVTLG
ADALGSSAKSVQGASHLLFVPQLLLFMLSTGIAPEQTFPGWLRPYVRNQP
VSQFAETLRGLARGHVIVGNVAATLAWCVGAVLVFGAITLRMQRRG
118466735YP_880145.1 3-(3-hydroxyphenyl)propionate hydroxylase [Mycobacterium avium 104]MIAPGPRATDHDTDVLVVGAGPVGLTLANILGLQGIRTVVVEERDTLIDY
PRGVGLDDEALRTFQSIGLVERVLPHTVPNQILRFMDAKRRVLAEMAPPD
ARFGWPKRNGFVQPLVDAELLAGLDRFAHVQVRWGSPMTGCREDADGVNV
ELGADGGNVGDGGGDGHPAGLRARYVVGCDGGRSMTRRVMGVSFDGTTSS
TRWLVVDIANDPLGHPNSEVGADPERPYASISIAHGIRRFEFMIHADESD
EQAEDPEFLTRMLARMVPHPDRVDVIRRRVYTHHSRIAGEFRRGRLLLAG
DAAHLMPVWQGQGYNSGIRDAANLGWKLAAVVSGRAGDKLLDTYDMERRK
HARAMIDLSTMVGRVISPTNRRVAGARDLLVRSASIVPTLKRYVLEMRFK
PMPRYEHGAVVHANPGRADSPVGTLFIQPRVDTRDQQDVLLDDVLGPWFA
VLCWNNNPRKILGETAFANWKALGARFFALRPATQLRWTGHDDPDVVVVG
DRRGDLKSWFDIHAESVLFLRPDRCIAGACIAQRAPDLSAALFDALTLTP
RGGDPQSGTGSVLYVAQPAPESSGAVAGPA
118466734YP_880701.1 XRE family transcriptional regulator [Mycobacterium avium 104]MTQEVLALHSGVTRNVLIDVEFGRRGLLYERLFDLAEALDVPVADLLAVP
EPPPKRKRRSKRSTQ
118466733YP_879943.1 hypothetical protein MAV_0664 [Mycobacterium avium 104]MRWRRRLLVAAGYLLAVAFVGLSAVAGAMYWDRVQTRGEQAARAVLPGLA
AKEIPEVFAYDYQTVERSLSAAYPLLTPDYRAEFQKSVNNQIIPEAKKRE
VVVQANVVGVGVMSAQRDSASVMVYMNRTVTDKSRQPLYDGSRLRVDFKK
IGKQWLIAYITPI
118466732YP_883172.1 acyl-CoA dehydrogenase [Mycobacterium avium 104]MAINLELPRKMQAVTTKTHQGAAELMRPIARKYDLKEHAYPVELDTLISL
FEGASESIEFAGANALGGEDEERDKNHNGANMAALLQTLEASWGDLAMML
SVPYQGLGNAAISAVANDEQLQRLGKVWAAMAITEPGFGSDSAAVSTTAT
LDGDEYVINGEKIFVTAGSRATHIVVWATLDKSKGRPAIKSFIVPRDHPG
VTVERLEKKLGIKGSDTAAIRFDNVRIPKENLLGNPEIEEGKGFSGVMET
FDNTRPIVAAMAVGVARAALEEIRKILTDAGVEISYDKPAHVQSAAAAEF
LRMEADWESAYLLSLRAAWQADNKIPNSKEASMSKAKAGRMATDVTLKTV
ELAGTAGYSEQSLLEKWARDSKILDIFEGTQQIQQLVVARRLLGLSSAEL
K
118466731YP_881054.1 hypothetical protein MAV_1831 [Mycobacterium avium 104]MHHRPAVRPGRPSQRAQCRAGGELHTPVDGCRPGLRDGARLALPAGSDTT
DQLRPMIVTDKHAKVSQRLDAVRAQGGRVAMVGTSGGTHEGHLRWYVGPG
RSATSSRCSGTARSVSSGLMVPCRATPAISNGTRRYSSRPRLTWFLHRRL
IPGFGMPIEEFFWLDDLSAACATDRRWSFLFASAPLNVPGGVGSPANALA
IR
118466730YP_883132.1 camphor resistance protein CrcB [Mycobacterium avium 104]MAQHDYRELAAVFAGGALGSLARAALSALAAGDPASWPWPTFTVNIVGAF
LVGYFTTRLLERLPTSSYRRPLLGTGFCGGLTTFSTMQVETLTMLEHHYW
GLAAGYTLTSIAAGLLAVHLATKLVRRVRVRR
118466729YP_879674.1 CobB/CobQ-like glutamine amidotransferase [Mycobacterium avium 104]MADSVVRIGLVLPDVMGTYGDGGNALVLRQRLRLRGIDAEIVELTLADPV
PESLDLYTLGGAEDYAQRLATRHLLRYPGLQRAAERGAPVLAICAAVQVL
GHWYETSAGERVDGVGMLDATTSPQDARHIGELVTKPLLAGLTEPLTGFE
NHRGGTVLGPAAAPLGAVVKGAGNRAGDGFDGVVQGSVVATYMHGPCLAR
NPQLADLLLGKVVGGLPELQMPEVELLRRERLAAR
118466728YP_882282.1 carveol dehydrogenase [Mycobacterium avium 104]MADNKVALITGAARGQGRAHAVRLSAGGADVIAVDIAGQLPESVPYESPT
PDDLAETARLVEANGRRAITAAIDVRDGDKLRAAVGDAVAELGRLDIIVA
NAGICCPAPWDQITDQAFRDTIDTNVIGTWNTVMAGAHHIIAGGRGGSII
LIGSAAGVKMQAFMVHYTASKHAITGMARAFAAELGRYNIRVNSLHPGAV
DTPMGTGRMRDALESAAATYPHLEGLHKPLLPDGIAQPEDIADAVAWLAS
DQSRFVTASGISVDLGVAHC
118466727YP_880436.1 patatin [Mycobacterium avium 104]MALALGSGGARGYAHIGVIEALQARGYDIVGVAGSSMGALVGGLQAAGRL
DEFAEWAKSLTQRTILRLLDPSISAAGVMRAGKILDAVRDILGPVAIEDL
RIPYTAVATDLLAGKSVWFQRGPLDEAIRASIAIPGVIAPHTLDGRLLAD
GGILDPLPMAPLSAVNADLTIAVNLSGSEAITRREAEPAATAEWLTRMMR
STSALFDTAAARSLLDRPTARAVLSRLGGPSGDADAWPDNPEEPDQPVLA
DDDDEAVELPGAATDVPKLGSFEVMNRTIDIAQAALARHTLAVYPPDLLI
EVPRSICRGLEFHRAVEVIDAGRALADQALDALEDGDDDRPAVER
118466726YP_882750.1 uroporphyrinogen decarboxylase [Mycobacterium avium 104]MNSSARTRRDLPESPYLAAVNGRKPHRVPVWFMRQAGRSLPEYRALRAQH
DMLSACFDAELVCEITLQPVRRHDVDAAILFSDIVVPLLGAGIDLDIVAG
VGPVIASPVRTAADVAAMKPLERQRVQPIADAVRLLVSALGEVPLIGFAG
APFTLASYLIEGGPSRHHARTKAMMLADPESWHTLMEKLTDITVGFLRVQ
LDAGVDAVQVFDSWAGALSLANYRSYVQPHSARVFAALADYGVPMTHFGV
GTAELLGAMSAALKPAPATVVGVDWRTALADAATRVMPGTALQGNLDPVV
LLAGWPVVETAARAVVDDGRRAVDAGAAGHVFNLGHGVLPETDPGVLTEL
VSLVHSL
118466725YP_881673.1 hypothetical protein MAV_2481 [Mycobacterium avium 104]MDLAHWVTSIVAFVRAGYPAGMPATGHVPLVALAHRRLCHDDITAIATDL
IARRLWPISSVDIGVEITRFTNQLPSPQDVDLVLRRVHAIRCSRG
118466724YP_879544.1 hypothetical protein MAV_0255 [Mycobacterium avium 104]MNENAYRHAAYAIARDSDAPAAVTAYAGAVAAAMHRAQLEGTTLACQLIT
ELSSDPVTHAAAVSIGPFGVLTLSDWLQEVWGDVTEIAALTEVPELIESE
VLYRRATVELFAETDASASTATLAFAGALAVANVRWLATGSDPAASGFVS
SVLDADPVAAAAREELDESTRASIAISVGNRWTEIMERVQVMEMVAAIET
AA
118466723YP_881298.1 cobalt transport protein [Mycobacterium avium 104]MTAPSDTKSAAGRTRRPPRPVVLLVPVPGTSKIHELWAGTKLLVVLGVSV
LLTFFPGWVTVGLMLALLVAAARLAHIPRGALPSPRRWIWIVLAVGGITA
ALGAGSPVVSIAGLHIGLGGTLHFLRVTALSIVLIGLGAMLSWTTNVAEM
GPALATLGRPLRWLRIPSDEWAVALALALRAFPMLIEEFQVLYAARRLRP
NQTPRSRRARRRQQARDMIDLLTAAIVVTLRRADEMGDAITARGGIGQLS
AAPARPKLADWVTLAITVAAGAIGVALDSMIPFQ
118466722YP_879908.1 hypothetical protein MAV_0628 [Mycobacterium avium 104]MSTSNTVGARRRGLYGLLAEGLLTAAAATVIALPVAGVAHAECNQDVGQS
IDSYLQKHPDLHQQLQQRSQAEGGNGNVIDYLNRHPDVRQHLIDLSHSCP
P
118466721YP_881048.1 aldehyde dehydrogenase [Mycobacterium avium 104]MTASSVAATTVQFNPESRLYIAGRLRDSSTGKVAENINPATEEVLGTCAD
AGAEDMDEAIAAARRAFDTTDWSTNREFRQHCLLQLHEALQEEKEDARAE
LIAEAGAPVGMTYIAQLDWPLADAVRWPAQYISEFAWERQLDVDAKMGEP
YNRVVVKEPMGVVGAITPWNFPVEIIANKVGQILATGNTMVLKPAIETPW
SALRWGRIIAEKTDIPAGVVNIVPASDNDVAQRLVTDPRVDMVSFTGSTA
VGKLIQRLSADMMKRNLLELGGKSVYLLLDDADLATTVPGCIGALMHSGQ
GCALTTRMLVPRERYDEAVELATATFASVTVGDPTDPANFCGPLVSAKQR
DRVMDYIRIGKEEGARVTIGGGKPEGLDSGYFVAPTVFADVTPDMRIFQE
EIFGPVITITPYDGGDDGAIEMANNSMYGLAGTVLGSKERAIAVGRRIRT
GSVCVNSAIFYGADAPFGGYKMSGIGRQNGIEGFEQHLQTKVIAYPID
118466720YP_882202.1 2-hydroxy-6-oxo-6-phenylhexa-2-4-dienoate hydrolase [Mycobacterium aviMADTPGRTGITEQDLREISTEKGALRYYDTGGDTGGPDSAAVLLFLHGSG
PGVTGWRNFRGILPAFAAHYRCLVLEFPGFGVSDDFGGHPMVTAFGTVAP
FLDALGVEKVHIIGNSMGGGVGINFATHNPDRVGRLVTIGGIGTNIFSPS
PSEGIRLLQEFVEDPTRQRLVDWLKSMVYDQALITEQLIEERWALATDPD
TLAAARRMYGKAAFSAMNAALNASDRPLPWAVMHKLTAPTLLTWGRDDRV
SPPDMALIPMRTIPNAELHIFPNSGHWAMIEAKAAFESTVLAFLSRG
118466719YP_882145.1 N-acyl-D-glutamate amidohydrolase [Mycobacterium avium 104]MGYDTVITNGRWFDGTGGPSAMRDIGVRDGRVVTIAAGPLDTAGATVIDA
SGQWVIPGIIDIHTHYDVEILCEPELSESLRHGVTTVLVGSCSLSTVYLD
NVDAGDIFGRVEAIPRRYVIEHLKAARSWTNPKEYVAELERRNLGPNVAA
FIGHSDMRAATMGLDRATRKDVRPSAAELARMETMLNEALDEGFVGMSSQ
QLLFDKLDGEVCRSRTLPSTYAAPRELRRLNAILRRRDKILQSGPDITNP
LSVLSQLMTSLGIGRPRLKTSLLSAADIKAIPFVIHVMDRLARVVNALGG
DFRWQHLPVPFEVYADGISLVVFEEFGSGAAALHLQTEIERNRLMRDEGY
RRRFRKDYDSRFGPRVWHRDFFDAEIVACPEQAVVGKSFGQVGLERGGLH
PVDAFLDLVVEHGERLRWRTTISNHRPEVLRKMAQSPTVQMGFSDAGAHL
RNMAFYNSGLRLLRHAHDAQKAGKPFISMEHAVHRLTGELGRWYGIDAGT
LRVGDRADIVVIDPARLDESLDRYAEHPVASYGGLSRMVNRNDDTVTAVL
VAGKLAFGSGRAAPQLGKQRYGQFLRAGRPSRTLVSTG
118466718YP_881650.1 hypothetical protein MAV_2458 [Mycobacterium avium 104]MLPRLESSDAAQAGLSIDEHLHRSQLAQRRADKWLISGSLLIGTAALGVF
GLPLFLWGVRLLRRAQREGLSVRPMLVTLLGYLVIIDAAINTVGWALDLV
ANHTLLARVLLNGWGNMFDAGYFWHYNELWVGGAAGPGEKALEVGLILTV
FTMRIAAAIGFLQMKRWGHQWMVITCWMGVVIWITYVFNMTMFADVRFAG
VVLPVVGWWLYDIFYITPFLAIPYLHTVNRELFAD
118466717YP_881767.1 methyltransferase [Mycobacterium avium 104]MARTDNDTWDINESVGATALGVAGGRAAETRSADPLISDPYAKLFLEAAG
DGIWRVYLDDELPAELVGADPQFEDRMQAMLGYTACRTKFFDDYFLAAAG
EGIRQIVILAAGLDSRAWRLAWPAGCVVYEIDQPKVLEFKIGTLKSHAVD
PIASHVSVGIDLRLDWPKALAQAGFDASAPTAWSAEGLLPYLTADAQGLL
FDRIQSLSAPGSRVAVEAFTNEFFSPESFARREEQTERYRQAAIRLGGKD
ITESGNLLYEEERTEVVDWLQAHGWTVTAATSAEDLMAASNRAVPAGLDA
AVPESVFVEGRLR
118466716YP_880905.1 MoaC domain-containing protein [Mycobacterium avium 104]MSEPVKSVVQRGLWFEEFEIGTTYLHRPGRTITEADNVLFTTLTMNTQSL
HLDAAWAAQQPGFRGERLVNSMFTLSTLVGLSVSQLTLGTIVANLGFSEV
SFPKPVFHGDTLYAETVCTGKRESKSRPGEGIVTLEHTGRNQHGDVVARA
VRTTLVQKRPSDQEAP
118466715YP_881306.1 modulator of DNA gyrase [Mycobacterium avium 104]MTPNRGIDADFLDLPRHELADAALSAATAAGASHADLRVHRLITEIIQLR
DGELETAVINREVGLAVRVIVDGTWGFASHAELAPSVAAETARRAVHVAT
TLATLSSERVELAPEPVYRDATWVSSYRIDPFDVSAADKIGVLGDYSGRL
LAADGIDHVSALLTAVKEQTFYADTFGSSITQQRVRVLPSLEAVTVDAQA
GSFDSMRTLAPPMGRGWEALAGDEVWNWTDELAQLPSLLAEKVKAPTVVP
GPTDLVIDPTNLWLTIHESIGHATEYDRAIGYEAAYAGTSFATPDKLGAM
RYGSPVMNVTADRTVEFGLATIGYDDEGVAAQSWDLVRDGIFTGYQLDRV
FARRLGHPRSNGCSYADSPHHVPIQRMANVSLQPAPEQISTDDLIARVED
GIYIVGDKSWSIDMQRYNFQFTGQRFYRIRGGRLDGQLRDVAYQATTTDF
WNSMEAVGGPATWRLGGAFNCGKAQPGQIAPVSHGCPSALFRGVNVLNTR
TEGGR
118466714YP_883474.1 MaoC family protein [Mycobacterium avium 104]MAIDPSAVGAVTEPLLFEWTDRDTLLYALGVGAGVDDLAFTTENSHGIDQ
QVLPTYAVICCPAFGAAGLVGKFNWAMLLHGSQSIRLHAPLPPAGKLSVV
SEVADIQDKGEGKNAILVLRGRGTEPDSGQLIAETLTTLVIRGEGGFGGM
PGQRPIAPEFPDREPDARIALPTREDQALIYRLSGDRNPLHSDPWFAREL
AGFPKPILHGLCTYGVSGRALVAELGGGVAANITSIASRFTSPVFPGETL
TTLIWRTEPGKAVFRTEASNPDGSNTRVVLDDGAVEYA
118466713YP_883503.1 ribosomal-protein-alanine acetyltransferase [Mycobacterium avium 104]MTAGGEPVTVGALTRADARRCAELEAQLFDGDDPWPAAAFHRELASAHNH
YVGARVGDTLVGYAGISRLGRVPPYEYEIHTIGVDPAYQGRGIGRLMLDR
LLEFADGGVVYLEVRTDNEPAIGLYRSVGFEQIGLRRRYYRISGADAYTM
RRKARQ
118466712YP_880988.1 tylactone synthase modules 4 & 5 [Mycobacterium avium 104]MSTVEGLRDPASSFAIVGYAARFPGAADADEFWRVLAEGRDAVSEVPKDR
WDADEFFDPDPDAPGKVVTRRAGFVDDVTGFDAPFFGMSAREARLLDPQH
RLLLETAWRAVEHSGTAPTDLANTNTGVFIGISTHDYLGMASDELTYDQI
EAYTAIGTSSAAAAGRISYRLGLQGPAVAVDTACSSSLVAIHQACQALRL
GECDLALAGGANVLLTPATMITFSQAHMLAPDGRCKTFDAAADGYVRGEG
CGVLVVKRLEDAIRDGDRIRAVIRGSAINQDGASGGLTVPNGVAQQRVIA
EALQRAGIAPGDVDYLEAHGTGTSLGDPIEVQAAGAVLGAGREASRPLLI
GSVKTNIGHLEAAAGIAGVIKVILALEHGMLPQHLHFRDPSPHIPWDRLA
VQVVKEATAWQRNGRPRVAGVSSFGFAGTNAHVILEEAPDGTGRAAVPPA
AVRPPGQRRFHVLPLSARTPAALVQIAGEYRDWLSAHPDTALADLCLTAG
AGRAHFEHRAALVVDSTGSAGELLAALADDRPAPGLLRGVCEDAPKTAWL
FTGQGSQYAGMARELFDTEPVFAETLTRCATVLADVLEKPLLDVIFDTDD
PASEATLRQTSYAQPALFAVEMGLARLWQSWGFEPDVVLGHSVGQYSAAC
VAGVLRVEDGARLIAERGRLFGSLPAGGRMVAAFAAAARVEGLTDEFPSL
SVAAYNGANTVLSGPGQELEQAVARLTAEKVRCDWLDTSHAFHSALLDPI
LDEFESYANQFDFGPPQRILICNRTGSALGRSVKLDGAYWRRHARQPVEF
AKSVHTLADLGCKVLLEIGPQPVLTAAALRAWPDPATAPRAIASLRRNTA
DHRQITEALAEAYIVGHLPDFGAAVGPARKLDLPTYPFQHRQYWFSEQRV
PPGSQQTSTQTTAVRLLEDGRIAELAELLDGASADQHTLDVLTKLAAQHN
QQRKSRSIAEDRYEIRWEKSTVPGPEAEATWLVVGDDDDAVAPLVDALTA
RGHQHRILVLPASDADEERLEIVLRAAAAEEAPLRIALVAALDSGTAPSM
RSLLRMQHRVLAGTRRLFRAAAAAELRQPIWLVTRGAQRVTDADTVFPDQ
SCLWGFGRAASLEYPQLWGGLADLAQGSAEEWSRLVRVASAPRDPAVGED
QIALRGSDIYVPRLTRRSGQPAAAALTLRADATYLVTGGLGSIGLEIAGH
LAAQGARHLVLTGRRAPGEAAQRRIDALSQQHGCEVRVIAADVADAHHVA
RLLGAVRAELPPVAGIVHAAGEIGTTPLSDLEDAEIDRVFAGKVWGAWHL
SEAAADLRLDFFVSTSSIASVWGGLGQTAYGAANAFLDGLAWRLREQGVN
GISVNFGPWAAGMADENARARLAQRGIKTLSPADALAGLADVMATAAAQG
VVARIDWTRFLPLYQQAGQRSLLAELAREIPDFAPAPTPSGKTGLVERLA
GAPVQQRRKLMTEFLRNAVAEVTRVDAAEIREDAGFFDLGMDSLMAIELR
RHIEQGVGKQIPATLAMDYPRLSDVAEYLLGDVLDLRGQPDAKPAPPAGT
PAPAGRTDEPIAIVAMACRFPGAADPEAFWELLSGGVDAIREVPEDRFDI
DEFYDPDPETPGKMYSRFGGYLDQIDEFDPEFFGISPREAVWIDPQQRLV
LETVWEGLERAGYSPAALRGSRSGIFVGVGANEYSHLLSAESVDKIEPHF
ITGNALNAISGRVAFALGLEGPAVAVDTACSSSLVAVHQACQALHSGDCD
LALAGGVNVLLSPVSNIAASRARMLSPVGRCKTFDATADGYVRSEGCGIL
VLKRMSDAVRDGDRVCAVIPASAVNQDGASSGLTVPNGGAQQRLIATALS
RAGLSGDDVDYLEAHGTGTALGDPIEVQAAGAVYGATRDTDRPLLIGSVK
TNIGHLEAASGVAGLIKVVLSLQHEMLPQSLHFETPSPHIPWDSLPLRVV
DKAVPWQTNGRPRRAGVSSFGFTGTNAHVLIEEAPQPVTTQDATPAAESD
ARPVDVLPLSARSPEALLALAQRYGEWLHAHPDADIGDLCFTVGAGRAHF
EHRAALVVDSVRSAREALADLADNRTRPGVARGECTDPPTTAWLFTGQGS
QYPGMARELFDAEPVFAETVTRCADAVDGLLPRPLTEVIFATDKDTGGEA
GKTLRNTAFAQPALFAVEMGLARLWQSWGVEPDVVLGHSVGQYAAACVAG
VFSLEDGARLMAERGRLFGGLPDGGRMVAVFADAQYVEELANDCPRVSVA
AYNGPNTVLSGPGADLEQIVARGASDGIRCSWLETSHAFHSELLDPVLDE
FESYAAHLDFAVPTLPLVCNRTGTVLTTETPLDARYWRRHSRQPVQFAES
VRTVAALGCTVLMEIGPQPVLTGAAVQVWPEHLAAPRAIVSLRKGVGDRR
QIAEGLAAAYVSGHRPEFAALHRRPRRKLELPTYPFQRRRFWPKASGIAG
IDGQGAAASGLLGSAKELASGDSVYTSRLSVKSQPWLADHVIYGTVVVPG
ATYAAMALAAVGPPARVQNVYFYEPIILPDKASREVQLSLHPLQEGGWSF
RVDSRPYGVPDAEWSLNADGTVVAGIEDEPAADPADHIDAVIERLDRNRP
QLLFDSFAESELEWGTTWSTSLKSLWMGDGEAVGDVTVGDELAEHLGTEP
MHPVLLDLCTGVVFPAFPALLAAEQGFNDLLLPLRYGQVSLREKMPRRFY
CRGKWRPSALDSETQVFDIDFIDRDGRHLGGIREFTVKRAPREALLRGLG
GDATRLLYTLGWHEVPPQPSNDGVANPSGTWLIAGFDELGAQLPGCIPFD
RNTDPESFGQLLARAEDRGGPVTGIVWRATQSGGRESSAESVARLETEIA
GLLTAVHALQNADGSAVKLPGGLWIVTERGVATESGEPVDPVQAALWGLG
RTIVNEEPALRCRLVDSDGSEQAVRSLAGLLGAPLDEPELAVRQGKLLAS
RLLPWARSGHLAVPRGTDYVLAPTERGAIDNLRLIEQEAPPPAEGCVQVR
VEAGGLNFREVLNVLGLYPGDPGPLGGDFAGTVTQLGSGVTGLEVGTRVY
GFMQGAFASRFNVPVQLLAPIPDGVSAVDAATIPAAALTARLAFDWAQLK
PGDRVLIHAASGGVGLAAIQLAQRHGATVFATASTYKRATLRKLGVEYVY
DSRSTDFADQILADTDGAGVDVVLNSLTNEGFIEATVRATAQHGRFVEIA
KRDIWTREQMAAARPDIAYEIVALDWACVEQPEHIHALLTEVSDGLASGE
WRPLPAEIYPLAEAKTAFRRMQQARHIGKIVLQMPKPLQPRGDRSYLITG
GLGAIGLHLAAYLAQLGAGEIVLTSRRAPDAAAWRAIDDITERYRCRVHT
FAADVGDAAQVEQLLARIRAELPPLAGVAHLAGVLDDALLSQQSPERFRV
ALAPKAFGASYLDHATRTDDLDFFIVSSSVSSLLGSPGQANYSTANAWLD
GLVAARQARGLPATGVNLGPWAQGGMASSEAARANIGAQGLIPLEPTAAL
AALAEVVANGTGQATVIKANWQRAAKLLGGARPPILDLVLPSAVGEASGD
SELLKQLQEIPVAQRAAFITEFLQREVQGFLRLAQPPAATSRFLDLGTDS
LMAVELRNRLHSQFGGAFTINATAVFDYPTIGGLAEYLAGQLPDAESEPG
AAVAANPNPGSETGTGEAEPEREAAPEPS
118466711YP_882608.1 alkanesulfonate monooxygenase [Mycobacterium avium 104]MPAEASRFLWYIPNTVEPGHRGDDTVDGWGSLDYSVDLASRAEQHGWEGA
LIGTGWGRPDTFTVATAIAARTTAFAPLVAVRPGYWHPAHFASAAATLDR
LNGGRLLVNIVSGADDVAAYGDTEVDKSRRYDRTREFIRLLRRLWTQDDV
TFHGEFFRVEHSTLRPRPLGAEQGRHPKLYFGGASPAAEQVAATDADVQL
FWGESLDGIAERIDRLKSLSDKLGREHPPLEFGLRVTTLVRDTSEQAWRD
AEAKVAKLAGTPTMMLLHDPAGSEGQRRLNDLAARGEVIDSCLYTTPSKY
GGEGAGTTWLVGSAAEVAAALRAYADLGVSHFVLSDTPYQSEVVRLGDQL
LPLLRHTALAN
118466710YP_883646.1 alpha-mannosidase [Mycobacterium avium 104]MEMTSALSTELFVGPPEAPLQLVRVAVAGCAEPTPVRVDGPGLRGRALAE
AGAEVIEVAVTVDEPVVGQRRPARAGAGEAELPFEFTVAEPGWTMFMVSH
FHYDPVWWNTQGAYTSEWTEDPPGRARQTNGFDLVHAHLEMARREPEYKF
VLAEVDYLKPYWDTRPEDRADLRRFIAQGRVEVMGGTYNEPNTNLTSPET
TIRNLVHGMGFQRDVLGADPATAWQLDVFGHDPQFPGLAADAGLTSSSWA
RGPHHQWGPATGDGSDGGVERMQFSSEFEWIAPSGRGLLTHYMPAHYSAG
WWMDSAASLAEAQDATYALFVQLKKVALTRNVLLPVGTDYTPPNKWVTAI
HRDWAARYTWPRFVCALPREFFAAVRAELAQRGGAPSPQTRDMNPIYTGK
DVSYIDTKQANRAAENTVLAAERFAVFAGLLAGAEYPQAALAKAWVQLAY
GAHHDAITGSESDQVYLDLLTGWRDAWELGRTARDDALALLSRRVDGADV
TVWNPLNGRRTDVVTARLDAAPGAGVRVLDADGAEVPAHVEHGGRSVSWL
ARDVPSLGWRAYRLVAGEAASGWAPLRGSAIANEHYRLAVDAERGGTVAS
LIADGRELIGEGRVGNELAVYEEYPSHPSQGEGPWHLLPKGPVVCSSATR
ARVRAYRGPLGERVVVHGRIGTLLRYTQTLTLWRGVARVDCRTTIDEFTG
ADRLVRLRWPCPVPGAMPVSEVGDAVVGRGFALLHDGDRALDTARHPWTL
DNPAYGWFGLSSAARVRISDGGLRCLSVAEVVSPAETTSGPLARELLVAL
VRAGVTATCSAADGPRYGHLEVDSNLPDVRVALGGPRRNAFTAAVLADAD
PAYADELRRQLAATGRARLWVPARAPLAAVWLPDADLRDARALPVLVVDG
RDERELRAAIAALVDDLGDAEITVTQQSPSRTADFDDYTVALLNLGVPSF
AVDTAGTLHTALLRSCTGWPSGIWIDDPRRSAPDGSNFQLQHWTHHFDYA
LVSGPGDWRRAEIPARSAQFGNPLLAVAAGGGAGTGPGLPPAGSLLRVQP
AESVQLAALKPASNPLASGSAARPDPTAVALRLVETAGAGTRVAVDSDVA
TVSDLHAADLLEKPSRQVNSIDLHGYQVATVLARLHAPAAPAGAAALAPH
AEAAQPLYARYWLHNRGPAPLGGLPAVAHLHPARASADPDSRVTLRLSAA
SDCTDATLAGAVLLRCPDGWSADPAELPLRLCAGQHLQADIAVSVPARAA
PGLYPVRAELRLTGEHLPASWRQGVEDVCVVAVGDGERAPLIYLADEPAE
VTLEPGEAADLTVAVGSHARAELALEAHLISPWGTWDWMGPAAVGAVLPA
RGAVDLGFRLAPPAWLDPGQWWALVRIGCAGELLYSPAVRVTVT
118466709YP_884181.1 hypothetical protein MAV_5063 [Mycobacterium avium 104]MVAANAEHDIRLGDNPFAVDPVDDLLHAVPANSAGWSETMYFHAWSPEEG
VGVFVHTGRWPTDLDLWWAQTIALLPDGRLLVDRSWGRAADNRGPATGNL
RITCQEPLRSWRLTFDGAGAVTDRASMACGPVGAGRAQPFSFDIELRAAA
PVWDMAGALGAPRPRVDGLSWASFHHTQGFYATGELCSGQQRWSMDGVAH
RDHSSGVRDVTGLGGLHFFVVVFPKSGRVANGLVNWRTNGAIDHRVFTVQ
EKGVCEVGFNVRVTGLQSYRTHEPHDLTITMHREAGVYPLRASWLHGYSL
TVLSPNENINGVDLETQPDPMVITQSTVRVVAPDGEIGYGVIERDYRPSM
LPSPRER
118466708YP_883188.1 NADH dehydrogenase subunit D [Mycobacterium avium 104]MSTTTESTHDGAGETLVVAGGQDWDKVVEAARSADPGERIVVNMGPQHPS
THGVLRLILEIEGETVTEARCGIGYLHTGIEKNLEYRYWTQGVTFVTRMD
YLSPFFNETAYCLGVEKLLGITDQIPERVNVIRVMMMELNRISSHLVALA
TGGMELGAMTPMFVGFRGREIVLTLFESITGLRMNSAYIRPGGVAQDLPP
NAKTEIAQALDQLRQPLREMGDLLNENAIWKARTQDIGYLDLTGCMALGI
TGPILRATGLPHDLRKSEPYCGYENYEFDVITADTCDAYGRYMIRVKEMW
ESIKIVEQCLDKLQPGPIMVENGKIAWPADLKVGPDGLGNSPEHIAKIMG
GSMEALIHHFKLVTEGIRVPPGQVYTAVESPRGELGVHMVSDGGTRPYRV
HYRDPSFTNLQSVAAMCEGGMVADLITAVASIDPVMGGVDR
118466707YP_882613.1 alanyl-tRNA synthetase [Mycobacterium avium 104]MQTHEIRKRFLDHFVKAGHTEVPSASVILDDPNLLFVNAGMVQFVPYFLG
ARTPPYPTATSIQKCIRTPDIDEVGITTRHNTFFQMAGNFSFGDYFKREA
IELAWTLLTGSVEQGGYGLDPERIWTTVYFDDDEAVRLWQEIAGLPAERI
QRRGMEDNYWSMGIPGPCGPSSEIYYDRGEEFGVGGGPIANEDRYVELWN
LVFMQSERGEGTSKTDFEILGPLPRKNIDTGMGVERVAFVLQGVHNVYET
DLLRPVIDAVAARAPRPYDAGNHDDDVRYRIIADHSRTAAILIGDGVTPG
NDGRGYVLRRLLRRVIRSARLLDIEGPIVGDLMATVRDAMGPSYPELVTD
FDRIARIAVAEETAFNRTLAAGSKLFDEVASTTKATGAKSISGSDAFTLH
DTYGFPIELTLEMASEAGLQVDEVGFRELMAEQRRRAKADAAARKHAHAD
LTAYRELVDAGPTEFTGFDELSSEARILGIFVDGKRVPVVTHGGDGADRV
ELVLDRTPLYAESGGQIADEGTISGTGAGESARAAVTDVQKIAKTLWVHR
VNVESGEFVEGDTVIAAVDPQWRRGATQGHSGTHMVHAALRQVLGPNAVQ
AGSLNRPGYLRFDFNWQGPLTEEQRTQIEEVTNQAVQADFEVHTFTEQLE
KAKAMGAIALFGESYPEQVRVVEIGGPFSLELCGGTHVHNSAQIGPVTIL
GESSVGSGVRRVEAYVGLDSFRHLAKERALMAGLASSLKVPSEEVPARVA
NLVERLRAAEKELERMRLASARAAAGNAAAGAERIGNVRVVAQRMSGGMT
AADLRSLVGDIRGKLGSDPAVVALIAEGEGGSVPYAVAANPAAQDLGIRA
NDLVKQLAAPVDGRGGGKADLAQGSGKDPAGIDAALDAVRSEIAAIARVG
118466706YP_883241.1 UDP-glucose 6-dehydrogenase [Mycobacterium avium 104]MSTEPLVGVVGVGYVGLTTAVCVAAAGRKTVAVDINPDRVGRLRAGVAVI
DEPGLSELLGDGLAGGVLRFSADFAELADRDVVFVCVPTPSAPDGHADLA
AVESVIDRLGRVLRRGAVVALKSTVPVGTTSTMAQRLCHKGIRVVSTPEF
LREGRAVDDFRNPDRLVIGSHDELAAQLVHQAYGLAGHRVLRMSPESAEL
AKYASNAFLAVKLSYTNSLAALCARVGADIDDVTCCMGADRRIGAEFLRP
GPGWGGSCLPKDTAALLDIAHRHRVSFAEVEAARQTNTAQARRIVTALRH
TLGRPLSGRRITALGLTFKAATSDTRESPALAACRELAAAGAQVAGYDPQ
LPNIDPAVLQQNRVTAVDDPYRAAKAADAVVVLTEWPQFRSLDWRAVAQD
APLAVVLDARNSLDPATVREAGLRYLGNGVPQGF
118466705YP_881412.1 cobalamin biosynthesis protein [Mycobacterium avium 104]MLATHPVGVLIGYLADRALGDPRRGHPVALFGRAAAGLENLSYRDGRVAG
ALHVAVSIGAVGLLGLAVHRAAARAGPRWSIAATAAAGWVCSGGSSLTRT
GLAMAELLQRGDVDAARRLLPSLCGRDPAALDAAGLARAALESVAENTSD
AQVAPLLWAAAGGVPAVLAYRGINTLDAMIGHRSPRYLRFGWAAAKLDDI
ANYPAARVTASLTVLLAPVVGGSPSGAARAWRRDAARHPSPNAGVVEAAF
AGALGVRLGGPTQYRHQLQIRPTLGAGREPTVTDLRRAVRLSAAVQAAAV
ALAAGLLAAYRRRP
118466704YP_880301.1 short chain dehydrogenase [Mycobacterium avium 104]MILDRFRLDDKVAVITGAGRGLGAAIAVAFAEAGADVLIASRTESQLEAV
AEQVRAAGRRAHVVAADLAHPESTAELAGRAVEAFGKLDIVVNNVGGTMP
NTLLTTSTKDLKDAFTFNVATAHALTVAAVPLMLEHSGGGNIINITSTMG
RLAGRGFAAYGTAKAALSHYTRLTALDLCPRIRVNAIAPGSILTSALDVV
ASNDELRAPMEKATPLRRLGDPVDIASAAVYLASPAGEFLTGKTLEVDGG
LTYPNLDIPVPDL
118466703YP_883586.1 30S ribosomal protein S8 [Mycobacterium avium 104]MTDPIADFLTRLRNANSAYHDEVTLPHSKLKANIAQILKNEGYISDFRTE
DARVGKSLIVQLKYGPSRERSIAGLRRVSKPGLRVYAKSTNLPRVLGGLG
VAIISTSSGLLTDRQAARQGVGGEVLAYVW
118466702YP_882942.1 signal recognition particle protein [Mycobacterium avium 104]MFESLSDRLTSALAGLRGKGRLTDADIEATTREIRLALLEADVSLPVVRA
FVTRIKERAKGAEVSGALNPAQQVVKIVNEELIGILGGETRQLAFAKTPP
TVIMLAGLQGSGKTSLAGKLAAWLRGQGHTPLLVACDLQRPAAVNQLQVV
GERAGVPVFAPHPGASPESGPGDPVAVAAQGLAEARAKHHDVVIVDTAGR
LGIDDELMAQAAAIRDAIDPDEILFVLDAMIGQDAVTTAEAFREGVGFTG
VVLTKLDGDARGGAALSVREVTGVPILFASTGEKLEDFDVFHPDRMSSRI
LGMGDVLSLIEQAEQVFDAEQAEAAAVKIGSGELTLEDFLEQMLAIRKMG
PIGNLLGMLPGAGQMKDALAAVDDKQLDRLQAIIRGMTPEERADPKIINA
SRRLRIANGSGVTVSEVNQLVDRFFEARKMMSSMLGGMGIPGLGRKSATR
KAKGAKGKAKKGKKGARGPTPPKVRSPLGPGMPAGYPDLSQLPEGLNELP
PGLADFDLSKLKFPGNK
118466701YP_880291.1 hypothetical protein MAV_1035 [Mycobacterium avium 104]MDVNAVSNPLERCYMSAFLRSVSLSMASAAAVGFVLVVGPAPTANATPCG
APEANVDPPAAPPAMPAPQPVVQPPTGRRPTHTNDQAPLPKLGPLISSLL
KPSAPGRQYSAPVHPRAEGPGPDPSAPMYPQAEVLPPGPNPPTPGGAVPP
NANQLRPNAAPMPQPQPQPQPAPGPPPPSIAGAPTSLVDWVTGPNGPNKT
LQRFSISGTDLGIAWDNGDPANRQVLMAFGDTFGYCKVHGQQWRYNTLFR
SNDHDLSHGIHIADGVPNDRYSGSPVWAPGLSKQVVNTIHKAAHETGIIP
TSGMSMGRTQYMSYMSIRQWGRDGEWSTNYSAIARSTDNGQNWGIFPTSI
RTASPDAIPGAGFTPGNENFQMGAFLKGNDGYIYQFGTPSGRGGAAFLSR
VPPNQLPDLTKYQYWNGDNGGHWVANNPGAATPIFPGPVGEMSAQYNSYL
KQYLVLYTDGGSNDVVARTAPTPQGPWSPEQPLVSSFQMPGGIYAPMIHP
WSSGRDLYFNLSLWSAYDVMLMHTVLP
118466700YP_880168.1 Rieske (2Fe-2S) domain-containing protein [Mycobacterium avium 104]MPHFPKPAAGSWTENYPELGTGPVDYTDSIDPAFFEAEREAIFKKTWLNV
GRVNRLPRTGSYFTRELPSAGKGTSVIIVKTKDGSVKAYHNVCRHRGNKL
VWNDFPNEETSGTCRQFTCKYHAWRYSLDGDLTFVQQEEEFFDLDKSNYG
LAPVRCEVWEGFIFINFDDNAAPLTDYLGPLAKSIEGYPFGEMTETYSYR
AEVGSNWKLFIDAFVEFYHAPILHQGQYTKEEAAKIQKFGYEALHYELAG
PHSLQSTWGGQAPPPDMSMVKPMDQVLRSGLFGPWDKPEIIEKLDLPPGV
NVKRVPQWGIDSWLFYPNFMLLIWEPGWFLTYHYWPTAVDRHIFESTLYF
VPPRNARERLAQELAAVTFKEYALQDANTLEATQTMIGTRAVKEFLLCDQ
EVLIRHLHKTTGDYVKEYQNNGHVAAR
118466699YP_884403.1 hypothetical protein MAV_5292 [Mycobacterium avium 104]MQLRHLSIPFLVAEAGGDPWSIDSGLQAGRPAQIASLARAFHDAGMSTAE
ADVAFAAARGRFEASWNHRNGALPINDSAEVQRVTRALAVEGRQLPRIAT
DLETIAAVLAESQRTSTWYIEALEYDLAAIDDEIGQALEEADHCAAEELR
YSAVTETKAITLVLEQIRESYSRLLHSALARLQADGVDPANVRGVDELSI
PPADTGPEQVKWWWDSLSAAQQRLLIDQHPQELGNLNGIPAEARDSVNRA
TMTDDLSKVEAVARVRGVSVQALRDNALHNRDIDMFRNPAAYGLCATDIV
RYQNAVKTNDCLNKACDPGLPLMLWAYDPLAFAGKGRAGIAIGNPDKSRN
TAVVVPGTNSSVRGGWMSDGADDAINLYTQAQRADPHHATAVLAWMGYDA
PEFDDSHWEQAVTDPAKLEQVGTPWRARQAGVLLAGDVNGLAATHDAGSR
AHVTVIGHSYGSTTVADAFANSGMRANDAVLTGCPGTDLAHSAADFHLDG
GRLYVGAASTDAISWIGESGSGLPNGLNETLGGPLGPFAGLGTDPAHAGF
GAARFRAEVAGSHSVMPWFTDHSDYYDVGSEALHNMTEIVTGRGNELAAE
GMLAPDRNAARVSILGRVHTPLGTLSLPRVEIRMPVVVDPEWERPARSVT
NEHGF
118466698YP_881721.1 helper protein [Mycobacterium avium 104]MTTAAKPVAPSSAAPLAADLDAALRRLKLATVRRNAAEVLQVAKTQRWTP
EEILRTLVEAEIAARDASNTANRLKAAAFPVTKTLDGFDVTGSSITAATF
DYLSSLEWIRAQQNLAVIGPPGTGKSHLLIGCGHAAVHAGFKVRYFTAAD
LIEVLYRGLADNTVGKIIDTLLRADLVILDEIGFAPLDDTGTQLLFRLVA
AGYERRSLAIASHWPFEQWGRFLPEHTTAASILDRLLHHASIVVTSGESY
RMRHADHKKGAAKN
118466697YP_883246.1 PknJ protein [Mycobacterium avium 104]MTNQQDPYWRNPLSYDPLGRVPPPEPEPVGPPPTQPATLAPPYRPGVNTL
ATLSLVFAFLFAPAGAVLGHLGLAQIRRTGELGRDRALVGVTLSYVFILL
AVVALAGWATLGGSTAAHRAAHEATTSAGPPPPTVPPDTITTLLPGLDAL
RNITADANLDVGPTWNSPGRSAQDGSIDRPECWGSIAAGSPDAYTPGAFT
GYHAGEFTDTRSMLKSIQVIQGVAAFRDAPGAQAQLDALLAGWRQCGGST
VTVTAPGGQPIAMALSTPADAGNGITTLDLTPKGIQVRSARAVAAKANVV
VDLNVSASGTTDSERPRLAAVSIANYILGKIPG
118466696YP_880532.1 mmpL protein [Mycobacterium avium 104]MLQKIARVAIAAPRRIIALGVLVFLAAAVFGIPVAKSLSPGGFQDPDSES
ARAIGVLTDKFGQSGQQMLILVTAPGGSNSDPARRVGTELVEQLQRSPLV
YNVSSPWTAPPQASADLVSRDGKSGLIVVNLKGGENFVQNNAQTLADQFV
HDRDGVTVRAGGAAMQYAQINTQNQADLLVMEMIALPLSFLVLIWVFGGL
LAAALPMALGALAVVGSMSVLRLITFTTEVSIFALNLSTALGLALAIDYT
LLIVSRYRDELAEGHDRDQALIRTMATSGRTVLFSAVTVALSMSATVAFP
MYFLKSFAYAGVATVAFVATASIVITPAAIVLLGDRLDALDVRRLLRRAL
RRAQPVRKPVEQLFWYRSSKFVMRRWAPVGLIVVGLLLLLGLPFFSVKWG
FPDDRVLPRSASAHQVGDRLRSGFAHDSATSVPVVIPDAAGLSPADLDDY
AAALSRVPDVSAVSAPGGTFTGGTRVGPPAGATGLGDGSAFLTVSSTAPL
FSTANDVQLKRLHEVPGPAGRSVEMGGVAQVNRDSVDAVTDRLPLVLGLM
AAITFVLLFLLTGSVLLPAKALACNFLSLTAAFGALVWIFQDGHLGALGT
TPSGTLVANMPVLLFCIAFGLSMDYEVFLLSRIREYWLASGAARPARPTP
KRAHAANDESVALGVARTGRVITAAALVMSMSFAALIAAHVSFMRMFGLG
LTLAVFADATLVRMVVVPAFMHVMGRWNWWAPKPLAWLHDRFGISEAADE
EPRLRACPRTRRIRRIARRRGRRTGAQHRLTAVRPTARRVWRSDPILRLI
RGGRCTQA
118466695YP_882706.1 enoyl-CoA hydratase/isomerase [Mycobacterium avium 104]MAQNPTPPDTPRPPEGDWLGTPYLRFERYGPIALCTIDRPQARNALSPAM
YFGIRYAVGRLNEDPDLAGLVLTGTGDVFAPGGDMGGGGGEDNWITFGSA
LGMDVTPFDAVRTSAKPIVSAVNGLCQGGGFQIALCSDLSVVSDRATFRV
PELFRGYADTYYSQMLARVIGPVRTRDLMFTGRVLTAVEALDWGLVTRVV
PHENLLDAAKDLLAQCCRTAPRARGVIKSSLDNYLGLYDRIGMTASLSDA
EAIEGFRAFKQRRSPDWVHPDLRVDGRL
118466694YP_883037.1 electron transfer flavoprotein- alpha subunit [Mycobacterium avium 104MEHAEGALKKVTSELITAARALGEPSAVVVGTPGTAAPLVDGLKEAGAAK
IYVAESDDVDKYLITPVVDVLASLAESNAPAAVLLAANADGKEIAGRLAA
RIGSGLLVDVVEVKEGAKAVHSIFGGAFTVEAQANGDTPVITLRAGAVDA
EPAAGAGEQVTVEVPAAAENATKITAREPAVAGDRPELTEASIVVSGGRG
VGSAENFKVVEELADALGAAVGASRAAVDSGYYPGQFQVGQTGKTVSPQL
YIALGISGAIQHRAGMQTSKTIVAVNKDEEAPIFEIADYGVVGDLFKVAP
QLTEAIKARKG
118466693YP_884193.1 phosphotransferase [Mycobacterium avium 104]MTVLRALWRQNFPVARPVGHRDLSTGVPFVITSWIHGTVIHTECDAQRLT
APERLNLGFQVARTLANLHQIPPAAVGLLPPRTGHIDRQLAGLSDVWTWA
GTGSVHDSSWRAIRARLVERRPQRRTRLTLVHGDFRLANLVLAEDAIRAI
VDWDWCTIGDPIADLAWLLMDWRSPRELASCLPNPTRAGGFPTRGEMVEA
YRQATGCSLDDLPYHRAMAHWRAATLLQAEATRQTAHVLDEETPALDVDD
VDDTIADLFSGAASFLRAAK
118466692YP_881864.1 hypothetical protein MAV_2673 [Mycobacterium avium 104]MIAGAVAIAGLLLSSPPRVHAAPAPEVEYVYDVVVRRHYGFPDNDALGYG
HGICDKVGRGEGYGQVMGEVKSDVTPNDEFAANYLVSYAVNLLCPELIWQ
LRNSAAGYQPPGGASAPGTYY
118466691YP_880613.1 hypothetical protein MAV_1369 [Mycobacterium avium 104]MITPLVFAGAVSATGPSLPVRTPPVHAAVTPVAAVSPTFPDLTGPAVVAI
DRGPTAFHVAEPALSAPPPAAIVNAPGALGIPSIALAAYRNAEQKMAVAA
PGCGVSWNLLAGIGRIESGHAGGGAVDARGTAITPIYGPSLDGTLPGNEV
IIQSAAGNRVTYARAMGPMQFLPGTWARYASDGKGDGVADPQNLFDSTLA
AARYLCSGGLNLRDQSQVLTAILRYNNSMPYAQNVLGWAAAYATGVVPVD
LPPMTGPPPPLGDAHLEHPEGLGPNLPMNINGLPLDDPLARVPLIDLSSP
ALGSPQPMFPWMTPTPQQAPTQVPGCTVICISSQGSPPAGPPPPFGAPPP
FAPPPSGPPPFAPPPPDAGPVPAPPAGPAPQAAPAPPAGAAPQAPSPKSA
GPTPNAPKKPGPA
118466690YP_880417.1 KDP operon transcriptional regulator KdpE [Mycobacterium avium 104]MTRVLVIDDEPQILRALRINLSVRGYEVVTASTGAGALRAAAEHKPDVVI
LDLGLPDISGIDVLAGLRGWLTAPVIVLSARTDSSDKVEALDAGADDYVT
KPFGMDEFLARLRAAVRRNTAASEMEQPVVETESFTVDLAAKKVTKNGSE
VHLTPTEWGMLEVLVRNRGKLVGREELLKEVWGPAYATETHYLRVYLAQL
RRKLENDPSHPKHLLTESGMGYRFEA
118466689YP_884322.1 cyclododecanone monooxygenase [Mycobacterium avium 104]MTPDVDTQQDGCGPTQTPDDIDIDALRQKYAHEREKRLRKEGSKQYIELE
DDFSGYYEVDPYTPVTPREPIREDIDVAVLGGGFAGLLSAAHLKKAGVDD
VRIIELGGDFGGVWYWNRYPGIQCDNESYCYIPLLEELDFMPSKKFADGA
EIYQHCRNIGKHFGLYDSAIFSTQVHDLRWDEQIKRWRVSTNRGDDIRAR
FVVLASGPFHRPKLPGIPGIKTFGGHSFHSSRWDYDYTGGDSGGNLHKLA
DKRVGVVGTGATGIQIVPFLARYAQHLYVFQRTPSTVDARNNTPTDPEWV
KTLRPGWQRERQRNFHAWTFEGMAPGQPDLVCDFWTELGRNTAARVLALD
DPASLTPEQFMAIREEEDYKIMERLRRRIDTLIDDPATAEALKPYYRFLC
KRPCSNDDYLPSFNRPNVTLVDVSASKGVERATEKGLVANGVEYELDCII
YASGFEITTEISRRYSIETIAGRDGLSLFDYWRDGYKTLHGMTSRGFPNQ
FYTGFTQVGISANIAANYELQGEHIAYIIAEALKRGAATVEPSDEAQQQW
CTTIRETAVDNSAFDAQCTPGYYNNEGGGGGEGIRSHLGEPYGPGFYAFE
DLLRAWRDKGDLEGLVLGS
118466688YP_882264.1 TPR repeat-containing protein [Mycobacterium avium 104]MEAKQLAPDIRRELSTLDRATADAVARHLVAAGELLDEDPEAALRHARAA
RARSSRIAAIREAVGIAAYHCGDWAQALAELRAARRMGSKSALLALIADC
ERGLGRPERAIELARGPEAAELSGDDADELRIVAAGARADLGQLEQALTI
LSTPQLDSTRTGSTAARLFYAYADTLLALGRNDEALQWFLHAAAADLDGV
TDAEDRVSELA
118466687YP_882969.1 XRE family transcriptional regulator [Mycobacterium avium 104]MDDHDGKAAAIPNNRLMQRLQAKGLSPQRFATAMSVDVKTVRRWLSNTNY
NIREDNARRAATLLGCTPHDLWPNQYSPTMASALATMSPSGPFTATLYAS
RTQLPISAWQQHFADATTSIDILVLAATFLFDTLDGFLDTLLDAAARGVA
VRFLVGDPDTATMILRGVEEGIGEAVIARCRTSVELLAPHAGTPGLDIRT
HDTTLYTSIFRVDDAMIVNFHIYGSPGRNNPVLVLSRHHEPRLWATLEEA
FTQVWDHATPLTTKG
118466686YP_884301.1 hypothetical protein MAV_5184 [Mycobacterium avium 104]MPSEINNSETRLSWVLAVLAGVLGATAFTHSAGYFVTFMTGNAQRAMLGY
FRGDVVLSVTAGVLIVCFVAGVVIASVCRRHFWVDHPHGPTVLTTFSLVA
ATLVDVIDEGWEENLLDFAPIMLVTFGIGALNTSFVKDGEVSVPLSYVTG
TLVKMGQGIERHIAGGTAADWLGYFLLFASFVVGATVGGFISLFVNGTSM
LVAATVMCALTTGYTYFHSDRRALLDEA
118466685YP_881496.1 cytochrome C oxidase polypeptide 4 [Mycobacterium avium 104]MHIEARLFEFIAGFFFLTALLYGVLTALFATGGEEWAGTTALALTGGLAL
IVATFFRFVARRIDTRPEDYEGAEISDGAGELGFFSPHSWWPILIALSGS
VAAVGIALWLPWLIVAGVMFILSSVAGLVFEYYLGPEKH
118466684YP_881615.1 hypothetical protein MAV_2420 [Mycobacterium avium 104]MKAATAKMRRVEWNCNRYLRVERTVMKFQDTYFSREDRYSIGVESTSGRY
YASIPVSNGILDYEEYYELTPDQYHQFLNDRGAAIDFVEACRRHEHDDLL
LQQPGSNRGTSA
118466683YP_881074.1 TetR family transcriptional regulator [Mycobacterium avium 104]MTVTYSRSMTPSSSTAAAPQLDTSRGERTRSAILDASRRLFLERGYAGTP
INAITEACGISRAGFYTYFKDKREIFNVLGKTAYHDALAVIAEWAEAPEP
LGPADIRVWVGHYFDYMDQHGAFVLASAHSAPDDDEFRNSRNRMVTRASW
KLGQAIAGGGGVHSPDVVGVAVMGLLDRAWHTVHRQTVAVDRSEMIAVVA
EMIVAMTRR
118466682YP_883359.1 hypothetical protein MAV_4218 [Mycobacterium avium 104]MPDGKANAREHALVIGGSIAGLCAARVLSESYSAVTVCERDELPAAPASR
ATVPQDRHLHLLMARGAIEFEKLFPGLLDDMTAAGVPRLHNRPECIHLGA
AGHVLGTGQTLRDEFTAYVPSRPQLEWQLRKRVHAIGNVTVLRRSVAQPR
FDPARARVTGVWLDPVAGGSAEFVAADLVVDAAGRGTRLPVWLSQWGFQR
PPEEVIDIGINYATQHFRIPDGLIAQKVVVAGASHDEPLGLGMLCYEDRV
WVLTTFGVADAKPPRTFPEMLTLARRLLPAHFGDALARAEPLGDPAFHAF
PASRWRRYDKLDRVPAGIVALGDAVASFNPTFGQGMTMTALQAGHLRRAL
RCPDDRLAAALYRATAKTTFPVWTMNAIGDVTFHHATTKRPAPWWWRPSG
ALFDQFLGAAETEPVLAEWFLRRFSLLDSLYLIPPPRIVGRAVGHNMRLW
LGQRRGAGRPGTATARPSP
118466681YP_882213.1 stress responsive A/B barrel domain family protein [Mycobacterium aviuMYSVTRLIDIAEQDRDRMAAALRRAASDAGALHWVAGPTLPGSRNGGDLL
VHLRFASKRQWDCTAACFAAILDDPAVGRVNGTTYSGTPVHAGQKPGTVY
RTLLLAVSPDTAEDTVARFEADLRLMPRYVRTITGWQLSRVEEATGASAW
THVFEQLFTDVDGLMGPYLMHPIHWAVVDRWFDPECPDVIVRDRVCHSFC
ISTDPVLT
118466680YP_883085.1 TetR family transcriptional regulator [Mycobacterium avium 104]MSGVEQRGQLRFCDPRVPAPERGDAARNRALLLDAARRLVAERGADAVTM
DDVAAAAGVGKGTLFRRFGSRAGLMMVLLDEDERAIQQAFLFGPPPLGPD
APPLDRLVAFGRERLRFAHTHHALLSAANRDPRTRYGPPSAVLRRHVRVL
LAATHTTGDLDAQADALLALLDADYVHHQLNDHGHTLQTLGDAWESLARK
LCGN
118466679YP_879880.1 long-chain-fatty-acid--CoA ligase [Mycobacterium avium 104]MTTDPRTVPAALDRLARRLPDHDALITEDRSFTAAALRDEVHRAAAALIE
LGVRAGDRVAIWSPNTWHWVVACLAIHHAGAAMVPLNTRYTAAEAGDILA
RVGAPVLFGMGRFLGHDRLADLDRAALPALRHIVRIPIETDDPVPGSWDE
FIAHGTDLGAVAERAAAVTSDDVSDILFTSGTTGRSKGVLCAHRQSLSAS
ASWAANGKITSDDRYLCINPFFHNFGYKAGILACLQTGATLIPHLTFDPL
RALQAIEQHRITVLPGPPTIYQTLLDHPARRDYDLSSLRFAVTGAATVPV
VLVERMQSELDIDIVLTAYGLTEANGMGTMCRADDDAVTVATTCGRPFAD
FELRIDDSGEVLLRGPNVMLGYLDDPDATAAAIDADGWLHTGDIGVLDEA
GNLRITDRLKDMYICGGFNVYPAEVEQVLARMEGVADAAVIGVPDERLGE
VGRAFVVPRPGAQLDEQSVIAYTRDHLANFKAPRSVRFVDALPRNSGGKV
VKPQLRELD
118466678YP_884157.1 hypothetical protein MAV_5038 [Mycobacterium avium 104]MGTLDLGPRIEAAARRWGARRPQGAVRYSGPTRQPPAECRTE
118466677YP_879375.1 30S ribosomal protein S18 [Mycobacterium avium 104]MAKSNKRRPAPEKPVKARKCVFCAKKDQAIDYKDTALLRTYISERGKIRA
RRVTGNCVQHQRDIAIAVKNAREVALLPFTSSAR
118466676YP_881363.1 phosphoadenosine phosphosulfate reductase [Mycobacterium avium 104]MSDGATDFTEEQLRELAERGASELEGASAIDILRWTDEHFGPVDGPRGWA
TCKYVVACNMQDAVTVSLASDVRPGVPVLFLDTGYHFPETIGTRDAVEAV
YDIHLLNVTPEHTVAEQDELLGKDLFARDPNECCRLRKVEPLRRALRGYA
AWVSGLRRVEAPTRADAPLISFDESFKVVKVNPIAAWTDEQVDEYIERNG
VLVNPLVQEGYPSIGCAPCTAKPAPGEDPRSGRWRGRNKVECGLHAS
118466675YP_881652.1 short chain dehydrogenase [Mycobacterium avium 104]MALEQFRLDGQVAIVTGAGKGVGAGIARVLAEAGATVVGTARTEADIVGT
MEGIEAAGGKGLALVADAMSRPDGERVVNTAMERLGRIDILVNNVGGSSY
ARFLDITDEDFRHTFDWCVTSAFIMSQLVAAHMLAAGHGSIVNISSGSAR
FGIRALTAYCVAKGGLEALTRAMAQELAPKIRVNAIALGSFATDGLRGSL
DLMPGSLEKMLAATPLHRLGDVEDLGRLTVYLCTRDCYATNAIFHVDGGL
DSNNSPLPIPDY
118466674YP_880125.1 methylmalonyl-CoA mutase- N-terminus of large subunit [Mycobacterium aMDNTAHTPSGIPLQPVYGPADRSAEPPQPGEFPFTRGNFASGYRGKLWTF
RQYSGFGTAEESNRRYRYLLEQGGTGLSVALDLPTQCGYDSDDPEFGEEV
GRVGVAVDTLADFEILFDGIPLDKLSTSMTINGTAAILLAFYVAAAEKKG
IPRANLTGTIQNDILKEYASRGTWIWPPEPSLRLIADTIEFCAAEVPKFN
AISVAGAHFRDAGANAVQEMAFTLADGVTYCDTVVERGRMTIDQFAPQIS
FFFYTHGDFFEEIAKYRAGRRRWATIVRERYGATTAKASMFRFGCVCGGA
SLYAPQAHNNIVRVAYEAMAAVLGGVQSMFTAAWDEPFALPTEETTTLAL
RTQQILAYETGVASVADPLGGSYFVEALTDETEARIIEIMADLDRHGGMV
SAIEDGYLQGLIADEAFRLHQDIEAGTRPVVGVNRFVTEEPEHDVVTYEL
DAEGRDLQLKRLSKVKAERDSAAVKSSLAALSRAAEGDDNLMHKLIDCAN
AYCTVGEMVSALKAVWGEFQQPVVF
118466673YP_880095.1 gp79 protein [Mycobacterium avium 104]MTDYHQTAAIALAKCAAYDPWFPKASHAIVDSWAEQIARYELQPPDVLAG
VAKMYAENGSGFRPLPKDLTDAARAVRRDRTERESDAERRAREDRRDAEL
DRRNELAQLVDSIARSKAIDDE
118466672YP_883329.1 GTPase EngC [Mycobacterium avium 104]MRPGDYDESDVKIRSGRGSRPRTKTRPEHADARAAMVVSVDRGRWGCVLG
GDPDRRVTAMRARELGRTPIVVGDDVDVVGDLSGRPDTLARIVRRGERRT
VLRRTADDTDPTERVVVANADQLLIVVALADPPPRTGLVDRALIAAYAGG
LVPILCLTKTDLAPPEPFAQQFADLDLTVVAAGRDDPLPAVADLLAGKIT
VLLGHSGVGKSTLVNRLVPDADRAVGAVTEIGKGRHTSTQSVALPLTERL
GTTGWVIDTPGIRSFGLAHIQPDDVVMAFSDLAEAIADCPRGCGHMGPPA
DPECALDTLTGPAARRVAAARRLLDALNQTS
118466671YP_882903.1 cytochrome C biogenesis protein transmembrane region [Mycobacterium avMDRGLVGLAVAAGMVAALNPCGFAMLPAYLLLVVRGAGARAPGVAAAGRA
LAASAGMALGFLTVFGLFGALTVSAAGAVQRWLPYATVVVGVLLVALGGW
LLAGRSLSALTPRPVGPLWAPTARLGSMYGYGISYAIASLSCTVGPFLAV
TAAGLRSGSLLTGAAVYLGYVAGLTLVVGVLAVAAATAGAATADRLRRMV
PFVDRISGAVLVLVGLYVAYYGGYEVRLFGAGGDPRDAVIGAAGRLQGAL
AGWVHRHGLWPWALALLALAAVRFGRARRRGRRADRLPDPAAAAAPQVAD
QHHEDQRRESDQKPVLDVADVVAAQHGQQQPEDDQADDVPGPVVDPAPSP
RRRRHLDGVDAGEVLDLGTGHGESPSDRIGLSNPDSGTTAGRARGARPHH
GPRRWRAAQ
118466670YP_882697.1 hypothetical protein MAV_3515 [Mycobacterium avium 104]MSGAIHPGYRRYVAIGDSQTEGLWDGDDSTGLLGFADRLAAMLDSAYPGL
QYANLAIRGKRIGHVLAEQVPAALAMRPDLITVCAGMNDVIQPGRSFGPA
LTDLDHIYAALAGSGATVVTTTFPNVAQFLPLGRLVAGRLTRINAAIRAA
ANRHGFRLVDLYSAPSMRELDTWAVDRVHASTKGHILFAAAAAEALNLPE
SSHDWALGGQQRARRSVAAGAYEQWRWTQDSFVPWVWRRLRGLSSYDGRE
PKRPRLQGVGSASGILDA
118466669YP_882411.1 hypothetical protein MAV_3229 [Mycobacterium avium 104]MRRTFEDLIAEAEAAPVDGWDFSWLDGRATEERPSWGYQRLLRDRLSTVS
AALDIHTGGGEVLAGAGPFPPTMAAIETWPPNAALATARLHPLGAVVVAV
RDEPPLPFADHAFDLVTSRHPVSVWWSEIARVLRPGGSYFAQHIGPATMG
ELVEYFIGPQPQKWAEFHPDAVRAQVAAAGLRVVEVRMERLRAEFFDIGA
VVYFLRKVIWTVPDFSVARYRDRLAELHERIESQGPFVAHPTRVLVEARK
PE
118466668YP_881727.1 virulence factor Mce [Mycobacterium avium 104]MAIALTAVLLGGIVTVVRSAAGVGRTTVVGYFANSTGLYNGDSVVILGVP
VGKIEKIEPEPDRVRITFWLNDKYKVPADVKAAILSPSLVTPRSIQLTPA
YTGGPALADHAVIPQQRTAVPVEYDDFRQQLEKLTQVLQPTAPGGTSTLG
AFINTAADNLRGQGPDIRKTVIELSQAISALGDHSNDLFSTVKNLSILVS
ALHDSSDLLQQLNQNLAEVTGLLANDPNEVANAVRNLNDVVGDVRGFVAE
NRDALGTTSDKLASVTQAVTDSLGDVKQLLHTAPTAFQNFLNIYQPAQGT
LTGALAFNNFANTIQFLCGAVEAASRLGAKESAKLCVQYLAPIIKNRQVN
FPPLGENLFVGAAARPNELTYSEDWLRPDYVPPHPDSPPTGDAPAPPAAG
ATPAEAPPPAADAPPPAQAAPTNPAEGLRGMMMPPGGGQ
118466667YP_879975.1 site-specific recombinase- phage integrase [Mycobacterium avium 104]MRYQVTVDAGKAADGRRRQVRRRYRTENEAREGLAKITGGVVEGSFVARS
ALTVEQACRDWLAGMHDIEPTTRAAYTHALKPLRERHGDMAVQQLTKSHL
DQLVTDLTTGKLDGQKRAWTANSINPMLNLVSRVLADLVRQGALARDVAA
FVKRLKRPESKLTTFTEEEVRQLLKHVENDRLGHAWHLALAGLRRGEICG
LEWADVQLDDDRDAGTLTVAHNRVSVGGRVHEKAPKTVRSARTLPLTPTL
ARMLKRAKALQAAERLRLGPHYLGDGVRVVVDDSGRPYHPDTLSDFWREL
CGDAKVRRIRLHDARHSCASLMHAQGVPIAVISAWLGHADPAFTMRTYVH
AENDALNLAAASLQKVVTPS
118466666YP_881772.1 hypothetical protein MAV_2581 [Mycobacterium avium 104]MSGFDTSQPITDEASLEDIDETDGATKPKSATAPAQPDELGDATPGPR
118466665YP_881152.1 amidohydrolase [Mycobacterium avium 104]MGEVQNRVLIFSADGHVGAKRMADYLPYFDPDVRDIVKDLLAEEEQAYRR
MLAPDFSSGPPEEPAPELDPRWAPAFPDRFGGWDIGVRMEQLDREGVAGE
MLVPGHQFSSLPLFSVVNKPFEANLRDAGMRAYQRWLADFMSGGDGRLYG
MADPGSCHDIDASVRELHWARENGFVSVGVPGIIEDPTLPSIDSDHYEPF
WKACVDLDLTLAVHAGWGFPQGRYQEFISAFVATHLGGAEASQMMAAQQR
LDEEAREALQKEFAESPASPFRLDYGPRRLLWQLMIGGIFDRYPQLRFVL
TEVRSDWLPVTLQILDSWYEQRETSLKMRPSEYWERHCFATPSSIHKVEV
DARDEIGVDRLMLGIDYPHPEGMWPDTWNWIKVAFAGVPENEARMILGEN
ALRAFPVDGNHLRAIADRIGPDPSILLSGGDAVPTEHVEHYHRRGGFLRP
TERVDQDAILRFADEDLQITR
118466664YP_884376.1 LacI family transcriptional regulator [Mycobacterium avium 104]MTGPQGNGNSSSNKAARPTTADVARLAGVSTATVSYVLNNARGRRISPDT
RDAVYRAAKLLGYRPNLAARNLARGKSGVVLYVVPHVAVGEMPMQAGSRM
TTALAREGLLQVQVFETDDDQHVVDAIANLDPVAVTSLFPLSAAARRAVT
EAGIPHIEIGTLPALNDPHLSVGEMRIAHLVERGHRRIAFAYTGIARWRP
LGDYWFEGVSRAARLRGLPPVRADEVILDTAASVVSAWVRDGVTAVCAQS
DEIACLVLYGIHQAGLRCPGDLAVMGVDASPMGMVSTPPLTTVQFDPCAV
ADAALAAVFERLGHAAPPSPELTDIARLVVRSST
118466663YP_881072.1 hypothetical protein MAV_1850 [Mycobacterium avium 104]MNLRVTVFGATGQIGRFVVADLLADGHAATAYVRNPGKLQVADPHLTVAT
GELSDAEAVRKAVRGADAVISALGPSLSRRAKGTPVTEGTRNIVAAMQAE
HVSRYIGLATPSVPDSRDRPTLKAKILPIIAGTLFPNALGEIVGMTKAVT
DSDLAWTIARITSPNNSRPKGTLRVGFLGRDKVGSVMSRADIAAFLVAQL
DDETFIRAAPAISN
118466662YP_883576.1 methyltransferase [Mycobacterium avium 104]MTSTRYEGDTWDLASSVGVTATMVAAARAMATRADNPLINDPFAEPLVKA
VGVDLLSRLAGGELDPAELNDVHDGAAGSAGAMSRMADNMAVRTKFFDEF
FLNATKAGIAQVVILASGLDARAYRLAWPAGTVVYEVDQPQVIDFKTTAL
AQLGAAPTAERRVVAVDLRDDWPAALRAAGFDPTRPTAWSAEGLLGYLPP
EAQDRLLDTITELSAPGSRLATESAPNPAPGEEEKLKERMQAISQRWRAH
GFDLDMAGLVYFGERNEAAPYLAGHGWRLNSVTIRDLFAANGLDPLDDDD
TRMGEMLYTWGIYE
118466661YP_883757.1 alkanesulfonate monoxygenase [Mycobacterium avium 104]MSLAFHWFLPTYGDSRNLVAGGHGTPMSGDRPATLRYLHQICSAAEDNGF
EAVLTPTGLWCEDAWLTTAMLVESTETLKFLVAFRPGLLSPTLAAQMAGT
FQRHSQGRLLLNVVTGGEPHEQRAYGDFLDKEARYARTAEFLHVVRQLWT
SPQPVTFAGEHIRVEGAQLNNPPDPIPAVFFGGSSASAGPVAAKHSDVYL
TWGEPLTAVAKKLDWVRGLAVDAGRILQYGLRIHVISRDTSAAAWAEADR
LLSAIDPADIERVQASLARSESEGQRRMRELHGGDSGKLLVGPNLWAGVG
LVRGGAGTALVGSHAEVAERLAEYAKLGITHFILSGYPHLEEAYWFGEGV
LPLLERMGLWRHPNRRSRPAATTPFAVASAH
118466660YP_883205.1 hypothetical protein MAV_4053 [Mycobacterium avium 104]MALGLCLIIGIELLALTQHDRRLVLTASGVGLALVLLSLRRALGRGAERE
SEHDADDLGDSLRRWLAATETTIRWSESTRADWDRHLRPMLARRYAIATG
QRQAKDPASFQATGQMLFGAELWEWVNPNNVTRTGGRQPGPGRAALEEIL
RKLEQV
118466659YP_880309.1 D-mannonate oxidoreductase [Mycobacterium avium 104]MVHIGAGNFHRAHQAVYFDDLACSGISDQWGVSAISLRSHDVKDLLSAQD
GLYTVVQRGHDHQTARVVGSIGSVHYAPNDGAAVRAALTDPRTRIVSLTI
TPNGYFLDPVTREFDADHPDVRADLVASGCYGTAWGYLTEALEQRRRAGI
APFTVLCCDNIPDNTQAARTALVSFAALKNPGLARWIDRHVAFPSTMVDR
ITPQTSDSEREFVERTFGVADNWPVLTEPHSQWIIEDSFSDGRPPLDEVG
VQFVTDVSDHKLIKTRLLNGTHIALACLATLAGYRRTDEAMKDPIIFDYV
ERLMRDEVQPLLPPVPGMNTPDYRDTLLTRLGNPRMSDQLSRLARRGSTK
IASFLLPSLHEAIAQDRPHTLLMLALAGWARYLRGYDLNGRKIRIDDPEA
DLLTKLANMAGNNPDPLLRHEILADLRLVPGFSERLGEMVASIDEHGVIA
TLRQSLQDDSRELVAR
118466658YP_882229.1 hypothetical protein MAV_3043 [Mycobacterium avium 104]MSAAFDAIDAALDDLLDCDYAALATREKLALLNRCERLRRRLPAIEHPLI
NALARDASPAELGGRLSHAIAEATLISRAEAARRVHTAADLGPRVGLTGE
PLPPLLAATAARQREGSLGLEQVAVIRKFCHQLPGWIDQATRERAEADLA
REGTRYRPEQLAALAGTLADCLNPDGLYRDEDRARRRSLTLGNQHADGMS
ELRGWLSPELRATLEAVLAKLAAPGMCNPLDESPCVEGTPSQTAIEGDAR
SAAQRNHDGLLAGLRALLASGNLGQHNGLPASIIVTTTLADLEAAAGRGL
TGGGTLLPMSDVIRLSRHARHYLAIFDHGKALALYHTKRLASPGQRIVLY
AKDRGCTAPGCTVPGYYSEVHHCTDYATCHTTDINDLTFACGPHHRLLQP
GAWTTHKNAKGETEWIPPPHLDRNQPRTNAFHHPEKLLQGEDDDDGP
118466657YP_879600.1 phosphotransferase enzyme family protein [Mycobacterium avium 104]MAGQRGGVESGLDAGVLARWLDANDAPGSGEETRLTPLQGGSQNTLYLIE
RGPARMVLRMPGARADAARIDGLLREIRLVRALSGTDVPHAALIAADDTG
TVLGMPFYVMAAIDGWSPMDGGWPAPFDTDPRARRGLAFQLVEGAAKLGR
VDWRKQGLEGFGRPDGFHERQVDRWLAFLDAYRVRELPGLDEASDWLRRN
RPAHYRPGIMHGDYQFANVMFAHGEPARLAAIVDWEMTTVGDPLLDLAWC
LLGYDGENPREDGFYLDMRGMPSRSELLEHYESVSGLSTENIDYYLVLAN
WKLGIVLEKTYAAGVRGGSRNEGVDPKITEAFGAMIPQLIATAAELARQL
GN
118466656YP_883193.1 NADH dehydrogenase subunit I [Mycobacterium avium 104]MAKFLDAVAGFGVTFASMFKKHVTEEYPEKPGPVAPRYHGRHQLNRYPDG
LEKCIGCELCAWACPADAIYVEGADNTEELRYSPGERYGRVYQINYLRCI
GCGLCVEACPTRALTMTNDYEMADDNRADLIYEKDRLLAPLLPEMTAPPH
PRAPGATDKDYYLGNVTAHGLREAQRAGEPR
118466655YP_882155.1 short chain dehydrogenase [Mycobacterium avium 104]MKPNLTLEIPDLRGKFAVVTGANSGLGFGLAKRLAAAGAEVVLAVRDPAK
GDQAVAAIRRAVPQAKLTIRQLDLSSLRSVAALGEQLTAEGRPIDILINN
AGVMAPPRRQQTSDGFELQFGTNHLGHFALTGRLLALLRAADSARVVTVS
SIAATQRKLDFADVNAEHGYQPMYSYGVAKLAQLMFAVELDWRSRLGGWG
LMSNAAHPGLAKTNLLSGASYGSSAPTLQARLTRLTWRLLPFMWLDIDEA
VKPTLYAAVSPDAQGARYYGPRGFYETARGGVTFARVPPLARSEPEMARL
WRLSEQLSGVDYPG
118466654YP_883494.1 RNA polymerase sigma factor SigD [Mycobacterium avium 104]MTIPAGERLDAVVAKAVTGDHNALREVLETIRPIVVRYCRARVGTVERGG
LSADDVAQEVCLATITALPRYRDRGRPFLAFLYGIAAHKVADAHRAAGRD
LAYPTESIPDRWSNDAGPEQLAIEADSVSRMSELLEILPAKQREILILRV
VVGLSAEETAAAVGSTTGAVRVAQHRALSRLKSEMIAAGDCA
118466653YP_881940.1 ErfK/YbiS/YcfS/YnhG family protein [Mycobacterium avium 104]MASKSSDRLVGRILGVRRPRRFLAAVFVVVAVAGAIQLAEAAPCPHGGCP
GGAAPKTTGPARVRITPGPGARNVDPIAPVLVKAETGTLAGVEMVNEGGT
AVQGVMTPDNLVWKPTVALGYGRNYTLTITSRGTDGVETKQVSTFSTLRP
SNQTKVSFTTTSESPLRDGASYGVGTVIVAHFDEQIADRAAAERHLTVTT
NPKVTGSWFWVDGQNAHWRPEHYYAPGTTVTAEAKIYGIALGDGLFGQDD
SRVSFRIGDAHVSIADDATHQVSVFDNGVLVRTMPTSMGMGGTENIGGRS
ISLWTPPGVYTVLDKGNPVVMDSSTFGLPKNSRLGYRETINYATKISSDG
IYLHELDATVWAQGHQDTSHGCLNLNADNAKWFYDFSVPGDVVEVRNSGG
PPLTLAQNGDWTLSWDQWRRGSALKPT
118466652YP_884395.1 membrane protein- MmpL family protein [Mycobacterium avium 104]MPDRPGILGRLTGRYALLVVGLWVLAAAVANVAVPQLERVVDSHARSFMP
PSAPSAVAAARAAQLFDQTPSNNFVYVVLERNQRLGAGDRQFYDALAAAL
GSDHRHVYAVTDLWSQPATAAGAQSTDGQAVSVMVRLAGMLGTAQARDSV
NAVRATAQKLGPPAGLQVHVTGPGATIVDEFSAIDRQMLGITAATIGLIL
LLLLVVYRSPVAAAIPLISVGLALALARAVVAALGQANVVEVSLFSVALM
AAMTLGAGTDYAIFLVGRYHEARRGGVAPAQALTVAYRSIAPVVIGSALT
VSVALACLVFAHVGSFRSAGLPCAIGILATMVAALTLTPALMSLAVRRRY
LEPRPSRTARRWRRVGTTVARWPGPILVAALGLTLLVALPLAGMRIGFNE
PAATPSSTDSNRGYASAGRHFPENALLPDVIAIRADHDLRNPAGLIAIER
ITRHIMAVPGVRAVQSASRPDGKVPEQATLSYQAGVLGRQFGDTVDSLTQ
RLARVSELDGALAQTQQAVDGLGNGLHGGSAGLADMSGAADDMRAGMDGL
QRNVTTVSGYLDPLRDLVGRTPDCAANPICSMVDRVLAPVDSLVQTSAQL
GSGAAKLTTGSNTAATAMAGLPQNVDAMKSALVQARSATRDLLGLSDTLG
PQMRQLTDYLNEISTQFQGSAAADFYLPQRALTDPRYTAVLNHLISQTGR
AAYLLVYGDGAEWGADSAERAEQVRAAIKEATKEGTLTPVEVDLAGVGPV
TADLQRFVADDTRLLVGAALVLIFLIVTAMLRSPVAGLVVVGTVVTSYAS
AIGASVLIWQHLLHQELHWAVAPIAFIALIAVGADYNLLLALRIKQEAAA
GLRTGIIRAFGGTGGVVTVAGIIFGLTMLALLTSSVLSIAQIGTTIAVGL
LLDTLVVRAFIVPSIVALLGRWFWWPSPLPRRGVARVVKTVEPQPVSVAT
AV
118466651YP_880314.1 transposase [Mycobacterium avium 104]MVVVGADVHKHTHTFVAVDEVGRKLGEKTVKALTSGHAEAVMWARERFGA
QVVWAIEDCRHLSARLERDLLTAGQQVVRVPPKLMAQARASARTRGKSDP
IDALAVARGFLREPDLPVASHDKVSRELKLLVDRREVLVAQRTAMINRLR
WRVHELDPERAPGPASLDRGKHRHLLGAWLATVPGLVAELARDELADITR
LTEAINALAKRIGSRVRTVAPALLAMPGCAELTAAKLVGETAGVTRFKSE
AAFARHAGVAPVPVWSGNTAGRVRMTRSGNRQLNAALHRIAITQIRLEGL
GQTYYRHRLAAGDSNPEALRCLKRRLARIIFGHLHTDHQHRTQPCQTAAA
118466650YP_879803.1 nucleoside-diphosphate-sugar epimerase [Mycobacterium avium 104]MRALVTGAAGFIGSTLVDRLLADGHTVVGLDNFASGRASNLEHLVGNPAH
VFVEADIVTADLEAILDEHRPEVVFHLAAQIDVRHSVADPQFDASVNVIG
TVRLAEAARRTGVRKIVHTSSGGSIYGTPPTYPTPETVPTDPASPYAAGK
VAGEIYLNTFRHLYGLDCSHIAPANVYGPRQDPHGEAGVVAIFAQALLSG
KPTKVFGDGTNTRDYVFVDDVVDAFVKASGDAGGGQRFNIGTGVETSDRQ
LHSAVAAAVGGPDDPEFHPPRLGDLKRSCLDIGLAARVLGWQPKVGLQQG
VARTVEYFRNQHN
118466649YP_881036.1 acyl-CoA dehydrogenase [Mycobacterium avium 104]MSALAGGVFASGTVEDDGAELRQLVDDIGRRSFDAKLGRRRVPDEFDADL
WRNLEDTGLARLTSTPDLDAGPHELAIVLYGLARHAGAVPLAETDALAGW
LGREAGIELPNGPLTVAIADSDLAGGRLTGTAMDVPWSGAATAVLLAARG
RDGSRVCVLDGGETSADDGYNLAGEPRGRLTFDVAADELTPVDDAVADEL
SRRGGWCRCIQIVGALDAAAALTVAHTRERVQFGRPLSAFQAVQQSLAGM
AGEIERARAAVELAVAAAAEHGFGSPHTDYAVTVAKVAVGRAVIPVTTTA
HQLHGAIGVTSEHPLWLFTLRAQSWADDYGTTAHHARRLGRMALAAGDPW
DLVIGNLTRPKTVDK
118466648YP_883382.1 two-component sensor protein [Mycobacterium avium 104]MTAPRPLRLTQLTVRGWLALVLWIMGTTVLIGALVGAVLLHRTDQVSRQV
ADGVGPARVAAARLQAALRDQETGLRGYLIAADRQFLAPYYDGQRTEQAA
ADEIRRLVGGNAGNTELIADLDAVESAAADWRTNYAEPVIASVTPRAPAV
VSAPTADLGKAKFDHLRALFETQNTHLAQAAASATAELHEINGWRDWVLG
AMVLAILGTGLFLGLFSRAAITRPIAQLAASCRRITEGNFAETIVAPKRP
KDIRDMAIDVENMRRRMVEELDVSRSAQEQLDEQAAELRRSNTELEQFAY
VASHDLQEPLRKVASFCQLLERRYGDQLDERGLEYIGFAVDGAKRMQALI
NDLLTFSRVGRLGTTEAEVQLDATLDAGLANLAAAVEETGAEIVRPAELP
RIVGDPMLLTMLWQNLIGNAIKFRHKDRRPRVVIECAPGEGTHDGEWLLS
VSDNGIGIPEEFSDKVFVIFQRLHGREVYAGTGVGLALVKKIVEHHGGTV
RIDTSYTDGTRFEFSLPVPGPVDETDAVALEGAQQ
118466647YP_883441.1 hypothetical protein MAV_4304 [Mycobacterium avium 104]MTDHLWLHFARHGPGITPPIITRGHGVTIYDDRGNSYLDGLSGLFTVQVG
HGRAELAEAAARQAGTLAFFPLWGYATPPAIELAERLAGYAPGDLNRVFF
TTGGTEAVETAWKLAKQYFKLTGKPGKHKVISRAVAYHGTTQGALAITGL
PRYKAPFEPVTPGGFRVPNTNFYRAPEAFANDPKGFGLWAADRIAEAIEF
EGPDTVAAVFVEPVQNAGGSIPPPPGYFERVREICDRYDVLLVSDEVICA
FGRIGSMFACADFGYVPDMITCAKGMTSGYSPIGAMIASERLFEPFADGD
TMFPHGYTFGGHPVSAAVGLVNLDIFEREGLNDRVRTLAPTFRATLEKLY
DLPIVGDVRGEGFFYGVELVKDRATKQTFTDSERRALLGRVGAALFEAGL
YCRTDDRGDSVIQLAPPLISGQAEFDTIEAALRGVLSDECRRL
118466646YP_881751.1 hypothetical protein MAV_2559 [Mycobacterium avium 104]MTGVDEEVNQHDLETPDSIQVRFGIEYVESHPAKATAVLSMPMHRFRNPY
TGAPTVGPLAILVDAAAGIVNHYRRQPGQWTVSSELSMDLSPDVGDLDGT
VLASAHSAGPLGATSLGICTLTYRGMVIGTGIVRSFFIHAGDVVPQQRPE
TLRRSGETSFADLMAVHIAQDGPATVLAQRVDRNLNNDIDIVHGGVAAAG
LELAASAAVNRDPSEGLLQTGSLRVNFLRPFFAGTESRYEGTTMRIGRNT
GVSDAQAIGDDGKVAIAARVTAYR
118466645YP_883265.1 hypothetical protein MAV_4116 [Mycobacterium avium 104]MPKRSLLAQARPESGSGEYVLGTWRAAALSMAVIAPAAWYGLGALLGAAV
MIPVIYALARLRRHAPQARSTAELIGAMLGRKAGTAAGIVQLLAYLVLAA
QFAATLGLQLLQLLSPGDDPAAIVSWLPVGAAAAALVVGATACWASTRAV
ASLAMPLVLAGLLLYVCLAVAVTALVTLSTDPVVIGSAATPRPLSGQLVG
FGLGMVGVELLTVRTPRIARPGRSMSLATAVVAAAAVVLWVGDHRGVAGP
WRWSATMLAEAVPEFYTDEGRRWMAAAGIALAVAAALVTGWAATRAAAGL
AAMRGATPNAGLRLTVMGLVAVVAVVVSAHGMRSIGMVILGAAPLLLMAL
YVLVAEANSRIPGDSVVAWWVRLVMPALAVVAVVKPLVDSQFAPVQVATV
VAAAIGVGAAGAAPLLARHRERTAKSE
118466644YP_883944.1 hypothetical protein MAV_4819 [Mycobacterium avium 104]MTHSHSHGLPSGPAPIDRLPARIVVGLLIAIGVAVAVGAIVLWPSRQHVD
IPMPLQNAAGGAVSTQAGHVLSSGLGDCGSPSVSQVLTGPPQPALPGAGR
CVLTQVAIDSGPNAGAATLLESSPGPGQPKFAVGDRIRIVRQVDDQGATS
YAFYDFERGWALVGLAVAFAVVIVAVARWRGLLALVGILVAFVVLVTFLL
PALRDGAPAVPVALVAAAAILYAVIYLAHGVSLRTSAALLGTLSSLLLAA
GLSWAAIQLAHLTGLSDEQNSTVSAYLGSVSIGGLLLAGFIIGSLGVLND
VTVTQSSTVFELARLGGSRRAIFTGALRVGRDHIASTVYTLVLAYAGSSL
PLLLLFSVANRSLTDVLTGESVAIEIARSAVGGMALALSVPLTTAIAAVL
ARPSGGRKRGEAGRGGPPPSV
118466643YP_884124.1 LprO protein [Mycobacterium avium 104]MLTRRASFRRLAACCTALSACLTLAVTSGQPLARAADGRDLLANAISSTR
GSYLVYNFGPGHPAPMLNAGGSWYEMNNGGHLMIIKNAAGRLSPHLLVDT
HQGDQARCENNPGARTAEGLWQASELYAPLQAWQRMGQPTIAINANFFDV
RPQKGGSWRQTGCSSPLGAFVDNTNGRGRANQAVTGTVAYPGKQGLSGGG
ESWSALTTMILPSGGAPYVVWPKTKSDYDAATPVVADLLNKNEKFVAVSG
IGLLAPGNTGQLHDGGPSAARTAIGYARQKDEMYIFEGGSYTPDNMQDLF
RGLGSDNAVLLDGGGSSAIVLRRDTGGMWAGAGSPRGSCDTRQVLCDSHE
RALPSWLAFN
118466642YP_883961.1 hypothetical protein MAV_4837 [Mycobacterium avium 104]MLAGMLTATVTAGPARADQAAFLNDLHNAGIHAVNGGDDALLQMGADLCQ
QLSWGASPQQLEGLALQRSDADQGTGGINGRQAADVVIFALRDLCPNA
118466641YP_879894.1 hypothetical protein MAV_0614 [Mycobacterium avium 104]MVSVSDESRIAAAQAYIDALVSHDGDAVPFAPGCTRVEQGIKNGFSGNHL
RRSLNRGPQYRLLAHTTTPDYRIDGDRVHASYQVLTKAALGGRRLAAHVT
ETFLIPAESPSGRAEIQHIKVRFQPFIQTRGRQ
118466640YP_883373.1 cell envelope-related function transcriptional attenuator [MycobacteriMIATALTLAVVLGTGIAWSNVRSFEDGIFHMSAPSLGKGGDDGAIDILLV
GLDSRTDAHGNPLSQQELETLRAGDEEATNTDTIILIRIPNNGKSATAIS
IPRDSYVAAPGLGKTKINGVYGQTREAKRASLVKAGDSAEDAAAQGTEAG
REALIKTVADLTGVTVDHYAEIGLLGFALITDALGGVDVCLKEPVFEPLS
GADFPAGPQRLSGPEALSFVRQRHELPRGDLDRVVRQQVVMASLAHRVIS
GQTLSSPATVKRLEAAVQRSVVISAGWDVMDFVQQMQKLAGGNVAFATIP
VLDGAGWSDDGMQSVVRVDPHQVADWVGSLLHDQEQGKTEEIAYTPAKTT
ASVVNDTDINGLAAAVSDVLSAKGFATGTVGNNDGGHVKTSQVRAAKSDD
LGAKEVSKELGGLPVVADSSLAPGAVRVVLANDYSGPGSGLSGTESIMPA
KVSTAGAVSTNDKAPAPSPILTAGSDKPECIN
118466639YP_880371.1 phosphoheptose isomerase [Mycobacterium avium 104]MAGMTGPDVVPPSVELVQRRLAETIAVKQQMQNGVVAAQAVEVARAMIDC
LRAGGKVILFGNGGSAQDAGHLAAELMGRFAFDRPGLAAISLPDATAAIT
AIGNDYSYDEVFARQVLAAGRAGDVVVGLTTSGNSANVVRALEAARQAGM
TTVTLTGAGGGKVADVAQICIRIPSDDTGRIQEASLHLGHSICEMVEAAL
FPRPS
118466638YP_879566.1 hypothetical protein MAV_0277 [Mycobacterium avium 104]MAGKGELVPRPPKKVEYEIRFATTNAKKGWQDLAATIRNPLADAWDFLTR
TPLANTPTNYPLKGQLGTITRGGERYERWQHKPTKQGDARIWFYVEGRTV
YLEQVHTSHPNETK
118466637YP_880564.1 hypothetical protein MAV_1319 [Mycobacterium avium 104]MRGIDPAGKPAGHSDDGNGCGSCGTQCAVPCSRPLPWPARPVSSRVPEEV
RTAVIVQMSIYLRNHARLAGVKNFSRG
118466636YP_881084.1 beta-ketoadipyl CoA thiolase [Mycobacterium avium 104]MATTKSRAAIVAAARTPIGTARKGTLANVPAVELAKPVVTAVVERSGLDA
AEFDDFVLAESMQGGGDSARYIAVALGLTDVAGLAVNRQCASSLSAIAVG
AGQIAAGMSRAILAGGMESLSTAPIMQKRKPFTSGKSPEDYVQWFPESHP
PTAEAPAMDMSITVAHNCNLQYGISREDQDEWALRSHQRAIKAIDAGSFA
DEIIPIQVPQADGSTITFAEDEHPRRGSSMESLAGLKVLHPEIEGFTVTA
GNSSGINDAAAVVALASPDTAAETLAHVLSWTQVGLDPTRTGSGPIKAIP
KALELAGRKLEDVALFEINEAFAAQAVACARELRLDEEIVNVYGSGISLG
HPIAATGARMVTSAIYELRRRGGGIGVLSMCAGGGMGAAMVIEVA
118466635YP_881990.1 methyltransferase- putative- family protein [Mycobacterium avium 104]MTTPQFGSQRSDDDNWDIVSSVGYTALLVAGWRALHAVSPRPLVRDDYAK
TFIAASGDPYLTGVLANPGTSEDELAFPRLYGVQTRFFDDFFDAAGAAGI
RQAVIIAAGLDSRAYRLEWPPATTVFEVDLAKVLEFKARVLGEQGAVPKA
RRVEVAADLRADWSRPLEAAGFDVESPSAWSVEGLLPYLTDEAQHALFTR
ISGLSAPGSRIAIGALGSRLDHDQLHALEESHPGVDVSGNVDFSALTYEP
QSDPAEWLAAHGWVVDPVRNTLDLQAGYGMTPPEVDVKIDGFMRSQYITA
AR
118466634YP_880827.1 amidohydrolase [Mycobacterium avium 104]MKAIDCLVNVHFGETEKQPTWMLKVRDDYFKGPASMFAPVELSELIDEMD
AQGVRKAILMDNLAKPSVTARKFVEDKPERFALAMGGVNLLRPIPSLREL
GAVVADLPVAYAAVGPSFWGDGQYPPSDAVYYPLYTKCAELELPLCVNTG
IPGPPIPGEVQNPIHLDRVCVRFPELKLCMIHGADPWWDVAIRLLLKYAN
LRLMTSAWSPKRLPESLLHYMRTRGQDKVIFASDWPVLKMHRVVPEAAGL
DLPADVLENYLYNNAHEFFFGGHKEG
118466633YP_883664.1 hypothetical protein MAV_4533 [Mycobacterium avium 104]MGWIQDSWHGVTHVGSSTWIAWAAWAAIALAVITLIFTNSQIARNRRAAA
EQTRPHVAMFMEPHPADWHVIELVVRNFGQTAAYDIEFSFDNPPTVAEYE
SATDGYADVVELRLPRQLPVLAPGQEWRTVWDSALDRAEIGSGIESRFTG
TVTYYDRPAPAGGRRFWQRERTPLHTDVVLDWDALPPVQRIELMTTHDLA
KREKEKLELLRGLLTYFHYASKETRPEVFRSEIERINAAVRETQDRWRSR
QLDEPTDVSLRWSNAEDDLGKHHSQPA
118466632YP_881431.1 type III restriction system methylase [Mycobacterium avium 104]MTTRGANPEPISFPEWSYVGKGTYHRRDFRYDTMTKMSTFGEEETLFADL
GSHEIFTPTMDHGFLSVKDIAAARCDPR
118466631YP_882332.1 DNA polymerase LigD ligase subunit [Mycobacterium avium 104]MTDFAALPDSVRAALRDEPVPQWCSPTLATLTEQRFSDPHWIFERKFDGM
RCLAFRDGDRVRLLSRNRKPLNGTYPELVEALAAQRETRFVLDGEVVAFE
GRRTSFARLQGRLGITDPDVARASSVRIYYYVFDLLHLDGKSTVAVPLIW
RKRLLRKAIDFTDPLRYAPHRVGDGMAAYRAACGRGDEGVIAKRAESAYD
GRRSENWLKFKCVRDQEFVVGGYTSPKGKRLELGALLLGYYQGDQLRYAG
KVGTGFDEATLHRLHQLLSGIACDTTPFTRSLVPEAGAHWVRPELVVQIG
FTEWTRDGKLRHPRYLGIRTDKDPTEVIRETR
118466630YP_880188.1 hypothetical protein MAV_0926 [Mycobacterium avium 104]MVRVNVDPKSECTAAQLRDGMAALLGLARAAGADVVDNDLAAMPASRREV
ELLIAADDGDAAMGVAVTLCAKAFQSTPVPGVVTFISRGTDDDAHGVLSG
FGLTGDIERTAGDEGFDIVYVTLREQDLERIPESRIHTALEASLNCEVHI
RTR
118466629YP_881264.1 muconolactone delta-isomerase [Mycobacterium avium 104]MEFLVAATTQVPDGTPAEAVDDLRARESARCRELARQGQLLRLWRAPSPP
GRWRTLGLFAAADDNALEQLLASTPLRAWRTEEVTPLPVHPNDPTARLIT
PEPVSGGAAEFLQAITIRVPADAPQRVVDDVLAREAERAVELGAQGCLQR
LWWLHSGPGDPRVLALWRTADTESLAAVLRSLPLHAWLQVDTTTPLHTHP
DDPVSGSLAGR
118466628YP_883047.1 phytoene dehydrogenase [Mycobacterium avium 104]MSMRAIEGSADHVVVIGAGLAGLSAALHLAGRGRAVTVVEREAWPGGRAG
RRDIDGYRIDTGPTVLTMPDIIEDTFAAVGDSLARRLELCTLDPAYRAVF
ADGSSLDVHRDPDRMADAVAEFAGREQATGYRRLRAWLTRLYRTEFDGFI
AANFDSPLSLLTPRLAQLIAIGGFRNWDRMVKRYLSDPRLQRIFTFQSLY
AGVAPRDALAVYAVIAYMDTVSGVVFPRGGVRALPDALAAAASDAGVQFR
YGTTVTALEKTGGRVGAVLTEQAGRISCDAVVLTTELPQTYALLGRTPRR
ALRLRHSPSAVVAHVGCPAVASQTAHHTILFGDAWDHTFADIIGAGQLMR
DPSLLVTRPTASDPTLAPRGRDLLYVLAPAPNLESGGIDWDSVGRGYVDD
LIALVGQRLLPGLPGSATVLDVVTPADWARRGMAAGSPFALAHTFAQTGP
FRPANMVRGIDNAVLAGSSTVPGVGVPTTLISGRLAADRITGVSKRTPAR
IDMKAGSP
118466627YP_880278.1 hypothetical protein MAV_1020 [Mycobacterium avium 104]MTDGSKPSENDTLARIRDLVAQEKTLRAQLQRGDIDTSEEHDRLRRVEVE
LDQCWDLLRQRRALRESGGDPREAQVRPPDEVEGYLS
118466625YP_882124.1 hypothetical protein MAV_2939 [Mycobacterium avium 104]MQHARIVGRGQPIRYPSARDAAATSGLAAVGIAAVAFVVCVANFALGHAG
AGVTAAIVAMLAFGAGLAWLAMDRRRIRQEQRDWTISRPAR
118466624YP_879431.1 hypothetical protein MAV_0136 [Mycobacterium avium 104]MRPIGLASTPPTQQVDYARSPMHPFRRAVEERDEQAIQALLADTVVFTSP
VAFKPYVGKPITAAILRGVMRIFEDFRYLREIGDPGGRDHALVFETGIAG
APGIRITGCDFLHCDDDGLIDDFMVMVRPLSGATALSEAMGAQFARIQQE
AVELANRFGTA
118466623YP_881381.1 FAD dependent oxidoreductase- putative [Mycobacterium avium 104]MVTDRFDAIIVGAGFGGIGAAIQLKRLGFDNIVILDREDDLGGTWHVNHY
PGIAVDIPSTTYSYWFEPNPGWSRLFAPGGEVKQYAADVADKYDVRRHMR
FNTTVEGAQWDEDAEVWRVALAGGESLTTRFLITATGFLSQPHTPDIPGI
GSFGGKVVHTTAWDHDYRYQGRRIAVIGTGASAVQVVPELAKEAEELTVY
QRTATHVLPKVDFEFDPAVRRLFARVPAAQRALRWVTDVLLEIIMIVGAL
HFKESRGRGNISASDLAKINRFRWIRDKELRAKLTPDYDCGCKRPTFSNS
FYRVLTQPNVHLETNPIERIEPDGIVTADGRKNVIDTLVLATGFDLWEAN
FPAIEVIGRKGRNLGKWWRETRFQAYQGVSMPYFPNYLSLASPFAFSGLS
FFHTIEYQMRHMDRLLGEVKRRGATTFEVTEEANDRFMERMTKLLDNSVF
YAGNCATSRSYYFSPSGEASLLRPTSTLNSIREASSFPLSDYVIA
118466622YP_882949.1 chromosome segregation protein SMC [Mycobacterium avium 104]MYLKSLTLKGFKSFASPTTLRFEPGITAVVGPNGSGKSNVVDALAWVMGE
QGAKTLRGGKMEDVIFAGTSSRAPLGRAEVTVTIDNSDNALPIEYSEVSI
TRRMFRDGASEYEINGSSCRLMDVQELLSDSGIGREMHVIVGQGKLDEIL
QSRPEDRRAFIEEAAGVLKHRKRKEKALRKLDAMSANLARLTDLTTELRR
QLKPLGRQAEVARRAQTIQADLRDARLRLAADDLVNRRGEREAIFEAEAA
MRREHDEASARLAVASEELAAHEKALGELSGRAESVQQTWFALSALAERV
AATVRIASERAQHLDLGPVTAGDTDPDALDAEAERVAAAEQQLLAELAAA
RSRLETARAELAEREREAAEADRAHMAAVRAEADRREGLARLAGQVETMR
ARVESIDDSVARLSERIEAAAARAQQAKAEFETVQGRVGELDQGEVGLDE
HHERTVAALRLADERVAELQAAERDAERKVASLRARIDALAVGLERKDGT
AWLTENHSGAGILGPMAKLVKVRSGYEAAVAAVLGSAADALAADGLGAAR
SALGALKQADGGRAALVLGDWPADPPAPQPAPAGALWALDLIDAPERLRG
AITAMLSGVAVVDDLDRALALVAEHPRLRAVTLDGDLVGAGWVSGGSDRK
LSTLEVTSEIDKASAELAAAEAQVAQLSAALSGALAEQAARQDSAEQALA
ALNESDSAISGMYEQLGRLGQEARTSEDEWSRLLRQREELEAGRTQTVAE
VTELENRLRNAQETPQEPAAEPVNRQQIAAATDAARSAEVEARLAVRTAE
ERANAVRGRADSLRRAAAAEREARVRAQQAREARLRAAAVAAAVADSGRL
LATRLNAVVAAASRIRDALAAERQQRATAMTAVRDEVNALSARVAALTDS
LHRDEVANAQAALRIEQLEQMVLEQFGMAPADLIAEYGPHIALPPSELEM
AEYEQAKERGEQVFAPAPIPFDRPTQERRAKRAERELAELGRVNPLALEE
FAALEERYNFLSTQLEDVKAARKDLLGVVDEVDARILQVFSEAYTDVERE
FSDVFGVLFPGGEGRLRLTDPSNMLTTGIEVEARPPGKKITRLSLLSGGE
KALTAVAMLVAIFRARPSPFYIMDEVEAALDDTNLRRLISLFELLRARSQ
LIIITHQKPTMEVADALYGVTMQGDGITAVISQRMRGQQVDQLVTT
118466621YP_881804.1 hypothetical protein MAV_2613 [Mycobacterium avium 104]MTATAVEDWLLDSALAPAADDDMLAPLYRAAARNELALPFCAACALPLEL
DQEVCDQCGNAEQDWRTVDLRGTVHAATLMHRREAGLVHGLVPYPVVDVE
LTSGHRIVMTTVQPADTAPPIGTTVHIGFRHLGDVAIPAIDILEDQ
118466620YP_883932.1 chaperone protein DnaJ [Mycobacterium avium 104]MAQREWVEKDFYKELGVSSDASPEEIKRAYRKLARDLHPDANPDNPAAGE
RFKAVSEAHNVLSDPAKRKEYDETRRLFAGGGFGGRRFDTGGFGGFNVGG
DGAEFNLNDLFDAAGRSGGTNIGDLFGGLFGRASGGRPSRPRRGNDLETE
TQLDFVEAAKGVAMPLRLTSPAPCTNCHGSGARPGTSPKVCPTCNGSGVI
SRNQGAFGFSEPCTDCRGSGSIIEHPCDECKGTGVTTRTRTINVRIPPGV
EDGQRIRLPGQGEAGLRGAPSGDLYVTVHVRPHKVFGRDGDDLTVTVPVS
FTELALGSTISVPTLDGKVGVRVPKGTADGRILRVRGRGVPKRSGGHGDL
LVTVKVAVPPNLDGAAQEALEAYAAAERASGFDPRAGWAGNR
118466619YP_883369.1 hypothetical protein MAV_4229 [Mycobacterium avium 104]MAAGAGRHAGVTPESEREDESEREPQTSEE
118466618YP_883792.1 hypothetical protein MAV_4663 [Mycobacterium avium 104]MSATVERVIEDTLQASGLTYSKHAGAHGGPSGLVVELPGERKLKTNTILS
VGEHSVRVEAFVCRKPDENHEGVYRFLLKRNRRLYGVAYTLDNVGDIYLV
GRMSLASVSGDEIDRVLGQVLEAVDSDFNTLLELGFRSSIQKEWEWRVSR
GESLKNLQAFAHLIDDDEG
118466617YP_879871.1 pigment production hydroxylase [Mycobacterium avium 104]MTSIQQRDAQSVLAGIDDLLPRIRERAQATEDLRRLPDETVADLQDVGFF
TLLQPEQWGGLQCDPTLFYEAVRRLASACGSTGWVSSIIGVHNWHLALFD
QQAQEEVWGEDPNVRISSSYAPMGAGVVTDGGYLVNGSWNWSSGCDHATW
AFLGGPVIKDGRPVDFGSFLIPRSEYRIDDVWHVVGLRGTGSNTVVVKDV
FVPRHRFLSYKAMNDGTAGGYETNTAPVYKMPWGTMHPTTISAPIVGMAY
GAYAAHVEHQGKRVRAAFAGEKAKDDPFAKVRIAEAASDIDAAWRQLSGN
VADEYALLSAGKEIPFELRARARRDQVRATGRAIASIDRLFEASGATALA
NDQPVQRFWRDAHAGRVHAANDPERAYQIFGNHEFGLPPGDTMV
118466616YP_884383.1 fructose-1-6-bisphosphate aldolase [Mycobacterium avium 104]MSNQQQAERMTSGKGFIAALDQSGGSTPKALRLYGIEDSAYSSEKEMFDL
IHQMRSRIITSPAFTGDRVLAAILFEQTMDRDIEGKPSTTYLWETKGVVP
ILKIDKGLAEASDDVQLMKPIPGLDELLQRAVSKGVFGTKERSVIGGANP
AGIAAVVAQQFELAHQVLSHGLVPIIEPEVTISIADKAKAEGILRDEITK
QLDSVPDGQRVMLKLSLPTEANFYRPLIEHPKVMRVVALSGGYSREEANE
LLAKNAGLIASFSRALTEGLTVDQSDEQFNATLDKAIQSIYDASVAG
118466615YP_879705.1 molybdopterin oxidoreductase Fe4S4 region [Mycobacterium avium 104]MAPKKALSKVFLEWPVLRQVRSTDKLGRGSAVTSKHTRALAPRTATADRV
VQSVCPYCAVGCGQRVYVKDERVVAIEGDPDSPISRGRLCPKGSASEQLV
NSPGRQLQVLYRAPRATEWQPLQLDTAIDMIADRFVESRRNSWQDIDKKG
NLLRRTMGIAALGGATLDNEENYLIKKLFTAAGAIQIENQARI
118466614YP_879392.1 LysR family transcriptional regulator [Mycobacterium avium 104]MGQVLDIAPLRSLVAVADCGGFHRAAAALHLSQSAVSQHLRRIEAVVGEP
IVQRSGRGVVFTEVGQKALRHARTILAAHDTALDDLGATENKVLTIGATE
HGADVMLAGLSGALRDRLPDLRVRFRLDRNVSLADSIDRGLVDVAIMLDG
AGLDRANASGLVRLQWVSARTLTIAPKDPLPLVIFSEPCTLREPAFAILD
SHRIDYEIAAECGDLSGLYAAVRSGLGVALLPMIGKFPDGLGPAEGLPPA
NNASILVRGRTGIDPALLSTVDTAVRDLLATAT
118466613YP_881225.1 PPE family protein [Mycobacterium avium 104]MHFAVLPPEVNSGRMYSGPGSGSMLAAASAWDELANELHVTAANIESVIS
GLTSEPWQGPSAAAVTAAAATQVEWLTATAEQAAQTGAQLKAAATAYESA
YAMTVPPSVVAANRSRLASLVATNLLGQNTPAIAATEVAYGEMWAQDVAA
MYGYAGAAQAASRVTPFTPPQRTTNEAGMGAQNASVAQAAGTSAGHVQSA
VSNSNAMSAVPNALQNLASSSSSSSAASGLSDFSSFLNPYNLVSLGSAFF
GNGTGLIGVSGAAGFISDAEHKMTEPSAKSKAVAAPERLEPPAGSRSSGA
TTVSAGMGRASSLGGMSVPQGWSTAAPELRLTALQAPAAAAAPPGRPGPF
GEMPLFGGAPLMGLPGRGAADSRDGRSSGDAGTAGRGRRAAASHGPAGAA
RTASTGTTAELREITDLLGKLAELRATGALTDTEFAEQKQRLLRAR
118466612YP_882952.1 hypothetical protein MAV_3780 [Mycobacterium avium 104]MLIGSEDVDGVFTPGELLKIALAACSGMASDAPLARRLGDDYRAVIRVSG
AADREQERYPLLEETLELDLSGLSDEDRQRLLLVVHRAVDQVCTVGRTLT
SGTTVNFEIAAGAGHAGA
118466611YP_881608.1 twin arginine translocase protein A [Mycobacterium avium 104]MGSLSPWHWAILAVVVILLFGAKKLPDAARSLGKSMRIFKSELREMQSEN
KTETSALGAQSESSAANPTPVQSQRVDPPAPSEQGHSEARPAS
118466610YP_884028.1 hypothetical protein MAV_4907 [Mycobacterium avium 104]MTSTPGTTGTTEFAELHDLIGGLRRCVSSLRARYGDSPAMRRIVIDADRI
LSDVDLLDTDVSELDLARATVQQSGEKVVIPDTQYDSEFWRDVDDEGVGG
HHRS
118466609YP_881095.1 LppE protein [Mycobacterium avium 104]MQFTEIRNVGGFTGSYWADLGPAAEVEMTGGTYLMTGSATGFKADNPSAR
TTETFSIRVTC
118466608YP_884238.1 HpcH/HpaI aldolase/citrate lyase [Mycobacterium avium 104]MTAPSNLRLALNRRTPIFGGWVTGPTLLGPEEFARAGYDYVGFDAQHGYL
DDADIAGVLRRIEHLPIGTVVRLPNADAAPIGRVADAGADAVVIAMIESP
DQAAAAVAATRYPPAGVRSFGPLRVSLGHDPAAHESRVSVFAMIETAAAL
SGITQICAVDGLTGIYVGPADLAISLGAGVIGATRQPEVLDAIVHIHKAA
TKAGLVTGIHAGDGSTGHAMAQLGFDMITLAAEAQALRRGAAEHLREATQ
118466607YP_880762.1 F0F1 ATP synthase subunit B [Mycobacterium avium 104]MMGDASLSVLASSQVVAEGGNNFLVPNGTFFFVLAIFLIVLAVIGTFVVP
PVMKVLRERDAMVAKTAADNRKAAEQFEAAQADYEEAMTEARVQASSLRD
NARAEGRKVVEDARAKAEQEVLSTLQLAARQLKRERDAVELDLRANVASM
SATLASRILGVDVAPAAATTSATKTSGR
118466606YP_881135.1 caib/baif family protein [Mycobacterium avium 104]MPEVGTADGPLAGLVVIDLSTTLPGAQATQFLADCGAEVIMVEPPDGSPL
RELASWPALLRGKRSVTLDVHNDADLDRLRGLLQRADVMVNTMRPTTAER
LGLTHDALSERYPRLVVATITGWGSTGPFRDYKGWEALIMAKTGVMHEKR
GLAPQPRPAYITFSYAAWGAAHAAVQGVLAALLERETSGLGQVVETNLVT
GVGSMDPYNWFYELVLERYPGAYEPMDAAYDDQGRPQAYLIYALLVCPTK
DGRWLQFAQVSPKLMGAWLTELDLLGELADPKWQGFPMLPTPELRTEWWD
MMIERVGARTLAEWQQAMAENPDLSGELFRTPEESLDHPQTVHEGRSVTV
ADPELGPVRQPSTLIHAEGKPLTELRPAPRLGEHNEALLAQDSLEAAATA
PRIAADDPPLKGVTVLEFGSMFAGPYGATLLADLGARVIKVEPLEGDNIR
NLVAFPEAGGAKVLQGKESVAIDFTKPEGLELVYELAKRSDIVLQCFRGK
AAERAKIDEASLRAVNPDLAFVTTSGYGLDGPFAHRAAYAPSVGAASGLS
LIDSHDTGEPPADLDDLHRRAVRLHAGGTVPAVQSDGIAAHGVASALLVA
LYAKRRGKALRNVVTTMLGTVQQAMIPYNASYPSRPANRAADDEFFGMSA
LYRMYRAADGYVFLAAPLPREWPALAKAMSPYVDLHADERFADADARAAH
DDELIAALTPVFATKTKLEWEHELTAQNVGCVEVVEANSELVLQTDPYFE
AGYAVEAVSPIFEEHRRLAPLCRFSRSRTRADAGCTIGQHTDAVLRELGL
DDDAIGGLREKAVIGGSS
118466605YP_880083.1 hypothetical protein MAV_0810 [Mycobacterium avium 104]MAGQDYVPLYLAGTQASCIAGAAITQGQLVVITGGTLVGGGVNPTVVPTS
AATSAQVGVAAASAASGAPVSVYFGGVHLLAAAGAINAGDPVVAAANGAV
VDLGDGTTYDQVIGHAWSAAANGQVAVRLGEF
118466604YP_880730.1 hypothetical protein MAV_1489 [Mycobacterium avium 104]MLTMTNRLEARHRAEQAARMSFTGATWQEIADALGYRSRQAAQLAVKRLD
DATPAETVEQARARHDGALRLLQRQNFTRYAHAIEGGDDDTALGYSKELR
GIVTERAKLAGVYAPARTEVDVSVTHDATAVIDRLESELLALVATRQPQN
AISGTIIDADVEEIER
118466603YP_881895.1 L-carnitine dehydratase/bile acid-inducible protein F [Mycobacterium aMQPLIGVTVVSLAVNLPGPLAAARLAELGAAVTKVEPATGDPLAAAAPDW
YARLIEHQNVLTLDLKDTGDRAKLDELLAGADLLITSMRPSALHRSGLAR
PQQRFPRLSLIEIVGHHGEHAETPGHDLNYQAAQGTLTPPHMPKVPIADV
LGAERAVSSALAALLQAAKAGAGQRYRVVLEEAAARAGDAVRYGLMGEGA
VLGGAYPGYGIYASADGYVALGAIEPHFFARTCQVFGADGSHESLGAAFA
AKTTAELEDLARHMDIPLNEVR
118466602YP_883867.1 hypothetical protein MAV_4740 [Mycobacterium avium 104]MTQPPPPPPPPGYPPQQPAAQAPNNYLVWSILVTLFCCLPFGIVAIVKSS
QVNGLWAQGRYAEAQASADSAKKWVIWSAVIGVVVGIIYGILMAVGALNT
NTNAALAAMF
118466601YP_880936.1 ribose-5-phosphate isomerase B [Mycobacterium avium 104]MRVYLGSDHAGFELKQQIIAHLEQSGHQPIDCGAFSYDADDDYPAFCIAA
ATRTVADPDSLGIVLGGSGNGEQIAANKVPGARCALAWSVETAQLAREHN
NAQLIGIGGRMHTVAEALAIVDAFVTTPWSKAPRHQRRIDILAEYERTHQ
APPVPGAVG
118466600YP_883020.1 hypothetical protein MAV_3857 [Mycobacterium avium 104]MRNRGAIRGAVQQPAASAGPPGVPRSPGWRPGNDPAAATVPQPHGPAGRR
PPAPSQRVSPPARPTPTLGATALDRFDQREDEAARFDWRGLVHRLTGIDL
GPGKEATYENELRARIRAAVGAAFPIAVLNLKGGVGKTAVVEALGSTFAA
VRDDRVLALDIDAGDLAERHGRHNPHSMADLLRDGPATRYEDIRALTYMN
GFGLEVLGLPDYARTDWRLERQDVVKAFSMLRNHYSVVLVDCVKALNSSV
MEAVLPESRALVVVTSPAIDAIRKTQTTLEWLRHNGYQQLMRSTVLAVNH
VEPAKVDAVAVTELDRLSARVGATVVLPFDRHVHEGRKIALDRLSKESRR
SYLEMAAALADMFPGRGEQRGRGPH
118466599YP_881174.1 PEP-utilizing protein [Mycobacterium avium 104]MIGPIAELTDPIRGESAPDRLWTLTNVGEATPDILSPLCWSLWGTGVEFA
SRGGLYDFGVLPASALVVPNDPNQWSTACFFGRQAMNVDRARELAGLLPG
MTGDDFERDLLGSVRPDATPTKSDPKRLPVAAVKTPWVLLRSRSAARDAH
SAQMSWWRATVLGGDSKDPKALLADSVQRFSSVMRVHVRSRMILNALRSQ
VESIVGKLGCSDLVPVLLAGYGGVIETELADDVWSLGQGRLSMDEFLLRH
GFHGPNEGNVIGHSWREDHDAVKRAAQAHAGRAEEERPSVRVQRAVAARQ
RAEAELLATLSLPRRLMLRKLLSFTGAHVRAVELGKAGFLTAIDGCRAAA
AALGRDLVRAGILERPDDTCYLTVEELLAPLPSNVRELVDFRRARREEYR
RIEVPTVFTGMPVPIDPGGASAGQDAAVRGMPAGTGVFEGTVRVVLDAES
DDTLDDGEVLVCKMVDPGWTALVSLAGALVTDIGSPASHGAIVARELGIA
CVVGTGNGTRVLHTGDVVRVDGVTGEIAVLQRAES
118466598YP_883930.1 GAF domain-containing protein [Mycobacterium avium 104]MLDLDDRVTDRQRELARLRAAVDAAARGGGECVLISGVPGVGKSALMKAF
GVEVAGRGCVFAYGRCRDGAPAPYAAVRDALGSLVRTMAATAPAERDRWR
ADLAGGVSPIAGVLGELVPDLPRVLGETASHPELDATDSRRQLHRAATRL
LSATASYRTVVLAIDDLQWADRDTLLLLAELLTVSLRDVLVVGAHRAGGF
DPAAAGIAAENLTTIELEPLARDDVEELLATVCGQSGELPEVAAEFHHRT
GGNPLQVRQLLYRAQREGALLPVGSGGPPRWDLRVLTSIEVSATAAEFLG
RYLDQLRPADREVLSALSCIGGEFDLDDAAAAAARTPDVVAHALWACLEL
RLLEALDMTGQRISNAISRDARYRFSHDRVAEAARAGLSPDEMRAVHLRI
GRRLITLGDDRLFEAARHVGVGGLAVSDEAERTRFVEVLRRAAHQARAQA
SFPLALGYCRDALDLLGEQRWAGQFVLTRELALDAADAALRVGDVPVLNT
LLDEAEEFLREPPDRARLAYLRMKGRVAENRLQEALEIGLAALDELGERV
ATQAGKPRMGNAIVRMRLTMARWSTERLLQLPHCTDQRVIALHPILAELC
NMAVLVRPNLLPLLVRKQLELTLAHGHTSSSPLVITGYGIVLVLLGDHAG
SQRFGEVGMLLAQRPELREARPQTVFMYLDYIHHWRHPIRDGLGELRDAV
EEALDRGDQENAGFLTAVLLSQSFWVGRPLPEIDALASSLIPHIRSQPVP
SALCQAVQQLCLNLMGRSADPFLLAGESGYDERQVLPAARQQGDEVALGA
AAAMKQGLHFWCGDHAGAAEATTEAIEHLGGLAGVAASQLVHLIGALSMI
HCAPRDSATIRFVRQALASHRKWAAGAPENYAAPYALIQGAWARARGQHG
KAERHLHQAIELAEEHRLPAIGARAHEEAAALYAETGRQTLREHMLRSAY
QRWLNLGFAVRADWLAREHPWLLRRDLRTGSAGIDPIGAHQLVHALSGAR
TPDALANIILGSVADTTGAGRVLFITGEADNQSVRAIHDHGEVLIVEGPW
TEVPYRRDVVRRVIDGGAPVIVAADRAAATNSVLAAPIALHDRTLGVIYA
EQGEPGRNFGADHEEAIAFLCAQAAAPLWSFQLEARLRAADEYRQSLIDV
QSRFVPNELLRILDIDDLRRVRNGHRVEREMTVLISDIRSYTAMIEDMNV
AEAGNLAMGFLRAVELPIISYHGMIQDVRGDEIVAVFESEADAVRAGLGM
LRSLHEHNQERRALGSEELRAGIGINTGAVAVGLVGGVNRMVLTIIGDAV
NLAARIESTNKRYGSALLISDRTYQRIAGSEEFDVRRMERVMVVNRRRPV
TIYEVYNGDSGPLRAAKRAAQPAFDEAFALFDAGDVDAARAAFQRCRDML
PDDPIAPLHLAHCDAVARGEMLPGQEIALQNK
118466597YP_881774.1 hypothetical protein MAV_2583 [Mycobacterium avium 104]MTALITEGLFRVDGGRAVLFASRRRSSGAVKFPAERPELFDGDSDIQQDI
EPIELSTAGTLYTYTTQEFPPPLPYKGNRDPKVFQPYVVGFVELAEGVLV
ETLIVDATADELRIGQRLVSTTTTLETADGQSLLTFAFRPAEES
118466596YP_880601.1 glycogen synthase [Mycobacterium avium 104]MRLSVKVIGRAGKRITGESGPRPDSRAPPHPNYGAGMRVAMMTREYPPEV
YGGAGVHVTELVTQLRRLCAVDVHCMGALRPGAAGVQVHQPDPRLQGANP
ALSTLSADLMMANAAAQASVVHSHTWYTGMAGHLAALLHDIPHVLTAHSL
EPLRPWKAEQLGGGYRISTWVEHTAVLAAHAVIAVSSAMREDILRVYPAL
DPSAVHVIRNGVDTDVWYPAGPMQTGSMLAELGVDPARPLVVFVGRITRQ
KGLAHLVAAAHRFSPEAQVLLCAGAPDTPEIADEIRDAVAALARGRTGVF
WIREMLPIGELREILSAASVFVCPSVYEPLGIVNLEAMACAAPVVASDVG
GIPEVVADGVTGSLVHYDPRDPAGYQAGLADAVNELIADREKAQRYGRAG
RQRCVEEFSWAHVAEQTLEIYRKVCA
118466595YP_884147.1 type I restriction-modification system- M subunit [Mycobacterium aviumMAAKAKKQAPMATSPQAKLAAVIKSARDYMRKDAGLNGDLDRIPQLAWLL
FLKAFDGLEENREITEENFRPAIEAPYRWRDWAADPNGRTGDALLTFVNN
ELLPYLRGLSGTGSHDPRDVLAAVFKETYNRMLSGYLLRDVVNKVNEINF
ASSDDIHTMAHLYESMLREMRDAAGDSGEFYTPRPIIRFIVQQVDPRLGE
VILDPACGTGGFLVEALEHLSPKVTTTAQLRALHENLRGIEKKPLPFLLG
MMNLVLHGVGQPNITRGNALAESITQISKARRVDVILTNPPFGGEEEKSI
QANFPADKQTAETAWLFLQLVIRMLKDGGRCGIVVPNGLLFGGGVGARIK
KQLLTECNLHTIVRLPDGAFAPYTDIPSNLLFFDKTGRTKEIWYYEISPP
EGRKKYSKSKPMRFEEFADCQVWWSNRVENERAWRVPIADIEANDMYNLD
LRNPNRGDDLAHRPPAELLAELIDTERSILALLDGLQREVTGEGP
118466594YP_880584.1 aldehyde dehydrogenase [Mycobacterium avium 104]MADPPALVQTYQLYIDGQWVEPQDGRYDDLSPCTEAVIATAPDASVAQVD
DAIAAARRAFDSGPWGRISAEQRARCLNQLGEALTKHADDFFALSQTEWG
CIGNERIMQIDGAGFMSMHAAQLATQLVDQEVAGISAGTTLLRHVPLGVV
AVLTPWNFPHCLNVMKLNHALAAGNTVVLKPSPLTPLAGLALARLIDEHT
DIPPGVVNVVTPSGVEAAKLLTTDPRIDMVSFTGSSAVGRQVMSAAGDTI
KRILLELGGKSASIVLDDANVTDEMLEQMLFQSCSLHAGQACILHSRLLL
PDSLHDDVVDRLAALARDVKVGDPTDPDVQMGPLISAAQRDRVEAHIAGA
RSDGATLVTGGGRPAGLDVGYYVEPTILSGVEPNSTVAQEEVFGPVLSVL
RYRDDDDAVAIANNSRYGLSGAVWGDDVDRAVGVARRIRTGQIAVNGISP
AGAPFGGFRLSGLGREGGGIGGLHQYMEPMAIGVPA
118466593YP_880815.1 enoyl-CoA hydratase/isomerase [Mycobacterium avium 104]MPMSAQFDTILLEVDATDHVATITLNRPEQLNAFNRAMCAEMAQAWRLVK
LDDAVHAVVLRAAGDRAFSAGLDIKTPYGQPENIWNHEDPGEALSPKWQK
MWKPVVCAVQGMCTAGAFYFVNESDVVICSQDATFFDSHVSAGLVCALEP
VGLMRRIGLGETLRIALMGNDERVGADTALRIGLVTEVVPAERLWDRAHE
IAATIAAKPPTATAGTVKAIWESLDKPYRAAMEQGLIYTRLGNPLGTAEL
AAGRDAGARGAARTPKIR
118466592YP_883684.1 hypothetical protein MAV_4553 [Mycobacterium avium 104]MIANYLRGQIQPGIDAVGGFFRTCVLTGKALFRRPFQWRETIEQGWFITS
VSLLPTLAVAIPLTVLIIFTLNILLAEFGAADISGAGAALGAVTQLGPLT
TVLVIAGAGSTAICADLGARTIREEIDALEVLGIDPIHRLVVPRVVAATI
VATLLNGAVITIGLVGGFVFGVFIQHISAGAYVGTLTLITGLPEVVISVV
KSATFGTIAGLVGCYRGLTTKGGPKGVGTAVNETLVLCVIALFAVNVVLT
TIGVRFGTGR
118466591YP_880110.1 gp54 protein [Mycobacterium avium 104]MSAVELFTYAGGYQVRVIRDDDGDPWFVLADLCRVLDIRNARDVAARLAD
DQKGVDQVDTPGGRQQMTLVSEAGMYEVVIRSDKSEAVSFRRWVTGEVLP
AIRKTGTYSRYPAGPAALPSKKELAQWVIDAEERAERAEAKVAELTPPAA
AWNELAESAGDYSVADAAKVLSRDPQIETGERRLYAFMAAIGWVFKVKGR
WRAYQSQVEIGRLSEKVGKPFWHEGRGEMVLPDPTVRITPKGVAELHKRL
GGTGQLALVSAL
118466590YP_883970.1 hypothetical protein MAV_4846 [Mycobacterium avium 104]MAANDDPEERIRELERPLADSARASEQGSAPPTGPGYPPAPAPWSYGGPV
PGPPGQRPSGNRVWWVVGTLIAVGVLALAGGIAAFAAHQLSGVKSIINSP
PTISRTFGPPPGISTTPAPSTSRRTPTSPAAPPGTELSVAGINENRTLAC
DDNPVSVSGVSNTVVITGHCTSLSVSGVQNTVTVEAVERIGASGFNNKVT
YHSGTPSISNSGGSNVVGRG
118466589YP_883376.1 cadmium-translocating P-type ATPase [Mycobacterium avium 104]MEDPALQVISDAAGRMRVSVGWVRADSRRAVAVEEAVAKCDGVRVVHAYP
RTGSVVIWYSPRRCDRSAVLAAIGEAAHVAAELIPARAPHSSEIRNADVL
RMVIGGAALALLGVRRYVFARPPLLGPSGRLFATGVTVFTGYPFLRGALR
SLRSGRAGTDALVSAATVASLVLRENVVALTVLWLLNIGEYLQDLTLRRT
RRAISELLRGSQDTAWIRLEHNEIQVATDTLQIGDEVVVHDHVAIPVDGE
VIDGEAIVDQSAITGENLPVSVVVGMPVHAGSVVVRGRLVVRARAVGNQT
TIGRIITRVEEAQHDRAPIQTVGENFSRRFVPTSFIVSAITLAVTGDVRR
AMTMLLIACPCAVGLATPTAISAAIGNGARRGILIKGGSHLEQAGQVDAI
VFDKTGTLTVGRPVVTNIVAMHKDWEPEQVLAYAASSEIHSRHPLAEAVI
RSTEERHITIPPHEECEVLVGLGMRTWADGRTLLLGSPSLLQAEKVKVSK
KAKEWVDKLRRQAETPLLLAVDGTLVGLISLRDEVRPEAAGVLKKLRANG
IRRIVMLTGDHPDIAAVVADELGIDEWRAEVMPEDKLAAVRDLQEEGFVV
GMVGDGINDAPALAAADIGIAMGLAGTDVAVETADVALSNDDLHRLLDVR
DLGSRAVDVIRENYGMSIAVNAAGLIIGAGGALSPVLAAILHNASSVAVV
ANSSRLIRYRLN
118466588YP_883233.1 transferase [Mycobacterium avium 104]MSTMPRTSFVIATRDRSAELTGTLTRLLDTTECPIIVVDNASRDDSVAAA
SRIAAAGRVTVIPLSRNAGAAARNIGVARCGTPYVAFCDDDSWWAPDAIA
RAEQIFDTFGTVALLAARTVLLPARRDDEFTEQLAHSPLGHRAGLPGPSI
LGFQACSALVRAWAFRRVGGFSPILHFRGEETLLACDLAADGWDLCFCPE
LVAYHRPSQIRSASRAQRARILRNALLTACLRRPVDRCARAGAALAWAAL
HDAAHAKALLEATAALPAALRERRRLPDAVERSLRMLESG
118466587YP_883688.1 methyltransferase- putative- family protein [Mycobacterium avium 104]MPRTDDDSWEITESVGATALGVAAARAAETESENPLISDPFARVFLDAAG
DGMWNWFAAPNLPAQIAEAEPDLKPRMQGMVDYMAARTAFFDNFFLAATR
AGVRQVVILAAGLDSRAWRLPFEDGTTVYELDQPRVLEFKATTLAEYGAR
PTCHLVSVPVDLRHDWPAALRQAGFDAHAPSAWSAEGLLPFLPAAAQQLL
FERVQTLAAPGSRIAVEAPGPDFLDEAARERQRQTMQRVRDLMADLEPDR
DIPDVQDLWYFEEREDVGDWLGRHGWDVTVTPAPELMARYDRRPPHDIED
ATPQTRFVAAQRTERTRPDR
118466586YP_880922.1 hypothetical protein MAV_1693 [Mycobacterium avium 104]MVPDLQDLQVMNSPIHPQSPFLPQVRGPGRVGPSPRRCRRAYWRP
118466585YP_882489.1 enoyl-CoA hydratase [Mycobacterium avium 104]MSLVLVDHPRPGVALITLNRPERMNSMAFDVMVPLKEALQKVTYDNAVRV
VVLTGAGRGFSSGADHKSAGTVPHVEGLTRPTYALRSMEILDEVILALRR
LHQPVIAAVNGPAIGGGLCLALAADIRVASTSAYFRAAGINNGLTASELG
LSYLLPRAIGSSRAFEIMLTGRDVTAEEAERIGLVSCQVPEEQLLDTCYA
IAARIAAFSRPGIELTKRTLWSGLDAGSLEGHMQAEGLGQLFVRLLTANF
EEAVAARAERRPPVFTDDK
118466584YP_882432.1 daunorubicin resistance ATP-binding protein [Mycobacterium avium 104]MSAPAIEVEGLTKKFGGSTLALAGVDFSVPAGTVCGLLGHNGAGKTTTIN
ILSTLIRPTSGRARVAGYDVVRQPAEVRASIGMAGQFTGMDPMLTGRENL
VLFGRLRGLNRRRAKARADELLEQFNLVDAADRRLSTYSGGMYRRVDLAS
ALVVPPKVLFLDEPTTGLDPRSRRDVWALVSSLRVQGISVLLTTQYLEEA
DVLSDSIVVIDHGRVIASGTSEELKRAVGTSYCQVTPANPAELPQVAAAL
TGLEGIEIDSDTGSVSVFAPDGVATLVEVFRRVDALGLELADISLRKPSL
DEAFLHLTERTVARS
118466583YP_880044.1 dihydrouridine synthase [Mycobacterium avium 104]MRIGPIELASPVVLAPMAGVTNVAFRTLCRELERELVGTVSGLYVCEMVT
ARALVERHPATMHMTTFAPDESPRSLQLYTVDPATTYAAAKMIANEGLAD
HIDMNFGCPVPKVTKRGGGSALPYKRRLFGQIVAAAVRATQGTEIPVTVK
FRIGIDEEHHTHLDAGRIAEAEGAAAVALHARTAAQRYSGTADWEQIALL
KQQVRTIPVLGNGDIYDASDALTMMAATGCDGVVIGRGCLGRPWLFAELS
AAFTGSPPPTPPTLGQVADIVRRHGRLLAAHFGEDKGMRDIRKHIAWYLH
GFPAGSELRRALAIVKTLDELDRLLDRLDGSVPFPDEATGPRGRQGSPAR
VVLPEGWLDDPDDCTVPAGADVMHSGG
118466582YP_880606.1 ABC transporter ATP-binding protein [Mycobacterium avium 104]MATDGFAPIEIRGLTKNFGAVRALDGLDLTVREGEVHGFLGPNGAGKSTT
IRILLGLVKADGGTVRLLGGDPWTQAVELHRQIAYVPGDVTLWPSLTGGE
IIDLLARMRGGIDKRRRAELIERFDLDPHKKARTYSKGNRQKVSLISAFS
SRARLLLLDEPSSGLDPLMENVFQQCVAQARDRGTTVLLSSHILAETEAL
CERVTIIRAGKTIESGSLSSMRHLSRTSIKAEMTGDPGDLRRIKGVEDIS
IEGNTLRAQVDSESLGELIRVLGDAGVRSLVSQPPTLEELFLRHYDTSGT
DGERGAHEAEVSLS
118466581YP_879594.1 sensor histidine kinase [Mycobacterium avium 104]MADTRRVWSLRLRLLVGQIVVLALVCLGITAVTELALNHHLVKQLDGQLA
GTSFRSALMYPEPNHPRHEHSPYPRPGPGPRFLDAPGQPAGMVAAVVSHG
KTVDAGYLTSSGTRDALTSTAQTQLEQIAGSRAPVTVNLDGLGRYRVVAA
PSRNGSDIIVTGLSMANIDATLIRMLVIFGIVTVIALAAATIAGVVIIRR
ALAPLRRVAQTAREVADLPLARGEVELPVRVRESDANPSTEVGQLGAALN
RMLDHIADALSARQASETRVRQFVADASHELRTPLAAIRGYTELTQRMGD
DREAVAQAMSRVASETERMTRLVEDLLLLARLDSGRPLEREPVDLSRLAV
DAVNDAHVAGPDHQWELDLPEEPVVITGDAARLHQVLTNLLANARVHTGA
GTVVTTRLSTEPAHTVLQVIDNGPGIPAELQSEVFERFARGDSSRSRKGG
STGLGLAIVSAVVKAHNGTISVNSSPGHTEFTVRLPPNGWQPHASA
118466580YP_883120.1 Rieske (2Fe-2S) domain-containing protein [Mycobacterium avium 104]MTRSGRPPEGSWTEHYPELGTGPVSFKDSTSPEFYELEREAIFKRAWLNV
ARVEELPRVGSYLTKEIEAARTSVIVVKGRDERIRAFYNVCRHRGNKLVW
NDFPGEETRGTCRQFTCKYHGWRYDLTGALKFVQQESEFFDLDPAEYGLR
PVHCDVWNGFVFINFDPQPRQSLREFLGPMITGLDGYPFDKLTERYDWVA
HNNSNWKIFADAFQEYYHVPALHSQQVPPEVRDSNAVFTCGHFQLDGPHR
LVSTAGRRRWLMPPEYMYPIERATRSGLVGPWRTPDIGELPAGLNPGRIE
QWGISNFQIFPNLEILIYGGWYLLYRYWPTSHNTHRFEAYTYFHPARSVR
ERIEHEVAAVVLKEFALQDAGMLGGTQAALEYGVVEDFPLNDQEILVRHL
HKVVVDWVDAYRRERETVGV
118466579YP_883296.1 helicase- UvrD/Rep family protein [Mycobacterium avium 104]MSFTWDAQAGAVLAPGAHGTVRVLGGPGTGKSSLLVDAAVAQIEAGVNPE
SVLLLTGSGRLPMAERSALTTALLRSAGAGPAVREPLVRTVHGYAYAVLR
RAAERAGEAPPRLVTSAEQDAIIRELLAGDLADGPRAATAWPAALRPALS
TAGFATELRNLLARCAERGVDPQALERLGRRCRRPEWVAAGQFARQYEQV
MLLRAAVGTAAPEATTPALGAAELVGAALEAFAVDAELLAAERGRIRVLL
VDDAQQLDPQAARLVRVLAAGADLALIAGDPNQAVFGFRGGDPGSLLDGA
APAVTLTTSHRCAPAVARAVSGVAGRLPGSSAGRRIEGAGPGEGSVAVRL
AASAHAEAAAIADALRRAHLVDGVPWSQMAVIVRSVPRAGARLPRALAAA
GVPVTAPAASGPLAEQPAVRALLTVLLATADGLDGQRALALLTGPIGRVD
PVSLRQLRRNLQRANAGRPPGDFAELLVEALTGTAPPPGALFRALRRVRA
VLDAAGRCHRDGQDPRYILWAAWHRSGLQRRWLSVSERGGPAAAQAGRDL
DSVTALFDITDDYVSRTSGASLRGLVEHVAALQLPGAGPVPVATAEQVSV
LSAHAALGREWDFVVIAGLQDGLWPNTVPRGGVLGTQRLLDVLDGVSADA
SVRAPLLAEERRLLVAAMGRARQRLLVTAVDSDTDGSDHEAALPSPFCYE
IAQWAGEDVETAALQPVSAPRVLSAAALVGRLRGVVCAPDGAVDELDRRC
AATQLARLAQAGVPGADPASWHGLIPVSTAEPLRGGGDVVTLTPSTMQTL
TDCPLRWLAERHGGTDPRDLRSAIGSVVHALIAQPHRSPAELVAELDRAW
RHLPFAAQWHSDNELARHRAMLEAFAQWRANTRGALTEVGVEVEIDGTLS
TGDGREVRLRGRVDRLERDAAGRLVIVDVKTGKTPVSKDDAQQHAQLALY
QLAVAHGLLGAAGGDAEPGGARLVYVGKAAASGVVEREQDPLTAAAADQW
REALRRAADATAGPQFIARRNDGCTHCPLRPCCPAHADGSGR
118466578YP_883277.1 hypothetical protein MAV_4128 [Mycobacterium avium 104]MLAAFGFESLGVVVGDMYFIDPDPLEGQETPERGVRLELRLVDRDEPQGS
IYAGVPITFGRPVWRVDLFGSTESPPGTLDRAHHHPRFNGWEPSRRHFVP
ELSADPLSWLAGQLADPAAVLARAGVDPDEVSRADRAGLAAAAPEIVAAV
KRLLDGVRDGTLAPAPEKPVAAARTGWL
118466577YP_882037.1 acetyl-CoA acetyltransferase [Mycobacterium avium 104]MTVDPRTPVLIGYGQVNHRDDIDPAVRSVEPVDLMAAAVERAADAAVIEA
VDSIRVVNILSAQYRDPGLLLGQRIGARDFGTLYTPVGGNVPQSLVNQAC
LDIQRGRANVVLLAGAETWRTRRGLRAKGGKLVWTEQDRSVPMAEVSGED
VAMAGEAEIRISLDRPAYVYPLFEQALRVSTGESVEDHLTRIGRLWARFN
AVAVDNPHAWIRTPHSADDICRAGPHNRMISWPYTKLMNSNNMVDQGAAL
VLTSVEQARRLKVPPERWVYPLAGTDAHDTASIAERHELHRSAAIRIAGA
RALQLAGLGIDDVDHVDLYSCFPSAVQVAAAELGLGLDDPARPLTVTGGL
TFAGGPWSNYVMHSIATMAELLVANPGRRGLITANGGYLTKHSFGVYGTE
PPAEFRWEDTQSAVDREPTTDAAVEWEGVGTVEAWTTPHDREGEPEKAFL
AVRTPDGSRALAVVTDRAAAQATVREDIGGAKVAVAADGSAALQ
118466576YP_880870.1 hypothetical protein MAV_1636 [Mycobacterium avium 104]MRVTVDENLCEANGFCESLAPDVFELGDADVVQIADGPVPPRLEIDVRAA
VDQCPKAALRLID
118466575YP_880824.1 enoyl-CoA hydratase [Mycobacterium avium 104]MSAADHVVTDEAVLYQTTETGVAVVTFNRPERLNAWGPDISSGFYACIDR
AEADPAVRVIVLTGAGRGFCAGANLGGAGSIDAKLGDGDTDVTALVGDRH
PHFLTALRKPIIAAINGACVGIGLTHALMCDVRFAAAGAKFATAFTRRGL
IAEYGITWILPRLAGWGAAMDLLLSGRTFFAEEAAKLGLVNEIVAPDELM
ARALTYADDIARNCSPASLAVIKRQAYDDALRDVVDVSARAETLMHESLQ
RPDVIEGITSFLEKRPPRFPPLAT
118466574YP_883060.1 hexapeptide transferase [Mycobacterium avium 104]MTTMWGAPLHRRWRGSNLRDPRQAKFLTLASLKWVLRNRAYTPWYLVRYW
RLLKFKLANPHIITRGMVFLGKGVEIHATPELAQLEIGRWVHIGDKNTIR
AHEGSLRFGDKVVLGRDNVINAYLDIELGDSVLMADWCYVCDFDHRMDDI
NVPIKDQGIVKSPVRIGPDTWVGVKVTVLRGTSIGRGCVLGSHAVVRGVI
PDYSIAVGAPAKVVKNRQLSWESSAAQRAELAAALADIERKKASR
118466573YP_883566.1 RNA polymerase sigma factor SigL [Mycobacterium avium 104]MVGISRASGTAEAALMKALYDEHAAVLWRYALRLTGDASQSEDVVQETLL
RAWQHPEVIGDTERSARAWLFTVARNMIIDDRRSARFRNVVGSTDTAGAP
EQSTPDEVNAALDRLLIADAMAQLSAEHRAVIERSYYRGWTTAQIATDLG
IAEGTVKSRLHYAVRALRLTLQELGVTR
118466572YP_881308.1 hypothetical protein MAV_2093 [Mycobacterium avium 104]MAAPVSLREDQLTRLVAVFPGSPSEARVAALIRRVCAQTSSLPPLPAPME
VGEPESETEAAVAEFAEQFSADVSAITHAQRSRLSKQLGDRTFGVVVQMY
IADFVPRVRAGLDALEVGSRYLGWLSGPISWDYGSDPSDLVFNDFLIAVA
RMRALDPVTSELVRLRGAAQHHCRLCNSLREGSALDAGGSETLYEEIERF
ESSGLLDERAKAALRYTDALIWTPAHLVADDVAEVRSRFSEAEAVELTFD
IMRNASNKVAVSLAADAPRVENGTQRYLIGADGQTVFS
118466571YP_882639.1 hypothetical protein MAV_3457 [Mycobacterium avium 104]MVEHMFEYVVASRSTPEAVALLDRAREAARAEARAAAARLVAVAELLVLR
CRETGERADWAADAWEAVAAQVGAALGCSVAMGHSYLRYAMAMRERLPQV
GAVFAAGGIDYRAFQTLVFRTDLITDAQVLARVDATLAVLVSRRPSLTRG
GLAAAVDRVVAAVDADAVRRARDAVTGRYLDVRANESGMAWVEGNVLGPD
GHALDRRLDELASGVCAGDPRSRAQRRADALGALAAGAGRLACGCGSPDC
PSAAAPAPRSTVVIHVVAEQATVAGRGATPAVVAGLDGLIPAQVIAELAA
SARLVPVAVPEGGPEPGYTPSARLADFIRCRDLTCRAPGCDRPAVDCDVD
HTIPYAQGGPTHPSNLKCLCRGHHLLKTFWGWRDRQLPDGTVIWTLPDGD
TYVTTPGSALLFPTLCTPTGAVSPAKPDTEHRCGERTAMMPLRRHTRAHN
RAHRITTERNHNRRTRLTTHPATPGPAPPPDPDDEPPPF
118466570YP_881596.1 RecB family protein exonuclease [Mycobacterium avium 104]MIVQPEARQSAARPAGQVSRPALSPSRAADFKQCPLLYRFRAIDRLPEAP
SPAQLRGSLVHAALQQLYELPAAQRGPETALALVGPAWEQLLAATPELTA
DLDPTQHGQLLAEAQALLAGYYRLEDPTRFDPQCCEERVEVELADGTLLR
GFIDRIDVAATGELRVVDYKTGKAPPAARALAEFKAMFQMKFYAVALLRS
RGVPPTRLRLIYLADGQVLDYSPEYDELLRFEKTLMAIWRAIQSAGRTGD
FRPTQSRLCDWCPHQQLCPLFGGTPPPYPGWPDTLGAQDNSTLSDPVDLA
G
118466569YP_880244.1 hypothetical protein MAV_0984 [Mycobacterium avium 104]MRILISGASIAGPVLAYWLTRYGFEVTVVERAPTLRKTGGHAVDLFRPAM
EISAKMGVLPRIEDLATGTTRLTLYREGRPQPSRIDLTKIYAASSDRHVE
IMRDDLSEVYYDAARDDVEYLFGDSITAIEPDGTVTFEHCAPRTFDVVVG
ADGLHSNVRRLTFGDEAGLTRFLGGYLSVVSAPKTLVGPGEMVGHVGVGR
FAGIYTADHLDDARAVFLFRSAAELAYDHRDTARQKELLREAFAGMHDEV
DGWLAETERTPTFYFDSITQLRTDRWSRRRVTLVGDAGYCPGPAVGGSTS
LAVLGAYVLAGELARADGDHLRAFAAYELQMRESVRRSRSFARAAARGVI
PGSRAGVWALTRGAQLVSAMPTSLARALAKLNTKGVRMHDSMPVPDYAGS
DV
118466568YP_879356.1 short chain dehydrogenase [Mycobacterium avium 104]MPNALITGAGGGIGSAIATALAPTHTLLLAGRPSDRLDAVAQRLGATTFP
LDLTDGGDIEAACEVVDELDVLVHNAGLSIPGNVADSNVDEWRATFAVNV
FGPVELTLALLPALRRARGQVVFINSGAGRNVSPGMASYSASKFALRAFA
DSLRNDEPELRVTTVYPGRTDTGMQRELIAFEGGSYDPDRFLKPETVAAA
VANVVATPPDGHVHEVVLRPARR
118466567YP_881284.1 LprM protein [Mycobacterium avium 104]MRSLLSQIDEFIAHTNEQTDDIIAAAENLNALAGQVAAADPVVDKALTSV
PKALAVLAQERTKIADTIDRVGKFSAIAADTIHQSKQSLVDNLRNIAPVL
RSLADAGPALTRGLDGLATYPWPASTVRNWFRGDYANLTLIVDLTLSRID
QGLFTGSRWEGNLTQLELQWGRTIGMQPSPVTGGNPLTYPYHFGGY
118466566YP_883626.1 30S ribosomal protein S12 [Mycobacterium avium 104]MPTIQQLVRKGRRDKIGKVKTAALKGSPQRRGVCTRVYTTTPKKPNSALR
KVARVKLTSQVEVTAYIPGEGHNLQEHSMVLVRGGRVKDLPGVRYKIIRG
SLDTQGVKNRKQARSRYGAKKEKS
118466565YP_879895.1 acetyl-CoA acetyltransferase [Mycobacterium avium 104]MGNPVIVAATRSPIGKRNGWLSGLHATELLGAVQKAVVEKAGIDAGDVEQ
VIGGCVTQYAEQSNNISRTAWLTAGLPDHVGATTVDCQCGSGQQANHLIA
GLIATGAIDVGIACGIEAMSRVGLGANAGPDHNWRAESWDIDMPNQFEAA
ERIAKRRGITREDIDEFGLASQAKAKQAWDEGRFDREISPIVAPALDENK
QPTAERVTISRDQGLRETTLSGLSALKPVIEGGIHTAGTSSQISDGAAAV
LWMDEDKAKALGLRPRARIISQALVGAEPYYHLDGPVQSTAKVLEKAGMK
MGDIDITEINEAFASVVLSWARVHEPDMARVNVNGGAIALGHPVGCTGSR
LITTALHELERSDQTTALITMCAGGALSTGTIIERI
118466564YP_882307.1 hypothetical protein MAV_3124 [Mycobacterium avium 104]MTGRSTTAADPLGPDSLTWKYFGDLRTGMMGVWIGAIQNMYPELGAGVQE
HSILLREPLQRVARSVYPIMGVVYDGDRAPQTGRQITSYHHTIKGTDASG
RRYHALNPDTFYWAHATFFMLIIKVAEYFCGGLTEAEKRQLFDEHVQWYR
MYGMSMRPVPKSWEEFQEYWERTGREVLEINQATLDIFRMRIPKPKFVLM
PTPLWDQLFRPLVAGQRWIAAGLFEPAVREKAGMHWTPGDEVLLRLFGKI
VELAFLAVPDEIRLHPRALAAYRREQGRLPSDAPLVEAPPFMAPPRDRRG
LPMHYFPPPPRLPFDPALQPARALMERAGSLVHTTLSLAGLRAGRGRPKR
PVRAA
118466563YP_881916.1 hypothetical protein MAV_2727 [Mycobacterium avium 104]MAALVFALAGLAFLDSLNVLNVGVVSAVIFDSRLSRRSPVPGALSFVAGV
FAVTTTFGLCTVLGISFITTALDFHVTPAIRFRGELVLGIALICLAYFPL
TAQSSAPGWAMAAMRKRPWLLGFLGLAVGSGQAPTAVPYLTGLAMLAALD
PRPPLWPLVIIAYCAIAVSPPLAILALSLRRTPRAMRIQRGLVRALTRYG
PMSVRLLFLVFGVGLIADALVNHSALW
118466562YP_881206.1 DNA-binding protein [Mycobacterium avium 104]MITLDRLVNVLGGYGVRLRWSSVPRSTELRSVVIHETPEDRPVVGDVLLA
VGAGSLDEAVRWAASARAAVVVLRDDETPMTFDGVTDVGAVLVIDPTVSW
SAVAAVVYGLVLEGRETESGRGPTDLFALADSLADGIGNPVVIQDRHLGV
LAYSRLAQADPALVETVLQRQTPEPLRALLEARGVFAHLQVADEPLFVAE
DAERGLSGRMVVAVRAGAELIGSVWVACEAPLQPAALRALADGARTVALH
LLRSRASADLERQVESELVIRLLEGTADAATVASRLDLAHNGLRVVAVQA
FVGADRDAPLLLAFERATTGFGWSRPGRSALAGNSVYAVLPADEASTARR
WVGALRAALPERLTMIAGISGVAEVGDLAAARQEADECLALHEMSPAAPP
PAYDESWDDILLQRLRAAARSGRAPTRGPVADLGRHDRANGTDYLATLRA
WLQAQGDPAEAGRQLGVHENTVRYRLRKMAEITNLSLDDSKKRLAMMIEL
AAIHTD
118466561YP_883128.1 hypothetical protein MAV_3970 [Mycobacterium avium 104]MLVAFLTVTVLISAIVGAIAAAAMGQPTAALLIALVAGGWFSAAVLC
118466560YP_881854.1 lipid-transfer protein [Mycobacterium avium 104]MTCAVVGIGRTEYSRNSGRTTRGMAVAACRDAIADAGLTPADVDGICTFM
ANDSEQPIFVGWALGIDELAWANAMYGGGNLVADQIATAAAVIEAGMCKA
VLVYRSLNGRSGYRFGHIEGPMQVQHHDQFDTASGFMVPPQWFAMWARRH
QHEYGSTSEDLGHIAITQRNHAGPNEHALRREPLTMDDYLAARWINEPFR
VLDCTSEVDGAVAVLIVGEDIARNTKQPPMWLVGSSNSQGGAGWSEWDDP
TEMYSRTAGPKIWEKTGLTPADMDVACMYDCFTYTVMATMEGFGFCEKGE
VGKFFSTGRATYGGDVVVNPHGGLLSEGYIHGLNHHYEAALQLRHAAGVR
QVEGAQLALVTAGGGPFGGANVYSKEHP
118466559YP_882647.1 adenine phosphoribosyltransferase [Mycobacterium avium 104]MTDAGEATPVAELIASLTRQVPDFPKPGIQFKDLTPLFADATAMTAVTGA
LARHASGADLVAGIDSRGFLVAAAVADRLHTGVLAIRKGGKLPPPVHAER
YDLEYGSATLEIPADGIDLRGRRIVIIDDVLATGGTLAAAARLLRRTGAT
VTAAAVVFELGALGGRAALAPLPVHRLTCQ
118466558YP_879304.1 chromosomal replication initiation protein [Mycobacterium avium 104]MWNAVVSELNGEPVADGGAANRTTLVTPLTPQQRAWLNLVRPLTIVEGFA
LLSVPSSFVQNEIERHLRAPITDALSRRLGQQIQLGVRIAPPPDDVEDAL
IPPAEPFPDTDAALSADDGADGEPVENGEPVTDTQPGWPNYFTERPHAID
PAVAAGTSLNRRYTFDTFVIGASNRFAHAAALAIAEAPARAYNPLFIWGE
SGLGKTHLLHAAGNYAQRLFPGMRVKYVSTEEFTNDFINSLRDDRKVAFK
RSYRDVDVLLVDDIQFIEGKEGIQEEFFHTFNTLHNANKQIVISSDRPPK
QLATLEDRLRTRFEWGLITDVQPPELETRIAILRKKAQMERLAVPDDVLE
LIASSIERNIRELEGALIRVTAFASLNKTPIDKSLAEIVLRDLIADASTM
QISAATIMAATAEYFDTTVEELRGPGKTRALAQSRQIAMYLCRELTDLSL
PKIGQAFGRDHTTVMYAQRKILSEMAERREVFDHVKELTTRIRQRSKR
118466557YP_879919.1 FMN-dependent monooxygenase [Mycobacterium avium 104]MKLGLQLGYWGAGPPENHGELVAAAEEAGYDAVFTAEAWGSDAYTPLAWW
GSSTSRVRLGTSVVQLSARTPTACAMAALTLDHLSGGRHILGLGVSGPQV
VEGWYGQRFPKPLARTREYIDIIRQVWAREKPVTSDGPHYPLPLTGTGTT
GLGKALKPITHPLRADIPIFLGAEGPKNVALAAEICDGWLPIFYTPRLAD
MYNEWLDEGFARPGARRSRADFEICATANIVITEDRGAAFAAMKPYIALY
MGGMGAEDTNFHADVYRRMGYAEVVDDVTKLFRSGRKDEAAKIIPDEVID
DAAIVGDVDYVRKQIKAWEAAGVTMMVVSGRSTEQVRELATLI
118466556YP_882630.1 2-dehydropantoate 2-reductase [Mycobacterium avium 104]MVCGRTPRERIELRPDDADPIVVPGPVHTDPGRVSGPVDVVLLAVKATQN
AGAAGWLARLCGEHTVVVVLQNGVEQVEQVRPLCPDSPVIPGIVWYSATT
QPQGWVRLRTEPALVLPSGPSAQAVAALLRDAGCRVDCDPDIITAAWRKL
LTNALAGFMALSRRRSGMFRRDDVAALSRRYVAECLAVARAEGARLSDDV
VDELVELFRRAPEDMGTSILSDAEAHRPMEWDVRNGVIARKGRAHGLPTP
ISDVLVPLLAAASDGPG
118466555YP_879625.1 hypothetical protein MAV_0338 [Mycobacterium avium 104]MLLTVLRFNFASPHGDPRTQSRLMSAALELAQWGESHGITSVSVDEHHAT
GHGWSCNPIMAAAMFLARTSTLIASVDCALGPLWNPVRLAEDIALVDNMS
RGRLHTTVGLGYRPVEYDALGADFGRRGALMDSLLERMLAVWSGGGAPAG
ICTGTWTRPHPPLYVGGGARATARRAARFRLPLSLADHLPEIADYYRELC
AEIDLAPVVLMPGPLNRGMIYLHEDPERAWAELGDHILWEAVTYGGWSTD
QRSLMHLPGVQTLDEVRASGRYRFLTPDQLIAEVRDAPDFGPIVLHPLVG
GMPVEEAWQSVQLLTDKVLPALKG
118466554YP_880943.1 ATP-dependent protease ATP-binding subunit ClpX [Mycobacterium avium 1MARIGDGGDLLKCSFCGKSQKQVKKLIAGPGVYICDECIDLCNEIIEEEL
ADADDVKLDELPKPIEIREFLEGYVIGQDTAKRTLAVAVYNHYKRIQAGE
KGRDSRHEPVELTKSNILMLGPTGCGKTYLAQTLAKMLNVPFAIADATAL
TEAGYVGEDVENILLKLIQAADYDVKRAETGIIYIDEVDKIARKSENPSI
TRDVSGEGVQQALLKILEGTQASVPPQGGRKHPHQEFIQIDTTNVLFIVA
GAFAGLEKIIYERVGKRGLGFGAEVRSKAEIDTTDHFAEVMPEDLIKFGL
IPEFIGRLPVVASVTNLDRESLVKILSEPKNALVKQYTRLFEMDGVELEF
TDDALEAIADQAIHRGTGARGLRAIMEEVLLPVMYDIPSRDDVAKVVVTK
ETVQDNVLPTIVPRKPSRTERRDKSA
118466553YP_879552.1 hypothetical protein MAV_0263 [Mycobacterium avium 104]MTTQTDCIITAADAVVHAHADALAPLTAIGRGTVEDPPTVEASLAAALHL
IAAKPALDAAVTDLLRELIDAGVRESKLARLLSIRSSTLTDRLAASAPTA
VPVPELHYGMFRRKDKVSRRAARESMIAAARDLGRTYAAALRPISTVSQG
SVPEAAVVDEALEAVLHLHRSRSALDAALDPILAALVLGGVRRMSLAEGL
GVHATTLQRRLAGQPLAHARHADLRDEGEGKWSVIRAEVGRYAPAQELDK
AVVQAAVNEAITGIQETAPTRGAREDSVTVPQSPSQFSDGLAR
118466552YP_882134.1 acetoin:2-6-dichlorophenolindophenol oxidoreductase beta subunit [MycoMADQEMTMREALNLALDQALAADERVFLLGEDIADPGASGPTAGLSTKYG
CDRVLDTPISEAAIVGAAIGAAIDGLLPVAEIMIMDFIGIAADQLINNAA
KLRFMTAGRTSAPLTVRTQVYAGLSTGATHSQSLEAWFMHIPGLKVIVPA
TPRDGKGLLSSAIFDPDPCLFIETIRLQGKKGLVPVEPGFRIPLGQADIK
RPGTDVSLIGYGRPVHDALAAAAMLGDQGVSAEVVDLRTLVPLDVDTVVA
SVRRTRRAVIVHDAVQFAGPGAEVAAILHSRLFSELAAPVERVAARFVPN
PAAAALEAQVYPSPERIAAAALKTLGRTLTGATAHG
118466548YP_883309.1 acid phosphatase [Mycobacterium avium 104]MGLHNHRLVLLRHGETEWSKTGRHTGRTEVELTEAGRTQAERAGRALSEL
KLVEPLVISSPRQRSLATAELAGLNVDEVSEQLAEWDYGSYEGLTTEQIR
QSVPDWLVWTHGCPGGESVAQVSGRADAAVTAALRQMESRDVVFVSHGHF
CRAVMTRWVELPLAEGSRFAMITASIAVCGFEHGVRQLRALGLT
118466546YP_881821.1 thiolase [Mycobacterium avium 104]MGVGATPYYKRGGSLPKSITELAGEAILAACDDAGLPVTDVDGFAYYSGA
SAGYTEKMDTADFMETLGIPEVRFTAALTSGGGGSAGAIGLARAAIVAGD
ASVVVTVMALQQSKQRLGSVFSAMDPDPINSFLQPSGLFGPGQLMSVLAR
RHMHLYGTRREAFAEIALSTRANAFNRPKAMHRQPLTLDDYFNARMIAEP
LCLYDFCQETDGAVAVITTSMDRARDLRQPPVPVVAAAHGGVRDWGRAFA
WMGMPDEYFASSGNAPIAKRLYEQAAISAADIDVALLYDHFSPMVLMQLE
DYGFCGKGEGGAFVESGAIRYDGGSIPVNTHGGQLSEAYIIGMTHIMEGV
EQMRGTAINQVRDAELALVTGGPASLPVSGLILGRAA
118466545YP_881125.1 2-hydroxy-6-ketonona-2-4-dienedoic acid hydrolase [Mycobacterium aviumMTGSQPPETDAEAITRLDTDNYRSLWMYLKELEFRQGFVDIAVNGTVVRT
RYAEAGSPDKPHAILLHGTGGHWETFAPNLEALSEHLHCVAIDMVGNGFS
DKPDYDYEIAVYVEHVLGVMDHFGMTSANFVAMSLGAFVASAVAVGHPDR
VDKVILMSPAGREASASNMARIRAERTKAVNEPTWGSLHAVFAHLIADES
NRLPDLIGLRQAIYRREDTRRTIDRLLILQDEKVRNRNLIPDEKWRGITA
PVMIVASGKDHGVYQDTARTIADLIPNSEVFEMPSVRHWPHFEDPESFNA
AAVEFLTRR
118466544YP_883672.1 cyclopropane-fatty-acyl-phospholipid synthase 1 [Mycobacterium avium 1MAENLTPHFEEVQAHYDLSDDFFRLFLDPTMTYSCAYWDRNRDISLEEAQ
LRKIDLSLGKLGLRPGMTLLDVGCGWGATMRRAVENYDVNVIGLTLSRHQ
AAHVQQLLDAMDTPRSRRVLLHGWEEFDEPVDRIVSIGAFEHFGYDRYDD
FFATAYRVLPDDGVMLLHTITMLTPEQIVERGLPLTEEQTSFNEFIATEI
FPGGQLPAIEVVEFHSSKMGFTLKRRQSLQLHYARTLDHWADALRAHHSE
AVAIQSEEVYQRYMRYLTGCADAFRAGYIDVNQFTLAK
118466543YP_879994.1 esterase [Mycobacterium avium 104]MMTRMPDLSRRAVLRLGAGAAVGAVGAYGLDILLQPRASQAMPAAGTGTP
LAPPPPAPGPPRDPAPPAAAAPTMVTGSFVSAARGGVNTNWAIARPPGQT
KPLRPVIALHGKGSDAATVMAGGVEQGLAQAVNAGLPPFAVVAVDGGGSY
WHKRSSGEDSGAMVLDELIPLLGNQGLDTSRVAFLGWSMGGYGALLLGGR
LGPARTAAICAVSPALWLSSGAAAPGAFDGPDDFAANSVFGMPALGSIPI
RVDCGDSDPFYAATKQFIAQLPNPPAGGFSPGGHNPEFWSSQLPAELSWM
APLLTA
118466542YP_882867.1 hypothetical protein MAV_3690 [Mycobacterium avium 104]MRAVVGVTRVLGGLALAAIAAVAPRAVAQPPGFPNLDGFTAVPSDGYLTS
GAPGSPPRIGFSTPYAVACDFYGGPAPVPQPSQDIKCKGDMSGMDDVPFP
GGRPRPGDCVLGTVDFKGPGYQLSRMSYGGCDGNPAPLPSGGKTLGAGQK
LTYLNVTCAVGADHLIACLDTTSGDHGFVVQRTGSWAF
118466541YP_883270.1 FF domain-containing protein [Mycobacterium avium 104]MFTVDDKATGPHDAALDHERIVLQARDVDFDWSALPFYYVPGEPFTTHFC
NVLHLLLPAGEEFIVEAFKDTLPLIKDDQLRRDVQGFISQEAMHSQAHAG
VLGHFAAKGIDVTPFTDQMRWLFGQLIGDRPRWSPRRRQSWLLERVSMVA
ALEHYTAILGEWILDTPQHDALGTDPVMLDLLRWHGAEEVEHKAVAFDTM
KHLRAGYWRQVRTQLLVTPALLWLFIRGVRFMYSVDPHLPPGSKPRWRDY
FSAARRGLVPGPFEFLRVIGAYYTPGFHPSQLGGVGRAVDYLARSPAARA
AH
118466540YP_882534.1 acyltransferase- ws/dgat/mgat subfamily protein [Mycobacterium avium 1MMKRLSSVDAAFWSAETAGWHMHVGALAICDPKGSAEYTFERLRQLLIER
LPEVPQLRWRVTGAPLGLDRPWFVEDEELDVDFHLRRIGVPAPGGRRELE
ELVGRLMSYKLDRSRPLWEMWVIEGLDGNAGGRFATLTKMHHAIVDGVSG
AGLGEILLDATPEPRPPQQETVGSLVGFQLPGLERRAVGALINVGVKTPF
RIARLLEQTVRQQVATLGVRSRPPRYFEAPKTRFNAPVSPHRRVTGCRVE
LARAKAIKDAYDVKLNDVVLALVAGAVRDYLQKRGELPAKPLIAQIPVST
RTDENKDDIGNKVSSMTVSLATHIEDPGERLRAIHDSTQSAKLMAKALSA
HQIMGLTETTPPGLLHLAARAYTASGLSRNLAPINLVVSNVPGPPFPLYM
AGAKLDSLVPLGPPVMDVALNITCFSYTDYLDFGFVTTPEVANDIDDMAD
RIEPALTDLEKAAAGETG
118466539YP_883709.1 heat shock protein HtpX [Mycobacterium avium 104]MTWHPHANRFKTFALLVGMSALIVFVGSLFGRTAMFFAVLFAIGMNVYTY
YNSDKLALRAMHAQPVSELQAPAMYRIVRELATAAHQPMPRLYISDTNAP
NAFATGRNPRNAAVCCTTGILGILNERELRAVLGHELSHVYNRDILISCI
AGAMASVITALANMAMFAGMFGGNDRDGENPFALLLVSLLGPIAATVVRL
AVSRSREYQADESGAVLTGDPLALASALRKISGGVQAAPLPPEPQLASQA
HLMIANPFRAGERIGSLFSTHPPIEDRIRRLESMAGR
118466538YP_880105.1 hypothetical protein MAV_0832 [Mycobacterium avium 104]MRRRLDRSPDPDLDQVARIAVGVAEKIRDDDPRLLFDQLTDLCRWHPAKA
AQLIMTFAAWFDLDVPVQALWARVHDITGDVPRGAA
118466537YP_881052.1 retinol dehydrogenase 14 [Mycobacterium avium 104]MAKTIVITGASDGIGRAAARILRDAGHTIVVVGRSLEKTKAIADELGCRH
HIGDFARLEDVRRLAGELLEQYPVIDVLCNNAGGIMADRRTTVDGHEMTL
QVNHLAPFLLTTLVLPRLISSKATVIATSSSVNRRGRIRLDDLEGERRYS
ATGAYSAAKLANILFTKELHRRYADAGVTAVSFEPGPVASNFGADSTLLM
RLIYHSVANRFLLSPTRGADTLAWLADSRPDVDWSSGLHYRKRKPVKPSR
LADDAALGRQLWKQSELMVQ
118466536YP_883404.1 leucine-responsive regulatory protein [Mycobacterium avium 104]MSETLDDVDRILVRELVADGRATLAELAASARLSVSAVQSRVRRLEARGV
ITGYSARIEPEAVGHRLSAFVAITPLDPSQPDDAPARLQHIEEIESCHSV
AGEESYVLLVRVESARALEDLLQRIRTAANVRTRSTIILNTFYDNRVYVP
118466535YP_883168.1 PPE family protein [Mycobacterium avium 104]MDFGFLPPEVNSARMYAGPGSGSLLAAAGSWDSLAAELSITAAVYESVLA
GLTGLYWHGPASRAMAAGAAPYVGWLHTTAERAQQTATQARAAAAAYELA
HAMTVPPAAVAANRTQLAALVATNFFGQNTAAIAATEAQYAEYWAQDAAA
MYAYSASSAAAAQFSPFASPRRTTDPGGVTAQQAAVAAAETGSTGTDSGT
QVIPPTAGASEIPLDFRILDTILGAQTTFRSIFTTEGIPAGIIQADKNLG
ILPNLATIPAALPRTPALSASPTGLGRIDAVLARAARIGPMSVPAGWTAA
TGNPVAAAPVTGWSEPSAADARPGVTAPGLPGIPGATLRRAALVVPRYGV
RITVMARPPAAG
118466534YP_880146.1 3-ketosteroid-delta-1-dehydrogenase [Mycobacterium avium 104]MTDFDHLVDVLIVGSGGGGMTAALTAQAAGLDALIVEKSSHFGGSTALSG
GGIWVPGAPAQRREGYSPSPEGVVEYLKNITDGLVSEARIRQYVETAPQM
LAFLENLSGWFEFVWKPGYADYYPELPGGSELGSTINVPPIDLRKLGPDE
HKLLQPLALAPKGIWLGPKELRTFYRIRQSWAGKAVLLKLIARMVRARVF
GERMAAIGQSLAARMRLALRDRGVPLWLDSPMVRLLTDPQGAVSGAVVER
EGKPQRIGARFGVILASGGFDHDLAWRKELLPEVEQDWSFGNPAAMGDGI
RAGQNVGAATDLLDEAWWFPAIQWPDGRMQFMLNERMMPAQFIVNGAGRR
FINEAAPYMDFGHAMIEGQRSGVTHIPCWLITDHRSWNRYVIGGHLPLPK
IPGAPVPTGRKIPPAWLESGVVKAAMTWDEMAAQIGVPAGELAETARRFN
ELARKGHDDDFNRGDSVYDNYYGDPTLPNPNLYPLGDPPYYAFRIVLGDL
GTSGGLRTDEHARVLRADDTVVPGLYAVGNTSAPVMGRSYAGAGATIGPA
MTFGYVAAKHVAAQVANRAANTHRR
118466533YP_881164.1 hypothetical protein MAV_1945 [Mycobacterium avium 104]MTGSPAPDVDLDSGQPWEVVVERGKIAEFAEAMLSDDPAYRGPGAIIPPT
FLTSAARWAPPGVRVSVGFDRKRLLHGEQEYTFHGDLPAEGDVLTAVERV
VDRFSKPGKRGGTMRFATVVTEYRNAAGELIAEAKATFIETAAKR
118466532YP_883504.1 peptidase M22- glycoprotease [Mycobacterium avium 104]MSPLVLALDTSTPAVTAGIVRRDDLSVLAQRITVDARAHAERLTPNVLAA
LRDSGLNMTDLAAVVVGCGPGPFTGLRAGMATAAAYGHALGIPVHGVCSL
DAIGGQTTGDTLVVTGARRREVYWARYRDGVRTDGPAVAAPADVDPGGAE
AVAGSPEHARLFGLPVTGPAHPTPAGLVAAVGDWSVRPQPLVPLYLRRPD
ATPRAARP
118466531YP_880499.1 alpha/beta hydrolase [Mycobacterium avium 104]MEFAGVDGITLVADEWNRGSDGAGRPSILMLHGGGQNRFSWKNTGQTLAD
EGLHVVALDSRGHGDSDRSPQADYQIETLTADVLRVLDAIGRPVTIIGAS
MGGLTGILAAHRAGPAKVTRLVLVDVVPRFEKDGSARIRDFMISGLDGFD
SLEQAADAVAAYLPYRSKPRSPEGLKKNLRLRDGRWYWHWDPAFMTKPGD
DPELRTESFEQAAKNLSIPVLLIRGKLSDVVSPEGVRHFLATVPRAEFVE
LSNAGHTAAGDDNDAFSDAVVAFVKRR
118466530YP_883879.1 hypothetical protein MAV_4753 [Mycobacterium avium 104]MCTQGGDTPTIRALVQHRKPQRNTESRTATPKADTSH
118466529YP_880652.1 cyclic diguanylate phosphodiesterase domain-containing protein [MycobaMKRWAVNPWRRSGVPARVGWLLAGGYGTAALLVLLSSVRGWRGPYGTRPV
DDLVMFVCLAVAAMCAARAARAASGRRRYGWLALTTALLGWAVGEVIWAV
YDVRPEFEHAAHPAAAEMVLLLFPVGAMTSLVLLSQLSRHSPRRLLLDGL
IVATSLFVISWVFVVEAQLREHTGTQVATLAEVFNDIVLMTTAILTLSRA
RPGDRPSRSLLACGIATISVTDIAMVFYTGIGSYHTDDIGDLARVAGVGT
LALAGLASVYEQPAPGSPDEIEFRTRLWLPYLPLILAAAVGWGHAAGKAI
HEPMLAALGILVAAVLARQFVVLVDNQNLLSEVAREAFRDNLTGLANRAL
FVHRLEQAVARRHPDGTPIAVLCLDLDNFKAVNDALGHPAGDELLVRVAE
RLTAALGDSGTIARLGGDEFAAVIEASVDESQAAAHRILEAFTGAILIDG
IPITVRPSIGFTVCTGASTCTVDQLLRHADLAMYAAKREGGQCIRSFMPD
LPLPYAFPPPPGSAAPTAVAAVAAGGNGAAPASPPQVATAATSSPSPHDA
ARRPPRGIRAALGMLAIGVVAFSVSSVAHPDAGHGIFSATALYSALNAVA
AGLIALRACRIPADRWAWALIAAGMACSAVGDVVYAVWVPDGRSPSVADP
EYLAYYPFVYAGLLLLMRARLKRLPIAVQLDSVVCALTLAAVAAALTAGP
LHQAAVHAPKTVWVGLAYPWCDLMLLALAAGMLPILGWRNEIRWALLVAG
LVLFAVADGAYLFQTAAGSYRVGSLLDVCWPASSVLIAMASWAPPPATAT
QARRRFSPYVTPVASTIVALGVIVLAHHSRSAATLAALSLVVGAGRFSLT
FRDVSLLHSHDRHAMTDELTALPNRRQLVTALQGLPASASPGAGSMPSRA
NPRRALLLLSLSDFHEITESIGRQFGDELLCHIANRLAGSVRRDDLLARV
GDDQFAVLLADGANLTAASAQAGRLLEALSEPIALDPITVQVDGRIAIAL
CPDHCDHPRELLSRAETALAHAKSARSKIAVYDSAFEAHRDNDTNLIEEL
RTALFDTDELKLHYQPKIDGRDGSIHSVEAVLRWQHPTRGTLLPEEFLPV
AERAGLMRKISNRTLSMALQQVRSWREEGLRLTVAVNLSTTNLLDIELVG
TVERLLANYDLPADALILEITESALVDSVRSRNTVTALQRLGIRISIDDY
GTGWSSLARLQEVSVDELKLDRIFVARLAHDARSVAIVRSTVALADNLGA
DLVAEGVENEDTLDALRRYGCNITQGFVHTPPLPPDELRAWIASHAPDPS
QSRG
118466528YP_881221.1 transposase [Mycobacterium avium 104]MKCELLKNAQLTPEVFVSHRNAPLSETGRLRLARCVVEDGWSLRRAAERF
QVAVTTAQRWASRYRELGPAGMADRSSRPLRSPNQTPTRTERRIIKVRVL
RRWGPARIAYLLGLNVSTVHRVLTRYKLAKLRWLDRATGQVVRRMEAACC
GDLVHVDVKKLGKIPAGGGWRMLGRTVGNRNAQADKTSGERSKHRHPLRG
YHFLHTAIDAHSRLAYSELLTDERKETAAAFWLRAQAWFTTCGFTVRKVL
TDNGSCYRSHAFRDALGDIEHRRTRPYRPQTNGKVERFHRTLADEWAYAR
LYRSDAERCAEFPRWLHTYNHHRGHTALGGQPPATRVPNLSGQYN
118466527YP_880802.1 phosphotransferase enzyme family protein- putative [Mycobacterium aviuMLSIPRYPGDVTPQWLSAALSGRGAPVEVAEVDVAAIGTGQTGATYRVTA
RYATDPGDLPQTFVIKLPAQDDTVRDRVVIGYRSECAFYSSVADRVQVPT
PRCFYSEITEDAMDFALLLADQAPAVQGDQLLGCGETEARLAVTALAGLH
APSWCDPVWLDFPGIAFGRPDEAGAGGMGEVAKMSADITLERLGDRMSAE
DRETFAAAMGVIAPWLLSEYDRFALLHGDYRLDNLLFDPDRTRVSVVDWQ
TLGVGLPARDLAYFTATSLDSPLRAAIEEELVADYHRALVAGGVNGYDRE
TCWRDYRLGVLQAPLISALGFAFAAATERGDDMVLTMLGRGCRAIRELGT
LELIG
118466526YP_880067.1 gp28 protein [Mycobacterium avium 104]MTPAFASLLLSALSGGRPRVPIVCAQLHNGAPGSAGLSNPSAITARQELT
VTAPDTGAVGLTGVPPSWEVTAAETVAAVSLWSGFDGDPSAMCMFTLPAQ
PPVTVADGDTLVLGSCGLEWAPAAAGLWAPAKTVTAPTARAAAGMLAPRV
TADGVVAVPPMNAAAAMLAPVVRTYRTPAPTMHANAGMLTPSVTAGAKVA
VPLATAAAAALAPTVATREAVAAPLMTATAAALAPTATTKSVVSVPTMAA
AAQALMPRLAGSAVIPVMTAEASAKELPTTISASSVIVVPLSAAAAQMLV
PTVKTTLPVTFDALGSGAASYASSGSWSHNAAGNYVLAFVATDLGVATSA
VSYGGVAMTLLAYAYHDNSAIYGELSVWGLASPPSGAKTVVASMSGSNYF
VANTVSYNDVSAVGSKLTAEGALAASQSLTCAAGQMIVHGFGVGANFGGG
TFTAYSGGTERYNGASGAYTGLLIQDSSASTTFTGTTSSFWSAAGIVLQ
118466525YP_879678.1 aspartate kinase [Mycobacterium avium 104]MALVVQKYGGSSVANADRIRRVAERIVATKKQGNDVVVVVSAMGDTTDDL
MDLAQQVCPAPPPRELDMLLTAGERISNALVAMAIESLGAQARSFTGSQA
GVITTGTHGNAKIIDVTPGRLQAALDEGRIVLVAGFQGVSQDTRDVTTLG
RGGSDTTAVALAAALGADVCEIYTDVDGIFSADPRIVHNARKLDTVTFEE
MLEMAACGAKVLMLRCVEYARRYNIPVHVRSSYSDKKGTVVVGSIKDKPM
EDPILTGVAHDRSEAKVTVVGIPDIPGYAARVFRAVADADVNIDMVLQNV
SKVEDGKTDITFTCSREAGPTAVAKLDALKDEIGFTQLLYDDHIGKVSLI
GAGMRSHPGVTATFCEALAQVGVNIELISTSEIRISVLCRDTELDKAVVA
LHEAFGLGGAETATVYAGTGR
118466524YP_880785.1 nicotinate phosphoribosyltransferase [Mycobacterium avium 104]MNDPVVTGLLTDKYELTMLAAALRDGSAGRRTTFELFARRLPEGRRYGVV
GGTGRLLEALPQFTFGDEACQSLRQFLDPDTLRYLRDFRFGGDIDGYAEG
ELYFPGSPVLSVTGTFAECVVLETLALSIFNHDTAIASAAARMVSAARGR
PLIEMGSRRTHEQAAVAAARAAYIAGFAASSNLEAQRCYGIPAEGTSAHA
FTMLHARTDAAAESTELAAFRAQVQALGVDTTLLVDTYDVTTGVANAVTA
AGTGLGAVRIDSGELGVLARQVREQLDRLGATRTRIVVSGDLDEFSIAAL
AAEPVDSYGVGTSVVTGSGAPTANMVYKLVEVDGLPVQKRSSHKESRGGR
KEALRLSRDTGIITEELVYPAGHRPDVAEPARAVTVPLVRGGELVSKPNL
AAARELVASGLRSLPWEGLNLSHGEPAIPTTQIPADRRRPPGID
118466523YP_882399.1 threonine dehydratase [Mycobacterium avium 104]MSAELSQSPSVAPLSAADIDDAAKRIAAVVTPTPLQFSDRLSAITGAQVY
LKREDLQIVRSYKLRGAYNLLVQLSETELAAGVVCSSAGNHAQGFAYACR
MLQVHGRVYVPAKTPLQKRDRIRYHGGEFIELIVGGTTYDQAAEAALADV
ASTGATLVPPYDDLRTIAGQGTIAVELLDQLDTEPDLVVVPVGGGGCIAG
ITTYLAERTDTTAVLGVEPAGAAAMMAALAAGEPVTLDHVDQFVDGAAVR
RAGDLTYAALAAAGDMVSITTVDEGAVCTAMLDLYQNEGIIAEPAGALSV
TGLLEADIEPGSTVVCLISGGNNDVSRYGEVLERSLVHLGLKHYFLVDFP
QEPGALRRFLDEVLGPNDDITLFEYVKRNNRETGEALVGIQLGSSADLDG
LLARMRATELHVETLKPGSPAYRYLLL
118466522YP_881505.1 hypothetical protein MAV_2300 [Mycobacterium avium 104]MSVVLPTVTTVASDGATQLSFADVGPAFGPEEVALRDTTFVVVDLETTGG
RSTSTGETAPDAITEIGAVKVRDGVVLGEFATLVDPQRSIPPQIMRLTGI
TTAMVSDAPAIDAVLPMFLEFAGLDRGAVLVAHNAGFDVGFLRAAAQQCD
IAWPRPRVLCTVRLARRVLSREEAPSVRLASLARLFAVTTQPTHRALDDA
RATVDVLHALIERVGNQGVHTYADLRGYLPDVTPAQRRKRVLAEGLPRRP
GVYLFRGPSGEVLYIGTAVDLRRRVAQYFTGADPRGRMKEMVALAGAVDH
VECAHALEAGVRELRLLAAHAPPYNRRSRFPQRWWWVALTDEAFPRLAVV
RAPRHDRAVGPFRARADAADTAELLARFAGLRTCTNRLGRAALHGPLCPE
AEVAPCPAARGVTATQYAAAVARVAALIDGADNSALAAAVDQVAALAERR
HFESAARLRDRTATAVEVLWRGQRLRVLASLPELVAAAPDGQGGYQLAVV
RYGRLAAAGNARRGVPPMPVVDAITAAAQAIWPEPGPLGGALVEETALIA
RWLEAPGVRIVRVEGTQDAAGWASPLRSAGAWAAWAAAARSARLASEQAL
RASELLTEPHPTREQLFGRAGVDGGTGAGQPVLPGRQPFGAAG
118466521YP_879729.1 transcription factor WhiB [Mycobacterium avium 104]MRGAAQRKAAVICRHCPVMQECGADALDNRVEFGVWGGMTERQRRALLKQ
HPEVVSWADFFDKRRNRSAG
118466520YP_880421.1 potassium-transporting ATPase subunit A [Mycobacterium avium 104]MSSTTAGLIFLAVLVAALVVVHVPLGDYMFRVYTTDRDLAAERTIYRLIG
VDARSEQTWGAYARGVLAFSSVSIIFLFVLQLVQGKLPLHLHDPATKMTP
SLAWNTAVSFVTNTNWQAYSGETTQGHLVQMAGLAVQNFVSAAVGMAVAV
ALVRGFARRRTGELGNFWVDLVRGTLRILLPISIVGAVLLVAGGAIQNFH
LHDQVVTTLGGTAQTIPGGPVASQEVIKELGTNGGGFYNANSAHPFENPT
AWTNWLEIFLILVIGFSLPRTFGRMVGNPKQGYAIASVMASLYLLSTGFM
LWFQLQHHGTVPSAVGAAMEGVEQRFGVPDSGVFAAATTLTSTGAVDSAH
DSLTSLGGMITMFNMQLGEVAPGGTGSGLYGMLVLAVITVFVAGLMVGRT
PEYLGKKINPREIKLAASYFLVTPLIVLTGTAIAMALPGERAGMANSGPH
GLSEVLYAFTSAANNNGSAFAGLSANTEWYNTALGLAMAFGRFLPIVLVL
ALAGSLARQGSTPDSAGTLPTHRPQFVGMVAGVTLIVVALTFLPMLALGP
LAEGIH
118466519YP_879816.1 hypothetical protein MAV_0536 [Mycobacterium avium 104]MFESSPDPAALVAVIESTHREESMLVARRFAAVAALLRHRVATADRPEPE
YAEIDGFEQTAAEVAAAMNLSAAAASYLVSYAETLDTRLPEVAALLAEGR
TDWRTVRLIITRTSLVTDAELIAKLDRSLAARIGNWHGWSRQRIVNAVDA
AVRTADPDAARERRLAAEEDRHIGISAAENGMAEVHGSVAAAAATAFDRR
LSQLAKQVCPADPRTLDQRRADALAALAEGRRLPCACGQPDCPARTGNQN
ADDRTGARVVINVVASDRTVYADGAEPGYLEGYGVIDADQVRRLAAAAHL
LVANPATSPAAALRYQPSAALERAVRCRDLTCRFPGCSRPAVICDLDHSV
PFNHQNPVAGGWTVLENLKCLCRQHHRLKTFGGWRDRQLADGTVVWTSPT
GRAYRTSPAGADLFAQPRGPARAAPTPNRRSRSKQRNGRIMRARKHNREQ
RPINEARIRLEQARQREIADRKFRNHMRDMLFLFKGAPSTSPFCAWVNDP
REPEELPPDWVPDEPAYQPLPDDPPF
118466518YP_881017.1 Fatty acid desaturase [Mycobacterium avium 104]MPKDLTNLQLLHELEPVVEGLLNRHLAKFKEWNPHDYVPWSDGKNFHTRG
GQDWEPGQTRLPDVAQVAIVQNLLTEDNLPSYHREIAMNFGMDGPWGQWV
NRWTAEEARHSTALRDYLVVTRSVDPVELELLRLEQMTRGFSPGQNQQGD
MFAESLFDSVMYVSFQELATRVSHRNTGKVCNDAIAEQLMARVSHDENLH
MIFYRDVSAAGLDIAPNQAMKSVHRILRNFKMPGFTVPEFRRKAVIIAVG
GVYDPRIHLDEVVMPVLKKWRIFEREDFTGEAARMRDDLGLLVKELQDAS
EKFEESKQRYLEREARRTEKITASKVLQTKGTLTLSRH
118466517YP_880984.1 acyl-CoA synthetase [Mycobacterium avium 104]MLHARASLRPADIAFTLTDYERDWAGVRESLTWSQLSRRTINVARELHLH
GSVGDRAVILAPQSLDYIAAFLGSMQAGLVAVPLPLPHRGSSHERVSAVL
ADTSPSVVLTTSAVAEDITEYVDKACLDAVPKIVEIDSLNLDVDGGPHVR
AADLPSVAYLQYSSGSTRQPTGVMISHRNLKVNFEQLMRGFFADAHVKAP
SDLTIVSWLPFYHDMGLVLGVCAPVLGGYRGELSSPLSFLERPARWVQAL
ASSPHAWSAAPNFAFDLAARKTTDGDLAGLDLGGVLGIISGAERVEPATL
QRFVDRFAHFNFRDEMVRPSYGLAEATVFAAAGTWNESSGAVRFDTDELS
AGRARRCPAGSGTALVKYQVPQSPTLRIVDGDTHRECPPGVVGEIWVHGE
NVADGYWRKPPHEQSCFGATLRDPSPGTPGGPWLKTGDQGFLFDGALFIV
GRIKDLLIINGRNHYPEDIEATVHEITRGRVAAISVPANGTEKLVTIIEF
KERSDSADTSHRIASVKSDVTAAISNAHGLNVDDVVLVSPGSIPTTTSGK
IRRAGCIEQYRQRQFTRLDS
118466516YP_879689.1 thiopurine S-methyltransferase (tpmt) superfamily protein [MycobacteriMSSDQVMDWDSAYREQAHFEGPPPWNIGEPQPELAALIEQGKFRSDVLDA
GCGCAELSLALAARGYTVVGIDLTPTAVAAATRAAAERGLTTASFVQADI
TSFTGYDGRFATVVDSTLFHSLPVEGRDGYLRSIHRAAAAGASLFILVFA
KGAFPAEMQPKPNEVDEDELRAAVGKYWVIDEIRPSFIVSNVPQIADAPF
EFPAHERDERGRMKMPAYLLTAHKAQ
118466515YP_883521.1 50S ribosomal protein L13 [Mycobacterium avium 104]MPTYAPKAGDTTRSWYVIDATDVVLGRLAVAAANLLRGKHKPTFAPNVDG
GDFVIVVNADKVAFSGQKLDKKLAYRHSGYPGGLRSRTIGELMQKHPDRV
VADAIVGMLPKNKLSRQIQRKLRVYAGPEHPHTAQQPIPYEIKQVAQ
118466514YP_882070.1 glycine dehydrogenase [Mycobacterium avium 104]MPDHTTFAARHIGPDPQAVAAMLDVIGVGSLDELAAKAVPAGIRDRLSAD
GIAPGLDRLPPPASETEALAELRGLAEANTVAVSMIGQGYYDTLTPPVLL
RNILENPAWYTAYTPYQPEISQGRLEALLNFQTMVADLTGLEIANASMLD
EGTAAAEAMTLMHRASRGKSNRLAVDVDVFAQTAAIVATRARPLGIEIVT
ADLRDGLPDGDFFGVIAQLPGASGAITDWAALVAQAHERGALVALGADLL
ALTLITPPGEIGADVAFGTTQRFGVPMGFGGPHAGYLAVHANHARQLPGR
LVGVSLDADGSPAYRLALQTREQHIRRDKATSNICTAQVLLAVMAAMYAS
YHGAEGLTAIARRVHGHAEAIAAALGTAVVHDRYFDTVLARVPGRAHEVI
AAAKARGINLWRVDDDHVSVACDEATTDEHVAAVLEAFGVAPAEPVASEI
ATRTSEFLTHPAFTQYRTETAMMRYLRTLADKDIALDRSMIPLGSCTMKL
NAAAEMEPITWPEFARQHPFAPASDTPGLRRLIGDLENWLVAITGYDAVS
LQPNAGSQGEYAGLLAIHDYHASRGEPHRDICLIPSSAHGTNAASAALAG
MRVVVVGCHDNGDVDLDDLRAKVTDHRDRLSTLMITYPSTHGVYEHDIAE
ICAAVHDAGGQVYVDGANLNALVGLARPGKFGGDVSHLNLHKTFCIPHGG
GGPGVGPVAVRSHLAPFLPGHPHAPELPQGHPVSSAPYGSASILPISWAY
IRMMGADGLRAASLTAITSANYIARRLDEYFPVLYTGENGMVAHECILDL
RPITKATGVTVDDVAKRLADYGFHAPTMSFPVAGTLMVEPTESETLTEVD
AFCDAMIAIRGEIDRVGAGEWPVEDNPLRGAPHTAECLVTTDWDHPYSRE
QAAYPLGKDFRPKVWPPVRRIDGAYGDRNLVCSCPPVEAFA
118466513YP_883014.1 ketol-acid reductoisomerase [Mycobacterium avium 104]MFYDDDADLTIIQGRKVGVIGYGSQGHAHSLSLRDSGVQVKVGLKEGSKS
RAKVSEQGLDVDTPAAVAKWADVIMLLAPDTAQADIFKNDIEPNLSDGDA
LFFGHGLNIHFGLIKPPAEVTVAMVAPKGPGHLVRRQFVDGKGVPCLIAV
DQDPTGKGEALALSYAKAIGGTRAGVIKTTFKDETETDLFGEQAVLCGGT
EELVKAGFDVMVEAGYPPEMAYFEVLHELKLIVDLMYEGGIARMNYSVSD
TAEFGGYLSGPRVIDAGTKDRMREILRDIQNGDFVKKLVANVEGGNKQLE
QLRKENAEHPIEVVGKRLRDLMSWVDRPITETA
118466512YP_884218.1 ABC transporter ATP-binding protein [Mycobacterium avium 104]MGVAIEVNGLTKSFGSSRIWEDVTLEIPAGEVSVLLGPSGTGKSVFLKSL
IGLLRPERGSVVIDDTDILQCSAKELYEIRTLFGVMFQDGALFGSMNLFD
NAAFPLREHTKKKESEIRDIVMEKLELVGLGGDEKKFPGEISGGMRKRAS
LARALVMDPQIILCDEPDSGLDPVRTAYLSQLILDINAQIDATVLIVTHN
INIARTVPDNMGMLFRRKLVMFGPREVLLTSDEPVVKQFLNGRRIGPIGM
SEEKDEATMAEEQAALEAGQHAGGVEEIEGVPPQIVASPGMPERKAVARR
QARVREILHTLPTTAQTAILDSMQDAHEYAAAEFTANGREGRSDNDPSTL
PIPAQPQH
118466511YP_881858.1 hypothetical protein MAV_2667 [Mycobacterium avium 104]MNRQNWIPGFEPPYIVAMVELAEEPDTRLISNVVDVAPEAISVGMAVEVF
FEDWTALSGEEDSRVWVPLFRPVKTR
118466510YP_881744.1 3-hydroxyacyl-CoA dehydrogenase type-2 [Mycobacterium avium 104]MTVAKFDGASAIVSGGAGGLGEATVRRLHADGLGVVIADLAADKGKALAD
ELGSGALFVSTDVTSDESVQGAIEQANQLGRLRYAVVAHGGFGVAQRIVQ
RDGSPADMAAFTKTINLYLNGTYNLTRLVAAAVAAAEPREDGERGAIVMT
ASVAGYEGQIGQTAYAAAKAGVIGLTIAAARDLSSVGIRVNTIAPGTMKT
PIMESVGEEAIAKFAANIPFPKRLGTPAEYADAATFLLSNGYVNGEVMRL
DGAQRFTPK
118466509YP_882018.1 hypothetical protein MAV_2831 [Mycobacterium avium 104]MSRIGTFADDDLAGWFVKSPDIGAALGAFSQAVYTKNRLPLRTRELARAV
IAHRNECVVCVNTRDEDGPAAGVDEELYDHVHEWRTWPGYSEQERLAAEF
ADRFATDHTGLRDDEDFWSRCAEHFSDELLADLALSCALWVGMGRVLRTL
DIGQACKLTIPSRG
118466508YP_879333.1 transposase- Mutator family protein [Mycobacterium avium 104]MVKRPRITTERNIAMALDQSALLEVLDALRTADAGERITQAAETIYQALI
DAELTAFIGASPHERTETRSNQRNGSRPRTLSTVAGDLELRIPKLRTGSF
FPALLERRRRVDQCLFAVVMEAYLHGTSTRKVDDLVKALGTDTGISKSEV
SRICKDLDTEVAAFRDRPLGDQRFPYVFLDATYCKARVNHRVVSQAVVIA
TGVAADGRREVLGFEVGDSEDGAFWTAFLRSLKSRGLAGVQLVISDAHAG
LRSAIDAVLIGAAWQRCRVHFLRNVLAQVPKGSAEMVAAAIRTVFAQPDA
EHVREQLDTIAGMLGRQFPKVETMLREAAADITAFADFPVAHWKKIWSTN
PLERLNKEIKRRTDVVGVFPNPAALLRPAGSVLVEAHDEWQVADKRYLSE
TSLALLDVSDQSAETIAPTAALTA
118466507YP_879964.1 hypothetical protein MAV_0685 [Mycobacterium avium 104]MCDDETMIVPTPTAAAPELAWSRDDGNVWAYPAAPWWDKLRQRITDFFHP
FPDEARVAEMDDYDDTVGDADDADDDVSSRSRFPMRRGRLACRGLT
118466506YP_879632.1 methylisocitrate lyase [Mycobacterium avium 104]MRDMIGAARSPEQKRAQLRAALESGRLQRFPGAFSPLVAKLVAELGFDGV
YVSGAALSADLGLPDIGLTTLTEVSGRGAQIAAVTELPTLIDADTGFGEP
LNAARTVTMLEYAGLAGCHLEDQVNPKRCGHLDGKAVVPVDEMVRRLRAA
VSARRDPNFVVCARTDAAAIEGLPAAIERARAYADAGADLIFTEALQCPT
EFERFRAALDTPLLANMTEFGKSPLLGADRLADIGYNVVIYPVTTLRLAM
HAVEAGLREIADTGTQSGLLDRMQHRSRLYQLLRYADYNHFDSDIYNFPR
118466505YP_880566.1 hypothetical protein MAV_1320 [Mycobacterium avium 104]MAICDTCGNDYDKAFTVTWTDGRSATFDSVECAAVELAPTCEHCECRILG
HGVESGGAMFCCAHCARQAGNHDVSDRGAAG
118466504YP_879311.1 TetR family transcriptional regulator [Mycobacterium avium 104]MARDDWLVGRDRRSAAAERIYAAAADLIARRGYDGFTIEALAARVHCSPA
TIYRHAGGKATIRDAVVGIQAARIVDTTREAIKDLRGPERVVTATIMALE
RLRSDPLAQLMRSIHAAPVSDWVINSPTVTALAAEMLGPGHDNPLAAQWL
IRVFLALWGWPLKDPAAERALVHRFLGASYRPGGERDSICGA
118466503YP_880808.1 L-carnitine dehydratase/bile acid-inducible protein F [Mycobacterium aMTDPRLPLHGLSVVEVSSFVAAPLCGMTLSQLGAEVIRVDPIGGASDVQR
WPLAADGTSIYWTGLNKGKRSATIDLRSAEGQRLVQRLIVEGDGVVVTNA
AGLSWLSHDALAALRADVIHVQLLGRGDGSTGVDYTVNAGIGYPLVTGPA
EHAGPINHVLPAWDVCCGLYAALSVVTAVHRREQSGAGARISLALEDVAL
ATAANLGLLTEPQVVGTQRERLGNAIYGQYGQDFTSRDGARFMVVTLTGR
HFRDLLDVTGTGAAVSALADALGVDFGSEGERYRYRDVLSGLFATWFGDH
TADEITAALSHTTVLFERYRTFAEVAAGPKVTANPLFSRLHQPGLGDYFA
PGLPAAFDGTHPAGAPAPALGQDTAEVLARLGLTAADIERLADAKTIAC
118466502YP_881375.1 hypothetical protein MAV_2165 [Mycobacterium avium 104]MTRIPYRRPEEMPARARELTARRGNLNVYRALANAEKVFTSWMVAGDAAL
SSPVLPRRLRELIVLRTASAMDCAYELGQHRDVARTVGIDPATIDAVISE
TGWQASDLTPTELAALHLTTELVTTRRVAQPLFDRVHRALGTEATVEALM
VINRYAGLALMLNALEVDLDETARLPIPPTS
118466501YP_880165.1 hypothetical protein MAV_0902 [Mycobacterium avium 104]MSTTRTDDLVEIQQLLARYAVTITQEDIDGLVAVFTPDGTYSAFGETYSL
NRFPELVAAAPKGLFLTGTAVVDLDGDQASGTQPLCFIDHATHDMRIGYY
RDTYVRTPDGWRLKTRAMTFIRRSGVHDSGRPHAIGRPAGDSAAQAAT
118466500YP_880335.1 bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferaseMKGDQPMSTDDWRENAKRPIRRALISVYDKTGLVELAQGLTEAGIEIVST
GSTAKVIAEKGIPVTRVEELTGFPEVLDGRVKTLHPRVHAGLLADLRKPE
HAAALEQLGIAAFELVVVNLYPFTETVDSGAGIDECVEQIDIGGPSMVRA
AAKNHPSVAVVVDPLGYDGVLAAVRHGGFTLAERKRLAALAFQHTADYDI
AVATWMESTLAPEHPPTTFPKWLGRSWRRSAMLRYGENPHQQASLYSDPG
AWPGLAQAEQLHGKEMSYNNFTDADAAWRAAFDHEQTCVAIIKHANPCGI
AISSTSVADAHRKAHECDPLSAFGGVIAANTEVSVEMAEYVSTIFTEVII
APAYQPAALDILTRKKNIRVLVASEPLTGGTELRPISGGLLVQQRDELDA
HGDNPANWTLATGAPADPATLADLVFAWRVCRAVKSNAIVIAAGGATIGV
GMGQVNRVDAARLAVERGGDRVRGAVAASDAFFPFPDGLETLTGAGVKAV
VHPGGSVRDDEVTAAAANAGITLYLTGARHFAH
118466499YP_881984.1 hypothetical protein MAV_2797 [Mycobacterium avium 104]MGPFVLRAALTGFALWIVTLFVHGLTFVGGDTKLQRVGIIFVVAVIFGLV
NAFIKPIVQILSIPLYILTLGLIHIVINALMLWITAWITEHTTHWGLQID
HFWWTAIWAAIVLSIVSWLLSLVIRRTAG
118466498YP_884267.1 methyltransferase- putative- family protein [Mycobacterium avium 104]MTDLDSSLPPSVRTAGDSWTITELVGATALGVAAARAAETAGPDPLIRDE
FAGLLVSSAGPAWARLADPEQSWLDDDPHGKRAHRVGIDYQAVRTHYFDE
YFDGALRAGIRQVVILAAGLDSRAYRLNWPAGTTVYEIDQPKVLEYKTET
LQRHGATPAAVRRPVPVDLRDDWPAALTAAGFQAARPTAWLAEGLLPYLP
SDAQDRLFEMVTALSAAGSQVAVEVFGMNSRSNAQRWLRMRERLGLDVNV
AALTYHEPDRSDAAAWLTGHGWRVHSVDNRDEMARLGRPVPEDLSDEAVR
STLLRAHLGGSTG
118466497YP_883073.1 NADP-dependent alcohol dehydrogenase c [Mycobacterium avium 104]MSTVSAYAATSATEPLTKTTIERRDPGPRDVAIDIKFAGICHSDIHTAKG
EWGHTNYPVVVGHEIAGVVTEVGAEVTKYKVGDHVGVGCMVNSCRQCSSC
TAGLEQYCKRGATFTYNSIDRDGSVTQGGYSQAIVVDEDFVVRIPDSLPL
DKAAPLLCAGITLFSPLRHWKAGPGTRLAIVGLGGLGHMGVKLGAAMGAE
VTVLSQSLKKMEDGLRLGAKHYHATADPDTFTKLRGSFDLMLNTVSANLK
LNDYLSLLDVDGTLVELGIPEHPMEVGAFPLALARRSLSGSNIGGIAETQ
EMLDFCAEHNVTPEIELIEPDYINEAYERVLASDVRYRFVIDISKL
118466496YP_880843.1 cytochrome P450 family protein [Mycobacterium avium 104]MSTTTMDEAAKLLADPMAYTDEQRLHAALTHLRANAPVSWVEVPNYKPFW
AITKHADVMDIERENMLFTNWPRPVLTTAEGDEMQAAAGVRTLIHMDDPQ
HRVVRAIGSDWFRPKAMRALKVRVDELAKIYVDKMLAAGPECDFVQEVAV
NYPLYVIMSLLGLPEADFPRMLKLTQELFGSDDSEFKRGSSNEDQLPALL
DMFGYFNGVTAARREHPTEDLASAIANARVDGEPLSDIDTVSYYLIVATA
GHDTTSATISGGLQALIENPDQLQRLRDNLDLMPLATEEMIRWVTPVKEF
MRTAAKDTVVRGVPIAAGESVLLSYVSANRDEDVFDEPFRFDVGRDPNKH
LAFGYGVHFCMGAALARMEVNSFFTELLPRLKSIELTGDPELVATTFVGG
LKHLPVRYSLA
118466495YP_879812.1 hypoxanthine phosphoribosyltransferase [Mycobacterium avium 104]MGVAQISSAITPAQPAELYPGDIKSVLLTAEQIQARIAELGREIGDNYRD
AAAETGQDLLLITVLKGAVIFVTDLARAIPLPTQFEFMAVSSYGSSTSSS
GVVRILKDLDRDIQGRDVLIVEDVVDSGLTLSWLLRNLSTRHPRSLRVCT
LLRKPDARGAHVDIAYVGFDIPNDFVVGYGLDYDERYRDLSYIGTLDPRV
YQQ
118466494YP_883769.1 glutamyl-tRNA reductase [Mycobacterium avium 104]MSVLLFGVSHRSAPVSVLEQLSIDESDHGKIVDRVLQSPLVTEAMVLSTC
NRVEVYAVVDAFHGGLAVIGQVLSDHSGMSMSDLTKYAYVRYSEAAVEHL
FAVASGLDSAVIGEQQVLGQVRRAYATAETNRTVGRVLHELAQRALSVGK
RVHSETAIDAAGASVVSVALDMADRRLGGLAGKTAVLVGAGAMGALAAAH
LSRAGIGQVHVLNRSLSRAQRLVRKIRETGVRADALPLEHLADALAGADV
VVSCTGAVSPVVSLADVHHALAAAGRSAADETAHPLVICDLGMPRDVDPA
VAGLPGVWVVDVDRVQHEPSAHAAAADVDAARTIVATEVAAYLAGQRMAE
VTPTVTALRQRAADVVEAELLRLDNRLPGLDSAHREEVARTVRRVVDKLL
HAPTVRIKQLASAPGGDSYAEALRELFELDQTAVDAVAAGELPVIATGFD
AGAPQQPTE
118466493YP_884351.1 hypothetical protein MAV_5237 [Mycobacterium avium 104]MSEREDRQDISELLVRYATGIDRRDWPLFRTVFTDDCVLDYGEIGHWTGV
DAVADFMEQVHALAGHTLHRLTNQVITVEGDRATARTYIDGLIMAGDNNS
GVNAIGFYDDEMVRTAHGWRIARRRYTQVRLTTVGVGS
118466492YP_884251.1 TetR family transcriptional regulator [Mycobacterium avium 104]MSHPVRATAIADTDTSTRQRILAATAEVLGRNGKTKLSLSDVATQAGVSR
PTLYRWFASKEELLSAFSAYERQIFESGLVKATAGLKGVDKLDAVLRFIV
DYQHSYSGVRMVDVEPEHTIAQFSWVIPQMREGLQRHLPGPNAAVKAATV
IRIAISHYIVRSDDADQFLAQLRHAVGIKAPTD
118466491YP_881279.1 virulence factor Mce [Mycobacterium avium 104]MRRKLSSIAWRVAIFTAVCLLFTFTLIAVFGQLRFEDRTGYQAVFTNISG
LKSGNFVRIAGVEVGKVGDLSLHRDGTVTVGFAVDKGVRLSEGTKAVVRY
ENLIGDRYLALEEGPGSPRRLPPGATIPLARTSPALDLDALIGGFRPLFR
ALDPDQVNALSGQLLRIFQGQGGTLASVLSQTSMLTSTLAGRSQLIGELI
TNLNTVLRTFATRDHEFSDGLDKLAQLVDGLAQRRDDISTGLAYINAAAG
SITDLLSQSRQPLKDVVQHTDRMSGQVLSDRDYVDNLLKELPDIYQVLAR
QGLNGDYFGFYFCEVLLKLNGKGGNPIFVKLLGQPSGRCTPK
118466490YP_883657.1 preprotein translocase subunit SecE [Mycobacterium avium 104]MSDEGDVANDAASDGADTTDDRAGGGRTAVVTRPQRPTGKRSRQRTAGDA
DAEPSDEAEVSAPEKAEKAKRKKAAKPKKSADTRANPFVFVYNYLKQVVA
EMRKVIWPNRKQMLTYTSVVLAFLAFMVALVGLADFGLTKLVLLVFG
118466489YP_882607.1 nitrilotriacetate monooxygenase component A [Mycobacterium avium 104]MSRRERGLTLNVNVLNLGIHTASWRRSAEPPTAFTDPGYYVRMARIAERG
TLDALFLADGPAVRDHPALRPSQALEPSVILAAVAAETEHLGLIGTFSST
FNDPVELAHRLLSLDQLSGGRLAWNIVTTYSEAAGGNFGLADLPDRSTRY
RRAAEFVDVALALWRDAATGGGVDHRGEFFAVTGSLPQGPSPQGHPLLVQ
AGGSPQGRELAGRVADAVFSAELDLDAAIEHYRYVKDAAVAHGRGRDAVR
ILPGLITTIGSSRAEAQRRYEEQNALLPAGHDVERLSQTLGADLSGLPLD
EPIPARLLGSVPDPSKFVGSLGFRESVVRLVVSGGLTLRQTLRAFSGSGH
RVIVGSPVDVADTIEQWFGAGAADGFNLMPDVFPDGLEVFVDEVVPILRS
RGLFRASYAEATLRERLTGDRHVVAA
118466488YP_884079.1 acyl-CoA dehydrogenase [Mycobacterium avium 104]MNDEEDMLVATVRAFIDREVKPTVREVEHADAYPEAWIEQMKRIGIYGLA
VPEEYGGSPVSMPCYVRVTEQLARGWMSLAGAMGGHTVVAKLLTLFGTED
QKRAYLPRMASGEIRATMALTEPGGGSDLQNMSTTALPDPDSDGLVINGA
KTWISNARRSGLIALLCKTDPKATPRHKGISILLVEHRPGLTVSRDLPKL
GYKGVESCELSFDNFRAPATAVLGGVAGQGFSQMMKGLETGRIQVAARAL
GVATAALEDALAYAQQRESFGQPIWQHQSVGNYLADMATKLTAARQLTRY
AAERYDSGERCDMEAGMAKLFASEVAMEIALNAVRIHGGYGYSQEYDVER
YFRDAPLMIVGEGTNEIQRNVIARQLVTRGGI
118466487YP_884132.1 mce-family protein mce1d [Mycobacterium avium 104]MSTIFDIRNIRLPKLSRTSVILGALVIVLALVVGYVGWRLYEKLTNNTVV
AYFPAANALYPGDKVQIMGLRVGAIDKIEPSGDKMKVTFHYQNKYRVPAN
ASAVILNPTLVASRAIQLEPPYKGGPVLADNAVIPEERTQVPVEWDQLRN
SITNIISKLGPTAEQPKGPFGEVIESFADGLAGKGKQFNTTLTNLSRALT
ALNEGRGDFFAVVRSLALFVNALHQDDQQFVALNQNLADFTTRLAHSDGD
LANAIEQFDSLLTTVRPWLDKNRGVLTYDVKNLETATNALLQPDPLNGLE
TALHVLPTAAANINQIYHPSHGSVVAIPSITNFANPMQFICSAIQAGSRL
GYQESAELCAQYLAPILDAIKFNYPPFGLNLFSTAETLPKEVAYSEPRLQ
PPNGYKDTTVPGIWVPDTPTSHRNTQPGWIVAPGMQGQQVGPITAGLMTP
DSLEELMGGPNIAPVQSNLQTPPGPPNAYDENPILPPMGLNAPVPIPPPP
PGPGVAPGPVAPTPAPVSAPAPNAGGPAAPADFGGGQ
118466486YP_880328.1 succinyl-CoA synthetase subunit beta [Mycobacterium avium 104]MDLFEYQAKELFAKHNVPTTPGRVTDTAEGARDIAAEIGRPVMVKAQVKT
GGRGKAGGVKYAATPEDAYTHAKNILGLDIKGHVVKKLLVSEASDIAEEY
YISFLLDRANRTYLAMCSVEGGMEIEEVAATKPERLAKVPVDAVTGVDLA
TARSIAEKGHLPAEVLDAAAVTINKLWELFVAEDATLVEVNPLVRTPDNQ
ILALDGKVTLDANADFRQPGHAAFEDRDATDPLELKAKEHDLNYVKLDGQ
VGIIGNGAGLVMSTLDVVAYAGEKHGGVKPANFLDIGGGASAEVMAAGLD
VILHDKQVKSVFVNVFGGITSCDAVANGIVTALNMLGDEANKPLVVRLDG
NNVDQGRRILAEANHPLVIQAETMDSGADKAAELANK
118466485YP_879363.1 hypothetical protein MAV_0063 [Mycobacterium avium 104]MNMAFGDGPHDAALRAAWTEFCARLQRAGERAFKDHNPASGPHRVDAFRF
LTQNLGQAFDLALETRDANYPVLHSFCGPTRKLGGDCADFTYQQAWIDGR
STYRITGTRGTSRFFNVTVQGRRTPGEGVLHEPFGDTPQANLFGQQLRVG
ADGRFELYVGGPERGHNWLPTTPESRKLFIRQGFDSWDEAPAQLRIERVD
MTVPKPLPTPGEMVEAMRWAGDFVTGLMSDWPEYPFRHGGVDAENPNTFP
RAAATDADGKRGRAAANMYWELAPDEALIVEFDAHPGLWMFTNMGVFFNS
MDYLYRPVSYTPSRTTVDGDGRIRLVMAHRDPGVHNWLDTQGFERGNLTY
RHMLEGEPAVLDTRVVEHDELLDALPKDTVMVTPSQRADAMWKRFRGIRR
RYVL
118466484YP_882501.1 DNA-binding protein [Mycobacterium avium 104]MGAAGAAVPDGHTRRAIVRLLLESGSITAGEIGDRLGLAAAGVRRHLDAL
IEAGDAESIAPAAWQHAGRGRPAKRYRLTSAGRAKLDHAYDDLAAAAMRQ
LREIGGEEAVQAFARQRIDAILAGVPGAASAADDDIEAAAQRIATALTKA
GYVATTTQVGGPIHGVQICQHHCPVSHVAEEFPELCDAEQQAMAEVLGTH
VQRLATIVNGDCACTTHVPLAQTAKAPSPRRHTTSNKGASL
118466483YP_883200.1 Omt protein [Mycobacterium avium 104]MGIDTSAITPEEETAFLTLQARAINNGWARPILPDPGAADAVTKIDYDFD
GLGLVTPVVCQTSLRAKLLDDRVRAFIAQHADAVVVDLGAGLDDGYARVN
PPDTVDWYSVELPGLAALRDKVMPPGPHEHTIGISVTDPEWISAIPADRP
AIVIADGLFPFLNKEQIIAVMRAITDHFPAGQLAFNDYGRMVIGVWISKL
FPQRMFKKVNQLRAFEGYNDPHTPERWSPKLTLVEETSLASVPEVDLFPT
WLRIATRMAGWSKRTARSARILRFSF
118466482YP_881668.1 sugar ABC transporter substrate-binding protein [Mycobacterium avium 1MLDRPFGRRSLLRGAGALSAAALAPWSAGCGSDDDGALTFFFAANPEERD
ARMRIIDEFARRHPDIKVRAVLSGPGVMQQLSTFCVGGRCPDVLMAWELS
YAELADRGVLLDLGPLLARDKAFAQQLQADSIPALYETFTFNGKQYALPE
QWSGNYLFYNKRLFDEAGVPSPPTAWERPWDFSEFLDTARALTKRDASGR
AAQYGFVNTWGSYYSAGLFAMNNGVPWSDPRLNPTHFNFDNAAFQEAVQF
YADLANKYRVAPNASETQSMSTPNLFAVGRAAMALGGHWRYQTYLRAEGL
DFDVAPLPVGPAVGKGQPACSDIGATGLAISSSSPRKEQAWEFVKFATGP
VGQALIGESCLFVPVLRSALKSDGFARAHRRVGNLGVLTDGPAFSQGLPI
TPAWEKVNALMDRNFGPILRGSRPATSLAGLSRSVDEVLRSP
118466481YP_880796.1 hypothetical protein MAV_1562 [Mycobacterium avium 104]MQLKWLSVAELIAEAGGDPWAINQSLQAGSPSQISSLAEPFHGAGRHTAE
ADHAFEQARKRFDAAWNHQNGDHPINDSAEVQRLVKSLGAQSEQLPKIGT
DLENIAAALAEAQKAGTQRSTLLSMTCNTAIPIMWVGRQPPGTHTAPPVD
EEYRFRREVTSVDLGSQNRGCGVSCQPAPEWLF
118466480YP_882320.1 hydrolase [Mycobacterium avium 104]MAAMTASVVPSDNYTGHVDPGTAARRTLPGATIIKASVGPMDNNAYLVTC
SATGETLLIDAANDADVLIGLIRDYAPKLSLIVTSHQHFDHWQALADVAA
ATGAPTAANEIDADPLPVKPDRLLAGGDTVRIGELAFDVIHLRGHTPGSI
ALALDGAATGGVTQLFTGDCLFPGGVGKTWQPGDFDQLIDDVTTRVFDVY
DDSTVVYPGHGDDTVLGNERPHLSEWRERGW
118466479YP_881825.1 cytochrome p450 [Mycobacterium avium 104]MKNIEMNTPESPALAHFHLLDECQDEARPVFRNTEAGIDYWVFTDNSVIL
DGLQHPELWSSSVIVPTEPEPPYKWIPIMIDPPDHAKWRHVLAEYFSPGR
VKGLRDAQQKLAAELIDQVAGEGGCDFVARISRVFPSTVFLTIMGMPVED
LEKFLAWEDMILHQSGVGEEVNAARLEGMTHVMGYFSGLIQQRRENRDPD
ADDIVSKAIDWTIDDEPINDLELLNCLLLLFMAGLDTVSNQLSYAMLHLA
THPADRARIVAEPQLIPRAVEELLRVYPIVQTARKATRDMDFHGCPVKAG
DMASFSLAFAGRDESAYPNARTVDFDRGVTRHLSFGGGPHRCLGSHLARQ
ELAVVLEEWHKRIPEYEVSGQPIEHGGQVFGVDSLNLTWG
118466478YP_880425.1 hypothetical protein MAV_1177 [Mycobacterium avium 104]MSINYQFGDVDAHGALIRAQAASLEAEHQAIIRDVLAAGDFWGGAGSVAC
QEFITQLGRNFQVIYEQANAHGQKVQTAGSNMASTDSAVGSSWA
118466477YP_882259.1 DNA repair protein RecN [Mycobacterium avium 104]MLTEIRIESLGAISAAVGEFDRGLTVLTGETGTGKTMVVTGLHLLGGARA
DATRVRSGADRAIVEGRFTTTDLDEALVVRLDEMLDASGAERDEDGSVIA
LRSVNRDGPSRAYLGGRSVPAKSLGDFTAELLTLHGQNDQLRLMRPEEQC
GALDRFAKAGPALERYTKLRDAWLSARRDLADRRNRMRELALEADRLTFA
LGEIDAVDPQPGEDDALVAEIMRLSELDTLREAAAAARAALSADDADGSG
LSAVDTLGKARAALESTDDPKLLALAGQIGEVLTVVVDAAGELAGFLEEL
PVDASALEAKLARQSELRGLTRKYAADIDGVLAWARESRERLAQLDVSEE
GLSALAARVEELGRELAGAAADLSTIRRKAAKRLAKEVTAELSGLAMADA
QFSIDVSTDVVPAGSGSDDAAVLTLPSGERVRAGADGIDQVEFGFAAHRG
MDRLPLAKSASGGELSRVMLALEVVLAASRKETVGTTMVFDEVDAGVGGR
AAVQIGRRLARLARTHQVIVVTHLPQVAAYADVHLVVHGAGPRGTSVVRR
VTGDERVAELARMLAGLGESDSGRAHARELLDAAQKDEI
118466476YP_880174.1 cytochrome p450 [Mycobacterium avium 104]MTNEFSELDFFRGSELIENPYPYYEALRQRCPVTKESHHNVTMITGWDEA
CAVLNDAETWSSCISVTGPFPGFPVPLEGDDVTELIERHRDELPFSDQLP
TLDPPTHTNHRSLLMRLITPKRLKENEDAMWVLADQALDTFLAPGHGEFI
KGFAGPFTLLVIADLLGVPEEDRDKFVKGIRQHSGGGVGGTGEETLAHSP
LEFLYGLFSDYVRDRRRQPREDVLTGLATATYPDGSIPEVEDVARVASNV
FSAGQETTVRLLGAALQTLGERPDIQAQLRKDRSLIPNFIEESLRHESPV
KGDFRLNRRPVTVGGVDLPAGTTVMVVQAAANRDPRRFDDPATFDPARKN
ARQHISFGRGIHSCPGAPLARAETRVAIERLLDRTTDIRINENIHGPAND
RRYQYVPTYILRGLTELHLEFTLA
118466475YP_881904.1 hypothetical protein MAV_2714 [Mycobacterium avium 104]MRHHARPGDVEGGLRRRDGGGGGAAPPGALIVSSHSSIAPVCAPPMAVSK
HAFAQRRTSIRPAPAGAVISRRSVRRRGRWRGSRASPNRWAGRASPAGSP
ASPPGAPTAGCRSTRRSD
118466474YP_882827.1 hypothetical protein MAV_3650 [Mycobacterium avium 104]MITEPVKTFSRKFMGYDTTAVDAHIEMLTAKQQLLIDDVESLRARLQESN
EQTAALRKEVAALTDTSPAPHAVQQRMAKMLARAVDEVAEMQAEARAEAD
ALIAAAEAEAQAAERKRDEVLADMAAQQEALEAEYRETKEKLDAELADMR
AEAQAAIDEARRAAERECEQLLGDAKQGADHYRDTARRAVEEASAQRIKI
LEQLMSVYRELEDVPAALQAAYDEQQGSADDGVLAAVDGKVRAG
118466473YP_883738.1 NAD-dependent epimerase/dehydratase [Mycobacterium avium 104]MLVTGAAGFIGSRVAAALRAAGHDVVAVDALLAAAHGPNPLPPNGCHRVD
VRDADALAPLLAGVDVVCHQAAMVGAGVDAADAPAYGGHNDLATTVLLAQ
MFAAGVRRLVLASSMVVYGQGGYRCERHGPVHPLPRRRADLDAGVFEHRC
PIGGEELRWQLVDEDACLRPRSLYAASKTAQEHYALAWSEATGGSVVALR
YHNVYGPGMPRDTPYSGVAAIFRSALEKGEPPRVFEDGGQMRDFVHVDDV
AAANLAALACRDGFTAVNVCSGQPISILQVATALCDARGGAVAPVVTGQY
RSGDVRHIVADPSRAARLLGFRAAVQPGDGLREFAFAPLR
118466472YP_884241.1 hypothetical protein MAV_5124 [Mycobacterium avium 104]MKKYYRHTLLYLHETISLGSGRSDRFTEVFTDTYRPMMDQLGARLFAIWE
STPYNGHWPQVTIIWEVDGFADYARIGAAQARGGSHEAAAGKWSAFLADI
GASGEGRIMYPGPSNKTLAQLREANFIAPLVIQEIMQTKPGRQDDYIREL
ERLYVPWSERTGKRWLGSFTTTFRYNEVIHYWALDGGWDCFANHYPSWKE
SPPAEIVTWMSVAPALRDGWEDSILQALPPSPLQ
118466471YP_882805.1 hypothetical protein MAV_3628 [Mycobacterium avium 104]MAVTLEKATDKLTLRTSPTVAEQVFDSSSTRRGRRSSRERPADILDISPQ
LSEVSSYGGFFALTVGGDPAGWRPATECYADGSADLIAATARRYRTRDLR
IGASLVHLAHASRLWSPVLGCAIGHGVVPDLGDLHRAATGAQLRLPEPVG
RRVTAPHPELLYRLVVDEHLGPLAAGLRVGLAPALLAGNVASALVGAARA
LLSARPDLRSAIVETTLALLDTGIMSGAGTITGPPLDFRRASCCLFYRLP
GGSVCGDCVLDR
118466470YP_882800.1 transposase- Mutator family protein [Mycobacterium avium 104]MSVMDVKRPPRDPSSQPSTESSRSPTMTAPHIVDPAGLLGEALAEASPDL
MRSLLQTVINALLSADADAVVGAEWGQPTPGRRAQRNGYRHRGLDTRVGT
IDVAVPKLRKGTYFPDWLLERRKRAESALITVVADCYLAGVSTRRMDKLV
KTLGIDSLSKSQVSRMATDLDEHVEAFRHRPLDSAGPFTFVAADALTMKV
REGGRVVNGVVLLATGVNGDGHREVLGMRVVTSETGPAWNEFFADLVARG
LAGVRLVTSDAHAGLREAIAANLPGAAWQRCRTHYAANLMSICPKSMWPA
VKAMLHSVYDQPDAPAVAAQFDRLIDYVTDKLPAVADHLATAREDILAFT
AFPKDVWSQIWSNNPAERLNKEIRRRTDAVGIFPNRDAIVRLVGAVLAEQ
NDEWAEGRRYLGLDILTRCRLTTITDDNPDIGANDMPALTA
118466469YP_881398.1 FAD binding domain-containing protein [Mycobacterium avium 104]MTTRVPVLIVGAGVGGLSMSALLTQHGVRSLLVEKRREVFLYPKARNLSF
RSLEILRGMGLGDEVHAVAEHVSTVVAKPALNSPEERPALDVEGIFAGLE
RFSPEPAAQYCPQSRLEPILLAATRRGGSDVRYGTELSSIDMDEAGVTAV
VRDAESGTAETIRADYLIGADGVHSPLRNLLGITTSGYGALPIYVVFVYF
RAPWRKFIPHLHDGDGVQVKNADVDGIFLVAEGDLGMFITTYFPDEGETA
EQFTPQRCRELLTKAIGEPLDIDVIEVAAWQPYEQVADRFDCGRAFLVGD
SAHTMPPFKAGGANTAIQSAHNLAWKLAAVLRGAAGPALLDTYHAERHPV
GVFAARQSLTGPSMALLRPGGKRPQLPADEEAPIFALMIGYRYGANGIEL
VDELRAQPGTRVPHVWVRDGVSTLDLVGPEFTVLTGDERWCAAAASMSLP
AHRVYNDQWAAITGLAPDGALLIRPDDFVGWRADELPTDPQTALRQALSL
CLGRAR
118466468YP_883151.1 transposase- Mutator family protein [Mycobacterium avium 104]MVKRPRITTERNIAMALDQSALLEVLDALRTADAGERITQAAETIYQALI
DAELTAFIGASPHERTETRSNQRNGSRPRTLSTVAGDLELRIPKLRTGSF
FPALLERRRRVDQCLFAVVMEAYLHGTSTRKVDDLVKALGTDTGISKSEV
SRICKDLDTEVAAFRDRPLGDQRFPYVFLDATYCKARVNHRVVSQAVVIA
TGVAADGRREVLGFEVGDSEDGAFWTAFLRSLKSRGLAGVQLVISDAHAG
LRSAIDAVLIGAAWQRCRVHFLRNVLAQVPKGSAEMVAAAIRTVFAQPDA
EHVREQLDTIAGMLGRQFPKVETMLREAAADITAFADFPVAHWKKIWSTN
PLERLNKEIKRRTDVVGVFPNPAALLRLAGSVLVEAHDEWQVADKRYLSE
TSLALLDVSDQSAETIAPTAALTA
118466467YP_882538.1 PPE family protein [Mycobacterium avium 104]MDFGSLPPEINSGRIYSGPGSAPLLAAAAAWHGLAAEMHSAAASYGSAIA
ELRTLWHGPSSTAMAAAAAPFIAWLDGTAVQAEQTAAQATAAAAAYDSVF
AATVPPPVIAANRALLASLIATNVLGQNTPAIAATEAHYAEMWAQDAAAM
YAYAGASAVATRLTPFGAPPQTADANAAADQSAAAASALQSSTASSVESA
LSQAVSQVPVAAQVNATAVTAAAQLPLSLTDITGILKTFNSVMGTISGPY
TPLGVANLAKNWYQIALSIPSVGTGIQGIGPLLHPKALTGVLAPLLRSDL
LTGSTALSSAGTVSASAGRAGLVGALSVPANWASAVPAVRTVAAELPETM
LDAAPAMAVNGQQGMFGPTALSSLAGRAVGGTATRAVAGSTVRVPGAVAV
DDLATTSTVIVIPPNAK
118466466YP_881313.1 transposase- Mutator family protein [Mycobacterium avium 104]MSVMDVKRPPRDPSSQPSTESSRSPTMTAPHIVDPAGLLGEALAEASPDL
MRSLLQTVINALLSADADAVVGAEWGQPTPGRRAQRNGYRHRGLDTRVGT
IDVAVPKLRKGTYFPDWLLERRKRAESALITVVADCYLAGVSTRRMDKLV
KTLGIDSLSKSQVSRMATDLDEHVEAFRHRPLDSAGPFTFVAADALTMKV
REGGRVVNGVVLLATGVNGDGHREVLGMRVVTSETGPAWNEFFADLVARG
LAGVRLVTSDAHAGLREAIAANLPGAAWQRCRTHYAANLMSICPKSMWPA
VKAMLHSVYDQPDAPAVAAQFDRLIDYVTDKLPAVADHLATAREDILAFT
AFPKDVWSQIWSNNPAERLNKEIRRRTDAVGIFPNRDAIVRLVGAVLAEQ
NDEWAEGRRYLGLDILTRCRLTTITDDNPDIGANDMPALTA
118466465YP_879332.1 hypothetical protein MAV_0032 [Mycobacterium avium 104]MAEKYLIWDWATTARSDLASGRLGADLAKQGFAPKIEVSKIDTKYKICSG
NDCAILSEVNATIFSHLIDKSADQIERLITGEPS
118466464YP_880968.1 MmgE/PrpD family protein [Mycobacterium avium 104]MTALQQETVTDPVGPTGLLATWVAELTLDDVPPPVVDRAKHLLLDGIGCA
LVGAQLPWSRIATDAVLALEGSGDSIVIGTGRRTSAPAAAVLNGTFIQGF
ELDDFHPLAPLHSCSLLIPALLSTAATRSATTTGRELLPAAIAGFEVGPR
VGHALHGTQMLDRGWHSGPVFGTHAAAMASGKLRGLPPAQLEDALGLAGT
QSAGLMAAQYEAMSKRMHHGLAARNGFYAAGLAAAGYTGIKRVFEREYGG
FLSVFGEGHDPDAAALTADLGQRWETSLIMVKSYAAMGGLHGAIDAARRL
RNSVAPQNISSVDITVGETVYKHGWWLPERPLTPIGAQMNIGYATAAALL
DGNVLPEQFTAARLDADDIWALISATRVHLDESLADADITEKFRTDLAVT
TREGTVHRARVALPHGAPNDPVTNDEVVAKFHALADRVTSRGRAAAIERA
VIRLDDLTDVENLMDLLADPVAGALD
118466463YP_882889.1 type I phosphodiesterase / nucleotide pyrophosphatase [Mycobacterium aMPGSLRDVLPAAAALLGVADAGHEPGGSAVTDWVGAERVDRVLVLLVDGL
GWQLLAQLAGDAPLLAAVRAGEVGRLTRLDCTFPSTTPTSLVSLATGAAP
GQHGILGFTLRVPGTDRVLNHVRWRDDPAPDAWQPLPTWFERLAAAGVRA
RAVLPSSFLGSGLTEAAYRGARLVPAEPADDYPRLVGDELRAGPGLVYGY
TAELDTAAHLFGIGSPQWHTAAAAVDALLSGLLEALPPNAALLVTADHGG
LNVPPEARVDLDSDPRLAAGIRVVAGEPRVRYLHTEPGAAPDVQAAWSEL
LDGRAAVYSRAQAVATGMFGPVADRHLPRLGDVVVVCSADTAVLASAHEP
PETARLVGFHGAATPAETAIPLILFRR
118466462YP_882177.1 tetracenomycin polyketide synthesis O-methyltransferase TcmP [MycobactMTATEKVDFSSVAWGSVEWTNLVTLYLRACESRSRQPILGDTAAAEAVDR
IRYDFKRIHRMSLPASNQYLVALRAVQFDDWCAEFLARHPDAVVLHLGCG
LDGRAFRVSVPPSLSWFDVDQPSVIGLRRRLYDDTENYRMIGSSVTELQW
LDEVPAGRPTLMVAEGLLMYLREDEVRRLLQRLIDRFPGGEMHFDTLSAL
APLLSKVFTRGIITWGIRDARRIADWNPRLRFLEQSPALAGYQRIPSTVV
RSIYRLTWLTGGRGYDVLNRFEY
118466461YP_883696.1 hypothetical protein MAV_4566 [Mycobacterium avium 104]MIGSDPGLLRLRMATRTTAALGLSLLALWLLTRATGQPLTVALLGVVITM
VASRSVNEPDPRQQRITMALLPVPAAVAITAAAVLAPHPVAGDVVFVLIV
FAAAYIRRFGARGRALGMVAFMSYFFTLYLRARVSELPWMIGAVAVGTVC
TYVMTSHVLPDRPERVLRATIRALRARMAIVIDTTAEAVRTGRLDERRRR
RMRARTVRLNETALMVQSQIEDRADPGTLWPGVTAEQLAPWLLDAELAIE
WVATAGRRAAALGAELPEAVRAELVSALTQLGRAIRLPEPGGLRDAASRA
RRLLDAATDDRPAGTEVRRLALAIINAATATADVRAIVDGAAGAAVPDVA
GSERPPAAAGVAAEEPAEQEEEQPAGLRPTTRQAIQVSVAASLAIITGEL
VSPARWYWAVIAAFVIFAGTNSWGETLTKGWQRLLGTMLGVPAGVLVATL
LTGHEAAALAGIFVCLFCAFYFMTVTYSLMTFWITTMLALLYGLLGQFSF
GVLMLRIEETALGAVIGATVAVVVLPTNTRTAIRADTRAFLTSLSALIEA
CAAAMSGGAASPSEQARQLDRDLQQFRVTAKPLLAGVAGLAGRRGIRRAL
RIFTACDRYGRALARSSEQYRGSPGPGPQLAQAFSAAAAQTRRNLDALLE
AIDSGHPPTLVSAADELDAAETAARQHDSDGDGETRPDVRRFLTAVHALR
QIERAVISTATNLGGREDVRTATAAPR
118466460YP_882766.1 deoxyuridine 5'-triphosphate nucleotidohydrolase [Mycobacterium avium MSTSLAIVRLDPGLPLPSRAHEGDAGVDLYSAEDVRLEPGRRALVRTGVA
VAIPFGMVGLVHPRSGLAARVGLSIVNSPGTIDAGYRGEIKVALINLDPA
EPIVVHRGDRIAQLLVQRVELVELVEVSSFDEAGLAGTSRGDGGHGSSGG
HASL
118466459YP_882687.1 protocatechuate 3-4-dioxygenase- alpha subunit [Mycobacterium avium 10MPYPGDARLVDDGDPRAVRLHGTVYDGVGAAVPDALVELWQPDGGGRIVR
QAGSLRRDPAVFTGWGRCATGEDGGYGFTTLAPGSVIDGRTPFFALTVFA
RGLLNRLFTRAYLPGAGPDTDPLLARVAPERRTTLLCVAENGGRAYRFDI
RLQGPGETVFLAYRTDGR
118466458YP_883676.1 hypothetical protein MAV_4545 [Mycobacterium avium 104]MDNQEAPDAPASRRAHILRLAVFAGFLAVVFYLVAVARVIDVGEIRAVVS
ATGPAAPLTYVVASALAGALFVPGSILAAGSGLLFGPLLGVFVTLGATVG
TATAASFVGRRAGRDSARALLGPARADRVDALIGRGGLWAVVGQRFVPGI
SDALASYAFGAFGVPLWQMAVGAFIGSAPRAFAYTALGASIGNRSSLLAY
AAVAVWCVSAIVGAFAAHRGYRQWRGRPKDEAR
118466457YP_879420.1 hypothetical protein MAV_0124 [Mycobacterium avium 104]MRLTLAGSARPDTVTAWRRALHRWLQHEVRAPDDVRDDVVLGVNEALANC
VEHAYRSHRGTGAMKLQASYDPGAESIRVCVSDRGRWQSPSCRLSSDPRA
SRGIMLMHNLAEHCTIHARPDGTSVYLDYALDPNPVGAQRV
118466456YP_880263.1 hypothetical protein MAV_1004 [Mycobacterium avium 104]MKPKTRRGVAVLLACLMIVLCAGAGVGTWLLVGRGGPQHPEISAYSHGHL
TRVGPYLYCNVLNLEDCETPQSQGELPVSERYPIQLSVPDAIARAPWRLL
QVYEDPGNTTSTIYRPGTRFAVTIPSVDPHRGRLAGIVVQLLTLAMDPAG
EVRDVPHAEWSVRLTF
118466455YP_880465.1 adenylate cyclase- family protein 3 [Mycobacterium avium 104]MSLSYVLAVGEAAAILIPLRGHTSVGVNADFARQNTGPVLALIALGIVGV
AVAGALSLAPTLRWYVAGEEPTPQQRDAVMKLAGRQSAILVTAWAVSGGI
FLLLNLAGGARLLLPIALGALLGGSAAAGTGMLLAQRTLRPIMRAATLGA
EPRLAVPSVYARLVLLWFLCSAFPIAVIAALVVLRSYGWLVEKSASLDVP
ILVVSLAALVLGLPTMILTSRSISDPIGEVVDAMAEIEHGRMETYVGAYE
RSQIGRLQTGFNRMVAGLAERDRLRDLFGRHVGADVAQRAIEEGASLSGD
VVEAAVLFIDLVGSTQLAESRPPQEVAEVLNDFFRIVVNAVDEHHGLVNK
FAGDAALAVFGVPLPTNEPASAALATARTLGTQLRQLPVDFGIGVSAGRV
FAGNVGAENRYEYTVIGDAVNEAARLADLAKTADRRILCSAAAIEAAGEA
ERGHWAECYSTVLRGRSETTHVSAPTG
118466454YP_881482.1 hypothetical protein MAV_2278 [Mycobacterium avium 104]MIPPRPSSVIPPRLSSVIPPRPSSVTLAWLGPPGATLA
118466453YP_880777.1 hypothetical protein MAV_1541 [Mycobacterium avium 104]MIAQCTVDYVGRLTAHLPSARRLLLFKVDGSVSVHADDRAYKPLNWMSPP
CWLREEAGDAAPVWVVENKAGEQLRITVEDIEHDSSHDLGVDPGLVKDGV
EAHLQALLAEHVQLLGEGYTLVRREYMTAIGPVDLLCRDERGGSVAVEIK
RRGEIDGVEQLTRYLELLNRDSVLAPVRGVFAAQQIKPQARTLATDRGIR
CVTLDYDKMRGMDSDEYRLF
118466452YP_884070.1 hypothetical protein MAV_4949 [Mycobacterium avium 104]MIKNGTRLASQVCDTQVIVVRSADSLDDLRCGGVPMVPVGAERSGELDPS
FADGTVMGKRYVDETGAEVLVTKPGAGSLSIGQTPLQLKEVKPLPASD
118466451YP_883290.1 transcription factor WhiB [Mycobacterium avium 104]MSAPTVPRQALPCHVGDPDLWFAEAPADLERAKQLCAGCPVRRQCLAAAL
ERAEPWGVWGGEILDRGAVLGFKRPRGRPRKDGRRAGAAA
118466450YP_881136.1 TetR family transcriptional regulator [Mycobacterium avium 104]MLIEVAERLFAGRGIEAVTLKEIQQAAGQSNASVIRYHFGSRDGLIRALV
SYRQASLAADRQQMLAAMREQGKEADPRAVVWLLVRPLANSIAAGEMFVP
FLARLSEDPRARSDYWPEHVDDEWTQEQLEELVEAALQDFPERVRRGRTF
QLYISLINVLAAAARAGHGLSEAQLHNYVDAWVGMLTAPVSYETRALIAA
DES
118466449YP_881931.1 hypothetical protein MAV_2742 [Mycobacterium avium 104]MAAALPLVKLFRDTVAVRMSVAVLLGVAVAVVVGNTVGWRFALVGWVVTA
GVYVAWTQLILFGMDAEQTRVWATREDPTRWVADAVILSASVASLAGVGY
VVAAGSHAGARAVAAAVLGILAVAASWFAVHTLFTVHYARLYYSGQPGGI
NFHDPEPPRFRDFAYVAFTVGMTYQVSDTEIGLTAIRSTVLRHALLSYLL
GAVILAVTINLIAGLGAKL
118466448YP_881633.1 oxidoreductase- short chain dehydrogenase/reductase [Mycobacterium aviMDLGLAGSTAVVTGGSKGMGLAVAETLAAEGAKVAVMARGRHALDAAVAL
LREAGAPDAVGVSVDMADAESIADGFAAVAQRWGRLNSLVHTIGPGDGDF
EELDDTGWDEAFALGTMSAVRSIRNALPLLRAADWGRIVTFAAHSIQRQN
PRIVAYTASKAALASITKNLSKSLAAEGILVNCVCPGTIVTASFTEALKG
VLAADGLDATDPVDVMTWIDDNFHQPCDLGRAGLPEEVASITVYLASRRN
GYVTGAMVNVDGGSDFI
118466447YP_880368.1 Rieske (2Fe-2S) domain-containing protein [Mycobacterium avium 104]MAPINSPVSGTDEALTRRGLRHALDKTTDLAERELRVPLHYYRDPKITEI
EEGQILRRVPLAIVPSAQLPNTNDYMVRSVLGDSLLVTRDRSGASHVLLN
YCRHRGAMPACGSGNAARFVCPYHAWTYKNTGELFSVPGKAGFDSMNTKD
YGLVELPSEERHGFIWAVLTADATIDLDAHLGDFGAELALWNYSSYGYHT
QREFTSEVSWKGALEAFAEGYHFPYVHGQSLIGQNTLANTMVYDEFGKHH
RIGFPFTWITNAATDPAASLEPLANMGVIYWVYPNLILANSPVGVEIIDM
LPAGAPTRCTVRHSWMARVPAADDEMRAAYDAVFEGVHAAVRDEDFAMLP
QCGEGVRHGQHDHMIIGRNEIAVQHMIRVFAHELGVALA
118466446YP_882617.1 recombination factor protein RarA [Mycobacterium avium 104]MSDGLFDLPGAPPPGDHGLGVPAGAPLAVRMRPASLDEVVGQDHLLAPGS
PLRRLVEGSGVASAILYGPPGSGKTTLAALISQATGRRFEALSALSAGVK
DVRAVIESARTALLRGEQTVLFIDEVHRFSKTQQDALLSAVENRVVLLVA
ATTENPSFSVVAPLLSRSLILQLRPLSADDIRTVVRRAIDDPRGLGGRVP
VAPEAVDLLVRLAAGDARRALTALEVAAEAGESVTVQTVEQSLDEAAVRY
DRDGDQHYDVISAFIKSVRGSDVDAALHYLARMLVAGEDPRFIARRLMIL
ASEDIGMADSAALQVAVAAAQTVALIGMPEAQLTLAHCTVYLATAPKSNA
VTTALGAAMSDIKAGKAGLVPAHLRDGHYSGAAALGHAQGYQYSHDHPDG
VVAQQYPPDELVGVDYYRPTGRGAEREIAGRLDRLRAIIRNKRGRS
118466445YP_880208.1 TrnB2 protein [Mycobacterium avium 104]MALRAAYPRLTRQLERPVALLAGIGDHALFYGKALAGMPFAATRYTREVV
RLVAEISMGAGTLAMIGGTVVIVGFLTLAAGGTLAIQGYTSLGNIGIEAL
TGFLAAFINVRIAAPVVAGIGLAATFGAGVTAQLGAMRINEEVDALESMA
IRPVAYLVSTRILAGMLAITPLYSIAVILSFVASQFTTTFLLGQSQGLYQ
HYFNTFLNPIDLLWSFLQAILMALTILLIHTYYGYFASGGPAGVGNATGN
AVRTSLIVVVSVTLLVSLSIYGTNGNFNLSG
118466444YP_882474.1 hypothetical protein MAV_3292 [Mycobacterium avium 104]MWCPSVSLSLWANAWLAGKAAPDDVLDALSVWAPKQSVTAYDAVAAGHTG
LPWPDVHDAGTVTLLQTLRAAIGVPVGSGLMRGTINVVLPVPGDVRGLAP
GTQFEQDALAAGEAVIVSNPHQPGAAVGLVPEFCYADDDDGSQDYALTEL
CALSWTVYSLPGAPVLDHHELGDAEYTLRSAVRSAAETLGAIGLGSAASD
VDDPRGLVEQLLESARQHRIPDHAPSRALRVLENAAHVDAIIAVSAGLSR
SDSPDRFAAPIAAGLEPLGTQSSSEARIAGDALRPLTAVVRSARMAAVTA
ILHSAWGD
118466443YP_882097.1 transposase- Mutator family protein [Mycobacterium avium 104]MVKRPRITTERNIAMALDQSALLEVLDALRTADAGERITQAAETIYQALI
DAELTAFIGASPHERTETRSNQRNGSRPRTLSTVAGDLELRIPKLRTGSF
FPALLERRRRVDQCLFAVVMEAYLHGTSTRKVDDLVKALGTDTGISKSEV
SRICKDLDTEVAAFRDRPLGDQRFPYVFLDATYCKARVNHRVVSQAVVIA
TGVAADGRREVLGFEVGDSEDGAFWTAFLRSLKSRGLAGVQLVISDAHAG
LRSAIDAVLIGAAWQRCRVHFLRNVLAQVPKGSAEMVAAAIRTVFAQPDA
EHVREQLDTIAGMLGRQFPKVETMLREAAADITAFADFPVAHWKKIWSTN
PLERLNKEIKRRTDVVGVFPNPAALLRLAGSVLVEAHDEWQVADKRYLSE
TSLALLDVSDQSAETIAPTAALTA
118466442YP_884064.1 hypothetical protein MAV_4944 [Mycobacterium avium 104]MRWTRPGYALVLALLVVGPLLRPGYLLLRDAVSTPRSYLSDTALGLTAAP
RAVPQDFAVALASHLLDGGVVVKTLLLLGLWLAGWGAARLVALVLPGAGM
PGEFVATTLAIWNPYVAERLLQGHWSLLVGYGCLPWVATAMLGLRTGGAG
FFGLAFFIALAGLTPTGLLLAAAVALACVPVAGAGRRRWVWAAAAIGAAA
VAALPWLVAAVTGAALPSHTPANRLGVEAFAPRAEPGLGTLTSLASLGGI
WNADAVPGSRTTLFAVASAVVLLGVVAVGLPAVARRPAAVPLLVLAAAAV
LIPAGLATGPGLRLLGAVVDAAPGVGVLRDGQKWVALAVPGYALAGAGAV
LTLRRRLFGAAAPALVCCLALILALPDLVWGVGGRVSPVRYPRGWPAVAA
AINARPDAVAVLPAGTMRLFSWSGPAPVLDPLPRWVRADVLSTGDLVISG
TTIAGEGAHARAVQELLLSGPDPAALAAAGVGWLVLEADSAGEVGAAAHT
LGAAAPVYRDDEIALYRIGGHTAGVAADRRAATLIAHLAWLVLLLGSGAG
VLLGAWWRRGVSRAR
118466441YP_879749.1 ABC transporter ATP-binding protein [Mycobacterium avium 104]MAGMTTPLLSVEGLHVGFGEHAAVRGLDLRVLPGQTVAVVGESGSGKSST
AAAILGLLPPGGRITAGRIMFDGVDISAADRRALRSMRGRQIGYIPQDPM
TNLNPVWKVGFQIREALRANTSDRDTRRRAVQLLEAAGMPDPAKQAARYP
HQLSGGMCQRALIAIGLAGRPRLLIADEPTSALDVTVQRQVLDHLQRLTA
DLGTAVLLITHDLALAAERAESVVVVHDGVAVESGAAQSILQDPRHEYTR
RLVAAAPALTVSGGARTGPRQPDRTQPEPADILVASDLTKLYREPRATLW
RRTEFRAVDAVSFRLHRARTLAIAGESGSGKSTLALMVLGLLPPTSGTVV
FDGTRIDDTLSGDQHLAFRRRVQPVFQNPYSSLDPMYSVFRAIEEPLRIH
RVGDRRQRAKAVHDLVDQVALPSSVLNRLPRELSGGQRQRVAIARALALR
PQVLVCDEAVSALDVLVQAQILELLARLQAELGLAYLFISHDLAVIRQIA
DDVLVMRAGRVVEQAPTEKLFTAPAQDYTRQLLDAIPRPRRGGDRLSSCD
G
118466440YP_880552.1 GTP-binding protein TypA/BipA [Mycobacterium avium 104]MPFRNVAIVAHVDHGKTTLVDAMLRQSGALHHRGDDTQERILDSGDLEKE
KGITILAKNTAVHRHHPDGSVTVINVIDTPGHADFGGEVERGLSMVDGVL
LLVDASEGPLPQTRFVLRKALAAHLPVILVVNKTDRPDARIAEVVEASHD
LLLDVASDLDDEAAKAAEHALGLPTLYASGRAGVASTEQPADGEVPAGEN
LDPLFDVLLEHIPAPSGDPEAPLQALVTNLDASTFLGRLALIRIYNGKLC
KGQQVAWMREVDGLPVITSAKITELLATEGVERSPTDEAIAGDIVAVAGL
PEIMIGDTLADPDHAHALPRITVDEPAISVTIGTNTSPLAGKVPGHKLTA
RLVRNRLDQELVGNVSIRVVDIGRPDAWEVQGRGELALAVLVEQMRREGF
ELTVGKPQVVTRTIDGQLHEPFEAMTIDCPEEFVGAITQLMAARKGRMEE
MTNHAAGWVRMDFIVPSRGLIGFRTDFLTITRGTGIANAVFDGYRPWAGE
IRARHTGSLVSDRAGTITPFAMIQLADRGQFFVEPGQDTYEGMVVGINPR
AEDLDINVTREKKLTNMRSSTADVIETLAKPLELDLEQAMEFCAADECVE
VTPEIVRVRKVELDATSRARSRARAKARG
118466439YP_881030.1 LprM protein [Mycobacterium avium 104]MDQASAEGLSLTVALERLLAVEVEASTARRLAGRLRFACLPTPATLADFD
VDAAAGIDRKLIDELGTCRYLESATNILLIGPPGTGKTHLSVGLARAAAH
AGYRTYFTTAADLAARCHRAAIEGRWATTMRFYAGQDLTRSLDFYATFPF
PKPTLSKWLRGDYANLTAVIDLTLSRLDAGLFTGTFLEGELTELELQWGR
TIGQMPSPYTARNPLVVPYHFNQGP
118466438YP_884318.1 aldehyde dehydrogenase [Mycobacterium avium 104]MREYLKFYIDGQWVDPVRPNTFDVENPATEQVCGKISLGSAADVDVAVGA
ARRAFGRWSQSSREDRLDLLQAILAEYQKRADDLAAAVTEEIGAPPSLAA
GPQVFLGIGHLTTAIEVLKNFAFTEQRGATLIAREPIGVCGLITPWNWPI
NQVAVKVYPALATGCTVVLKPSEVAPFSSYIFAEILAAAGVPAGVFNLVN
GDGPGVGAALASHPDIDLVSFTGSTRAGVEVARNAAPTVKRVTQELGGKS
PNIVLDDGGFADAVRAGVANMMPNSGQSCNAPSRMLVPASRMAEAISIAR
EVAEQVQVGDPDDATAIGPVASRAQFEKVQRLIQQGIDEGATVVAGGPGR
PAGLDQGYYVKPTVFADVTNDMTIAREEIFGPVLCILGYDDLDHAVRLAN
DTDYGLAGYVSGADLDTAREVAGKIRAGWVTINHAFDLNAPFGGYKRSGN
GREWSDFGFHEYLEVKSILGYAPAQADR
118466437YP_883984.1 hypothetical protein MAV_4860 [Mycobacterium avium 104]MSKHRIPRPGSGRITLALLAVVPAAMAYPWHSPRDYWLLGIAAAVLIVLF
GWWGGLYFTTLLRRRLAIIGRHNAVRPQRPDPATTVLIRVGAPADGSDAL
PLPLIAGYLDRYGIRADKVRITSRDNASDESRRQTWIGLTVSAPDNLAAL
QARSPRIPLAETAQVAARRLADHLRETGWEAGVVPPDDVPRLLTSNPRER
WRGVQRGPSDYLAAYQIPVDESLPETLEAIRSYPARESCVALEIAGDKAA
PTIAVACAFQTDTAPDRGAPLAGLIPQRGNHLPALTALDLLSTGRLDGHT
AAPADLLDRLHWPTQGAPAGDADTVAAART
118466436YP_883617.1 hypothetical protein MAV_4482 [Mycobacterium avium 104]MSAEHLVHMLRAQGSFCASSGSPMYGDLFELVASDVEAGGVFADILSGHR
DAPSRDAIPLRLLGGLHRLVLDGRAGSLRRWYPSTGGSWDAGAAWPPILA
AAAEHAAALRAALDRPPQTNEVGRSAALIGGLLHINESCLPVRLFEIGSS
AGLNLRADHYRYRYAGGGWGPADSPVCIDDAWRGALPPARGVRIVERHGF
DIAPVDVGNSDGELTVLSYVWPDQAARLARLRGAIEVARRVPATLERRTA
ADAVGRLSLAEGALTVLWHSITWQYLSAGERAAVCAGVDALGARADASAP
LVHLTMEPARDGPGAPIRFLVRARGWPDGGPRVLAQCHPHGPPVDWL
118466435YP_884243.1 caib/baif family protein [Mycobacterium avium 104]MAGPVEGVTVVELGVWVAGPAAGGILADWGADVIKIEPPTGDPARMFGRM
LGCDLGLNPPFEMDNRSKRSVVLDLSSEPDRRAAFELLSGADVFLTNVRP
GALQRLGLDFASVSAANPRLVYGLITGYGESGPDADRAAFDVAAFWSRAG
VAHLLTRPGDTPPFQRGGMGDHSAGMTMAAAVCAALLARERTGAGQLVTT
SLYRQGAYTVSFDLNTYLMSGQPIAIGQRESMGNPCMNNYAASDGRRFWI
VGLEPERHWPALCRAVGRPEWRDDPRFADARARAANSVALIAALDEIFAT
RPLDEWAQIFAGEPDFFWSPVNSLEDVVADEQFHAAGGIVYVPDGADDQA
AVPMVATPADFHGTPWAPRSAAPELGQHTAEVLAELKARRGS
118466434YP_879836.1 negative regulator of genetic competence ClpC/mecB [Mycobacterium aviuMLNHNYIGTEHILLGLIHEGEGVAAKSLESLGISLEGVRSQVEEIIGQGQ
QAPSGHIPFTPRAKKVLELSLREALQLGHNYIGTEHILLGLIREGEGVAA
QVLVKLGAELTRVRQQVIQLLSGYQGKEAAEAGTGGRGGESGSPSTSLVL
DQFGRNLTAAAMEGKLDPVIGREKEIERVMQVLSRRTKNNPVLIGEPGVG
KTAVVEGLAQAIVHGQVPETLKDKQLYTLDLGSLVAGSRYRGDFEERLKK
VLKEINTRGDIILFIDELHTLVGAGAAEGAIDAASILKPKLARGELQTIG
ATTLDEYRKYIEKDAALERRFQPVQVGEPTVEHTIEILKGLRDRYEAHHR
VSITDSAMVAAATLADRYINDRYLPDKAIDLIDEAGARMRIRRMTAPPDL
REFDEKIAEARREKESAIDAQDFEKAASLRDREKQLVAQRAEREKQWRSG
DLDVVAEVDDEQIAEVLGNWTGIPVFKLTEAETTRLLRMEDELHKRIIGQ
EDAVKAVSKAIRRTRAGLKDPKRPSGSFIFAGPSGVGKTELSKALANFLF
GDDDALIQIDMGEFHDRFTASRLFGAPPGYVGYEEGGQLTEKVRRKPFSV
VLFDEIEKAHQEIYNSLLQVLEDGRLTDGQGRTVDFKNTVLIFTSNLGTS
DISKPVGLGFTQGGGENNYERMKQKVNDELKKHFRPEFLNRIDDIIVFHQ
LTRDEIIRMVDLMITRVAGQLKSKDMDLVLTDKAKALLAKRGFDPVLGAR
PLRRTIQREIEDQLSEKILFEEVGPGQIVTVDVDNWDGESAGEDAVFTFT
GTRKPPAEPDLAKAGAHSADPQ
118466433YP_880057.1 hypothetical protein MAV_0784 [Mycobacterium avium 104]MAINWKWPGWTWAANTFEFAGVAFAAALLAAWQDAPRHDLGALDWPHALS
HGGYEALGVVLYAVVGLKVPNRTASWLRNVVARPRRSAGR
118466432YP_881701.1 3-alpha-(or 20-beta)-hydroxysteroid dehydrogenase [Mycobacterium aviumMAERLAGKVALVSGGARGMGASHVRSLVAEGAKVVFGDILDDEGKAVAAE
VGEATRYLHLDVTKPEDWDAAVATALAEFGRIDVLVNNAGIINIGTLEDY
ALSEWQRILDINLTGVFLGIRAVVKPMKKAGRGSIINISSIEGMAGTIAC
HGYTATKFAVRGLTKSAALELGPSGIRVNSIHPGLIKTPMTEWVPEDIFQ
SALGRAAEPKEVSNLVVYLASDESSYSTGSEFVVDGGTTAGLGHKDFSNV
ETDAQPDWVT
118466431YP_879819.1 alpha/beta hydrolase [Mycobacterium avium 104]MRLRVTEAGDRGAPVVILAHGFPELAYSWRHQIDVLADAGYHVLAPDQRG
YGGSDRPDAVEAYDIHQLTADLVGLLDDVGAQRAVWVGHDWGAAVVWNAP
LLHPDRVAAVAAMSVPVTPRPRLAPTQAWRKMFGENFFYILYFQEPGVAD
AELNADPAQVMRRMMGSLRTDGDKAAGLRMVAPGPEGFLERLPEPDGLPE
WISQDELDHYIAEFSRTGFTGGLNWYRNFDRNWETTPELDGAKIAVPCLF
IGGTADPVLSFTRADRAAEVISGPYRHVMIDGAGHWLQQERPAEVNAALL
DFLNGLELR
118466430YP_884140.1 cyclase/dehydrase [Mycobacterium avium 104]MPVLSKTVEVNTDAAAIMAIVADFERYPEWSDGVTGCWVLARYDDGRPSQ
LRLDAAYQGFEGVYIQAVYYPGPNQIQTVMQQGELFKKQEQLFSVVEMGA
SSLLTVDIDVEPSMPVPAPMVKSMLNNVLDHLADNLKQRAEQLAAN
118466429YP_881868.1 hypothetical protein MAV_2677 [Mycobacterium avium 104]MLPWGGNTFRGRKEIIEGLPGTQPKIPHRIKHFVYVSMAK
118466428YP_881922.1 glucose-6-phosphate 1-dehydrogenase [Mycobacterium avium 104]MATQKPQTISYPAPEARPRRHHTDPLDPHVIVLFGATGDLAKRKLIPGLA
YLDQSELAPDIQIVATSLEDLSNDEFRELAKNAIDSFGTHKLTPDQWRNF
ADIITYIPQSAGSDALAAAVAEAEAKLGPNVRRLHYLSVPPKAARAVITM
LRDAKLVERSRVVMEKPFGTDLASAVALNDFVHQTFEESQIFRIDHFLGK
EAAQNILAFRFANGLFEPIWNRNFIDHIQIDIPEALGLDQRASFYEDTGA
YKDMVVTHLFQVMAFVVMEPPTALEPFAISEEKNKVFRSMLPVKPSNVVR
GQYIGYREEDGVAKDSDTETFIALKVGIDNWRWAGVPVYLRTGKRMAEGI
RIISIAFKEAPRTMFPPGSGVGTQGPDHLTFDLADNSRVSLSFYGKRPGP
GMKLDKLSMQFSTQEIETAVDVLEAYERLILDAMRGDHTLFTTAEGIESL
WERSEELLNDPPPAKLYQPGTWGPNAIHQLIAPNAWRLPFEREWRDPRPY
PGVGG
118466427YP_883254.1 MerR family transcriptional regulator [Mycobacterium avium 104]MADRRGNAGAPASDQGVYGISVAAELSGIAVQSLRLYERHGLVTPARSQG
GTRRYSADDLARLKRISKLVDAGVNLAGVARILALEDDNATLSAANTDLR
STNRALREAAKTADGDAATG
118466426YP_879696.1 lipoprotein [Mycobacterium avium 104]MILTGRTGLVALICVLPIALSPWPAMVFTALLAALAVAVAVDAALAASPA
RLRCIRSPDRSARLGQHADAALLIHNDGPRRFRGQIRDAWPPSARARPRL
HRVDIPAGQHQHIATRLEPVRRGDQRATVVTARSIGPLGLAGRQGSQSVP
GQLRVLPPFLSRKHLPSRLARLREIDGLLPTLVRGQGTEFDSLREYVVGD
DVRSIDWRATARRADVVVRTWRPERDRRVVIVLDTGRTAAGRVGVDPTAA
DPAGWPRLDWSMDAALLLAALASRAGDHVDFLAHDRVGRAGVFGASRTEL
LAQLVDAMAPLQPTLVETDWRAMVSAIALRARRRSLVVLLTDLNAAALDE
GLLPVLPQLSAKHHLLVAAVADPRVDQMAAGRSDAAAVYDAAAAERSRNE
RAAIAARLRHGGVEVVDAAPAELAPALADHYLAMKATGRL
118466425YP_883455.1 transposase- Mutator family protein [Mycobacterium avium 104]MVKRPRITTERNIAMALDQSALLEVLDALRNADAADRIKQAAETIYQALI
DAELTAVIGAGPHERSASRTNQRNGSRPRTLSTIAGDLELRIPKLRSGSF
FPALLERRRRVDQCLFAVVMEAYLHGTSTRKVDDLVKALGADAGISKSEV
SRICADLDTEVGAFRDRPLSEQHFPYVFLDATYCKARVNHRVVSQAVVIA
TGVAADGRREVLGFDVGDSEDGAFWTAFLRSLKTRGLSGVQLVISDAHTG
LRSAIEAILIGASWQRCRVHFLRNVLAQVPKGSAEMVAAAIRTIFAQPDA
EHVREQLDTIAGMLGRQLPKVETMLREAADDITAFADFPVLHWKKIWSTN
PLERLNKEIKRRTDVVGVFPNPAALLRLAGSVLVEAHDEWQVAEKRYLSE
TTLALLHPRSDSADQSVAVPAAITA
118466424YP_882187.1 steroid monooxygenase [Mycobacterium avium 104]MTDVSDVLVIGAGFGGLYAVHRAASSGLSVTALEAAPDVGGTWYWNRYPG
ARCDVESVDYSYSFDEELQRSWQWTERFAAQPEILAYLRHVADRFDLRRH
YRFGADVVDAAFEHGRWRVGTSNGQTFAARFLICATGCLSAVNRPDIPGA
QDFSGEVYFTAAWPREDPDLRGKRVGLIGTGSSGIQATPIIAAQAESLVV
FQRSANYTIPMPNRPFSAEEQQRIQEQYPERRRRSAYATSGTPHGTYHKN
AVDTDPAERAEALWKRWREGGVLFAKTFPDQTSDPAANDIARTFAEERIR
EIVTDPDVAADLIPVDHPIGTKRICTDDGYYATFNRDNVRLVNLRREPIE
AITADGIRTSTTTYPCDVLIFATGFDALTGALTRINPTGPRGDRLRDIWA
DGPLTFLGMMVPGLPNLFSISGPGSPSVLANMVLHAEVQVDWVIDLLCAA
RRLGVTEVEPRRDAAVAWTRHVAEVAERTLFPKAASSWYLGANIEGKKRV
FMPYIGGFGTYRRHCEQVADRGYAGLVLTTR
118466423YP_882830.1 hydrolase [Mycobacterium avium 104]MPKITDSISTADGTCPVRLFFPDGSGPWPGVVMYPDAGGVRDTFDQMAAE
LAGFGYAVLLPDVYYRSGEWAPFDMATVFADQQERNRLFAMIGSVTPDRM
ATDAAAFFDYLAARPEVSGDRFGVCGYCMGGRTSLIVAGRLPDRVAAAAS
FHGGGLVTDSDDSPHLLADRMSATVYVGGAQDDASFTTDHAEQLDKALTA
AGVRHTIEWYSAAHGFAVPDNAPYDPAAAERHWDAMRDVFAAALPR
118466422YP_883185.1 NADH dehydrogenase subunit A [Mycobacterium avium 104]MTVPKPGSSQQPGYRLAAAGGSHDGSWSELNVYIPILVLGAIATAFAVGS
VVIASLAGPSRFNKSKMAAYECGIEPTETSVSGPRATAGQRFPVKYYLTA
MLFIVFDIEIVFLYPWAVSYDALGTFALIEMVVFMLTVFVAYAYVWRRGG
LTWD
118466421YP_883001.1 polyphosphate kinase [Mycobacterium avium 104]MMRHDRNVTEIDAETRPDENLWHSGDSAVGAPPAATPAAMTDLPEDRYLN
RELSWLDFNARVLALADDNSLPLLERAKFLAIFASNLDEFYMVRVAGLKR
RDEMGLSVRSADGLTPRKQLALIGEHTQRIATRHARVFLDSVRPALAEEG
IHIVTWADLDQAERDELSTYFTEQVFPVLTPLAVDPAHPFPFVSGLSLNL
AVMVRQTEDGGQHFARVKVPNNVDRFVELAAPRAGAEGENRGVVRFLPME
ELIAAFLPLLFPGMEIVEHHAFRITRNADMEVEEDRDEDLLQALERELAR
RRFGPPVRLEIADDMTEGMLELLLRELDVHPGDVIEVPGLLDLSSLRQIY
DLDRPALKDPAFVPDTHPAFADRESPKSIFATLREGDVLVHHPYDSFSTS
VQRFIQQAAADPNVLAIKQTLYRTSGDSPIVRALIEAAEAGKQAVALVEI
KARFDEQANIRWARALEQAGVHVVYGLVGLKTHCKTCLVVRREGSAIRRY
CHIGTGNYNSKTARLYEDVGLLTAAPDIGADLTDLFNSLTGYSRKVSYRN
LLVAPHGIRTGIIERVEREIAAHRERGQGRIRLKMNALVDEQVIDSLYRA
SQAGVRVEVVVRGICALRPGVQGYSENIFVRSILGRFLEHSRIIHFRNIN
EFWIGSADMMHRNLDRRVEVLAQVKDPKLTAQLDELFESALDPSTRCWEL
GPDGQWTPSPQEGHTVRDHQVSLMERHRSP
118466420YP_883651.1 cyclopropane-fatty-acyl-phospholipid synthase 1 [Mycobacterium avium 1MAEQPSSPTKTRTRSEDIQAHYDVSDDFFGLFQDPTRTYSCAYFARDDMS
LEEAQYAKIDLNLDKLDLKPGMTLLDIGCGWGTTMKRAVERFDVNVIGLT
LSKNQHARCEELLASLDSNRCRQVRLQNWEDFNEPVDRIVSIEAFEHFGH
ENYDDFFKRTFDIMPDDGRMTVQSSVSYHPYDLAARGKKLSFETARFIKF
IVTEIFPGGRLPSTQMMVDHGEKAGFVVPEPLSLRPHYIKTLHIWGDTLE
SNRDKAIEVTSEEVYNRYIKYLRGCEHYFTEEMLDCSLVTYLKPGAAA
118466419YP_884109.1 hypothetical protein MAV_4988 [Mycobacterium avium 104]MTNEHGYSQQKDNYAKRLRRIEGQVRGIARMIEEDKYCIDVLTQISAVNS
ALRSVALNLLDEHLGHCVTRAVAGGGDDADEKLAEASAAIARLVRS
118466418YP_884220.1 p40 protein [Mycobacterium avium 104]MTSSHHALGGPFFDDLHLGQVFDSAPSMTLTTGLAATHQSIVGDRLRLAL
DSVLAAAVVGASGPLAHPALVCDVAIGQSTLVTQRVKANLFYRGLAFHRY
PVIGDTLFTRTEVVGLRQNSPKPGRAPTGLAAIRVTTSDQHARRILDFHR
CAMLPCREAADTGHRDDLSVIGASAALPPDPTADWDIAFYRANVPGGARS
MKEQEGVVLTSTADVVSGAAELARLTLNIAATHHDWRIGGRRLVYGGHTI
GLALAQVTRLLPNLITILGWQSCDHTNPVFEGDTVYSTVQIESAEPRRDG
ASTLQLRSRVFAAAADEDTTDRQVLDWRFSALSC
118466417YP_882162.1 transposase- Mutator family protein [Mycobacterium avium 104]MSRSDSSRDEAAKQLAQVLPPAALDALLADAEASGTPIDGPDGLLAQITK
SVLERALDVEIADHLGYEHGDPAGNGSGNSRNGHGRKTVLTTAGPVDLEV
PRDRNGTFDPVIVPKRKRRLGQVEDMILSLYARGMSTRDITEHLAEVYGA
SVSAATVSRVTEVVADEIAAWQSRPVDPVYPILYIDAIRLKIRDGGVVSN
KAAHVVIGVDVEGIKQVLGVWIQQTEGAKFWHGVLTELRNRGCRDALFVC
CDGLAGLPESIAAVWPQAVIQTCVVHLLRASMRYASYTDRKKMAAALRPI
YTAATEQAAAVALEQFRTEWKAKSPGAVAVWDRSWAEFVPFLAFPVEIRK
IIYTTNAIESLNYQLRKVTKARGSFPSDAAAMKLLYLAIRNINQKRGSAQ
GQGTYRWTEALNAFAIQFPDRLPL
118466416YP_881546.1 hypothetical protein MAV_2342 [Mycobacterium avium 104]MTAGTPAPDSAGDRETELTHALAAVRSRLAAAAEAAGRNVAEIEVLPVTK
FFPATDVVTLSRLGCRAVGESRDQEATAKVAEVTRLLATSARTNVAIPRW
HMVGHIQRNKARSVARWAHTAHSVDSTHLVSALDRGVAAALADGGRIDPM
RVYVQVSLDGDESRGGVDISRPGAVDEVCAQVAAANNLDLVGLMAIPPLN
SDPDEAFDRLQSEHRRVLETHRNAVGLSAGMSDDFEIAVKHGSTCVRVGT
ALLGRRPLPSP
118466415YP_880895.1 hypothetical protein MAV_1662 [Mycobacterium avium 104]MNRQRPAWPAAPWRRSPGKTAAVAGAALFLAGCGGSTPTATTVISTPPAQ
TKTVTVTVTPPPPPGPKTSIETNGTFIVNKEIAAGTYRTDGKSGCYWARL
RSFDTNDIIDNNVGDGAQVVRILPTDVAFMTRSCGIWRKID
118466414YP_884311.1 hypothetical protein MAV_5195 [Mycobacterium avium 104]MQAARIGIAGCAAVVIAAAGCGGGGKGSSPGSGSPTPSSSSGAVTGPPPG
QPSDYGYLLIKPSDVGGGLSAPQSPMLNPNNAPGAAQLFANADSSRRLWD
TIVIAADAPAATAELAATKSSYAGKVNGDWRPVAVGANGTTISGGSSDNT
QAMTVLLFTEGRALVTLEFDSAPNDPIDPAVAVDIARKQDAAIRTGLPG
118466413YP_880472.1 3-beta hydroxysteroid dehydrogenase/isomerase [Mycobacterium avium 104MIGPMGDPSLTAELGRVLVTGGSGFVGANLVTTLLERGYQVRSFDRAPSP
LPAHPHLEVLQGDITDAGVCAAAVEGIDTIFHTAAIIDLMGGASVTEEYR
QRSFAVNVGGTENLVRAGQAAGVQRFVYTSSNSVVMGGQNIVGGDETLPY
TDRFNDLYTETKVLAERFVLGQNGVDGMLTCAIRPSGIWGRGDQTMFRKL
FESVIAGHVKVLIGRKSARLDNSYVHNLIHGFILAAQHLTPGGTAPGQAY
FINDAEPINMFEFARPVVEACGVNWPRVRVNGPIVRAAMTGWQRLHFRFG
IPAPLLEPLAVERLYLDNFFSIAKASRDLGYQPLFTTEQAMSECLPYYVG
MFEQMKRQALAGKASA
118466412YP_883410.1 hypothetical protein MAV_4270 [Mycobacterium avium 104]MLACRGGTGCRITDNAVRATPGFAPASTARHLRALLDAAPVI
118466411YP_879649.1 DNA polymerase LigD polymerase subunit [Mycobacterium avium 104]MAAAEEVDVDGIAVRLTNPDKVYFPKLGSKGTKRHLIDYYRAVAGGPMLD
ALRDRPTHLQRFPDGIDGEEIYQKRIPQHHPDYLQTCRVTFPSGRTADAL
KVTHPAAIVWAAQMGTVTLHPWQVRCPETDHPDELRIDLDPQPGVAFAQA
RSVAVDVLRPLLDELGLVGYPKTSGGRGIHVFLRIATDWDFVEVRRAGIA
LAREVERRAPDAVTTSWWKEERGARIFIDFNQNARDRTMASAYSVRRTPI
ATVSMPLTWDQLAGADPDDYTMATVPDLVSARENPWAAIDDVAQSIGPLL
RMAEADEERGLGDMPYPPNYPKMPGEPKRVQPSRDTEHKKKN
118466410YP_883849.1 superoxide dismutase- Cu-Zn [Mycobacterium avium 104]MPKLLPPVVLAGCVVALGACSSPQHASSLPGTTPAVWTGSPSPSGAGAAE
AAPAAAPSITTHLKAPDGTQVATAKFEFSNGYATVTIETTANGVLTPGFH
GVHIHKVGKCEPSSVAPTGGAPGDFLSAGGHFQAPGHTGEPASGDLTSLQ
VRKDGSGTLVTTTDAFTMEDLLGGQKTAIIIHAGADNFANIPAERYNQTN
GTPGPDEMTMSTGDAGKRVACGVIGAG
118466409YP_879447.1 hypothetical protein MAV_0153 [Mycobacterium avium 104]MTIKVTPQMLRDTSNAIQANMEHAIGIGQGYVANQENVMNPATWSGDAVA
ASHATAIEVQNDLNKVLTGGTRLAEGLTKAAALMEGHEADSSHAFSALFG
GHGS
118466408YP_881785.1 acyl-CoA dehydrogenase [Mycobacterium avium 104]MEYGMGPELEAFRAEVRAFIAEHAPPIPPRAGVRSAENEAELKALQDWTA
RLFEAGYVGADWPVEFGGRDDRSAEHAIVVGEELARAAVPGVPSGNALAS
HALIHYGTDDQRRRHLPEIRAGRQLWCQLFSEPGAGSDLASLRTRAVLDG
DTYTVNGQKVWTTDGHWADYGYLLARTDSDAPKHKGISAFILDMSSPGIT
VRPLRELTGTSDFNEVFFDSVEVPAEAMIGEPGQGWAIANATLGHERTSV
GAAVVKLRLAIEALVQLASHVTVDGRLAIDNDRIRDRIGEFSAEVEALSA
LTYANLTRWLRGTERMHDGAMAKLMFSELNLEMARFAVELGGEAGVLVEG
DPDVLDGGRWQDEWLYARAYTIAGGSSEIMRNLIAERGLALPRDRR
118466407YP_882236.1 hypothetical protein MAV_3050 [Mycobacterium avium 104]MNSPPRISAVPGIIELAPFYADPPDGVRANMIFSADGAAAFGGRAGPLSC
RTDQRLLRILRGLADVVLVGAGTARAENYGPVRLTDAARARRLHEGRAAP
PPIAVVSRSGELPARLFSDPEQPPILVTCARTAARPDLDAQHVLVAGEET
VDVARAVAMLREAGMHRILCEGGPTLLDELVEADALTELCVTLAPKLAAS
QPLGYRVHPARLTAPVGLHLAHALVCDDYLFLRYRR
118466406YP_880062.1 hypothetical protein MAV_0789 [Mycobacterium avium 104]MKYKLGLKTVLAQPRVRLCDYYTSDLPSVESLKFPLGHSDLIQPHMFMND
QLGDCAIAGSIEEIRLANALRGVAVNFTDETAVQNYSEITGYVPGDPSTD
QGTDVHELYEFRQNTGLVDADGNRHKIVAYAGLTPGDFDELLIALSLFDM
VGIGIQVPDYCEAEFEAGQPWHLLRGRHRIEGGHYIPVVDATSRTEAGLF
TWGGHGGITAPFYATYNTVAVVALTEELFTGGKSPEGVDFNRLATDLNLL
NTGPVMSKAPRGKRRGEGPHAHPETFAPTGSTEVPGDDASA
118466405YP_881711.1 transposase- Mutator family protein [Mycobacterium avium 104]MVKRPRITTERNIAMALDQSALLEVLDALRTADAGERITQAAETIYQALI
DAELTAFIGASPHERTETRSNQRNGSRPRTLSTVAGDLELRIPKLRTGSF
FPALLERRRRVDQCLFAVVMEAYLHGTSTRKVDDLVKALGTDTGISKSEV
SRICKDLDTEVAAFRDRPLGDQRFPYVFLDATYCKARVNHRVVSQAVVIA
TGVAADGRREVLGFEVGDSEDGAFWTAFLRSLKSRGLAGVQLVISDAHAG
LRSAIDAVLIGAAWQRCRVHFLRNVLAQVPKGSAEMVAAAIRTVFAQPDA
EHVREQLDTIAGMLGRQFPKVETMLREAAADITAFADFPVAHWKKIWSTN
PLERLNKEIKRRTDVVGVFPNPAALLRLAGSVLVEAHDEWQVADKRYLSE
TSLALLDVSDQSAETIAPTAALTA
118466404YP_883340.1 polyphosphate kinase 2 [Mycobacterium avium 104]MSSAKNDGVPLKAGKKKSARAAVKIPDAVYEAELFRLQTELVKLQEWVRH
SGARLVVVFEGRDAAGKGGAIKRITEYLSPRVARVAALPVPTDRERGQWY
YQRYIAHLPSKGEIVLFDRSWYNRAGIEKVMGFCTPQEYVLFLRQTPIFE
QMLIDDGILLRKYWFSVSEAEQLRRFKARLKDPVRRWKLSPIDLESVYRW
EDYSRAKDEMMVHTDTPESPWYVVESDIKKHARLNMMAHLLSTIPYHAVE
APPVKLPRRPVVTGNYQRPPRELSRYVDDYAATLI
118466403YP_882964.1 Y4bN protein [Mycobacterium avium 104]MVVSVAPVSESFTLASAGGGGDKHEFTGDRKGHGRRLTDEFNAAVAPTAD
DEIEPAGTYVTFVSFPDLELALQSLDPQRSGEQPELVAVRETQTTDGIVQ
MATVYIPRGKKEYFLKRLDAYVSSADRTKADNAALIESIQSIRRATIREL
WTDPDELFPDDPTEVRWWEVWLLNRDRREQARFSDFVVQHELRTSEHYLG
FGDRTVVLLYASADQLAQTFQSVDDIAELRRPHDVATLLTELPAAEQTEW
VDDLRARLRMADKDAAVVCILDTGVQDTHPLLTDSIGAADLHVADPRWQT
TPVQSHGTEMAGLALYGDLHAALVDTQPVQLTHRLESVKFLPDNAHNDRD
LYGAITARAVDRPEIQAAARRRVFMLAVTARRPSVDGTDTEPTTRIDTGR
PTSWSAAIDALAFGRAIDDSDPKLTYLDRDEPRRPRLFLVSAGNIRDLRG
TDDHLARSDVEPVEDPAQSWNALTVGAYSNRDDMSGAPADFAGYVPVAKR
GELSPVSRTSVVFDRTKWPFKPDVVADGGNVAVSPDRTDVDTPPNLALLT
TRLQRPGHGFFTATRDTSAATAQVAAIAGNLSQAYPQLRPETIRGLIVHS
AQWTDAMRNRFNTESNKTRLASLLRRYGMGVPDAARALRSATDALTLIAE
ARIHPYERDRDSNSGKVREMNLHQLPWPTEILEGLGETEVRMRVTLSYFV
EPNPSSRGWTGRYIYPSHGLRFATRRPEDNIESFRQRINTRARIDGQRPP
ALDTEKGWFFGSNLQQAPGSLHTDIWTGPAANLASKGAIAVYPVAGWWKN
QRKYDQSNHGVDYSLIVSIESPHVDVDLWAPVAQQISTTVEIQT
118466402YP_883007.1 pyridoxamine 5'-phosphate oxidase [Mycobacterium avium 104]MGTNQRASIVMSDDEIADFVVKSRTGTLATIGRDGQPHLTAMWYAVVDGE
IWLETKAKSQKAINLKRDPRVSFLIEDGDTYDTLRGVSFEGVAELVDDPD
VAHRVGVSVFERYTGPYTDEMKPFVEQMMNKRVCVRIVARRARSWDHRKL
GLPPMPVGGSTAPAVLGTDR
118466401YP_880342.1 carbamoyl-phosphate synthase L subunit [Mycobacterium avium 104]MGITRVLVANRGEIARRVFATCRRLGVSTVAVYTDPDAGAPHVAEADARV
RLPNTTDYLNIEAIIGAARAAGADALHPGYGFLSENADFATAVADAGLTW
VGPPVDAVRAMGSKIESKKLMAAAGVPVLDELDPDTVTEAQLPVLVKASA
GGGGRGMRVVHELSALRGEVEAARREAQSAFGDPTVFCERYLPTGHHVEV
QVLADAHGTVWAVGERECSIQRRHQKIIEEAPSPLVERTPGMRAKLFEAA
RLAAGVIGYTGAGTVEFLADDDGEFYFLEMNTRLQVEHPVTEETTGLDLV
ELQLAVADGARLDAEPPAAQGYSIEARLYAEDPARGWQPQAGVVHAFAVP
SVRAEFGSLGRRIGIRLDAGITDGFAVSIHYDPMLAKVISYAPTRRQAAL
VLADALTRTRVHGVRTNRDLLVNVLRHPAFLDGATDTAFFDTHGLAELAA
PLGDAAAVRLSAVAAALADAARNRAHAPVLGAIPSGWRNLPSGFQVKDYR
DDEGHEHRVQYRFTRTGLVLPDDPSVQLVSATADDVVLRTDGVEHNFSVR
RYHGADADVYVDSVRGPVHLTVLPRFPEPGSSVEKGSLVAPMPGNVIRLG
AAIGDTVTAGQSLIWLEAMKMEHTIAAPVDGVLAELNVKTGQQVEVGAVL
ARVEAPQSEGDAQ
118466400YP_882384.1 transmembrane protein [Mycobacterium avium 104]MSTFDSSSLYWATAVVFGLPLLLIVLTEWHQSLVRKHSPLARPAFLLRSY
LIPLGALLVLLVNVARMPAQFTSVRVLATAFGFVVVVLLLSGLNATIFEG
APEGSWRQRVPGIFLDVTRFVLIGVGLAVIFSYVWGVRVGGLFTALGVTS
VVIGLMLQNSVGQIVSGLFMLFEQPFRIGDWLDTPAARGRIVEANWRSVH
IQTGHGLQITPNSVLATTSFTNLSRPPGGHQLTLTATFSETDPPDRVCAL
LRRVADALPQRRPDAVAAAVPAGGGEYHVTIGLTSPADDSAAQATLLRWL
WYGARREGLRLDGAEDDISTPERIERALRMVVAPALRLGPPDQQALVSHA
RIVRYGADEIVEHAGRVPEKMTFLLAGGVRLTATAPDGSVVAVGGLDEGS
FLGVTALTRQPNLADAQAVAEVTALEIDREHLVELVTGKPLLLQDLGRTI
DERRALVHRAVTAEPTPSREPVS
118466399YP_879771.1 GlcG protein [Mycobacterium avium 104]MIDLARARTIVDGALDHARGNDFPPMTIAVLDAAGRLVAFASEDGSSLLR
GRIARAKARGALNMGVGSRSLAARAESHPAFVNALVALAGGDLVPVPGGV
LIRDGNDDLIGAVGVSGHDPDHDEACAIQGVAAGGLRADPGN
118466398YP_881250.1 Orn/Lys/Arg decarboxylase [Mycobacterium avium 104]MDQSDAPLLNALADYRDKNRYGFAPPGHRQGRGTDDRVLAVLGREPFLDD
VLASGGLDDRRTSNGYLQRAEDLMAEAVGAEIAWFSTCGSSLSVRAAMMA
VAGGQGSLLVGRDSHKSIVAGLIFSGVQPRWITPRWDAERHFSHPPSPQQ
VEEAWDKHPDAAGALVVSPSPYGTCADIAGIAEVCHRRGKPLILDEAWGA
HLPFHEDLPTWAMDAGADVCVVSVHKMGAGFEQGSVFHVQGDLIDRDRLS
ACADLLMTTSPNVLIYAAMDGWRRQMVQHGHQLLGAALDLARQVRDEIEL
IPDVEVLDDELLGVQASHDLDRMQVLIDVCGTGTSGYQAADWLREHARID
VGMSDHRRILATLSMADDKETLGRLTDALRAWRTAAQDFDPAPRIALPSP
GEMQLETVELPRDAFFGRVQEVPTKTAAGRIAAEQITPYPPGIPAVVPGE
RLNDAVLDYLCSGVAAGTNLPDAADPSLQTIRVLA
118466397YP_880000.1 phosphoribosylaminoimidazole-succinocarboxamide synthase [MycobacteriuMPALSDYQHLVSGKVRELYRVDDEHLLLVATDRISAYDFVLDSTIPDKGR
ILTAMSVFFFGLVDAPNHLAGPPDDPRIPDEVLGRALVVRQLEMLPVECV
ARGYLTGSGLLDYQATGKVCGIALPPGLVEASKFAEPLFTPATKAALGDH
DENISFARVIEMVGGVRANQLRDRTLQIYVQAADHALRKGIIIADTKFEF
GTDPDGNLLLADEIFTPDSSRYWPADEYRVGVPQTSFDKQFVRNWLTSPE
SGWDRHGTEPPPPLPDHIIEATRNRYIEAYERISGLRFDDWIGPRA
118466396YP_883620.1 ferredoxin reductase [Mycobacterium avium 104]MSSDASASNGIVIVGGGLAAARTAEQLRRSEYSGPITIVSDEVHLPYDRP
PLSKEVLRKEVDDTALKPRQWYDDNDITLRLGSAARSLDTAAQTLTLEDG
TTLGYDELVIATGLVPRRIPTIPDLDGIRVLRTFDESLALREHASAAQRA
VIIGAGFIGCEVAASLRSLGVDVVLVEPQPTPLAAVLGQQIGELVARLHR
AEGVDVRLGVGVSEVRGDRHVEAVVLTDGTELAADVVVIGIGSRPATDWL
EGSGVAIDSVDRGVLCDEAGRTSAPNVWALGDVASWRDATGHQGRVEHWS
NVADQARVVVPAMLGKEVPPVVVVPYFWSDQYDVKIQCLGEPEADDIVHI
VEDDGRKFLAYYERDGALVGVVGGGMPGKVMKTRAKIAAAVPIAEMLG
118466395YP_883042.1 nucleoside-diphosphate sugar epimerase [Mycobacterium avium 104]MDAAITEVFDWHARPGAFERLSPPWSPIRLLTEAASLKDGRATLALPGGL
RWVAVHRPDGYDPPRRFVDSIGGDGLAALPARIAVRWRHIHEFEDVGGDR
TRVIDRVETPVPASLLRPMFDYRHRQLAGDLAAHRLAAQHGLRPLTVAVT
GSSGLVGSALTAFLRTGGHRVIRLVRRAARGDDERRWDPEDPDPGLCDGV
DAVIHLAGASIAGRFTDRHREAVRDSRIGPTRRLAELLGRGRPRPAALIS
ASAIGYYGYDRGDETLTEDSDRGDGFLADVVADWEQATTPALDAGVRVMQ
VRTGIVQSPRGGTLKLMRPLFSAGLGGRLGDGRQWLSWIGIDDLIDVYHR
ALWDSRLNGPVNAVAPQPVRNREYTTALAAVLHRPAVLPVPSLGPRLLLG
GQGARELAGASQRVAPAKLAAAGHRFRHPDIERALRHLLGRGG
118466394YP_880972.1 gamma-glutamyl phosphate reductase [Mycobacterium avium 104]MGLQAPFRSGGGTSRPQGRAAPRAVDLRREVHDAARRARVASRVLALLPT
VAKDQALRSAADAIAGHAELILSANAEDLETARAAGTPSAMLDRLALDTK
RVEGIAAGLRQVAGLPDPVGEVLRGYTLPNGLQLRQQRVPLGVVGMIYEG
RPNVTVDAFGLALKSGNAVLLRGSSSATRSNQALVQVLRASLVSEDLPAD
AVQLLSADDRATVTHLIQARGLVDVVIPRGGANLINAVVRDAQVPTIETG
VGNCHVYVHEGADLEVAERVLLNSKTRRPSVCNAAETLLVDAAIAEEALP
RLVTALQDAGVTVHGGFARDATEDDLRREYLSMDIAVAVVDGVDAAIAHI
NEYGTGHTEAIVTTNMAAAQRFTDGVDAAAVMVNASTAFTDGEQFGFGAE
IGISTQKLHARGPMGLPELTSTKWIAWGDGQTRPA
118466393YP_881041.1 enoyl-CoA hydratase [Mycobacterium avium 104]MTTSEIATLAGYEQFAPWLLVEKRGNVHVVSINRPEALNAVTEEVHHAFA
TIWKVLDADTDVKAVVTTGVGKAFSAGGDMVMFGRLIEDEVARTYQIHEA
RTVFLEVINFPKPLVSAVNGPAVGLGCSIALLSDLLVMGENSYLADPHVA
VGLTAGDGGTAMLPLLIGMMKAKEYVLLGDRITAPIAEKLNLVTKVVSDD
TVLDEALALGERFAALPPQALRSSKVALNMHLARAAQGVLEYALAEELTS
FSTPEFKERVAAFLARSKK
118466392YP_883569.1 preprotein translocase subunit SecY [Mycobacterium avium 104]MMQEIPAAQEEELLSAFISSLRTVDLRRKILFTLGIVVLYRVGAALPSPG
VNYPNVQQCIKEASGGAAGQIYSLINLFSGGALLKLTVFAVGVMPYITAS
IIVQLLTVVIPRFEELRKEGQSGQAKMTQYTRYLAIALAILQATSIVALA
ANGGLLQGCSLDIIADQSIFTLVVIVLVMTAGAALVMWMGELITERGIGN
GMSLLIFVGIAARIPAEGKTILDSRGGMIFAAVLVAALIIIVGVVFVEQG
QRRIPVQYAKRMVGRRMYGGTSTYLPLKVNQAGVIPVIFASSLIYIPHLI
TQLIRSGSGGVGNSWWDKFVGSYLSDPSDPVYIGIYFGLIIFFTYFYVSI
TFNPDERADEMKKFGGFIPGIRPGKPTADYLRYVLSRITLPGSIYLGAIS
VLPNLFLQIGNGGAVQNLPFGGTAVLIMIGVGLDTVKQIESQLMQRNYEG
FLK
118466391YP_879853.1 cysteinyl-tRNA synthetase [Mycobacterium avium 104]MTDRPRLRLHDTAAGAVRDFVPLRDGHVSIYLCGATVQGLPHIGHVRSGV
AFDILRRWLIALGYDVAFIRNVTDIDDKILNKAAAAGRPWWEWAATYERA
FSAAYDALDVLPPSAEPRATGHITQMVELIERLIEKGHAYTGDGDVYFDV
LSYPEYGQLSGHRIDDVHQGEGVASGKRDQRDFTLWKGAKPGEPSWPTPW
GRGRPGWHTECVAMAHEYLGPEFDIHCGGMDLVFPHHENEIAQSRAAGDG
FARYWLHNGWVTMGGEKMSKSLGNVLAIPAMLQRVRPAELRYYLGSAHYR
SMLEFSDTALQDAVKAYVGVEEFLHRVRVRVGAVEPGEPTPRFADALNDD
LAVPAALAEVHQARAEGNRALDSGDHEGALRQARSIRAMMGILGCDPLHE
RWETRDESSAALAAVDVLVRAELQNREKAREQRNWALADEIRNRLKQAGI
EVTDTADGPQWTLGGDGK
118466390YP_884066.1 SAM-dependent methyltransferase [Mycobacterium avium 104]MTDIFARRATLARSVRLLSQFRYERSEPARFYGALAADTAAMVDDLWRAG
HGESAAGRTLLDVGGGPGYFAAAFADAGVRYLGVEPDPGEMHAAGPVVAA
DTGTFVRASGMALPFADDSVDICLSSNVAEHVPRPWQLGAEMLRVTRPGG
LAVLSYTVWLGPFGGHEMGLTHYLGGSRAAARYARKHGHPAKNNYGSSLF
EVSVADGLAWAACTGAELAAFPRYHPRWAWWLTSVPVLREFLVSNLVLVL
QPQ
118466389YP_882191.1 MaoC like domain-containing protein [Mycobacterium avium 104]MTELFYDDVSVGDHIPTLTVTVDETQMFFFSAATYNGHRIHYDKEWARAE
GYDDVLVHGPLQAALLARALGDWIGGRGRLVSFSVQNRAVAYPGEPLSFG
GRVTGKRLDESGSGLVDLDIAGRRDDTVLMPGAATVQLPRREARS
118466388YP_880404.1 LpqT protein [Mycobacterium avium 104]MNRLRGCAAVAAAVALAVATAGCAPKPPDYQSILSKTPTTTTTTSATAKP
VPLSQYLQSIGVTGQQVAPASLPDLTVSIPTPPGWAPFSSPNISPQTVMI
SKGGKFPTARLVVFKLSGDFDPAQVIKHGNDDAQLFENFKQLDASGAPYN
GFPSSMIQGSYDLDGMRLHSWNRIVIATGSPPAHQRYLVQLTITSLADQA
AAESTDIEAIIHGFVVAAK
118466387YP_882498.1 FeS assembly ATPase SufC [Mycobacterium avium 104]MTTLEIKDLHVSVVNPNAAESEREIPILNGVDLTVKSGETHALMGPNGSG
KSTLSYAIAGHPKYTVTSGSITLDGQDVLAMSIDERARAGIFLAMQYPVE
VPGVSVSNFLRSAATAVRGEAPKLRHWVKEVKAAMGALEIDPAFAERNVN
EGFSGGEKKRHEILQLELLKPKIAILDETDSGLDVDALRVVSEGVNRYAQ
AEHGGILLITHYTRILRYIHPEYVHVFVGGRIAESGGSELADELEQNGYV
RFTQAAAAGA
118466386YP_883100.1 DnaK family protein [Mycobacterium avium 104]MRVGIDFGTTHTVVAAVDRGNYPVVSFDGTDAWPSIIAANAAGELRYGAD
AAAVRHDPSWSVLRSFKRLLNDAGPQTRVKLAGRDYRLAELLTGFLARLK
TDLQQRSNATVAPGEPIEAAISVPANASSAQRLLTLDAYVAAGFHVVALL
NEPSAASLEYAHRYRSTITAKREYVLVYDLGGGTFDASLLKMTGHSNEVV
VSEGIQRLGGDDFDGAIVELVRAGADLPGLDAAGRALLAEECAARKEAVG
PQTRRFLVDLSPFDRPPFSCPVDDVYAACAPLVDPTMRLLERVLRDPSRG
RADVDWSEVAGIYVVGGAGGFPLVSRMLRARFGDKRVKRSPHPFAATAIG
LAVFLDKESGFALSERFSRNFGVFREAEAGAGVVFDPIVCKDVSLPADGQ
TPLVVKRRYRAAHNIGHFRFVECSRLVDGRPDGDITPYDPVLFPFDPALR
DRDDLGRQPVGRWRDGPDVEERYVIAPSGAVEVTLTTQPAGFERTFRLER
CASAS
118466385YP_879323.1 protein phosphatase 2C [Mycobacterium avium 104]MTLVLRYAARSDRGLVRSNNEDSVYAGARLLALADGMGGHAAGEVASQLV
IAALAHLDDDEPGGDLLAKLDEAVRAGNAAIAAQVEAEPELEGMGTTLTA
ILFAGDRIGLVHIGDSRGYLLRDGELTQITKDDTFVQTLVDEGRITREEA
HSHPQRSLIMRALTGHEVEPTLTMREARAGDRYLLCSDGLSDPVSDETIL
EALQIPDVAEAAYRLIELALRGGGPDNVTVVVADVVDYDYGQTQPILAGA
VSGDEDQLTLPNTSAGRASAIRPRDESAKRVAPQPETPSRPRWSRRRLFI
VIALAVMLVLAGLTVGWWVIQRNYYVAEYNGRISIVRGIQGSLLGVPLQQ
PYLVGCLNARNELSLISYGQSGGSNCQLMTLQDLRRPGQVQVQTGLPGGS
LDQAESQLRQLLAEYLLPLCPPPRATSPPGAQATRSPVPETGGPASPAPP
TTSASPTPSTNATPGPASSSPAGPTTTSQTLTALPGPPLQPGIDCRTVA
118466384YP_880863.1 acyl-CoA dehydrogenase [Mycobacterium avium 104]MDYDLGDDAAQLRSHLRELVANHIPADFLGACTENPQDLATTETFCKLLA
AEGLLALAWPKEHGGGGGSVWQQTVLREEMWAQHEPRGPQYMGINWVGPA
LMRYGTEEQKTKHLAAIAAGDVIWCQGFSEPEAGTDLVSLRTRAVADGDG
WRITGQKVWTSYALMASWCVLAACTDPDAPKHKRLTLFLIPMDRPGFTVR
PIPSMLGPHHLNEMFLDDVPAYPGDVLGEVGDGWRVMREALAYERVGIAR
YARCESLLERMRGRLGDEWEQLPESIRARWVRALVDLRVARLLAYRAVSL
QDDPASGAAASAARIATTTCDQQVAELLFDVLGPTALDAGSGAPLHGAIE
DHWRYAQAATVASGTIEVQKMLVARDVLGGHR
118466383YP_883941.1 hypothetical protein MAV_4816 [Mycobacterium avium 104]MRDMSEPLGLSIGVANLVAARAGSVPVIRSSVLTLFEQRPTEVGLPDENP
NLTEPGLVLRGFVERVGDRAPLVAADGTKYLGAALTVEAVEAMARAVGYG
APITIAVPAYWSDDQFAALREEFFAQSDLAREGVAPMLVSDATAALAMLR
GTPGFPSDGVIALCDFGAGGTTVTLMDGRAGFAPVGPSLRYTDFSGDAID
QLVLDHLLASDVSTAMRGGSGRIGSQSRLLGACRRAKEQLSTAVAVTVAG
APGQGAQLTRAEFEQLISTPLDRFLDWCQEALRRNGIGNSTLRGVAIVGG
GASIPLLTARLSGRFGVPVHSTAQPGLSAALGAATLGAQYASGAAPTAAA
AAAVETPTEMVGAGGLDMTQAAWAAQATDVDDALAWSQDADTSDEPVPYT
GRDATGEYASEARRFDDVAAGGLPWYKRTALVLSVAGAGAAVLIALVLAI
NLLLTKSTQDRPTSPPSTPAPPQTVTITGPNDSTTVTVVPAPPPPSSEAP
PPPATTTTAPPEPSTTTTTTTPPPSSTTTTSAAPTTTAQPSTTSAAPTTT
RVRPIPPIFQPPFGR
118466382YP_883212.1 monoxygenase [Mycobacterium avium 104]MTLTSPAAASAGDLPARPGLRTVAAGSMIGTTIEWYDFYLYATASALVFK
PLFFPNISPSAGTLASFATYAAGFGARPLGAVLSGHFGDRLGRKTVLVAA
LLVMGLVTTAIGALPTYAEAGLAAPALLASLRVVQGLAVGAEWGGAAVLS
VEHAPPGRRGLFGSFTQLGSPAGMLLATSVFFGVRKATGPAAFLGFGWRI
PFLLSIFLVAVGLFVRLRLTDAEVFDRLRSRDELARLPIVQVLRTDARNV
VITTGLRLSQIGLFVLLTTYSLSYLQDSFGKGSGVGLVAVLISSALGFLS
TPGWALLSDRVGRRPPYLFGALASVVALVLFFVAAGTGSAVLVVVAIVFG
VNVVHDAMYGPQAAWFAELFDTRVRYSGSSLGYHIGAVLSGGFAPLIAAS
LLVAGGGRPWLIVGYFAVLAAITVGAACAGPGDARGADRMSAARRIYLNA
FDMACVGHQSAGLWRHPDDQGHRYRELSYWTELARTLEAGGFDALFLADV
LGVYDIYGASRDAAVVDAAQFPVNEPSAAVSAMAAVTETLGFGITLSLTY
EQPYALARRLSTLDHLTGGRVAWNIVTSYLDSAARNLGLDAQIPHDQRYE
IADEYLEVCYKLWEGSWEAGAVLRDRQRGVFTDPAKVHDIEHKGRYFSVP
GPFLCEPSPQRTPVLFQAGASPRGIRFAAAHAEAVFVSGPTAQVVREPVR
ALRTAAAQLGRDPRAVKVFTMVTPVVAETHDAAVAKLAEYRRFVSPRGAL
ALFGGWTGVDLAELDPDEPLTYVETDANRSALASFTTAGRAWTVAELAAE
IGIGGRGPVLVGSPTEVADELERWVDDADVDGFNVAYVTTPGTFVDFAKF
VVPELRRRGHVPEQVPGSTLRERLGAAGPLLGDDHPGAAYRLRRDR
118466381YP_883635.1 endonuclease IV [Mycobacterium avium 104]MCGGFFVPPGLSAEREINFTLGAQRETTFTLGAQRETTFTLAGVAGLGGR
RRARGRRRARGRRRASGHLTRLADVLIGSHVRNDDPLAAAQADGADVVQF
FLSNPQSWKKPQPRDDAEALKASSVPLYVHAPYLINVASANNRVRIPSRK
ILQDTCDAAAEINATAVIVHGGHADDNDMEAGFERWVKALDYLETDVQVY
LENTAGGDHAMARHFDTIGRLWDRIGDKGIGFCLDTCHAWAAGEALIDAV
DRIKALTGRIDLVHCNDSRDAAGSGADRHANFGTGQIDPDLLVTVVKAAA
APVICETADEGRKDDIAFLREHTKS
118466380YP_881640.1 hypothetical protein MAV_2447 [Mycobacterium avium 104]MSYETDRNHDLAPRQIARYRTENGEEFEVPFADDAEIPGTWLCRNGMEGT
LIEGDLPEPKKVKPPRTHWDMLLERRSIEELEELLKERLEIIKSRRRG
118466379YP_880156.1 peptidase- M24 family protein [Mycobacterium avium 104]MSVEVCPDERTLRSGRRRRALDQMAAHDLDVLVLGRQANVRYVSGAPQLW
VAGTRPFGPTCVLVRETGAVHLLSTWDEGVPEDIPHENLYGISWNPANTV
AALRRIDGTQTARRVGTDALSPVFAQLLPTVFPNAQLVDGELAMRAARRV
KTAEEMVALRESIAVAESALAAAVSELRPGVSEQALAGVLLEASAAGGVS
TPSNQDVAWATSRSHPWRRADGDGRIQDGDLVAFSAGVLAGGYVGEVGRT
WPADKKHAPSGAEALHRRWDALWDKLIAACHPDVRADELMTAYRAAGEPA
PPMPVARGLGMGFDPPVVSQHLPATAAGERLEPGMVLAVTGYVWEEGVGA
VFGREAVLITADGPEVLTASPFWQP
118466378YP_882979.1 2'-hydroxybiphenyl-2-sulfinate desulfinase [Mycobacterium avium 104]MLSGAQAGLHFTYDHPAYTRFGGEIPPLISEGLRAPGRTRLLGITPLAGR
QGIYVRADSPVTSPEQLRGRRVGVSGAAIRILTGELGDYRQLDPWRQTLI
ALGTWEARGLLQTLHIGGIGISDVELVRIESPGVDVPEERLEAAASVKGA
DLFPDVAAHQSDILSSGNVDALFTWLPWAAELEDLSGARVLADLGDDKRN
RYASVWTVSAQLVDERPDLVQRLVDAAVQAGRWAQAHPEDTVGIHAANLG
VAPSAIGRGFGADFAQHLIPTLDDSALAVVDQTQQFLIDHNLLDRPVDLT
QWAAPQFLTQSATGEQQ
118466377YP_882818.1 3-ketoacyl-(acyl-carrier-protein) reductase [Mycobacterium avium 104]MPRSSEGPLTGKVAFITGAARGQGRAHAVRLAADGADIIAVDLCDQIASV
PYPLATPEELAATVKLVEDIGSRIVARQADVRDRESLSAALQAGLDEFGR
LDIVVANAGIAPMSAGDDGWHDVIDVNLTGVYHTIKVAIPALVKQGTGGS
IVLISSSAGLAGVGSADPGSVGYVAAKHGVVGLMRVYANLLAGQMIRVNS
IHPSGVETPMINNEFTREWLAKMAAATDTPGAMGNAMPVEVLAPEDVANA
VAWLVSDQARYITGVTLPVDAGFLNK
118466376YP_883917.1 orotate phosphoribosyltransferase [Mycobacterium avium 104]MAEPELEELAELVRRLSVVHGRVTLSSGKEADYYVDLRRATLHHRASALI
GRLMRELTSDWDYAVVGGLTLGADPVATAIMHAPGRPIDAFVVRKSAKTH
GLQRLIEGSEVAGKRVLVVEDTSTTGNSALTAVRAVQQAGGQVLGVATVV
DRATGAAEAIEAEGLPYRSVLGLADLGLG
118466375YP_883551.1 hypothetical protein MAV_4416 [Mycobacterium avium 104]MHTIEADYLVVGAGAMGMAFIDTLVTETAASQARVVVVDRHHAPGGHWTI
AYPFVRLHQPSAFYGVNSLRLGGDSIDQIGWNRGLYELATADEICAYYDR
VMRTRLLPTGRVRYFPDSEYRGDGRFRTSAGADHTVEVTRRIVDATYMHV
SVPAMRPPPYTVGDGVDCVPPNELPRRPGYQRYVVVGAGKTGIDTCLWLL
GQGVEPDRLTWIMPRDSWLLDRATMQPGALFAEQIKHSFTAQLRAINEAG
SVAELFSRLEAAGLLLRIDPAVRPTMYRCATVTRLELEQLRRITDVVRLG
HVRSIEPGAMVLDGGAVAVDGRALYLDCTADGAEKRPATPIFTPGRITLQ
SVRGCQQIFSAALIAHVEAGYGDDARRNELCVPLPHPDTDVDWLRLALAD
YTNQLRWFDDPELMTWLSGARLDLFGHLIGHLLPSASAKPRVRARILGIA
KSVFAATAARLGELLAAEAALAAS
118466374YP_883247.1 aldo/keto reductase [Mycobacterium avium 104]MKYVDVDGVGRLSRIGLGTWQFGSREWGYGDSYAAGAAGDIVRRALALGV
TLFDTAEIYGFGKSERILGDALGEQRAEVAVASKIMPVAPFPAVVRQRAR
ASARRLGLDRIPLYQVHQPNPVFPDSVIMPGMRDLLDSGEIGAAGVSNYS
LQRWRKADAALGRPVISNQVHFSLAYPKALKNLVPFAERENRIVIAYSPL
EQGLLGGKYGVDNRPGGVRAVNALFGTENLRRIEPLLQLLRDVAAQVDAK
PAQVALAWLISYPGVVAIPGASSVEQLEFNVAAADIELPAESRDALTDAA
LAFRPTSAARFLTDLARERIPGRG
118466373YP_880257.1 ThiS family protein [Mycobacterium avium 104]MGRAPVQANGISVTVRYFAAARAATGAESETVVVRPGTTVGELVERLAVR
GSRLAEVLSRCSYLCDGIAVRDETQSLRSGDTIDVLPPFSGG
118466372YP_883067.1 hydrolase- nudix family protein- putative [Mycobacterium avium 104]MTSPEEAPLVPRPAATVMLVREAPTGLKVFLMRRHSRMEFAAGVMVFPGG
GVDERDRNADLGGLGAWAGPPPQWWAQRFGIEPDLAEALVCAAARETFEE
SGVLFAGPAGAPDSIVGDASVYRDARRALADGTLSFADFLRTEKLELRSD
LLRPWANWVTPEAERTRRYDTYFFVGALPQGQRADGQNTESDRAGWTTPE
AALEDFSAGRTFLLPPTWTQLDSLAGRTVADVLAVQRQIAPVQPHVEIRG
DNWVFEFFDSDRYHRAREAGGLGWRH
118466371YP_883908.1 peptidase- M50 family protein [Mycobacterium avium 104]MSFRAPQHESVRPSPIFLALLGLTALGGALAWLAGSSPRPLAYLGVFVFV
IAGWLVSLCLHEFGHAVTAWRFGDRDAAVRGYLTLDPRRYSHPALSLVLP
MVIIALGGIGLPGAAVYVQTWFMTPARRTLVSLAGPAANLVLAAVLLALT
RAFFTADHAVLWAGVAFLGFLQLTAVLLNLLPIPGLDGYDALEPHLSPET
QRALAPAKQWGFFILLFLLLAPGLNRWFFGIVYWLFDFSGVPHWLAGAGN
VLTRFWSRWV
118466370YP_883133.1 camphor resistance protein CrcB [Mycobacterium avium 104]MTTAAVWVGVALIGGVGSVLRFVVDGAVARRVSRPFPLGTLVVNLSGAAL
LGFLGGLALSREAALLAGTAFVGAYTTFSTWMLETQRLGEERQLRAALAN
VVVSVVLGGAAAFIGQQLAQLV
118466369YP_881216.1 hypothetical protein MAV_1997 [Mycobacterium avium 104]MSHRLTRHAVPRSANRSTTKEIVMPSPAPPRSGRPRRDRNPLALIAKPLL
GAALAAAVATAWPATAGADPDPGGAANPFGGLSCGCSGTRPAGDPAQIDH
GLRQGLSDGRPASSPERPPG
118466368YP_880723.1 transposase- Mutator family protein [Mycobacterium avium 104]MSVMDVKRPPRDPSSQPSTESSRSPTMTAPHIVDPAGLLGEALAEASPDL
MRSLLQTVINALLSADADAVVGAEWGQPTPGRRAQRNGYRHRGLDTRVGT
IDVAVPKLRKGTYFPDWLLERRKRAESALITVVADCYLAGVSTRRMDKLV
KTLGIDSLSKSQVSRMATDLDEHVEAFRHRPLDSAGPFTFVAADALTMKV
REGGRVVNGVVLLATGVNGDGHREVLGMRVVTSETGPAWNEFFADLVARG
LAGVRLVTSDAHAGLREAIAANLPGAAWQRCRTHYAANLMSICPKSMWPA
VKAMLHSVYDQPDAPAVAAQFDRLIDYVTDKLPAVADHLATAREDILAFT
AFPKDVWSQIWSNNPAERLNKEIRRRTDAVGIFPNRDAIVRLVGAVLAEQ
NDEWAEGRRYLGLDILTRCRLTTITDDNPDIGANDMPALTA
118466367YP_882110.1 PPE family protein [Mycobacterium avium 104]MDYGAFPPEFNSARIYSGPGSGSLVAAASAWSSLAAELNAAALSYDKVVT
ALASEEWLGSASASMASAVAPYVGWMSTTAAQAEEAASQARAAAAAYEAA
LAASVPPPLIAANRMQVSQLQATNVLGQNTPLIAQLEAQYGEYWAQDAAA
MYSYAGQSASASKVTPFQKAPQVTNPSGQAAQSAAVSTATANSTSTNTTK
ALQSLAQPASSSTTATKAATTAASTTSTDPLSEIWFLLTGQTSLPTNLGT
LVNGYSPFAGLFYNTEGLPYFSTGMANTFTQIAKSVGAIGGAAPAAAKAL
PGLGGLGGMLGGGAAAAHPVAALGGAGSIGGKLSVPVAWSGAPATPALGH
AIPVSSISAAPEAAGGPGNLLGGMPLAGAGAGGHGAAGPKYGFRPTVMAR
PPFAG
118466366YP_882744.1 methionine-R-sulfoxide reductase [Mycobacterium avium 104]MTSPKVQLTDDEWRQRLTPEEFHVLRQAGTERPFTGEYTDTKTEGVYQCR
ACGAELFRSTEKFESHCGWPSFYDPANSDAVILLPDHSLGTTRTEVLCAN
CHSHLGHVFTGEGYPTPTDQRYCINSICLRLVPS
118466365YP_881760.1 acetyl-CoA hydrolase/transferase- putative [Mycobacterium avium 104]MNPLTRVDFTAALRAALRPGMTVVLGDGVGALGCLDDGGSVGAALSAAAR
EVGSVRLVLGWLPAPIDGLDADAFGEVVALMPGWGVREVLRSPKARFLPT
RLAAIPALLADVLRPDVLLTRLVRRDGLLHFSTEVSWQRTVTDSGTRTLA
IIDTSAPAAAAEPGLGPPGLEVLGTVRGGPLRVPQREPEPIHEALADAVL
RLLPEGARIQYGPGQLGTALLRRAQVPLHIDTGLLTDAVVDLDRRGLLAG
TPSATYLLGSDALYDWADGRRILRGLDYTHDLTRLSRGAPLVAVNTAIEI
DQYGQVNVEGVRDKVVGGIGGHPDYCAAARVSSGGLSIIAVPTRVNGRSP
LVEQLSRPTSTPAHDVDLIVTEAGYVDLRAADWPQRRTLIAELFTE
118466364YP_880124.1 short chain dehydrogenase [Mycobacterium avium 104]MADNSLTDRTVVISGGSRGIGLAIGIAAARRGANVVLLAKTDTPHPRLPG
TVHTAAADVEAAGGKALAVIGDVRREEDVRRAVEATVQRFGGVDVCVNNA
SAIAVEPTAELSAKKFDLMQEVNIRGTFLLTKACLPHLRRAANPHVLTIS
PPINMNPRWLGAHPAYTLSKYGMTLLSLGWAAEFADDGIGVNCLWPQTYI
ATAAVANMADGDKLAESSRSPEIMADAAVEIVSRPAREATGDCYIDAEVL
HSAGVDDLSVYGGGEQPIPDLFLD
118466363YP_883808.1 methoxy mycolic acid synthase 1 [Mycobacterium avium 104]MPRMTGLEPYYEESQSIYDVSDEFFALFLDPTMAYTCAFFERDDMTLEEA
QTAKFDLALGKLNLEPGMTLLDIGCGWGGALKRALEKYDVNVIGITLSRN
QFEYSKKLLAGFPTDRNIEVRLQGWEEFDDKVDRIVTIGAFEAFKMERYS
AFFDRAYDILPDDGRMLLHTILTYTQKQQHERGVSITMSDLRFMRFIGQE
IFPGGQLPAQEDIFKFGEAAGFSVERVQLLREHYARTLNIWAANLEANKD
KAIAIQSQAVYDRYMHYLTGCENFFRKGISNVGQFTLVK
118466362YP_882854.1 30S ribosomal protein S15 [Mycobacterium avium 104]MALTAEQKKEILGTYGLHDTDTGSPEAQVALLTKRIADLTEHLKVHKHDH
HSRRGLLLLVGRRRRLLKYVAQIDVERYRSLVERLGLRR
118466361YP_882457.1 beta-lactamase [Mycobacterium avium 104]MDARVDRRAVRVHDDLDAGHRVSGAADSHFGCVVRSFASMFPARRFGGGA
LAVYVDGQPVVDVWTGWADRAGQRPWSENTAPMVFSATKGMAATVIHRLV
DRGLIDYEAPVAEYWPAFAANGKANMTVRQVMRHQAGLSGLRGATKEELL
DHLVMEERLAAAAPGRLLGKSAYHALTFGWLMSGLGRAVTGKGMRTLIRE
ELAEPLGTDGLYLGRPPAGAPTRVAEIVAPQNLVGSSIVNYVSRKVANQL
SGGFRAMYFPGMIAAVQGDTPLLDAEIPAANGVATARGLARMYGAIANGG
EVDGIRFLSRDLVAGLTGERSLRPDRNLYVPLAFHLGYHSVPIGGVMPGF
GHVGMGGSLGWADPASGVAFSLVHNRLLTPLVMTDHAAFVGIYALIRRAA
EQVRKHGFRPVTEFGAPFREPGAVAG
118466360YP_880203.1 3-oxoacyl-(acyl-carrier-protein) reductase- putative [Mycobacterium avMKTAVVTGGGSGIGLAVVERLRADGLNVASIDLRPSDAELAFTADVTDRS
QVDAALSAIRAQLGPVTVLVNAAGLDGFKKFNNITFEDWQRVIDVNLNGV
FHTTQAVLPDMIEAGWGRIVNISSSSTHSGAPYMSHYVAAKSAVNGLTKS
LALEYGPKGITVNAVPPGFIDTPMLRAAEKNGFLGDIEETIARTPVRRMG
TPQDIAAACAFLVSEEAGYITGQILGVNGGRNT
118466359YP_881107.1 ISAfe7- transposase OrfA [Mycobacterium avium 104]MPKEQSPGKPTTRRYSAEEKAAAVRMVRTLRAELGTEQGTVQRVARQLGY
GVESVRTWVRQVDIDEGLAPGVTTSESKKVKELEQEIRELKRANEILKRA
ASFFGAELDRQHKK
118466358YP_883652.1 DGPF domain-containing protein [Mycobacterium avium 104]MQYFALLISREQERKPDDAAAAMAAWESFHAKAGPAIKAGDALAPAAAAA
VITGGPDAPVVTDGPFAETAEVACGYYIFEAENLDEALALARDVPVAAFG
AVELWPVVHAVEPSRRITGNDWLALLLEPAESAHTPGTPEWEAVAAKHAE
LHAAAGDHIIGGAALHDKSTATTVRVRDGEVLITDGPYVESAEIATGIYL
LGAADRDEAVKIASMIPASTVQLRQLAGVSDL
118466357YP_880131.1 AMP-binding enzyme [Mycobacterium avium 104]MTEPAALVFEERRFSVPELDALADGWAAALAKDGVTAGRRVAVMTSNRPE
FLAVLLAIWRLAATAVLISPAWKRDEVEHALALTDPGHAVGDHPVLAGLM
PMLHLDEPVPPAQPTAGAPPRAGDAVLVFSSGTTGLPKAVRHTHASLDEA
VRHWREALRLTRRDRIQVATPPSHILGLLNLLTALKTGACVRLHPRFDID
KVLHHIESDRVTVEMAVAPIALAIASHPDLESYDLSSLRYIVWGATPVNA
EVAQTVTRRTGVGWLPAYGTTELPVIACNPIEDARLDTVGRPVPGVEVRV
VSLESGEPAGAGEVGEIQARSASLMAGYLPGEATGEAIRDGWYRTGDAGW
LDTGGWLRITDRLKEMIKVRGFQVAPAEIDAVLQGHPAVADCAVFGVPDG
LNGEAVVAAVAVSAPVDVTELTALVRQKLASYKHLSRVVVVPEIPRLPSG
KVLRRVLKERHGCTSDS
118466356YP_882522.1 phosphoglycerate kinase [Mycobacterium avium 104]MAVHNLKDLLAEGVSGRGVLVRSDLNVPLDSDGEQGRITDPGRITASVPT
LSALVEAGAKVVVAAHLGRPKNGPDPALSLAPVAAALGEQLGRHVQLASD
VVGTDALARAEGLTDGDVLLLENIRFDARETSKDDAERLALARQLAELVG
PTGAFVSDGFGVVHRKQASVYDVATLLPHYAGTLVAEEIAVLEQLTGSTK
RPYAVVLGGSKVSDKLGVIESLATKADSIVIGGGMCFTFLAAQGFSVGKS
LLETEMVDTCRRLLDTYVDVLRLPVDIVAADRFAADAAPQTVPADAIPDD
LMGLDIGPGSVKRFTALLSNAETIFWNGPMGVFEFPAFAAGTKGLAEAIA
AATGKGAFSVVGGGDSAAAVRALGIPESGFSHISTGGGASLEYLEGKALP
GIEVLGRPQPTGGAA
118466355YP_879787.1 DNA-binding protein [Mycobacterium avium 104]MKTTVQIYGLRVNQARVMRAMTVTAVMEALGWKHSRLNRLEKSTTALVPV
EDFDRLVEVLRFPAKFFTTAPTSRVHPSDLLFRAPRSITVSEREYLAQFA
ALAGEFLDELDSRAQLPPVRLPVLPSHTPVAKAAEVVRQALGFDVDVPIE
YLTHEVERSGVVIVVRRLLTSSSRRVLGDEDSTGKLDKHLGYSVRVGEFN
TRPLIVVRQSNSWERTRWTLAHEVGHLSLHASGGVTEEREEQASAFASEL
LAPAGVLAEEVSRAPSLAELLPVKAKWGISLGALLRHLHVSGLLASDRFE
ALRRQLYTRVNAETDTTWGRVEPGWNDRDVERPLLISRWLDIAFSARSAA
MLAPYELMWPQDVLEDFMAGQRGATGTHTHGAEERVPALAGRHDNVIVLS
QRGNRRG
118466354YP_882444.1 glycosyl transferase [Mycobacterium avium 104]MAVPPNLVDLAEAAGLSAIAYGPDMHDFWSDEFIRDFFKNFLRGPVTLIR
EAWEPVLKNWQEMSSALMSVGAGADLLFTGQLYQDLAINVADYYGIPMAT
LHYIPMRPNGQLLPRVPGPLVRTGMAVYDWMCWRMNKKAEDRQRRELGLP
TATVASPRRIAERGSLEIQAYDEVCFPGLAEEWAKWGGQRPFVGSLTMEL
PTDFDDEVLSWIGQGTPPICFGFGSMPVAESPADTVEMIGAACAELGERA
LICSGWSDFSNVPHPDHVKVVGVVNYTKIFPACRAVVHHGGSGTTAAGLR
AGIPSLILWTAGDQPLWGSHIKRLKVGTSRRFSATTPETLVADLRKILAP
EYLTRARELSSRMSKPAESAGRAVDLLEEFARSGRCIPRAEAQRSR
118466353YP_882297.1 arginine repressor [Mycobacterium avium 104]MTRSKSAPETTRAARQARIVAILSSAQVRSQSELAALLADEGIEVTQATL
SRDLEELGAVKLRGADGGVGVYMVPEDGSPVRGVSGGTARLSRLLSELLV
SADASANLAVLRTPPGAADYLASAIDRAALPYVVGTIAGDDTVFVAARDP
MTGAELADTLEKLT
118466352YP_881889.1 ISAfe7- transposase OrfA [Mycobacterium avium 104]MPKEQSPGKPTTRRYSAEEKAAAVRMVRTLRAELGTEQGTVQRVARQLGY
GVESVRTWVRQVDIDEGLAPGVTTSESKKVKELEQEIRELKRANEILKRA
ASFFGAELDRQHKK
118466351YP_880500.1 3-demethylubiquinone-9 3-methyltransferase [Mycobacterium avium 104]MPSITPSLWFDDNLEEAATFYTAVFPNSHIEGFNRTTEAGPGEPGTVLSG
SFVLDGSRFIGINGGPHFRFSEAVSFTVHCKDQDEVDYYWDRLSDGGEES
QCGWLKDRFGLSWQIVPDRLFELIGDPDRSRAAAATQAMYGMRKIVIAEL
ERAAASS
118466350YP_880194.1 nitroreductase [Mycobacterium avium 104]MMSTARTIRRFTDEPVDDATLARCLGAARWAPSGANAQGWRFVVLRSPEQ
RAVVAKAAAQALEVIEPVYGMSRPAPDDHSRRARTYRATYELHDRAGEFT
SVLFAQAHYPTASELLLGGSIFPAMQNFLLAARAQGLGACLTSWASYGGE
QLLREAVGVPEGWMIAGHIVVGWPKGKHGPLRRRPLAEFVNLDRWDAPAD
GLLSGL
118466349YP_881699.1 universal stress protein family protein [Mycobacterium avium 104]MAASSKRCGVLVGVDGSPASNFAVCWAARDAAMRNVPLTLVHMVNAATVW
PQVPMAAEAVAWQEDDGRRVLQEAVKIAEDATRNGRNLAITTELWHAPPA
PTLAQLSEEAELVVVGSTGRGAIGRLLLGSVSSGLVRRARCPVAVIHDED
PMMPYPQRAPVLVGIDGSPASELATAIAFDEALRRGVDLNAVHAWSDTQV
FGLPGMDWPAVRSQAERSLAERLAGWQERYPDVTVHRMVVCDRPARQLIE
QSESAQLTVVGSHGRGGLAGTLLGSVSNAVVHSVRMPVIVARPS
118466348YP_882235.1 oxidoreductase [Mycobacterium avium 104]MADPRTDPFEKLVALLNYPMFVVTTQSDGTPAGCLVGFASQASIHPPRFL
VGLSRRNHTFRTARDATHLAVHVFDHDHLDVAELFGSQTSDKVDKFDRCS
WHPGPHRLPILDDAAAWFAGEILDRFSLGDHVGHLLAPVDGSPPRQLESW
VSFGDVRHLEPGHEA
118466347YP_882203.1 carveol dehydrogenase [Mycobacterium avium 104]MITGAARGIGRAQAVRFAQEGADIVALDLCGPVDTVMVPPSTPDDLDHTA
SLVGEVGGRMHAELVDVRDLDGVQAATERGARRFGGLDVVCATAGITSRA
MTVEMNESVWRTMLDVNLTGVWHTCRAAAPHLIARGAGSMILTNSIAGLR
GLVGVAHYTAAKHGVVGLMQSLAHELAPHRVRVNCVHPTNVDTPLIQNDT
VRSAFRPDLDRPPTRAEFAEAARAMNLLQVPWVDPVDVANAALFLASDEA
RYITAVTLPVDAGATQR
118466346YP_881588.1 mce related protein [Mycobacterium avium 104]MPNSFELDGRGPSDRQLFGIGIAVLVVSALLTTVMLVKSTGRLDDYVRVV
ADLVNVGDGLPQKSDVKYHGVLVGMVDDVVPAAHGKPNYVHINLKEDYAK
SIPASVTARVVPSNVFAVSSVQLVGNGPGSKIRDGAHIPEDKRLPTVLFQ
TTVSKLRDLLAAAGRGRDDRSVGILAALGAATDHRRVSLLNAGAQLNRLL
DQLNSIVSTDTGPSTVSALLDATRGLAQTAPDLLDALHQAVEPMQTFAET
RGQLASLLSGADYTVGTTRQSFDNHIDQLIRITADFTPVLGVLAQKSNNF
VPAVTKLDNLANQFMEQVWNPQTNLGNMRAMLTFTPSSTYTRADCPHYGE
LKGPSCFTAPLIPVRPDLPDVLLPQNYQPPKDLAPPPGTVIGPDGNLVAV
GPPLINPTPNLTDPNPPLAPGITPSPPVPGSANPDNPSPGAPATPQPQQP
WVAPVAPKAPWIPQSSFRPSFGGNVGPVGSQYERTMLGAITGGPASEATQ
LLLGPVARGTTVSLAHPPGPSPAPRPGEGK
118466345YP_882670.1 CDP-alcohol phosphatidyltransferase [Mycobacterium avium 104]MSKVPFLSRAAFARLTTPTARACLRLGLTPDVVTVAGTIVAVAGALILFP
IGELFVGTLVVWFFVLFDMLDGAMARERGGGTRFGAVLDATCDRVSDGAV
FGGLLWWVVFGLHDEPLAAATLICLVTSQVISYIKARAEASGLRGDGGII
ERPERLIIVLVGAGLSDLPGYPLPWALPVAMWALAAASLVTCAQRLHTVR
TSPGATDRGSDAP
118466344YP_883520.1 30S ribosomal protein S9 [Mycobacterium avium 104]MTETTEALENPDNPDAETAAAEVTEAPVEAVPAESYVFERPIQTVGRRKE
AVVRVRLVPGTGKFNLNGRTLEGYFPNKVHQQLIKAPLVTVDRVDSFDIY
AHLHGGGPSGQAGALRLGIARALILASPDDRPALKKAGFLTRDPRATERK
KYGLKKARKAPQYSKR
118466343YP_882905.1 phosphatidate cytidylyltransferase [Mycobacterium avium 104]MATSDPGAGDEPEHAVENTTEGAAGQRAKKKTSRAGRDLRAAIAVGAGIG
AVLIVTLVFAPRFWVPIVAMAILVASHEVVRRLREAGYVIPVIPLLAGGQ
LTVWLTWPFHAAGALAGFGVTVVACLFWRLFMQDNRKRPEPFAGSPSANY
LRDASATVFLACWVPLFASFAALLVYPADGAGRVFCLMITVVASDVGGYA
VGVLFGKHPMVPAISPKKSWEGLAGSLVLGITAATLAATFLAGKAPWVGA
LLGVVLVFTCTLGDLVESQVKRDLGIKDMGRLLPGHGGLMDRLDGVLPSA
VAAWTVLTLVP
118466342YP_882440.1 glycosyltransferase 28 [Mycobacterium avium 104]MRFALASYGTRGDIEPSAAVGRELLRRGHDVRLAVPPELVGFVESTGLAA
VPYGPNVQEFLDEEFLRNMWRDFFRNPIRLVLKVWDPIIKYWAEASATLK
SVAEGADLLSTGLNFEQAAANVAEYYDIPLASLHHFPMRANGQLVPNMPS
PLVRSTMTAIEWLFWRSTKKVDNAQRRQLGLPKATRRSQRRIAERGWLEI
QAYDEVCFPGLAAEWAHWGDRRPFVGALTMELPTESDDDVASWIAAGTPP
ICFGSGSIPLESPTATVEMIGAASARLGERALICFGGTDVRGVPRFDHVK
VVGPVNYASVFPACRAVVHHGGSGTTAASLRAGIPTLALWSSADQPYWAA
QIKRLKVGTARRFSATTSETLAADLRTILAPDYATRARDLAARMTKPAES
IETTADLLEEAARRKTLG
118466341YP_881672.1 phospholipase- patatin family protein [Mycobacterium avium 104]MRADLVCEGGGVRGIGLVGAVDALAAAGYRFPRVAGSSAGAVVASLVAAL
QTAGEPLSRLTDIMRTIDYRKFLDRNLIGHVPVIGGGLSLLTSDGVYRGA
YLEQLLAGLLGDLGVRTFGDLRTGEAPEQFAWSLVVTASDLSRRRLVRIP
WDLGSYGIDPDDFPVARAVHASSAIPYVFEPVRVGGATWVDGGLLSDFPV
ELFDRPDGQPQWPTFGIRLSARPGIPPTHPVHGPVSLGIAAIETLVSNQD
NAYIDDPCTVRRTIFVPAEDVSPIDFDITAQQREALYERGRQAGQQFLQT
WNYADYLKACGGPVPETP
118466340YP_883333.1 hypothetical protein MAV_4188 [Mycobacterium avium 104]MSGQCSDDIERIANRLGFGCEHAAPWVTLRNPFGLANWTLPVLELLMVAG
AVLALWWAIRRLRRDRDPVNIVIWFATVIYLLIVEPPLYFPTVFRVDSTI
GAVFAHNVFTVQFMYDRLPLYIVGLYPAMLTLAYEVVRSLGVFRDWGAIV
GAVCVGFVHNCYYEIFDQLGPQLRWWAWNADNAINRPMLASVPLSSVLLF
ATVGPACVALFAQLLVTRPIERGRRLSRIALTGRTFGVAVLVPVGLVVAN
VPILLTGGQHPDGGLRRALYFALLGVFAVVAIPVLLRQWRNAAFTPSAPN
TFVAIFGSAYLLVLGSLWVSAMPAYLNAAHGLTRDGTPTGSLAYALVCFV
LAVALTVSVTVPVGRLSALLRRPDRREVMP
118466339YP_882315.1 hypothetical protein MAV_3131 [Mycobacterium avium 104]MTAYAAQLLEIGEPNDELTLQRLRAEPCVEFIDRLDAQLANLGSLRPAPP
PELLTEPGRWAYYPWRRTAVAVLGPRGYRAVRLDRNRHNITPQEQEKLGA
LSIGVAGLSVGHVIAHTLAAQGLGGRLRLADFDHIELSNLNRVPATVFDL
GLNKARVAARRIAELDPYIDVEIFDAGLALDNVDAFLDGLDIVIEECDSL
DIKAALREAARVRRIPVLMATSDRGLVDVERFDQEPARPILHGLMGDLDI
ELLPSMTSREKVRHILGYLEAEQLSSRGAASLIEVDRTLSTWPQLASDVV
LGAAALAEAVRRIGLGEKLHSGRTRIDIGSAFDHLDEPHVARHGPVLVDD
HDPLELPGMTGIIAAAAIRAPSGGNVQPWHVQAGPADVTIDIAPQHTSTM
DVGFRGSAVAVGAALLNAKIAAAAHHILGPVKLEEQVDGSLLRATLEMAD
GTDPGLARLYQPMLQRETNRHHGKPEAIDPALVEALSTAAQREGAQLRLL
TQKDQIWRAAILLGESDRIRYLTPQLHQEMISELRWPGDADPDTGIDVRS
LELDAGDLAMLDILRRTDIMAHLAEWNAGSALGDDIRNRLLASSALAAIT
VPGQDLRDYARGGAAVELVWIIAQRAGLAVQPVSPVFLYAHTRTEFEELS
LQFADELMQLERDFRSLVDIPADESAVLLLRFTAGPPTSVASRRSIDRAR
VLS
118466338YP_879538.1 enoyl-CoA hydratase [Mycobacterium avium 104]MAQAYESVTVEKKGHVAQVTLIGPGKGNAMGPAFWSELPELFETLDADPE
VRAIVLTGSGKNFSYGLDVPAMGGSFTPLLSGDALAGPRAVFHREVKRMQ
GAITAVADCRTPTIASVHGWCIGGGVDLISAVDIRYASADAKFSVREVKL
AIVADVGSLARLPYILNDGHLRELALTGKDIDAARAEKIGLVNDVYADAD
ACLAAAHATAAEIAANPPLTVHGIKDVLDQQRASAVAESLRYVAAWNAAF
LPSKDLTEGIAATFEKRPAQFTGE
118466337YP_879350.1 hypothetical protein MAV_0050 [Mycobacterium avium 104]MTGPAPIVADLRAESDALDALVAPLPPGRWADPTPAAGWTIAHQIGHLLW
TDRVALIAVTDEPGFAEVLAGAAADPAGFVDKGAEELAAVAPAELLADWR
ATRDRLHRALLGVPAGRKLPWFGPPMSAASMATARLMETWAHGLDVADAL
GVTRPATDRLRSIAHLGVRTRDYAFAVNNLTPPAEPFLVELRGPRGDTWS
WGPPEAAQRVTGSAEDFCFLVTQRRPLSALDITADGADAQRWLEIAQAFA
GPPGPGR
118466336YP_881297.1 ABC transporter [Mycobacterium avium 104]MGALCAAIEILAAVIPFAQGLGVLGTVPMGLLAYRYRPRALMAATVAGGV
IAFLIAGLGSLFMLVDCAWVGGLCGIVKRKGRGTPTVALLSLIAGVLWGA
GWVAVLAVLTRLRHLFFDVITANANGVAAFLNWMHLQGVGAGLKRYVADG
LQHWPLLIFPYMILLVVVVSFISWSALSRLLDRMRKIPDVHKLDPPDDGH
AAIGPVPVRLENVRFRYPGAEQDALREVSLDIQAGEHVAVTGANGSGKTT
LMLILAGRQPTSGTVHRPGAVGLGDVDGTAIVLQHPKSQVLGTRVADDVV
WGLPPGTDIDVHRLLREVGLDGLAERDTGSLSGGELQRLALAAALARDPK
LLIADEVTTMVDQQGRDALLGILSGLAKRHQTALVHITHYDNEAASADRV
IKLSDSPDNAVAAETNAAAAPAVAVPHGSGVPVLELIDVSHEYASGTPWS
KVALRDVSFVVEQGDGLLIHGGNGSGKSTLAWIMAGLTTPTSGSCLIDGR
PTHERVGEVALSFQSARLQLMRDHVDTEVASAAGFSPTDQDRVAEALMSV
GLDPAMGKRRIDQLSGGQMRRVVLAGLLARSPRALVLDEPLAGLDIGSQR
GLLRLLENLRRERGLTVVVISHDTVGLEELCPRSLYLRDGALQTASTAAG
GMP
118466335YP_884158.1 transposase- Mutator family protein [Mycobacterium avium 104]MVKRPRITTERNIAMALDQSALLEVLDALRTADAGERITQAAETIYQALI
DAELTAFIGASPHERTETRSNQRNGSRPRTLSTVAGDLELRIPKLRTGSF
FPALLERRRRVDQCLFAVVMEAYLHGTSTRKVDDLVKALGTDTGISKSEV
SRICKDLDTEVAAFRDRPLGDQRFPYVFLDATYCKARVNHRVVSQAVVIA
TGVAADGRREVLGFEVGDSEDGAFWTAFLRSLKSRGLAGVQLVISDAHAG
LRSAIDAVLIGAAWQRCRVHFLRNVLAQVPKGSAEMVAAAIRTVFAQPDA
EHVREQLDTIAGMLGRQFPKVETMLREAAADITAFADFPVAHWKKIWSTN
PLERLNKEIKRRTDVVGVFPNPAALLRLAGSVLVEAHDEWQVADKRYLSE
TSLALLDVSDQSAETIAPTAALTA
118466334YP_882920.1 siderophore utilization protein [Mycobacterium avium 104]MAGRPLQSFEVVRTEQLTPHMVRVVLRGKDFDAFVPSKFTDSYVKLAFVA
DDVDVAGLPQPLTLDSFAELPAEKKPSVRTLTVRHVDAASRQIALDVVVH
GEHGIAGQWAATAQPGQPIYLMGPGGAYTPDPAADWHLLAGDESALPAIA
AALEALPPSAVGKAFIEVAGHEDEIPLTAPDGVEVHWVYRGGRADLVPED
RAGDHAPLIEAVTSAPWLPGQVHVFIHGEAQAVMHNLRPYVRKERGVDAK
WAASISGYWRRGRTEETFRQWKKELAQAESAQA
118466333YP_880318.1 hypothetical protein MAV_1064 [Mycobacterium avium 104]MPSDQEDPTMTRAETIRSDARPTGPSREEFSERLLKGSVKKSYEPVVDID
WDAPLDPDKFFLPPRLVSLYGTPMWDEMTREQQIELSRQELVNTLSAGIW
FENMLNQSLLRTILHEDPTSRSTHYKLTELGDETRHMVMFGKAIERVGAK
PVQPKRFHRYIINALPLAFQRGSMLWVAALIGEEIFDSLQRQMMDDPELQ
PIIQRLMRIHVTEEARHIQFARDGARKRVAEMPRLNRWFMANINGLGGYF
FNYLFSNPVPYARAGLDPKRARKTARTSAHRREIQIAGFAPLAAFLTEVG
LMGPLARRGWKRSRFL
118466332YP_882188.1 hypothetical protein MAV_3002 [Mycobacterium avium 104]MSATMRSEVHMDDPLDGMVRAMPEQLNAGFLRVRIYCPRGAPAGDGLLHP
AHGEAPA
118466331YP_883432.1 adenosine deaminase [Mycobacterium avium 104]MTAPLELEQIRKAPKALLHDHLDGGLRPSTVLDIAGQTGYDGLPATDVEE
LATWFRTRSHSGSLERYLEPFSHTVAVMQTPEALHRVAYECVEDLAEDSV
VYAEIRFAPELHINRGMSFDEIVDAVLAGFADGEKACAAAGRPIVVRLLV
TAMRHAAVSREIAELAIRWRDKGVVGFDIAGAEAGNPPTRHLEAFDYMRD
HNARFTIHAGEAFGLPSIHEAIAFCGADRLGHGVRIVDDIDVLADGPDKG
KVRLGRLANILRDKRIPLELCPSSNVQTGAVKSIADHPFDLLARTRFRVT
VNTDNRLMSDTYMSREMHRLVQAFGYGWSDLERFTINAMKSAFIPFDERL
AIIDEVIKPRYAVLIG
118466330YP_884333.1 hypothetical protein MAV_5217 [Mycobacterium avium 104]MWWVEAHGNPELVPVENLHSGDPITDCGQRYIVLESKTLNDCVVLELESR
VDHQLQVIEKSFPTGYHVGRANHRVL
118466329YP_882776.1 hypothetical protein MAV_3599 [Mycobacterium avium 104]MRAKLPSGLELLFCQHHANEHEAKLTELDAVLEVSES
118466328YP_880480.1 transposase- Mutator family protein [Mycobacterium avium 104]MVKRPRITTERNIAMALDQSALLEVLDALRTADAGERITQAAETIYQALI
DAELTAFIGASPHERTETRSNQRNGSRPRTLSTVAGDLELRIPKLRTGSF
FPALLERRRRVDQCLFAVVMEAYLHGTSTRKVDDLVKALGTDTGISKSEV
SRICKDLDTEVAAFRDRPLGDQRFPYVFLDATYCKARVNHRVVSQAVVIA
TGVAADGRREVLGFEVGDSEDGAFWTAFLRSLKSRGLAGVQLVISDAHAG
LRSAIDAVLIGAAWQRCRVHFLRNVLAQVPKGSAEMVAAAIRTVFAQPDA
EHVREQLDTIAGMLGRQFPKVETMLREAAADITAFADFPVAHWKKIWSTN
PLERLNKEIKRRTDVVGVFPNPAALLRLAGSVLVEAHDEWQVADKRYLSE
TSLALLDVSDQSAETIAPTAALTA
118466327YP_884117.1 lysophospholipase [Mycobacterium avium 104]MNRTERSFDGVGGVRIVYDVWTPEVAPRAVLVLAHGFGEHARRYDHVARR
FGAAGLVTYALDHRGHGRSGGKRVLVRDIHEYTTDFDTLVGIATREHHGL
KCIVVGHSMGGGIVFAYGVERPDNYDLMVLSGPAVAAQDQVSPLLALAAK
VLGVIVPGLPAQELDADAVSRDPEVVAAYRNDPLVYHGKVPAGVGRALLQ
VGETMPQRAPALTAPLLVVHGSDDRLIPVAGSRRLVECVGSADVELKVYP
GLYHEVFNEPEREQVLDDVVGWITARL
118466326YP_884294.1 hypothetical protein MAV_5177 [Mycobacterium avium 104]MTSKLSTTLHTAFPDAVDRTTKALADQGFGVLTTIDVKATLKQKLGADME
DYLILGACNPALAHRALGIDRQIGQLLPCNVVVRSDPAEGDAVLVEAMDP
QLMVKVTGEAGALQEVADQATAKLQAAISALAG
118466325YP_880385.1 methyltransferase FkbM [Mycobacterium avium 104]MALARSAKRWLAPAAKRLAPRRFWRRKFRILDRLGRSRPDVQLVASLCDP
HRVSLDIGADLGEFTIAMAASSRSVIAFEPRPAQARDLAAMFDAVGAAVR
VEAVALSDEPGTIAMRVVESEPGRSTIDTDNSLGDLTGDQIRVIDVPVKR
LDDLNLDDVGLVKIDVEGHELAVLRGAAETLARNRPAIVVEAEERHHRGA
VAGITRLLTGLGYSGYFELDGARRPIAEFDPALHQDPANAGSRQDGWTGR
GPYVNNFVFLPDER
118466324YP_882046.1 molybdenum import ATP-binding protein ModC [Mycobacterium avium 104]MSELQLRAVVSQRRFEVEFSVAAGEVLAVLGPNGAGKSTALHVIAGLLRP
DRGLVRVGDRVLTDTAAGIDVPTHDRRVGLLLQDALLFPHMSVAANVAFG
PHSRRPMWRRGRRAEKATALRWLREVDAEPLADRKPRQLSGGQAQRVAIA
RALAAEPDVLLLDEPLAGLDVAAAAAIRAVLRRVVTRIGCAAMLVTHDLL
DVFTLADRVLVLESGRIAEIGPVADVLTAPRSHFAARVAGVNLVNGTAEG
DGALLARSGARWYAAPAAPAGPLASGQRAVAVFPPTAVAVYREQPHGSPR
NTVEVTVAEMDVRGAAVLVRGAQQPDGAPGLAAEITVDAASELRLTPGDR
VWFSVKAHEVVLYPATAAAER
118466323YP_880343.1 acetyl-CoA carboxylase carboxyltransferase [Mycobacterium avium 104]MTVLQSTLDREATAFTDAASAAMAKLEEIDTELANALAGGGPKYVERHHA
RGKLTARERIELLVDQDSPFLELSPLAAWGSSFKVGASTVTGIGVVEGVE
CMIVANDPTVKGGTSNPWTLKKILRANQIAFENRLPVISLVESGGADLPT
QKEIFIPGGRMFRDLTRLSAAGIPTIALVFGNSTAGGAYVPGMSDHVVMI
KERSKVFLAGPPLVKMATGEESDDESLGGAEMHARVSGLADYFAVDELDA
IRIGRRIVARLNWVKQGPTPKPVTEPLFDTEELIGIVPADLRIPFDPREV
IARIVDGSEFDEFKPLYGSSLVTGWARLHGYPIGILANARGVLFSEESQK
ATQFIQLANRSNTPLLFLHNTTGYMVGKDYEEGGMIKHGSMMINAVSNST
VPHISLLIGASYGAGHYGMCGRAYDPRFLFAWPTSKSAVMGGAQLAGVLS
IVARAAAEARGQQFDEQADAAMRAAVEGQIEAESLPLVLSGMLYDDGVID
PRDTRTVLGMCLSAIANGPIEGTSNFGVFRM
118466322YP_880429.1 hypothetical protein MAV_1183 [Mycobacterium avium 104]MVMDAPSPDAIRAETITITGHGGDEIEAYRPEAAAITRTIAHAPAGLAAK
DQ
118466321YP_882968.1 Pra protein [Mycobacterium avium 104]MRIDTSGTRFIVTRAAEPRLNFETGSPKIDTATGLPQHSVQLLALDDTGG
EVLNVTVAGDPNVGVTQPVSVTSLVAIPWAQGDRSGVAFRADAITGATAG
APAGEPGSRTQK
118466320YP_879408.1 hypothetical protein MAV_0112 [Mycobacterium avium 104]MHRGPLIVFAAVVCLAGGLLALRFPVFIDAYDQFGLQVKCGSGFTTELTQ
ASSAVGPAGTNYVDQCGSALMVRRLWAIPTAVLGGMALTWQAAAALAHDH
RRPAPSQSAAQSPS
118466319YP_880324.1 hypothetical protein MAV_1070 [Mycobacterium avium 104]MPAGRSAGRVNRRDTPSLPAARLARRRAAGTLTWLDDWALCVGGRR
118466318YP_881883.1 helper protein [Mycobacterium avium 104]MTTAAKPVAPSSAAPLAADLDAALRRLKLATVRRNAAEVLQVAKTQRWTP
EEILRTLVEAEIAARDASNTANRLKAAAFPVTKTLDGFDVTGSSITAATF
DYLSSLEWIRAQQNLAVIGPPGTGKSHLLIGCGHAAVHAGFKVRYFTAAD
LIEVLYRGLADNTVGKIIDTLLRADLVILDEIGFAPLDDTGTQLLFRLVA
AGYERRSLAIASHWPFEQWGRFLPEHTTAASILDRLLHHASIVVTSGESY
RMRHADHKKGAAKN
118466317YP_881534.1 penicillin binding protein transpeptidase domain-containing protein [MMQGKAIRQPKRRGKANPAEAAPGHSARQRRTRQIAQLTSRGGSFVFRHRA
GNVVMLVAMVVAAAQLFVLQVTNASALRAQAAGQLKVTDVEKAVRGSIID
RHKDQLAFTIESRALTFQPKRIHKQLEEAKSKNPSAPDPQQRLRDIAKEV
SGRLGNKPDSATVLKKLQSDENFVYLARAVDPAVASAISDKFPEVGSERQ
DLRQYPGGSLAANIVGGIDWDGHGLLGLEESMDSVLSGTDGSVTYDRGSD
GVVIPGSYRNRHRAVNGAMVQLTLDDDIQFYVQQQVQQAKNVSGAHNVSA
VVLDAKTGEVLAMANDNTFDPSQDIGRQGDKQLGNPAVSSPFEPGSVNKV
ITASSVIEYGLSNPDEVLQVPGSIQMGGVSIHDAWDHGVMPYTTTGVFGK
SSNVGTLMLAQRVGPERFYDMVRKFGLGQRTNVGLPGESAGLVPPIDQWS
GSTFSNLPIGQGLSMTLLQMTGMYQTIANDGVRIPPRIIKATIAPDGTRT
EEPRPEGVRVVSPQTAQTVRNMLRAVVQHDPMGYQQGTGPAAAVTGYQMA
GKTGTAQQINPACGCYFDNVYWITFAGMATVDNPRYVIGIMMDNPERNAD
GTPGHSAAPLFHNIAGWLMQRENVPLSPDPGPPLTLQAT
118466316YP_883912.1 membrane protein DedA family protein [Mycobacterium avium 104]MSTAVTALPDILDPMYWLGADGVFGSAVLPGILVIVFIETGLLFPLLPGE
SLLFTGGLLAAHPNPPASIWVLAPAVAIVAVLGDQTGYFIGRRIGPALFK
KEDSRFFKKHYVTESHAFFEKYGSWAVILARFAPFVRTFVPVIAGVSYMR
YPLFLGFDIVGGIAWGGGATLAGYFLGNVPFVHHNLEKIILGILVVSLMP
AFVAAWRGYRGRRRPTRTPERESERLPASE
118466315YP_880451.1 hypothetical protein MAV_1205 [Mycobacterium avium 104]MTETRPNERYGRSALSRIPRRWVIAALGVLVVAAGLAVAVVGYHRFGTSD
VKATMVGYRVLDDQTASITISVTRSDPSRPVDCIVRVRSHDGGETGRREL
LVPPSGAATVEVTTTVKSFQPPVVADVYGCGTDVPGYLRPS
118466314YP_880398.1 dimethyladenosine transferase [Mycobacterium avium 104]MASVQRKSWCALTIRLLGRTEIRRLAKELEFRPRKSLGQNFVHDANTVRR
VVSTSGVSRSDHVLEVGPGLGSLTLALLDRGAHVTAVEIDPVLAERLPHT
VAEHSHSEIQRLTVLNRDVLTLRRDELAEPPTAVVANLPYNVAVPALLHL
LAEFPSIRTVTVMVQAEVAERLAAEPGGKEYGVPSVKVRFFGRVRRCGMV
SPTVFWPIPRVYSGLVRIDRYPTSPWPTDPAFRRQVFQLVDIAFGQRRKT
CRNAFVDWAGSGNESADRLLAASIDPARRGETLSIDDFVRLLQRSADRGG
SDREGTSPPTAGQGAPAC
118466313YP_882415.1 DNA polymerase IV [Mycobacterium avium 104]MLHLDMDAFFASVEQLTRPTLRGRPVLVGGLGGRGVVAGASYEARVFGAR
SAMPMHQAKRLVGVSAVVLPPRGVVYGVASRRVFDTIRAVVPVVEQLSFD
EGFGEPAQLAGAPAEDVEAFCEQLRRRVREQTGLIASVGAGSGKQIAKIA
SGLAKPDGVRVVRRAEERELLGGLPVRRLWGIGPVAEEKLHRLGIETIGE
LAALTDAEAANILGATIGPALHRLARGIDDRPVAERAEAKQISSESTFAA
DLTTLEQLREAIEPIAEHAHHRLLRDGRGARTVTVKLKKSDMSTLTRSAT
LPYATTEAAALVGVARRLLLDPREIGPIRLLGVGFSGLSEVRQESLFPDL
EMPAPQSDSQSVETAAEAMFGPGHDAGWRVGDDVAHPDLGHGWVQGAGHG
VVTARFETRTSGPGPARTFPADSAELVRANPVDSLDWPDYVEGLQESSAP
PAENVGGR
118466312YP_883990.1 PPE family protein [Mycobacterium avium 104]MTSPFGPIWMASPPEVHSALLSAGPGPGPLLAAAGAWTSLSAQYATAAAE
LSALLGEAQAGSWEGESAAQYAAAHLPYLAWLQQASADSAGAAAQQEVAA
TAYTTALAAMPTLAELAANHTIHGVLLATNFFGINTIPIAVNEADYARMW
VQAATTMGTYQAVAGSALAAAPRTAPAPSIVKPGGEANNLAANAAQNSSG
DWWQNFIQQLSQFFQNIQKMLQDFWANLPAFLAANGPLLFFVAYQVFFNA
VGWPTWGAILTAPFLLPLLLGIGLSSLLAAPAEIAPVAAPAAITPVLASN
KPPTLPAAVALAPSVATPAGAPASTVAAGSGAAAAPGPAAAAGNFAYLVA
FGGDPDTGVGPTLSGRGGAKAPAATIPAAGAAAPARAEARARRRRRAALH
DYSDEFLDMDSGFGVPPDYGAEEELAAAVASGQGAGTLGFAGTQQRRKAF
QAAGLTKLADDDFGGSPRMPMVPGTWEQDTQNGAHPTEPGKGG
118466311YP_880992.1 competence protein ComEA [Mycobacterium avium 104]MRTELPAERLQRRLRAEPDADAAVQPEEPGPIAGEDFPDDDQNSLLPRWL
PGAPEHRGWVARIRADPGRAGAIGLAIVAALAVLVTVFTLIRDRPAPVMS
AKLPPVEKVSTASPRSSASPSGGPDRPVVVSVVGLVHTPGLVTLAPGARI
ADAVQAAGGAVNGADTAGLNMARPLDDGEQIVVGLAPVPGQPPVLGSSVA
AGSTPAPKPPPGPGAAKAKPKTSDAVDLNTATVQELDALPGVGPVTAAAI
VAWRQTNGRFTSVDQLADVEGIGPARLEKLRALVRV
118466310YP_879753.1 Type II/IV secretion system protein [Mycobacterium avium 104]MSSSLIDRVRERLAGETVPLGAPLPASVVAAAIRAESGGMLGDTEVLANL
RTLQTELTGAGILEPLLCADGTTDVLVTAPDAVWVDDGNGLRRSEIRFPD
EAAVRRLAQRLALAAGRRLDDAQPWVDGELTGIGAGGFAVRLHAVLPPVA
AAGTCLSLRVLRPASQDLAALSAAGAIEPAAAALVADIIAARLAFLVSGG
TGAGKTTLLAAILGAVPPDERIVCVEDAAELAPPHPHLVKLVARCANVEG
VGEVPVRQLVRQALRMRPDRIVVGEVRGAEVVDLLAALNTGHDGGAGTVH
ANNPGEVPARLEALGALGGLDRAALHSQLAAAVLSVGRSGVWLTVSDGEI
RPCACRREQPYL
118466309YP_884101.1 choline dehydrogenase [Mycobacterium avium 104]MQTAIGRAVPFARGRGIGGSSTINAMVFARGHRDSYSRWRDNGAAGWSFD
ELLPYFKRSESTCGKDPSLRGQDGPMAVAPAAHPNPVLVACLCAAIQQGY
PRAADISGGLEVGFGFTDLNIVDGKRQSAADAYLLPALDRPNLEFHSGAT
VHRLRIRGSRCTGVEYTTAEGRQVTAAAREIILCAGAIGSPHLLLASGIG
PPNHLRSFRVDVALELPGVGANLQDHPIVPLVYRAARPVPAGRYNHGELL
GLIRRHATGGPPEIQIFGVDSADVPGLGGADGYVLGVSVMQPVSRGRVGL
SGPTIQEPPAIDPNYLSDDRDMGLMIEGLRIGRKIGMSQALDPWRAEELA
PGDDAVDDAALRSYIQRSVASYFHPVGTCAMGTGPESVVDNQLRLHGIDN
LRVIDASVMPSLPSNNTAATVYAIAERGADLVRLG
118466308YP_882085.1 TetR family transcriptional regulator [Mycobacterium avium 104]MGKRQQSREQIEARIIELGRRQLVDRGAAGLSVRAIARDLGMVSSAVYRY
VSSRDELLTLLLVDAYSDLADTVDRARETAGEQWSDDVIAIARATRRWAV
EHPACWALLYGSPVPGYHAPPERTVAAGTRVVAALFDAVAAGITTGDIRL
TNDPAPQPMSSDFERIRHEFGFPGDDLVIAKCFLLWAGVLGAISLEVFGQ
YGADTLTDVEAVFDAQLRLLVDVLTRH
118466307YP_883469.1 RNA methyltransferase- TrmH family protein- group 2 [Mycobacterium aviMFKLMFVSPRIAPNTGNAIRTAAATGCELHLVEPMGFDLSEPKLRRAGLD
YHDLASVTVHASLAAAWDALTPARVVAFTSHAPASFAELRYRPGDVLMFG
PEPTGLDAATLADPHVTTQVRIPMLAGRRSLNLSNAAAIAVYEAWRQHGY
AGAT
118466306YP_881168.1 hypothetical protein MAV_1949 [Mycobacterium avium 104]MRVAIDPAKCMGHGICYALAPNVFEDDDQGYGHVIGDGEVPQEQAEAARN
GAANCPEGAISVTE
118466305YP_881392.1 beta-lactamase [Mycobacterium avium 104]MAALDALDEWPVGAVAAAVIGPTGVLAGHGDAERVFALASVTKPLAARAV
HVAVEEGAVELDAAAGPPGATIRHLLAHTSGLSMHSDQVLAPPGTRRIYS
NQGFTVLGETLEEETGIEFARYLHEAVCQPLGMTATRLDGGAVAAGFGAT
STVADLAAFAGDLLRPTTVSARLHAEATTVQFPGLDGVLPGYGVQRPNDW
GLGFELRDGKAPHWTGAANSARTYGHFGQAGGFIWADPDIERALVVLTDR
DFGEWALDRWPAISDAVISEYS
118466304YP_882886.1 hypothetical protein MAV_3709 [Mycobacterium avium 104]MPDVLPGYWQRTLALGADPAGEGDIVATLIRRGDDAAPAADHAVLAVHGY
TDYFFHTALADHFAARGFAFYALDLHKCGRSRRDGQTPHFVTDLANYDTE
LERALSVASGGNRRVLVYGHSAGGLIVSLWLDRLRRRNPVAHSAVGGLVL
NSPFLELPGPPILRHSLTVALIAGLSRVRSKGVARSPVQGGYGTTLHRDY
GGEFDYNLQWKPVGGFPITFGWLHAVRRGQARLHRGLDVGVPNLILRSDH
SVQETPDPASMHCGDAVLDVTQIARWAGCIGNRSTIIPVADAKHDVFLSL
PGPRAAAYRQLDLWLDGYLRDRSTESTRAPASRDEG
118466303YP_881733.1 L-carnitine dehydratase/bile acid-inducible protein F [Mycobacterium aMLEVAQFTFVPSAGAVLADWGADVVKIEHPVTGDAQRGLVKVLGAAATVP
GSSFAPIMEAPNRGKRSVGLALDNSEARPLLDELIRRSDVFLTNYLPSTR
KKLSIDVDDVRRINPAIIYVVGSGFGLKGPDRDAGAYDATAFWARGGSAD
GLTSPDATHSPFMPAGAYGDNIGGITIAGAVAAALYGRQATGEPSVLDVS
LLAVGAWTTQFNVNMAMLMGGPLPKVERRTQAPGNPLTGAYRTSDGRFVQ
LSMLQPTRYWPEFCRLMGLHDLAEDPRFTTLDAMAAHSETAQQIVADAIG
KLSFAECQALLRKGRGQWGPVQDAWEIANDEALTANGRIAEIVDAEGHPQ
KLVASPAQFDDDPASLTRAPQFAEHTDAVLRELGIDDDRLIELKIAGVIT
118466302YP_883708.1 transcriptional regulator [Mycobacterium avium 104]MEAVMAMPDSDSLDIHEAGLALDLPDLIFETRAGAGMNQAALAQALGVPR
ASVAAWESGTEVPRVDMLQRLAQVCGKRLHIRIDVD
118466301YP_883971.1 hypothetical protein MAV_4847 [Mycobacterium avium 104]MGEQGGFGFDPDEFDRMIREGSEGLREVFERVSKFVAAPGARTGWSSLFE
DLSRRGRPAPETAGEAGDGVWAIYTVDAGGGAHVEQVFATELDALRANKD
NVDPKRKVRFLPYGIAVSVLDDDPEQPG
118466300YP_880960.1 TetR family transcriptional regulator [Mycobacterium avium 104]MPSVTRTPPGRRSPGREQRREQLERRLLDATERLMRDGASFTELSVDRLA
GAAGISRASFYIYFEDKGHLLRRLASRVFGELTDGARRWWSVAGRHDPDD
VRAAMTRIIATYRRHQAVLVALNEMSGYDPLTAQTYREILTGISGQLTRV
IEDGQADGSIRPRLAAATTASALTWMVERACQQNLPAQPSAYDAELADTL
AEIVWGALYLKPASGS
118466299YP_879833.1 pantothenate kinase [Mycobacterium avium 104]MLLAIDVRNTHTVVGLISGSKEHAKVVQQWRIRTESEITADELALTIDGL
IGDDSERLTGAAALSTVPSVLHEVRLMLDQYWPSVPHVLIEPGVRTGIPL
LVDNPKEVGADRIVNCLAAFHRFQSPAIVIDFGSSICVDVVSAKGEFLGG
AIAPGLQVSSDAAAARSAALRRVELARPRSVIGKNTVECMQAGAVFGFAG
LVDGLVGRIREDVPGFGGDDVAIVATGHTAPLLLPELDTVSHYDQHLTLH
GLRLVFERNRDAQRGRLKTAR
118466298YP_879518.1 arabinosyltransferase C [Mycobacterium avium 104]MAAVAGIAGLLLCLAVPLLPVRQTTATVLWPQGTVDGHVSQITAPLVSGA
PRALDISIPCPAVATLPADGGLVVSTLPPGGMDAGKNGLFVRANKDVVVV
AFRDTVAAVAQRPAVAAGACSVLHAWADAGAAGAEFVGIPGAAGTLPAEK
KPQVGGIFTDLKVPAGPGLSARVDIDTRFITAPTVLKQIVMVLGTLAVLT
AIVALAVLDRRSRGGGTLINWRSPIAWLSRYRPGTHLANWRRVGLATWIA
DAAVLATLLLWHVVGATSSDDGYNLTIARVAPKAGYLVDYYRYFGTTDAP
FDWYLGLLSRLASVSTAGVWMRLPATLAGIGCWLIISHWVLRRLGPGRGG
LAANRVAVFTAGAVFVAAWLPFNNGLRPEPLIALGVLVTWMLVERAIALQ
RLAPAAVAVVVALLTATLAPQGLIAVAALLTGARAVAQAIRRRRASDGLL
APLAVLAAALSLILVVVFRSQTVATVLESARIKYKVGPTIAWYQDWLRYY
FLTVESNPDGSMARRFAVLVMLLCLFGMLVILLRRGHVPGVASGPAWRLI
GTTAVGLLLLTFTPTKWAVQFGAFAGLAGALGALTAFACSRIGLHNRRNL
TLYVTALLFVLAWATSGINGWFYVGNYGVPWYDIQPVIASHPVTSMFLTL
SIITGLLAAWQHFRMDYAGHTEVKDSRRNRVLASTPLLVVATIMVVGEVA
SLTKGAVFRYPLYTTGKANLAAIASGLSPTSCAMADDVLAEPDANAGMLQ
PLPGQTFGPDGPLGGVNPVGFKPDGVGDDLQSDPVVTKPGLVNSDASPNK
PNVAYSDSAGTAGGKGPVGVNGSHAALPFGLDPARTPVMGSYGENSLAAT
ATSAWYQLPPRTPDRPLVVVSAAGAIWSYKEDGTFTYGQSLKLQWGVARP
DGSTVPLAEVQPIDIGPQPAWRNLRFPLAWAPPEANVARIVAYDPNLSSE
QWFAFTPPRVPVTETLQQLIGSQTPVMMDIATAANFPCQRPFSEHLGVAE
LPAYRILPDRKQTAASSNLWQSSEAGGPFLFLQALLRTSTIPTYLRGDWY
RDWGSVEQYFRLVPADQAPDAAIEQGVMTVHGWSRQGPIRALP
118466297YP_882492.1 27 kDa lipoprotein antigen [Mycobacterium avium 104]MSASCHGLARVAVFAVAGATAVSLSACGTSNKSSPTSTSTSTSTVTSTST
SAAPNAEAKVSGLIASVAGNSIQVTKEDNGTAAVNFTSTTKITEAVPAGL
PDVTPGSCVSVKPTEGSAPGQPVTAASVKISQSVNGACPKPHQPTPGGSS
SPAPSLPPSQAPAKPALVRGSVASVSGNTINVTGTDPSGNTTQTTVTVDD
KTKYTKQSSANTDAITPGKCLSARGTNDSGGALQATSIQLRQAVDGKCGK
PKQPGHGG
118466296YP_882225.1 3-ketosteroid-delta-1-dehydrogenase [Mycobacterium avium 104]MTTHSATIPAGLPVADTAVDLLVVGSGTGMAAALAAHELGLSVLIVEKSS
YVGGSTARSGGALWLPASPVLDEANAGDTAERAGTYLDSVVAGSAPPQRS
AAFVAQVSATVEMLRRTTPLRLFWARDYSDYHPEEPGGSAAGRTCECRPF
DTSLLGEYRTRLEPGLMEVTVPMPTTGADYRWMNLVARLPRKGIPVYAKR
LVQGVGGRMLGRRYAAGGQGLMAGLFTGVLRAGIPIWTGTTLTRLTRRGE
RVSGAVVEHGGREVTISARRGVVLATGGFDHRMEMRWKFQSESLGADLSL
GAAGNTGDGIRAGQEIGAAIDLMDQAWWFPAVAPLPGKAPAVMLAERSLP
GCLIVDQHGRRFVNEATDYMSFGQRLLELERSGSPVESMWIVFDQQYRNS
YVFGAELFPRMRIPQAWYDAGIAVRADNLAELGAGIGVPVPEFVETMTRF
NQNAAAGEDPDFGRGRSAYDRYYGDPTVKPNPNLRPLVNGPFYAVRMVLS
DLGTCGGLKTDERARVLREDGGPIAGLYAIGNTAANAFGTTYPGAGATIA
QGLVYGYIAAQEAARPSAAQEAARPSASQPD
118466295YP_881127.1 2-4-dihydroxyhept-2-ene-1-7-dioic acid aldolase [Mycobacterium avium 1MWLASGSGYVTEICAGSGIDWVLLDSEHAPNDLRTILEQLQVLSGYPDVD
VLVRPPSADPVFIKRLLDVGAQNLIVPMIDDAGEAARAVAATRYPPEGIR
GVGSALARASRWNRISDYLATADASVSLTVQVESLAGMEHLGDIAEVDGV
DAVFIGPADLAASMGRLGQPEHPDVVNTIETALAAIVELGKSAGVNAFNK
AIAQRYLAAGASFVLVGADVALLARGAEKLVDEYKEMRS
118466294YP_884222.1 Crp/Fnr family transcriptional regulator protein [Mycobacterium avium MDEILTRSAIFRGVEPGAESLLTEQLQHVHFPRGYTVFAEHEPADRLYII
VSGKVKVGRRSADGRESLLTVAGPSDMVGELSIFNPGPRTTRSRPVEWCK
SGRVSACGSVVATMP
118466293YP_884071.1 AMP-dependent synthetase and ligase [Mycobacterium avium 104]MSISLLLEMAASSNAERTAVVSQDVRLTTQELSDLADGGAAVVAGSNAKH
LVYVGTGGVLLPVLIFTAARAGVAFTPINYRLSAEGIRALIERLPEPLVV
VDARYRDMVGEAPGGVMDSDDFLAAARAAEPAADAFADPDSVAIVLFTSG
TTSQPKAVELSHNNLTSYITGTVEFGAADETDAALICVPPYHIAGVSAAL
SNLYAGRKMVYLPNFDAREWVRLINAENVTTATVVPTMLDRIVTVLENGD
PDTGAPIELPSLRNLAYGGSKVGLPLVRRALELLPHVGFVNAYGLTETSS
TIAVLTPDDHRAALAATTPEAARRLGSVGQAVAGIELQIRDEAGNVLPPG
ETGELFVRGEQVSGRYTGIGSVLDEDGWFPTRDIAMLDDEGYLFIGGRSD
DTIIRGGENIAPAELEEVLVEHPHVRDVAVVGVEDPQWGQAIVAVVVPAA
GVEPDPEELREFVRKSLRGSRTPDEVVFRDELPTTATGKVLRREIIATLA
GLRAAPAQQ
118466292YP_883160.1 NADPH-ferredoxin reductase fpra [Mycobacterium avium 104]MRPYHVAIVGSGPSGFFAAASLLKAADGSEHPDIAVDMLEMLPTPWGLVR
SGVAPDHPKIKSISKQFEKTAADPRFRFFGNVSVGEHVQASELAERYDAV
IYAVGAQSDRALNIPGEDLPGSIAAVDFVGWYNAHPNFEEATPDLSGSRA
VVVGNGNVALDVARILVTDPDVLGLTDIADHALESLRPCGVDEVVVIGRR
GPLQTAFTTLELRELGELDNVDVIVDPAQLEGVTDEDVAAAGKTAKQNIS
VLRDYAKRSPRPGHRRIVLRFMTSPIEIKGDGRVESIVLGRNELVTDETG
RVLARDTGEREELPVQLVVRSVGYRGVPTPGLPFDEKTATIPNTGGRVEG
SRNEYVVGWIKRGPTGVIGTNKKDSQDTVDTLLADLANAGPDGLADFPDD
HADRLADWLASRQPKLVTTAHWELIDAHERAAGEARGRPRVKLPSLAKLL
RVSHG
118466291YP_882894.1 glutamine synthetase catalytic domain [Mycobacterium avium 104]MASEDSALTGSDTAMLSLAALDRLVAAGAPETRVDTVIVAFPDMQGRLVG
KRMDARLFVDEAAATGVECCGYLLAVDVDMNTVGGYAISGWDTGFGDLVM
RPDLSTLRRIPWLPGTALVIADVVGADGSPVAVSPRAVLRRQLDRLAGRG
LFADAATELEFMVFDEPYRQAWASGYRGLTPASDYNIDYAISASSRMEPL
LRDIRRGMAGAGLRFESVKGECNRGQQEIGFRYDEALRTCDNHVIYKNGA
KEIADQHGKSLTFMAKYDEREGNSCHVHLSLRDAQGGAAFADPSRPHGMS
TMFCSFLAGLLATMADFTLFYAPNINSYKRFADESFAPTALAWGLDNRTC
ALRVVGHGAHTRVECRVPGGDVNPYLAVAAIVAGGLYGIEQGLALPEPCA
GNAYRARGVGRLPATLAEAAALFEHSALARQVFGDDVVAHYLNNARVELA
AFHAAVTDWERMRGFERL
118466290YP_883697.1 dihydrolipoyllysine-residue acetyltransferase component of acetoincleaMSELKFLELHGDRVAFRDQGEGEVLLLIHGMAGSSETWRSVIPPLAKKFR
VIAPDLLGHGESAKPRTDYSLGAFAVWLRDFLDELGVSRATVVGHSLGGG
VAMQFVYQHPDYAQRLILISSGGLGPDVGWVLRLLSAPGAELVLPVIAPT
PVLSVGNKLRSWLRGAGIQSPRGAELWNAYSSLSDGETRQSFLKTLRSVV
DYRGQAVSALNRLRLREELPVMAIWGERDGIIPVDHAYAAHEARTDARLE
VLPDVGHFAQVEAPMRVVELIEDFIATGERRDATSPQPG
118466289YP_880488.1 transcriptional regulator [Mycobacterium avium 104]MDGVTELEKGPRGRRRGRGARERILGAAQQLFRERGINNTGMDLLCAAAQ
VSKRTAYQHFGSKDELIAEYLRRLDVDTTSEVFERDDLTPRERLLAVFAT
PPAFTDEPMPLCPFIAAAVEISDPQHPARVRAREYKTSVAARLSETAREA
GAADPELLGEQLALLLDGASVRTRALGSDAFPTAAGIAAALVERAIPPTA
R
118466288YP_883259.1 pyridoxamine 5'-phosphate oxidase [Mycobacterium avium 104]MPVTDDGVEILPVHECWDLLRGLTLGRLVTHADGQPDIFPVNYVVQRRTV
LFRTAEGTKLISAAINNRVLFEVDDHNVAGAWTVIIRGIARSLRTTEEIE
EAERAQVLPWTRSEKTHYVRIVPESVTGRRFRFGSPAG
118466287YP_883443.1 D-alanyl-D-alanine carboxypeptidase [Mycobacterium avium 104]MSTSGALVRSASCLAAALFLAAAPAVSGTASPLGRAEPGAEPNAAPTNCP
YKVNTPPAVDSSEVPTAGDPPMPLAVPAKPVGGDALGSCGIVAAPNTPPL
PGDVSAEAWLVADLDSGAVIAAKDPHGRHRPASIIKVLVAMAAINTLNLN
KAVPGTADDAAAEGTKVGVEEGGVFTVNQLLHGLLMHSGNDAAHALAMQL
GGMQQALEKINVLAAKLGGQDTRVATPSGLDAPGMSTSAYDIGLFYRYAW
QNPTFADIVATRTFDFPGHGDHPGYELENDNQLLYKYPGALGGKTGYTDD
AGQTFVGAANHDGRRLVAVLLHGTRQPIAPWEQAAHLLDYGFATPQGTQV
GSLIAPDPSLAPAKRDGAADRLAGNTAAAGMISSADALPVRVGVAVIGTI
VVFTLIMMARSMNRRPQHR
118466286YP_881565.1 TPR repeat-containing protein [Mycobacterium avium 104]MGREAELRRSLAALSNAEFHGVALVGDAGVGKSTLARMLAKTVESAGRTV
RFALGTQTGSAVPLGAFSHAVSLMAVNEPAVMLAAAHNTLSQDKNLVVVV
DDAQLLDPLSATLVNQLAAWRSARLIVTIRSGEPVLDAVTALLKERLLLT
VHVDPFTREQTELLAGTVLGGPVDPWVVDELLQRSSGNPLLLRGFLTAGR
DTGALFRTAEGWQLRGPLRGDRELHDALEYRLQSLSSEEREVVEILATAG
LLNWDILRDICDAEAVAALERRGLIRLVTDGSHAVAQLTHPMLGEAATRH
AGMVRTRQLNGKLARALQKHERTGSRHLRLPHLQSRIRLAEFMLHSDMEP
DLDVITEAARDALAMSNVQLGEELARFALDRGGGLPAALVLAEAVSWQGR
GEEAGFVLAHAEPDGDDDWLIARWGCLRAANLFWGCGDAEAARREADTVK
KRVSSEAGLHLIDALELSMAFFRGDVETTTELGPGLCESDAVPMATTWAA
VPTCAALAATGRYSEVGRIADIGVRAAMSCGMGLHRFNIGISEIIAATDA
GDDRAAERIYKRYAAMAEGLPGAEAMVDAMLGVVRLARGEFPAACAAFTR
SISLFAKGFPSPWLVVVGAFQAQAEGARGDSTAAAAALWRADRAYGPHAA
VFLPELELARAWERAAAGDTQAATTHATQAAEIARAAGMHAAEMRTRHAA
VRFGDRSQTARLERLARILDTPLAEAAADHARGLTQRDGDLLDAAAQQFA
DLGALACAADAAAQAAGEHARRGDRGKKFESSAWAHALASRYELHTPAVE
AAARPLPFSGRERQIVNLVAAGLSNREIADRLVISVRTVEGHLYRLFTKL
GINSREQLTLLVAREPRGRRELLGHSNPSLGDQDDVHPHAG
118466285YP_880749.1 threonine synthase [Mycobacterium avium 104]MSAQRTAVHQPWPGLIEAYRDRLPVGDDWTPVTLLEGGTPLIPARRLSEK
TGCTVHLKVEGLNPTGSFKDRGMTMAVTDALARGQQAVLCASTGNTSASA
AAYAARAGITCAVLIPQGKIAMGKLAQAVMHGAKIIQIDGNFDDCLELAR
KMAADFPTISLVNSVNPVRIEGQKTAAFEIVDVLGAAPDVHALPVGNAGN
ITAYWKGYTEYHHEGLIEKLPRMLGTQAAGAAPLVHGEPVKNPETIATAI
RIGAPASWTAAVDAQQQSHGRFLAATDDEILAAYHLVAESEGVFVEPASA
ASIAGLLKAVEDGWVARGSTVVCTVTGNGLKDPDTALRDMPTVTPLPVDP
VLVVEKLGLA
118466284YP_881108.1 transposase [Mycobacterium avium 104]MALSTYYDAKARVPSARALRDAVLGPALCQLWKDNYCVYGARKLWKTARR
DGHDVGRDQVARLMRAAGIEGVRRGKRVRTTKADPAAARHPDLVHRNFAA
AAPNQLWVTDLTFVPTWAGVAYVCFIIDAHSRMIVGWRVASHMRTSMVLD
ALEMARWSRGTTLQDLICHSDAGSQFTSIRYGERLAEIGAVPSIGTVGDS
FDNALAETVNGYYKAELIYGPARSRPWKTVEDVELATLSWVHWHNTSRLH
SYLGDIPPTEFEAAFYDAYRTDQPLIGIQ
118466283YP_883169.1 hypothetical protein MAV_4016 [Mycobacterium avium 104]MWEFGLLVLLVAVLAVFLVQRFVPRGPRGELLSGTLLVTGVSPRPEATGE
QYVTIAGVINGPTVNEHAVYQRMAVDVNQWPTIGQLFPVLYSSKNPDNWR
FAPPAPPEPSPPSQPGG
118466282YP_880517.1 hypothetical protein MAV_1272 [Mycobacterium avium 104]MSTEQTTSPAAQRESAAPRRTGTRGWGGWVAGAGLAAFALFFIANCRVAL
DPRVANPNVQGRPRPVKFIFGLDYMTFIQISTVVMLIVLVVVFVRGWRRN
PGSPAMLMFLCTTLIVWQDPIMNWAPFAVYNPDLIHWPESWPLVSLSPTV
EPFVVFGYVTFYFGPYFPAVWILRRLQAKYGPQSFFARHPLVSLGVLTCA
IGFVFDAWLEIQLVHMGMYIYSQVIPWGSVFTGTTFQFPLIWESFSVTFV
MVPAAILCYRDDTGKSVAEKLAAKAKLFPARPVLGTFLVMFVIINVSYFA
YGAWFAVIKATKAATSVACPWPYPEAKVYDPQGFYEKAGAQGPYSVGIWS
TWMSGQPHGRPDVQPPPPGAGACATTAVGHG
118466281YP_880019.1 phosphoribosylformylglycinamidine synthase II [Mycobacterium avium 104MTVSPTSAPTQAIDTVERAATTPDEPQPFGELGLKDDEYQRIREILGRRP
TDTELAMYSVMWSEHCSYKSSKVHLRYFGETTTDEMRAGMLAGIGENAGV
VDIGDGWAVTFKVESHNHPSYVEPYQGAATGVGGIVRDIMAMGARPVAVM
DQLRFGAADAPDTRRVLDGVVRGIGGYGNSLGLPNIGGETVFDACYAGNP
LVNAMCVGVLRQEDLHLAFASGAGNKIILFGARTGLDGIGGVSVLASDTF
DAENSRKKLPSVQVGDPFMEKVLIECCLELYAGGLVIGIQDLGGAGLACA
TSELASAGDGGMEVRLEAVPLRTAGMTPAEVLCSESQERMCAVVTPENVD
AFLAVCRKWDVLATVIGEVTDGDRLRITWHGQTVVDVPPRTVAHEGPVYQ
RPLARPDTQDALNADSSARLPRPATGAELRATLLALLGSPHLCSRAFITE
QYDRYVRGNTVLAEHADGGVLRVDETTGRGIAVSTDASGRYTMLDPYAGA
QLALAEAYRNVAVTGATPVAVTNCLNFGSPEDPAVMWQFAQAVRGLADGC
VALGIPVTGGNVSFYNQTGSAAILPTPVVGVLGVLDDVSRRLPTALGAEP
GETLMLLGETRDEFDGSVWAQVTADHLGGLPPKVDLAREKLLAEVLRAAS
RDGLVSAAHDLSEGGLAQAVVEAALAGETGCRIVLPEDADPFVTLFSESA
GRVLVAVPRTEESRFRSMCEARGLPAVRIGVVDQASDEVEVQGLFTVSLA
ELRQTSESVLPRLFG
118466280YP_881455.1 hypothetical protein MAV_2251 [Mycobacterium avium 104]MTTSSSLRTVVFGLTVVVTGKDYVFANCYAVWVLIAALGAFVISAVLGLV
VSAYSFRYKTVSLDFLRQLEDRDGALWKVSADQAVNYDVQQQVTTICSLR
GGNERKADLVVASLVFQVAAVALLALSVGLEIYGRMSASQPPGWSEIPWA
NWIFD
118466279YP_884252.1 FAD linked oxidase [Mycobacterium avium 104]MLRALADTVGSTHVVTDPDVLAARSVDHTGRYRGRASALVRPGSAEQLAE
VLRVCRDAGAHVTVQGGRTSLVAGTVPEHDDVLLSTERLHRIADVDTVER
RIEVGAGATLAAVQQAASAANLVFGVDLAARDSATVGGMASTNAGGLHTV
RYGNMGEQVLGIQVALPDGALLRRRSRVRRDNTGYDLPALFVGAEGTLGV
ITELDLRLHPTPTHTVTAICGFADLDAVVAAGRTFRDVDGIAALELIDGR
AAALTREHRGVPTPVDADWLLLVELAADHDQTERLAGLLDDAPLSGEPAV
GVDAVARQRLWQVREALAEVLGVYGPPLKFDVSLPLSSISEFERAAIDLV
HTHAPDALPVLFGHIGEGNLHLNVLRCAADREHALYEPMMDLIAASGGNV
SSEHGVGSRKRPYLGMSREPADIAAMRTVKAALDPTGYLNAAVLFD
118466277YP_882087.1 hypothetical protein MAV_2901 [Mycobacterium avium 104]MHRLATRAFAASITVTALAATLPASAAKADVMVYPGMEIRQDNRVCTLGY
VDPGLKIAFTAGHCRGGGGVVTDRGGTVIGRMAAFRDNTPSGTTVSTSQV
INDYEAIVLDNGVTANNILPGGRPLVSDPGLALTPGQPVCHFGVITGETC
GTVESVNNGWFTMSHGVQSHNGDSGGPVYLAPSGGPGQIVGIFNSVWGEY
PAAVSWQATSEEVREDLGVRDNAR
118466276YP_879707.1 4Fe-4S ferredoxin iron-sulfur binding domain-containing protein [MycobMGKGELMGQLTGPTDPAADAGWADRKPRKGFFTDTSICIGCKACEVACKE
WNRNPQDGDLELLGSSYDNTGALGASTWRHVAFVEQGRERIEQARESGRA
LIDLGMPTLPGAASEPTEPAVPHTPEFRWLMSSDVCKHCTHAGCLDVCPT
GALFRTEFGTVVVQHDVCNGCGTCVAGCPFGVVERRNDGTYATPAQRPDR
PSEEIVTGVAQKCTLCYDRLLEDEIPACAKTCPTTSIKFGDHDDLVAMAR
RRVAALHAQGLTEARLYGANEHDGVGGTGSIFLLLDEPEVYGLPPDPRVC
TADLMTMFKRAGLAAAGMVGAAVLAFWRSR
118466275YP_881903.1 hypothetical protein MAV_2713 [Mycobacterium avium 104]MIGAVLVGGAGIAAATPQDDAYLAQLRAAGLTWPPKTEEALIAEAHDVCY
DLTWGWTPQQIADDLHARLDNKGVTLLDVGSLVNAAHNIYCPGNVCDAPS
LCT
118466274YP_884236.1 lipolytic enzyme [Mycobacterium avium 104]MPADPMSELSIGIIGAGPGGLALGILLSQAGFDDFTIFDREDGVGGTWRI
NTYPGLACDVKSHLYSYSFDLNAHWSRLWSGQPEILDYFQRCADKYGLGP
HLRLGTEIRSAHWDADTQRWRLTTASGHRHHFDVVVSAVGLFTRPLLPEL
VEEEPFTGTVMHSARWDHSIPLHGKRIAVLGTGSTASQLIPELAKVAERV
YSVQRSPTWILPKPDRPYTRWERWAFAHLPLAKKLYRTRLWLRSESNISV
IEHGSEKTGQFTNIALGLLEASVPDEELRRKLTPDHPMGCKRLVFSSDYL
PALTRPNVEVLTSPARSLRRRSLVTEDGTEREVDLVVCATGYAAADYLGE
LDVTGEHGVTLREVWRDGAYAYLGMAVPGFPNFFMLYGPNTNVGSNSVIF
VLEAQARYIVRALKYLRRHRRRYIAVRPAALADFVAKIDRWMVGTVWTTQ
CSNYFRAPNGRVVTQWPRSARAFWSMTRRFRPADYRFQAPAVRVPAPASE
ADAR
118466273YP_883036.1 hypothetical protein MAV_3874 [Mycobacterium avium 104]MSIASVLIPSDHPSGPATGSSAAPRYSLLLSADPAMIEAAQRLRYEVFTS
TPGFALPSADGSGRDVDRFDEFCDHLLVRDDDTGELVGCYRMLAPAGAIA
AGGLYTATEFDIRAFDPLRPSLVEMGRAVVRDGHRNGGVVLLMWAGILAY
LDRYGYDYVTGCVSVPIGDADDAPPGSRLRGVRDFVVSRHGAPARYRVRP
HRPVVVDGTALDDIPPPARPSVPALMRGYLRLGAQVCGEPAHDPDFGVGD
FCVLLGKQDADTRYLKRLRSVSAAAELAGGR
118466272YP_883843.1 TetR family transcriptional regulator [Mycobacterium avium 104]MILDAARALVLDGGPRTASVAAIATASGAPAGTLYHRFGNRDGILTAAWL
RALERFQARALAADGDTPEDTAVAMAVAAVSFARALPDDARLLLTIRPGD
LLDGEPDAAFRQTLAAMNAPLTQRLAQLARHLYGNARPRSVDAVARAVAD
LPYAVVRRHAHDDPMPSWLETDVAASARAVLRSFGERP
118466271YP_880360.1 hypothetical protein MAV_1108 [Mycobacterium avium 104]MAWPTDHLTEAADYWETVSERTFGIAHQVWRDALSADWRGAAAETLRGAT
HADMTSTSAVADQLRAAASVARGGASDLSAARSRVRYAVEDAHSAGFDVG
EDLSIRDRTVGGSTAQRAARQAQARALAGDIRQRAAQLVSLDQEVAGKIT
AAVAGVRDTFPHDPTANRPSTDGHVRGVDNHTFKDAPSSGMSREQAKAGL
KDVNKRIWEHNHIDKPVIEQLPPNDPRRADFHVETEQLNAEKQQYLDVLF
HQHPPESVVGPHGEQLPGVPSGESAIGPAESGKGWQFSLPPGHAGIDPRV
TTIRVMEPTAQYPDGYVVYMNGMGQTVNPFTGRTIPPSDDYAHIPLPE
118466270YP_882009.1 P450 heme-thiolate protein [Mycobacterium avium 104]MKERLHWFAMHGFIRGAAALGARRGDVHARLIADPAVAADPARFYDEARA
RGTLVKGRVAYLTADHALAHELLRSEDFRVLVFGSNLPAPLRWLERRTRD
DLLHPLRAPSLLAVEPPEHTRYRKTVSAVFTPRAVAALRDRVERTAAELL
DQLTGGPGVVDIVGRYCSQLPVAIISEILGVPEQDRSRVLEFGELAAPSL
DIGLPWRQYRSVQRGIAGFSSWLAGHLQQLRSNPSDNLMSQLIQTAESGS
AETYLDETELAAIAGLVLAAGFETTVNLLGNGIRMLLDAPEHLDTLRRRP
ELWPNAVEEILRLESPVQLTARMALNDVEVAGRQLHRGDLVLVYLAAANR
DPAVFGDPHRFDIERPNAGRHLAFSGGRHFCLGAALARAEGEVGLRTFFE
RFPEARAAGAGSRRETRVLRGWSSLPVRLGPARSLAAAEAGGRPDEPTAG
118466269YP_881458.1 hypothetical protein MAV_2254 [Mycobacterium avium 104]MPATLSQIEAWSTEHLIDAAAYWTQTADRWEDAFLTMRNQAQSITWHGAG
GDALRQRTGADLSVVSGKADLLRQAAGIARNGASDISAAQRRVLYGVEDA
LNAGFTVGEDLSVTDTRSTSPAERAARQAQAEAFAADIRLRAEQLDGADT
KVSGQLTAATAGLSGGGFAQNSTSNRGGRAQNSSGNGGQPQPGHNAGQPQ
PATTNHNGVRLVDFTQDNASGPNPPPFAPWDNPDGAPPAPAPVQPGVIPQ
LEQSMTAPPAPKPGPPASPLPSPSVTPLPNPAAVGPAAAAPAKPPCSPYD
ATKAILEPPIGMVGILTAVPESLTIAGIPAALTQIGVGTVAVADGLDAAD
KCLP
118466268YP_883171.1 acyl-CoA dehydrogenase [Mycobacterium avium 104]MTDSGSTKTPARVKRRDRQSGVGLQPHKRTGIDIAIALLTPLVGQEFLDK
YHLRDPLNRGLRYGTKTIFSTGAATSRQFKRVQNLRGGPTRLKSSGKDYF
DLTPDDEQKMIVETLDEFAAEVLRPAAHDADEAATYPRDLIAKAAELGIT
AINIPEDFDGIAAHRSSVTNVLVAEALAYGDMGLALPLLAPGGVASALTH
WGSAEQQATYLPEFAGENVPQACVAIAEPQPLFDPTRLKTSAVRTPSGYR
LDGVKSLVPAAADAELFIVGAQLDGKPALFIVESSTKGLTVKADPSMGIR
AAELGHVELSGVTVPLGARLGEDEATDDDYSEAIALSRLGWAALTVGTSH
AVLDYVVPYVKEREAFGEPIARRQAVAFMCANIAIELDGLRLITWRGAAR
AEQGLPFAREAALAKRLGADKGMQIGSDGVQLLGGHGYTNEHPVERWYRD
LRAIGVAEGVVVI
118466267YP_884121.1 hypothetical protein MAV_5001 [Mycobacterium avium 104]MAKSIGETPRRSGVKSPPTARVMDVLAAVADSPGGLTSAELAKGCAISSS
TCALVLAELERRAWVTRRDDRRYVLGSGLFGLVHGLREQFPLLDRGRDAL
RLLHERLGAGCSMSKIGARHLTTVDSVGHGTDGEHAVGQRFPIDPPFGLV
AMAWRDDDAVQAWLRRVTPRLTRTEIAQHQRVLADIRARGYGAWRFDDTH
RSLHNRLAEALASLEPTAQVARRLTTLMTMVTLRSVTDVLETELPTTEFV
VLPIFGHDGQPEYQIEIHLGHSAGLTLPELDDALEQARRLLTAPVR
118466266YP_883108.1 hypothetical protein MAV_3948 [Mycobacterium avium 104]MAATGHPVRFDVSSAVGERASLAATYYPARGGTAAAVLVCLPGGTYSREY
WDLDIAGHDGYSFADFATGNGYAVLTVDPLGTGESSQPASDFGFAEIGAA
LDCALRALPGTTGVQAPAVAVAHSLGGYLALTQQALFGGYAAMAMLGCTN
QHVAPLNLDPAFRARAATPQGRAELAAEILAALAQPYFAGPREHLQGWFH
LADVPADIVAADAVTAVSVVPRVFGTAMIPGIVAEHAARIDVPVLLGYGV
VDVSPDPRAEAALYRSSPDITTVVLAGSAHCHNMASSRHRLWRRLLAWAA
TAIDD
118466265YP_880151.1 short chain dehydrogenase/reductase SDR [Mycobacterium avium 104]MVNELAGKVAIVTGGASGIGRGIVERFVAEGARVVIADIETERGERLAAE
LGGEAVFRRTDVSDIEQVGALVAAAVEKFGGLHVMVNNAGISSPLRRLLD
DDLADFHRVMGVNVLGVMAGTRDAARHMADNGGGAIINLTSIGGIQAGGG
VMTYRASKAAVIQFTKAAAIELARYDIRVNAIAPGNIPTPILGKSAGDMD
PEQRERFEARIREGMREDRPLKREGTPDDVAEAALYFATERSRYVTGTVL
PVDGGTSAGKAMRSKRQG
118466264YP_883354.1 transcriptional regulator [Mycobacterium avium 104]MKRMPYAEASRALLRDSVLDAMRDLLVTRDWSAITLSDVARAAGISRQTI
YNEFGSRQGLAQGYALRLADRLVDTIHEALDAHVGNIYESFLDAFRRFFA
DAAADPLVTSLRTGVAKPDLLQLITTDSAVIITRASARLASALTHTWVST
TDEDAGVLARAIVRLALSYVSMPPEADHDVAADLARLMTPFAERHGVVNV
G
118466263YP_882121.1 hypothetical protein MAV_2935 [Mycobacterium avium 104]MAPVADGVTADPDWMVAFARHLEACGFESIVAVEHTVLLTRYDSVYPYDS
SGRVGLAPDCPIPDPLDLLAFLAGHTTRLGLATGVLVLPNHHPVVLAKRV
GTLDALSGGRLRLCVGVGWLQEELRACGADFDNRGRRADEQLAVLRALWA
HRPDGASFHGEFFTFDNVMCYPKPVAAERFPVHIGGHSRAAARRAGRFGD
GFQPLGVTGARLASLIGLMRDEAVAAGRDPAALEVSLGHSVSKIDAERAA
RLADQGADRLVLAMPPTSDIEQAKDMLSACAQRLSLRPVSGP
118466262YP_880424.1 TrcR family transcriptional regulator [Mycobacterium avium 104]MSGQSAAQRPRQAILGQLPRIYRADGSPIRVLLVDDEPALTNLVKMALHY
EGWVVDIAHNGREAMAKFDRAAPDVLVLDIMLPDVDGLRILERVRQSDAY
TPTLFLTARDSVMDRVTGLTAGADDYMTKPFSLEELVARLRGLLRRASQQ
PAPTAETLKVGDLVVDTASREVTRGDTPVSLSSTEFELLRFLMRNPRRAL
SRTEILDRVWNYDFAGRTSIVDLYISYLRKKIDSGREPMIHTVRGVGYML
RPAE
118466261YP_883737.1 hypothetical protein MAV_4608 [Mycobacterium avium 104]MVSQSSDDTPTGPIAGQPRQPAAPRIIRSHATGATPPPGPATTGRRVAAD
LTAVALLLAAVLLPWNLYFGVGIPDSNPIVFAVLVAVTALALAALAVAGS
WRAGGARFDPARAARLRLALNVPYLLLVLAFVGFDAVQTVRFGGTVDVPG
GVGPGAWVGIAGALLSAQAVPAGTAAAPVPGTPAGDEATGWHRAARIIGA
LSMLAAVLSFGFNLYWRVRYALQSSGGAAQFGKENIAVIATAVVYGVVAL
VAVLVASRWLLRSDRASRLTTIALGTSTLAAGILVWLLPAGRDLDAFHGI
AQNTSTAGVGFEGYLAWAAGAALFAPRTLFERRTPSHTEESAWRATARNG
LLLIAVWALGSMAMRITDLAVAVTLNYPFSRYDSLVLAAFDLVTAVLAIW
LRRQLANLAARLVTSLCGLVAALAVARVVVGVQLAPRFADTPNSPVHHPV
YGNNLAQQITSVFDVTLCGLALGILVAAVVAGQLGRRRRARRAARRRAAQ
ANAAAPTTRIPVSQGAAPSAAATTRIATGGPGADHEPPTTEIPPLAGSPR
IFRGDDSGTRQIPVPKPQIYRPPQQ
118466260YP_882279.1 short chain dehydrogenase [Mycobacterium avium 104]MTQSTQTVVITGASAGIGRATAKEFGRRGANVALLARGAAGLQGAARDVE
AGGGKALALPTDVADHAAVVAAADETEAAFGPIDVWVNVAFTSVFAPFSE
ISAEEFKRVTEVTYLGYVHGTMAALAKMRPRDRGTIVQVGSALSQRSIPL
QSAYCGAKHAVNGFTESVRCELLHEGSRVRITLVQMPAVNTPQFSWVLSR
LPRHPQPVPPIYQPEVAARGVLYAADHPGRKQYWVGDSTMVTLLAQKFAA
PLLDRYLGRTGYDSQQTEQPVGGDRPHNLWQPLDQEPGSDHGAHGEFDDT
SHAHSPQLWASQHPVISGTGALGAAGLGAWLAARARRWTR
118466259YP_881740.1 cytochrome P450 143 [Mycobacterium avium 104]METLGAPELSFASLPMAADRGVGWKVLRDAGRVVSVDGIFYLTHREDVLA
ALRDPELFSSKKAFDVLGSPLPLVPISFDPPEHTRFRKILQPFFSPHTLK
EMLPSLQQQAIEIIERVAAQGECEVVADVAIPYPSQVFLTLFGLPLEDRD
KLVAWKTSVIAISEAPSLEDADLTPALELVAYLTEAINARRADPGPDILS
QLLNGEEPLDDAEIMGLSFLFVLAGLDTVTAAMSSALLELARNPELRATL
HDDPDQIDVFVEEIVRLEPPAPMLPRVTTTEVTIGDVTLPADTMVRLCVA
AINRDDSDEISTNDVVMDGKVHRHWGFGGGPHRCLGSHLARLELKLIVGE
WLRRIPEFSVKVGEEPQIVFPASTFSLERVPLKLG
118466258YP_882303.1 phenylalanyl-tRNA synthetase subunit beta [Mycobacterium avium 104]MRVPYSWLREVVAAGAPDWDVAPAELEQTLIRIGHEVEEVIELGPVDGPL
TVGRVTDIEELTGFKKPIQFCHVDVGDDVDREIVCGATNFVAGDLVVVAL
PGTTLPGGFAITARKTYGRNSDGMICSAAELGLGADHSGILVLPPGTAEP
GADGAAVLGLDDVIFHLAITPDRGYCMSLRGLAREIACAYDLEFVDPADV
KPLPVDGEAWPLTVQPDTGVRRFALRPVTGIDPAAVSPWWLQRRLLLSGI
RATSPAVDVTNYVMLELGHPMHAHDRNRISGGLGVRFARPGETVVTLDDI
ERKLEPVDVLIVDDAATAAIGGVMGAASTEVRADSTDVLLEAAVWDPAAV
SRTQRRLHLPSEAARRYERGVDPAISVAALDRCAALLAGIAGGTVSEALT
DWRGEPACDGWSPPAIQMPADLPDRLAGVTYPPGTAAKRLAQIGAAVTAD
GGTLTVVPPSWRPDLLQPADLVEEVLRLEGLEVIGSVLPSAPAGRGLSAA
QRRRRAIGRSLAQSGYVEILPTPFLPAGVFDVWGLPDDDPRRVTTQVLNP
LESDRPHLATTLLPALLEALVRNVSRGLVDVSLYALAQVVQPTAETRAVQ
FIPVDRRPTDAEIAVLDASLPRQPQHVAAVLTGLREQRGPWGPGRRAEAA
DAFEAVRVIARAAGVDVRLRAAQQLPWHPGRCAEVLVGDTPVGYAGQLHP
AVVERAGLPRGTCALELDLDAIPLVATLPAPRVSPFPAVFQDVSLVVAAD
VPAQAVADAVREGAGDLLEDLQLFDVFTGPQLGEHRKSLTFALRFRAPDR
TLTEDDATAARDAAVRRAAEAVGAELRT
118466257YP_879530.1 glycosyl transferase [Mycobacterium avium 104]MNDTVFAVVVTHRRPDELAKSLDALSSQTRLPDHLIVIDNDACDDGRVRE
LVAAQPIPTTYLQSRRNLGGAGGFALGMLHALAQGADWVWLADDDGRPQD
ARVLATLLACADKHGLAEVSPMVCNLDDPERLAFPLRRGLVWRRRASELR
TEAGQDLLAGIASLFNGALFRASALESIGVPDLRLFIRGDEVEMHRRLVR
SGLPFGTCLDAVYLHPCGSDEFRPILGGRMHTQYPDDATKRFFTYRNRGY
LLSQPGLRKLLVQEWVRFGWFFLVTRRDPRGLAEWIRLRRLGRRELFGKP
GGSR
118466256YP_882310.1 50S ribosomal protein L35 [Mycobacterium avium 104]MPKAKTHSGASKRFRRTGTGKIVRQKTNRRHLLEHKPTTRTRRLEGRTTV
SANDTKRVNSLLNG
118466255YP_880025.1 glycine cleavage T-protein (aminomethyl transferase) [Mycobacterium avMTHPVPAPDTGPDAGAVWHYGDPLGEQRAAETEALVIDRSHRGVLTLTGA
DRQTWLHSISTQYVSDLPEGASTQNLSLDGQGRVEDHWIQTELAGTTYLD
TEPWRAGPLLDYLRKMVFWSDVTPAAADLAVLSLLGPKLAERAVLDALGV
DALPAEAAAVPTRGGFLRRMPAGPAGRLELDLVVPRAEAADWRNRLAQAG
VRPGGVWAYEAHRVAARRPRLGVDTDERTIPHEVGWIGGPGQGAVHLDKG
CYRGQETVARVHNLGRPPRMLVLLHLDGSVDRPATGDPVQAGGRAVGRLG
TVVDHVDLGPIALALLKRGLPADTALATGPQAAVAAVIDPDSLPAAEQIG
AGRLAVERLRGGAG
118466254YP_880967.1 3-isopropylmalate dehydratase large subunit [Mycobacterium avium 104]MTVIEKILARKAGLDSVSSGDTVVVDVDMTVLIDLQFATMWISPTRIHDP
DRLAVIMDHAVPAPTIKDADGGRQARRFVADFGIERFYDVGRHGICHQVI
AENGLARPGEVLACTDSHTCAAGAYNNAARGLGPAEIYSIMCTGTTWFQV
APTIRYEFHGAKPEVVSGKDIFLHIADEYGDAPNRNLEFGGPGLAGIPMH
DRRTIATQGAEVSADFSTFEPDDVLTSFLAERGVVEYEAVTPDSDAAYHD
VRRVDLATLEPYVARPGTVSRNGSPVSRLGRQKIDQAFIGSCANGQLEDL
RIAAEVLRGKTVAPGVRLLITPASQAVYREALRRGYLQDLADAGAVVTNS
TCGACFGYHMGLLGAGEVCITASTRNFTGRMGSTEAEIFMASPATVAASA
VAGYITDPRSVTA
118466253YP_881812.1 thiolase [Mycobacterium avium 104]MSGAAGAAAIAGVALSDVGRVDDKGPYELIAQASRRALADAGLTPDDVDG
LASTSQGTLPPVDVGEYLGLRPRWIDSTAVGGASWEVMAAHAADAIAAGH
ADVVLLTYGSTARSDLRKGLRGANINWGARGPLQWEAPYGHTLISKYAMA
ARRHMFTYGTTIEQLAEVAVSARFNATDNPEAYYREPITIDDVLGGPMIA
DPFTKLHCCIRSDGGAAAVLVSAERAKDLRSKPVWVLGSAETTSHMLTSQ
WDDLTVGPAAVSGPLAFARAGVSPSDVDVAEIYDAFTYMLLLTIEDLGFS
PKGEGGAFVEKGSLRLGGALPTNTDGGGLSACHPGQRGLFLLVEAARQLR
GECGPRQVPDAKIACVSGTGGWFCSSGTMILGAEEP
118466252YP_880292.1 hypothetical protein MAV_1036 [Mycobacterium avium 104]MIALEYHDDSCGLADPLTPLAAAALPDDVPTSSAADVTGCRDDDGAEGHT
VFDGHRPDFWTIGRPGLRDIEVCIESTRADGAISLGLVVNGLDCSGVPID
QALSLADARGDAGVCGVSCRGGGHLKAS
118466251YP_881000.1 CBS domain-containing protein [Mycobacterium avium 104]MRIADVLRNKGAAVVTINPDATVRELIAGLTEQNIGAMVVVGAEGVLGIV
SERDVVRQLHVHGASVLSRPVSKIMTTTLATCTKTDTVDEISVLMTRNRV
RHVPVLDGKKLIGIVSIGDVVKTRMEELEAEQQQLQSYITQG
118466250YP_880929.1 alpha-amylase [Mycobacterium avium 104]MMSAHEVMSAHETERGAMQSKPWWSSAVFYQVYPRSFADSDGDGVGDIDG
VTAHLDHLEQLGVDAIWLNPVTVSPMADHGYDVADPRDIDPLFGGMAAIE
RLIAAAHRRGIKITMDVVPNHTSSAHPWFQAALAAGPGSDARQRYFFRDG
RGTDGELPPNNWTSVFGGSAWTRVLEPDGNPGQWYLHLFDTEQPDLNWEH
PDVFDDFEKTLRFWLERGVDGFRIDVAHGMAKPAGLPDSPDLESKVLHHS
DDDPRFNHPSVHDIHRDIRKVVNDYPGAVTVGEVWVTDNARWAEYLRPDE
LHLGFNFRLTKIDFDAAQIHDAIQNSLAATALQDATPTWTLSNHDVGREV
TRYGGGEVGLRRARAMAMVMLALPGAVFIYNGEELGLPDVELPDEVLQDP
TWERSGHTERGRDKCRVPMPWSGQAPPFGFSSRTDTWLPMPKEWAALTVQ
KQRDDPDSTLSFFRRALELRRRRVEFDGDGVEWLEATADAVTFRRPGGLV
CALNSGEQPVPLPPGELVLASAPLLDGKLPPDAAAWLA
118466249YP_879985.1 short chain dehydrogenase [Mycobacterium avium 104]MPRFDPLPERRPAIVAGASSGIGEATAIELAAHGFPVALGARRVEKLNDI
VGKINADGGEAVGFHLDVTDPNSVKSFVAQAVDALGDIEVLVAGAGDTYF
GKLAEIAGDEFESQLQIHLVGAFRLASAVLPGMLERQRGDLIFVGSDVAL
RQRPHMGAYGAAKAALVAMVNNFQMELEGTGVRASVVHPGPTKTAMGWSL
PAEKIGPALEDWAKWGQARHDYFLRAADLARAITFVAETPRGGFIANMEL
QPEAPLADNKDRQKLALGEEGMPGQ
118466248YP_880250.1 DNA or RNA helicase of superfamily protein II [Mycobacterium avium 104MSDGPLIVQSDKTVLLEVDHELAGAARAAIAPFAELERAPEHVHTYRITP
LALWNARAAGHDAEQVVDALVSFSRYAVPQPLLVDIVDTMARYGRLQLVK
NPAHGLTLVSLDRAVLEEVLRNKKIAPMLGARIDDDTVVVHPSERGRVKQ
MLLKIGWPAEDLAGYVDGEAHPISLTEDGWQLRDYQQMAADSFWSGGSGV
VVLPCGAGKTLVGAAAMAKAGATTLILVTNIVAARQWKRELVTRTSLTED
EIGEYSGERKEIRPVTISTYQMITRRTKGEYRHLELFDSRDWGLIIYDEV
HLLPAPVFRMTADLQSKRRLGLTATLVREDGREGDVFSLIGPKRYDAPWK
DIEAQGWIAPAECVEVRVTMTDNERMMYATAEPEERYRLCSTVHTKIAVV
KSILDKHPGEQTLVIGAYLDQLDELGEQLGAPVIQGSTRTKEREELFDAF
RRGEVNTLVVSKVANFSIDLPEAAVAVQVSGTFGSRQEEAQRLGRLLRPK
SDGGGAVFYSVVARDSLDAEYAAHRQRFLAEQGYGYIIRDADDLLGPAI
118466247YP_882178.1 MarR family transcriptional regulator [Mycobacterium avium 104]MSPDEAEFVDRLGLFFELLGATRTMGRVYGWLLICEPPQQSLTQLADALS
VSKASISTVARQLLDGGMVERLPSPNRQHLYRVTPGGFTSVLETQLSLMR
LGIEPAEFALSVLGDDRAEQRRRVEDFRDFCEFCTRDYRDQLMRMWTEYR
SAKTAGPTKAAKEAGSTKSARRRQS
118466246YP_880084.1 hypothetical protein MAV_0811 [Mycobacterium avium 104]MTVPGVELMRVGKWNLSTGEWECTEKEIAAAIEAHEKGILRKPVIRLGHN
DPRFSGDPAVGWLDNLRASEDGQALIGDMVGVPEWLAEILPSAYPSRSIE
GLYDYTAPDGSEHEFVLTGLALLGATRPGVESLQSLQDVARLYDIAAAGQ
VGGKAIELTIEAADAPKPYGDVKYADPKNGKYPIDTAEHVRAAWSYINMP
KNQKDYSAAELAQIKDRIKAAAKKFGIKIEAGEASETEGGAIVALPEKVA
EALGIDASADEDTVLAKIAELKPPAPAAEPEPEPQPAPVAAAAGVVNGLV
QIEQATLDELKAAAAQGVEARARQIAEEDERTVMAAIGQGKIAPARKDHW
LAALKADRDGTKQVLASLAAGLIPVNEVGHQGVAGQIGFEGAPDPEQQAK
DYAHGRVMARLGFPTTKGSVN
118466245YP_882680.1 hypothetical protein MAV_3498 [Mycobacterium avium 104]MSTGTAIAVALTFVWLGMVLAISFLEAPLKFRAPNVTLQIGLGIGRLVFR
ALNTVEVVFALVIGAIVVAGPTRAGVAVAIGVAVAALAVQLVAVRPALTR
RSDRVLAGDDGPRSRAHYGYVALEAVKVVALIAAGILLLSG
118466244YP_882258.1 hypothetical protein MAV_3074 [Mycobacterium avium 104]MKMSGLLSRNTDRPGIVGTARVDRNIDRLLRRVCPGDIVVLDVLDLDRIT
ADALVEADIAAVVNASPSVSGRYPNLGPEVLVNNGVTLIDEAGPDIFKKV
KDGAKIRLYDGGVYAGDRRLVRGTERTEHDIADLMREAKSGLAAHLEAFA
GNTIEFIKSESPLLIDGIGIPDIDVDLRRRHVVIVADEPSAEEDLKSLKP
FIKEYQPALIGVGTGADVLRKAGYRPQIIVGDPDQISADALKCGAQVVLP
ADADGHAPGLERIQDLGVGAMTFPAAGSAIDLALLLADHHGAALLVTAGH
TANIETFFDRTRAHSNPSTFLTRLRVGEKVVDAKAVATLYRNHISAGAIA
LLALTMLIAVIVALWVSRTDGVVLHWITDYWNHFSLMVQKWVT
118466243YP_881799.1 aldehyde dehydrogenase [Mycobacterium avium 104]MTDTATETLVQFDLLIGGESSSAASGLTYDSVDPFTGRPWARVPNAAAAD
VDRAVGAARAALNGPWGALTATARGKLLHRLGEIIAREADQLAELEVRDG
GKLVREMVGQMRSLPDYYFYYGGLADKLQGDVIPVDKPNYFVYTRHEPVG
VVGAITPWNSPLLLLTWKLAAGLAAGCTFVVKPSDHTPTSTLAFAKLFAE
AGFPPGVINVVTGWGPETGAALASHPGVDKVAFTGSTATGIHVGKAAIEN
MTRFSLELGGKSAQVVFADADLDAAANGVIAGVFAATGQTCLAGSRLLVD
RSVADALVEKIVARAATIKLGDPKDPTTEMGPVSNLPQYEKVLSHFASAR
EQGATVAYGGEPASDLGGFFVKPTVLTGVDPSMRAVAEEIFGPVLAVMTF
EDEDEAVAAANGTEFGLAAAVWTKDVHRAHRVAAKLRAGTVWVNAYRVVA
PHVPFGGIGYSGIGRENGIDAVKDFTETKAVWVELSGETRDPFTLG
118466242YP_879858.1 arsenical pump membrane protein [Mycobacterium avium 104]MALTVALVLLAVVLGFAVARPRGWPEAVAAVPAALLLVGVGAIPVAAAEQ
QIADLSGVVAFLGAVLVLAKLCDDEGLFEAAGAAIARGRVGSAGMLRRVF
VIASAITAVLSLDAAVVLLTPVVLAAVRRQRTAVRPYAYATAHLANGASL
LLPVSNLTNLLAFHTAQLSFTRFTLLMAAPWLAAVATLYAVFRGFFAKDL
RVQPDPAALGAPPRPPVFVLVVVALTLAGFAVAQSVGIAPAWVALCGASV
LAVRSLARGHTTVTEIARSVHVSFLVFVLALGVVVQAVMRNGMDRAMSAL
LPSGSGLPALLAIAATAAVLANVVNNLPATLVLLPLVAPAGPVAVLAVLI
GVNIGPNLTYVGSLSNLLWRRVLRQHGVDAGVGEYTRLGVCTVPVSLLVA
VLALWASARLLGG
118466241YP_880431.1 hypothetical protein MAV_1185 [Mycobacterium avium 104]MNPGANSPRPYRRLRHLATRADKHSKGGTSVSDANGPTARFGIDNTAVVK
VPVHHGPISDIDVSPDGRRLLVTNYGRDTVSVIDTHTCRVASTIAGLSEP
FAVAMSAADPNYAYVSTATAAYDAIEVIDVVTNWRIATHRLAHSLSDLAV
SPDGRYLYASRNAVRGADVAVLDTTTGELEVIELAAAAGTTTACVRVSAD
GRRLFVGVNGPNGGGLAIIETRTRTDGRRVGGRSRLVGTVELGLPVRDVA
LGNDGNTAYVASCGPVVGSVLDVVDTRAATIVSTHKINEITGPLTRMTLS
RDGERAYLISDDRVTVLGTRTQDVLGEVRVTKHPSALVESPDGNYLYVAD
HAGVLSVARLPSGTAPAAPCSGADEDDDATTGWLPELAPWEPVLA
118466240YP_879917.1 lipid-transfer protein [Mycobacterium avium 104]MSARNVAVVGFAHAPHVRRTDGTTNGVEMLMPCFAQLYQDLGITKADIGF
WCSGSSDYLAGRAFSFISAIDSIGAVPPINESHVEMDAAWALYEAYIKLL
TGEVDTALVYGFGKSSAGVLRQILSRQTDPYTVAPLWPDSISMAGLQARM
GLDTGKWTEEQMARVAFDSFANARRVDNVEGSITVAELLERPFFAEPLRR
HDIAPITDGAAAIVLAAGDRARELRENPAWITGIEHRIESPALGVRDLTE
SPSTKAAAEIATGGRTDNLDVVEICAPFTHQHLIIAEAIRIPGPTKVNPS
GGALAANPMFVAGLERIGFAAQHIWDGSAERVLAHATSGPALQQNLVAVM
EGKN
118466239YP_880907.1 pyruvate dehydrogenase E1 component- alpha subunit [Mycobacterium aviuMAQTSQPPMTVDLQPVQLVAADGTPTSEHRYSRELPAETLSWLYEMMVLT
RELDGEFVNLKRQGQLALFASCRGQEAAQVGATACLRKTDWLFPQYRELG
AFLVRGIPPGNVGAVWRGTWHGGLGFTDKCCAPLSIPIGTQTLHAVGAAM
AAQRLGEDSVTIAFLGDGATSVGDVHEALNFAAVFRTPCVFFVQNNQWAI
SLPVAKQTASPSLAHKAIGYGMPGIRVDGNDVLACYAVTAEAAARARAGG
GPTLIEAITYRLGPHTTSDDPTRYRTQDEVDHWAALDPIPRYRSYLQGQG
LWSERLEERVIGRATRMRAELRDAVFDAPDLDVDEVFTAVYAEITPELQA
QRRALRTELEKSD
118466238YP_883476.1 short chain dehydrogenase [Mycobacterium avium 104]MRGRHRHDVFMRYVVTGGTGFIGRRVVTRLLQTRPDAQVWVLVRRQSLGR
FERLSAQGDTPWGDRVKPLVGELPALELSDETLAELGHVDHLVHCAAIYD
ITAGEAEQRAANVDGTRAVIELAQRLGATLHHVSSIAVAGDFPGEYTEDD
FDVGQQLPTPYHQTKFEAELLVRSAPGLRHRIYRPAVVVGDSRTGEMDKV
DGPYYFFGVLAKLAVLPRFTPMLLPDTGRTNIVPVDYVADALVALMHADG
LDGQTFHLTAEKTIGLRGIYRGVAKAAGLPPLRGSLPGAVAAPVLKVRGR
ARVVRDMAATQLGIPAQVFDLVDLAPTFVSEKTRNALAGTGIEVPEFAGY
APRLWRYWAEHLDPDRARRDDPRGPLYGRHVIVTGASSGIGRASAIAIAQ
RGATVFALARNGAALDALVDEIRANGGAAHAFTCDVTDSASVEHTVKDIL
GRFDHVDYLVNNAGRSIRRSVVNSTDRLHDYERVMAVNYFGAVRMVLALL
PHWRERRFGHVVNVSSAGVQARNPKYSSYLPTKAALDAFADVVGSEVLSD
HITFTNIHMPLVRTPMIVPSHRLNPVRAISPERAAAMVVRGLVEKPARID
TPLGTLAEAGNYFAPRTSRRVLHQLYLGYPDSAAARGVATEPRPAERIER
TAPRKPRRPVRAVTRGLRTPRPVRRLVRLVPGVHW
118466237YP_881368.1 serine/threonine protein kinase [Mycobacterium avium 104]MSSSSRGSRLGTRLGPYELRSLIGTGTLGEVYRAYDTVKDRLVALKLLRG
ELDAGFRQRLWRECRAVTRLQEPHVLPLHDFGEIDGVPFIDMQLVDDGGS
LKELLREQGGLEPSRAASITGQVARALDAAHAAGLMHLDVKPENILLTHD
HFTYLADFGLAQAAGDEKLSRTYMAPERFTTGSLGPQTDIYSLACVLYEC
LTGQPPFEGADPGELRSAHLLSPAPRPSIMRRGVGRAFDDIITRGMAKQR
SARFASAGELARAASEAVFAAYEPVSAAAGLGGPRPLPAPPAQFDDPDDT
LGPPPVGERPPRGPAGRLPVVVTAVAVLMLIAGVVLSVKTVVGTHHNNSA
PPPAPTTRALAPPPPTTPPPPLTPTLSRPVTGADGLGFIGETARCDPGNP
PAAVVRTAKSLAVVCQNLSGSYYYRGERIRDGAHIELSNAERVEDGFDVT
NPVDGVVYEVRPNRLRIISFGHVDSSEPVLQYATAS
118466236YP_883206.1 hypothetical protein MAV_4054 [Mycobacterium avium 104]MPMPGMDKPTGRVVALIVLLLVVAAALRGYLPAQHDATRSEAGGRAALGL
VVAILAVTLALIAVAIVARLKDPRAPAPPAGALSETLGAGRGRPTWRVLL
IGLGVIVAWLLIVMLLARLFASHGLAPAPPPGTGASPPPHPAAPPAPPPQ
HPQRPRDGSQDTLGILLAGTVAMLLMVVASAVAGARRRWRSPAPAVPDEP
AENPAPQPHSESLARAAERGLAEMADLRRDPREAIIACYAAMERELAHVP
GAVPQDFDTPSEVLARAVEHHALHADNAVQLVNLFTEARFSPHVMNEGHR
DVAVRVLRLVLDELGSRSVA
118466235YP_883475.1 phosphoglycerate mutase [Mycobacterium avium 104]MALAALIATVTVAACGGSPQARSITVTFVRHAQSEANASGTIDTEVPGPG
LSPEGKGQAEQVAHQLGRKDYDSVYASTMTRAQQTAAPLAAELGKQVEVL
PGIQEINAGWYNGKPESMAKSTYLVAPANWLKGDVSDSIPGSISGKEFND
QFTAAVNKIYNSGHRNPVVFSHANSIMVWTLMNTRNAKDSLMNTHPLPNT
GRVVINGNPITGWTLVDWDGIRDFRS
118466234YP_880435.1 phospholipase- patatin family protein [Mycobacterium avium 104]MTTKRALVLAGGGIAGIAWETGVLRGIADESPAAARLLTESDVLVGTSAG
SAVAAQLCSGHTLDALFDRQVAASSPEIDSGVDVEAITELFLTALAEPYD
DSEDKTRQQLRRIGAVALATDTVPAPVRRRVIAARLPSHRWPRRALRLTA
IDVDTGELTVFDPASGVDLVDAVAASCAVPGAWPPVAIGGRRYMDGGVAS
SVNLGVAADCDVAVVLVPSGVDAPSPFGAGPAAEIAAFPGRALAVFADDR
SLAAFGPNPLDPGCRVPSARAGREQGRREAAAVAEFLGV
118466233YP_883749.1 phosphoglycerate mutase [Mycobacterium avium 104]MGEQTRVHVVRHGEVHNPDGVLYGRLPGFHLSEAGRAQAAAVAEALAPRD
IVAVIASPLQRAQETAAPIAARHGLAVDTDPDLIESANFFEGRRISPGDG
AWRDPRVWWQLRNPFRPSWGEPYTEIAARMETAVDKARARGTGHEVVCVS
HQLPVWTLRLHLTGRRLWHDPRKRECGLCSITTLVYDGDRLVDVEYSEPA
AP
118466232YP_880904.1 acyl-CoA dehydrogenase [Mycobacterium avium 104]MTTSITAGTLPKEYQDLRDTVAEFARTVVAPVSAKHDEEHSFPYEVVAKM
GEMGLFGLPFPEEYGGMGGDYFALSLALEELGKVDQSVAITLEAGVSLGA
MPIYRFGNEEQKRKWLPDLTAGRALAGFGLTEPGAGSDAGATRTTARLED
GEWVINGSKQFITNSGTDITSLVTVTAVTGTVGADKKEISTIIVPSGTPG
FTVEPVYSKVGWNASDTHPLSFSDARVPEENLLGARGTGYANFLSILDEG
RIAIAALATGAAQGCVDESVKYAKERQSFGQPIGSYQAISFKIARMEARA
HVARTAYYDAAAKMLAGKPFKKEAAIAKMIASEAAMDNARDATQIHGGYG
FMNEYPVARHYRDSKILEIGEGTTEVQLMLIARSLGLS
118466231YP_882990.1 DAK2 domain-containing protein [Mycobacterium avium 104]MAAQRRWVTLGSSWTSHDRPLDAAALRDWAHTAVSDLITHIDEINRLNVF
PVADSDTGANMLFTMRSALAELQAAGGPGCVARAAAALSTGALNGARGNS
GVILSQILRGVADVTATAAARAGGQLAHIEAAVLGAALQRGVELVIASMG
GEEIPGTIVSVLRAAATAVAQCARAGEGVTAAVIAAGDAAVIALEKTPEQ
LDVLADAGAVDAGGRGLLVLLDALRTTITGQAPARTVYRLAPRTAAPEAA
APRPAPQFEVMYRLDDCAPAAADALRDRLTELGDSVGIASAPSSAQHTYS
VHVHTDDAGAAVEAGLAAGRLSRIVISALSSGGPGLPAGGWTRERAVLAV
VDGDGAAGLFSGEGACVLQRDPAAADPVTTISAHQLMRAVVDTGAAQVMV
LPNGYVAAEELVAGCTAAIGWGIDVVPIPTESMVQGLAALAVHDTGRQAV
DDGYTMARAAGAARHGSVRIATETALTWAGSCRPGDGLGIAGGEVLIVAA
DAVGAAIGLLDLLLASGGDLVTVLLGAGLDADGSDAHAGAVVDILEEHMH
DHHPGTELVTYRTGHHGDVLLIGVE
118466230YP_881427.1 transposase- Mutator family protein [Mycobacterium avium 104]MSVMDVKRPPRDPSSQPSTESSRSPTMTAPHIVDPAGLLGEALAEASPDL
MRSLLQTVINALLSADADAVVGAEWGQPTPGRRAQRNGYRHRGLDTRVGT
IDVAVPKLRKGTYFPDWLLERRKRAESALITVVADCYLAGVSTRRMDKLV
KTLGIDSLSKSQVSRMATDLDEHVEAFRHRPLDSAGPFTFVAADALTMKV
REGGRVVNGVVLLATGVNGDGHREVLGMRVVTSETGPAWNEFFADLVARG
LAGVRLVTSDAHAGLREAIAANLPGAAWQRCRTHYAANLMSICPKSMWPA
VKAMLHSVYDQPDAPAVAAQFDRLIDYVTDKLPAVADHLATAREDILAFT
AFPKDVWSQIWSNNPAERLNKEIRRRTDAVGIFPNRDAIVRLVGAVLAEQ
NDEWAEGRRYLGLDILTRCRLTTITDDNPDIGANDMPALTA
118466229YP_882939.1 TetR family transcriptional regulator [Mycobacterium avium 104]MARTQQQRREETVARLLDASIATIIEVGYARASAAVITKRAGVSVGALFR
HFDTMGDFMAATASEVLRRQLESFTKRVAEIPADQPVLEAVLGILRDLTS
GPVNAVIYELTVAARTDEKLRETLQHELAQYAAKIDEVSRALPGVEGFPA
DTFPVLVALMRNVFDGAAVVEGVLPQPEIAAQRIPVLTALLNAALPQ
118466228YP_882416.1 hypothetical protein MAV_3234 [Mycobacterium avium 104]MGTEALSAGALTERDLRRSCTRIYRNVYQRGADFTASDRAIAAWLWSGRR
AVVAGNSAAALLGAQWVDPRAPAELITDRKRPPPLIVARNETLLPDEITE
VRGVPVTTPARTAYDLGRRPGLVAAVIAIDSLARATGLTTECVEPLMRAH
RGARGVRQLRRVLPLIDAGAESPQETRTRLAIVGAGLPKPSTQITVHNDW
GFVLARIDLGWEQWRVGVEYDGAQHWTDPRIRAKDIDRVAELERRGWRII
RVSADLLRNRPDVLVGRIREALCAAGCPL
118466227YP_881080.1 TetR family transcriptional regulator [Mycobacterium avium 104]MSDHRRPTERDAIMRAAYRLISEGAAGPSASSSTSIENILRVARVNRRVF
YRHFASKDDLIIAMQEWAGDLILADLQKAVAAADTPAAAVAAWIEDYLSI
GWQEARFRDALAFMSAEVIGAPGIAAALEVTYDRHRAVLTEALAAGLADG
SLPNAHPELDSFAIHAVTVRHLEARIRGRLDSDFREVRDQIVTLMLTGLS
APAVYRTATR
118466226YP_880521.1 acetyl-CoA acetyltransferase [Mycobacterium avium 104]MAEAVIVEAVRSPIGKRNGGLSGVHPAELSAQVLNGLVDKAGVDPGIVDD
VIWGCVMQAGEQALDIGRTALLTAGWPETVPGVTVDRQCGSSQQSIHFAA
AGVIAGHYDVVVAGGVESMSRTPMGASLANGGRPYPQAFLDRYQGQIPNQ
GIGAEMIAEKWGFDRTALDEFSLASHEKAAAAQDSGAFDDQIVGIKDQDG
NVVLKDEGIRRGTPMEKMASLKPAFKEDGVIHAGNSSQISDGSAAILFMS
AEKAKELGLKPIAKVHTATLAGADPVIMLTAPIPATQKVLKKSGLSIDDI
GVYEVNEAFAPVPMAWLKDIGADEKKLNPNGGAIALGHPLGGSGARIMTT
LLYHMRDKGIRYGLQTMCEGGGQANATIVELL
118466225YP_881063.1 alpha/beta hydrolase [Mycobacterium avium 104]MASIAVGDVEIDYVDAGSGPVVVFVHGAYVTGLLWQDVVDRLSDSHRCIA
PTLPFGAQAAPVGAHVDLSVAASGRLIAGLLDALDLSDVTLVANDTGGGI
VLAALGNASLKWDRVSKLVFTNCDSFEHFPPKSFAPIVRLCALSQSLGAI
ALKGLTTAPGLKVFTSAVTLNGVDAARRRAVFGGFLTSPAVRREAARFTA
DLKPSHTLAAVDALKRWDRPVLMAWGTSDKMFPLSHAERLAETFPNAVVR
AIDNSSTYVMLDRPDETAQAIRAFVDPMKDVTR
118466224YP_883789.1 DNA-binding response regulator [Mycobacterium avium 104]MTSVLIVEDEESLADPLAFLLRKEGFEATVVTDGSAALAEFDRAGADIVL
LDLMLPGMSGTDVCKQLRARSSVPVIMVTARDSEIDKVVGLELGADDYVT
KPYSARELIARIRAVLRRGGDDDSEISDGVLESGPVRMDVERHVVSVNGD
TITLPLKEFDLLEYLMRNSGRVLTRGQLIDRVWGADYVGDTKTLDVHVKR
LRSKIEADPANPVHLVTVRGLGYKLEG
118466223YP_881439.1 transposase- Mutator family protein [Mycobacterium avium 104]MVKRPRITTERNIAMALDQSALLEVLDALRTADAGERITQAAETIYQALI
DAELTAFIGASPHERTETRSNQRNGSRPRTLSTVAGDLELRIPKLRTGSF
FPALLERRRRVDQCLFAVVMEAYLHGTSTRKVDDLVKALGTDTGISKSEV
SRICKDLDTEVAAFRDRPLGDQRFPYVFLDATYCKARVNHRVVSQAVVIA
TGVAADGRREVLGFEVGDSEDGAFWTAFLRSLKSRGLAGVQLVISDAHAG
LRSAIDAVLIGAAWQRCRVHFLRNVLAQVPKGSAEMVAAAIRTVFAQPDA
EHVREQLDTIAGMLGRQFPKVETMLREAAADITAFADFPVAHWKKIWSTN
PLERLNKEIKRRTDVVGVFPNPAALLRLAGSVLVEAHDEWQVADKRYLSE
TSLALLDVSDQSAETIAPTAALTA
118466222YP_879663.1 hypothetical protein MAV_0377 [Mycobacterium avium 104]MGCAAAAVTLVGCSSGGHSAAPASSTAPSASTGTNAQVKVGGADLPGVNP
ASVTCVRTGGKIDIGSGSTGGAQQALAVVLTDEATPKVESLALVVDGNAL
AVSNNMGAKVGSADVAVDGKTYTITGQAQGADMKNPMAGMITKDFSIKVS
CG
118466221YP_884387.1 TetR family transcriptional regulator [Mycobacterium avium 104]MEPSRRWGDDRAILDDEEARRRILEAAGRCIVRRGNTQFRMGEVADEAGV
SRSTVYRYFPGRDDVLLGLMLRRVDHALAESVRSLPAPEDPVRSVPQMVL
ARVESVDGNPLNEALFAAESTAMASALQKGSEPLVELLLRHYGPLLERWK
AAGLLYPDVDFRSVVQWLHTATLFLLAPSWRYRPHADKRRFVEQFVVRAL
VPQIRQ
118466220YP_880109.1 hypothetical protein MAV_0836 [Mycobacterium avium 104]MTQLFGGICDRCLKPFRAARFPNDCLCRACYLGALPPVERAVALVSGAVS
118466219YP_881549.1 Wag31 protein [Mycobacterium avium 104]MAFSKPPIGKRGYNEDEVDAFLDLVEAELTRLIEENSDLRQRIEELDQEL
AAGGGAAAPAAAAPTQAIPVAEPEPVKAAPAAAVSNEEQAIKAARVLSLA
QDTADRLTSTAQAESEKMLADARANADQILSEARSTAETTVAEARQRADA
MLADAQARSEAQLRQAQEKADALQADAERKHSEIMGTINQQRTVLEGRLE
QLRTFEREYRTRLKTYLESQLEELGQRGSAAPVDSSADAGGFDQFNRGNN
118466218YP_880390.1 hypothetical protein MAV_1139 [Mycobacterium avium 104]MIRGARDFTPGMTITTDVAVVGSGPIGIVTALELAASGVQVVLIESGAQR
PDRAAQQLAEFDSRHDDYFHSRSGLTVRRQVGGTSALWGGRCVKFDRIDF
EHRLITEQAPWPIGYDDVEPYLQRACDWAACGRAVFNARDIPELAHRDLV
AGLPDGAVRSTDLERWALPTRFGRHYRKALRRTAGLTLWTGLTCTEIVTE
PAGGRVDHLVVKTLPGAQGKVVATVDAAEKSWSAEVCGPCGTGDQRFAVT
NDMCFPLRGKDDRDVV
118466217YP_880702.1 cell division cycle protein 48 [Mycobacterium avium 104]MPDVEPPALAAVLAGEDSSVRRAVQLVGQILTASVTTQVTLAGFLHAVLG
RSGSDLVCESRRLSSIGHVAAGLALAALIDRFDPPIGPSDDDEPPTWAHI
EIGDKRLAPPARLSAFFTAGQLAPAPVVVRLSSSTLYSDTPRLQVYTTPA
DRGHAVAVIEAIMTDADGAKNLYRGRALTASENNGLVLEVTEIPALSRTN
VVVPESVWEEIDLNIAALTTHRELMTQLGLGVRRGILLAGPPGVGKTAIS
QTIAGELVGPFTVINVDARAGKSVLSAVYKEARALGPTVIVLEDIDLIVG
NRRHHGEVRPLSEFLAVMDTDPAAPILTLASTNDVAALDAAAIRTARFDS
IIEIGYPTREAAAQILTTYLRGIPGAESVDASQVAAHFNAEINGADIREI
VRRTVLATGTVTDTALLATIRSGRFKPELPQGSYL
118466216YP_883799.1 hypothetical protein MAV_4671 [Mycobacterium avium 104]MTNPQGPPKQDPSTWGRPANQGPYGQPPTERPTERINTGGPGQAPGQVPP
PPPAPAPPPPGQTERFGTPRPQMQQPGYPPPPTPPAGPTERLATAPNPDN
GPAKKKRRFLRDPVSVLLIFIIVFALIIAGFIGAELYVRHVADTKVAQAV
ACEVKDQATASFGVTPLMLWQQATKHYTNISVQTAGNNIRDAKGMKLSIN
INDVRLKDNGNSKGTIGALDATIDWTTDGIKQSVQNAIPVLGPFVTNTVT
THPADGTIELKGMLDNITAKPVISGTGLQLQIVSFNALGFTMPKESVQST
LDDFTSNLTKNYPLGIHADSVQVTDKGVTSHFSTRNAAIPTGNNNDPCFA
NL
118466215YP_882666.1 pyridoxal biosynthesis lyase PdxS [Mycobacterium avium 104]MNTAHSPDGSGRTGTARVKRGMAEMLKGGVIMDVVTPEQAKIAEGAGAVA
VMALERVPADIRAQGGVSRMSDPDMIEGIISAVTIPVMAKARIGHFVEAQ
ILQSLGVDYIDESEVLTPADYTHHIDKWKFTVPFVCGATNLGEALRRINE
GAAMIRSKGEAGTGDVSNATTHMRAIGGEIRRLMSLSEDELYVAAKELQA
PYELVVEVARAGKLPVTLFTAGGIATPADAAMMMQLGAEGVFVGSGIFKS
GDPAQRAAAIVKATTFYDDPDVLAKVSRGLGEAMVGINVEQIAQPERLAE
RGW
118466214YP_884139.1 GntR family transcriptional regulator [Mycobacterium avium 104]MSMQPRSRRPLRRAQLSDEVAGHLRAAIMSGALRPGTFIRLDETAAELGV
SVTPVREALLKLRGEGMVQLEPHRGHVVLPLTRQDIEDIFWLQATIAKEL
AAAATDHITDTEIDELDRINDALAAAVGSGDAETIAGLEFGFHRVFNQAS
GRIKLAWFLLNAARYMPVLVYAADPQWGRAAVDNHRQLIAALRRRDTAAV
IEHTVWQFTDAAARLTAMRDRTGTPSNRG
118466213YP_881708.1 extradiol ring cleaving catechol dioxygenase [Mycobacterium avium 104]MNIFGNVHLGYLVIETDRFADWRRFGRDAIGMHLDDVLPDAMRFRLDDNA
CRFLLQRGAGEDVTALGWQLDDHATFEEILARLTRHEMPVTEGTPEQAAL
RGVDRLVRFPGPNGLAHEIFTRARIGHTPLDMRVGGGFVTGEGGMGHVAI
VSKEPQQMRGYYDTVFDARLSDYIDETISGLKFKIRFLRVNQRHHSVAIA
AANRLPINPIRTRIQHCNIQVGDLDDMTASYQRVKALGFKMALSVGQHTN
DRELSYYAISPSGFEWEVGWNPVVVDENTWEPTTYQGISIWGHTPEGQTI
IDKLAQFKSAAISLLHRENTVPALARTGIPDD
118466212YP_879369.1 hypothetical protein MAV_0069 [Mycobacterium avium 104]MAKWLGTPPAGTAPPSGRASTRAKDSDRQSTCTILDNALNDGELSAEEHR
ERVSAATRAVTLGDLQTLVCDLQTGPQPPALDPSPPSGRVRGWGTLAAAF
VVSVLLGIGIGWGLYGNTSSPLDFTSDPGAKPDGVNAVVLTPPTQLHSVG
GLTGLLEQMRKRFGSTLGYRLVIYPTYAALDRPDPSDDRRVLAYTYRGGW
GDPTSSAKSSSDGPVLVDLSKFDVTAAVGIMRGAPETLRMKPSDVKTSYL
IVEPATDPTTPGALSLSVYVSSDYGGGYIAFTGDGTVKQMNLPT
118466211YP_880641.1 homoserine dehydrogenase [Mycobacterium avium 104]MTKKLRVIQWTTGKVGKLSLRGVLDDPRLELVGVYAFSEEKAGSDAGALC
GRPDTGVLATTDIDALLALKADTVIYTPFMADIDQVVRLLESGLDVISTN
LFLNVGGIQGETKQRLAAACQRGGSSLYITGVNPGWINTMVTAMTAVCRH
VEMVSVSESADVSVYESPETWQSQGFSLSEAPPAVIETAKMWLSTFRDSV
QRMAVALGFELDDMEFFIEHATASERVHLGWWVIEKDTIAAMRAGWNGKV
NGKTVVQSNVAWYMTTLLNEGWQFDDDHYHVVIKGEPGVDTRIRFLPPDS
WGNHEWDTMTAMPAVSAAVDVAAAPAGILTLKDVGLPCAPAGLWLEG
118466210YP_883424.1 phosphoglucomutase/phosphomannomutase [Mycobacterium avium 104]MTPEEWIAHDPDPRTAAELAACDAAELAARFARPLRFGTAGLRGPVRGGP
DAMNVAVVSRASWALAQVLKRRGPAGARVIVGRDARHGSAVFATVAAEVI
AAQGFSVLLLPGPAPTPVVAFAVRHTGAAAGVQITASHNPPTDNGYKVYD
GGGIQIVSPTDHQIEAAMADAPPADEIRRTPVPPAHTDLVQRYIERAAGV
RRGTGSVRVALTALHGVGGTVAVDALHRAGFGRIHTVASQFAPDPDFPTV
AFPNPEEPGATDALLTLAADVDADVAIALDPDADRCAVGIPDASGWRMLS
GDETGWLLGDYLLSQPQRADRPVVASTVVSSRMLSAIAARHGAVHVETLT
GFKWLARADAEVPGGTLVYAYEEAIGHCVDPAAVRDKDGISAAVLVCDLV
AALIARGGSVSGRLDELARRHGVHDVAAVSRRVGTDGAAELMRRLRTSPP
ETLAGFGVALTDITDALIFTGGDDDTSVRLVVRPSGTEPKVKCYLEIRCA
PSDDLASSRRRARALRELLVATVRSW
118466209YP_879790.1 type II secretion system protein F [Mycobacterium avium 104]MTGPVVGALLLAVALVVGPPSPRRRLGVAVTGSRRPSARRLAGLGWVAAG
AGCAALAVLPLPSVLAGAVVAATAGLRHRRRGRIRRAAGEGRALETALDV
LVGELRAGSHPVRAFDVAAGETAGPVAVALRSVAARARLGADVAAGLAAA
SRGSARPEHWQRLALCWRLAGDHGLGIATLMRAAQRDIAERQRFSARVSS
SLAGARATAAILAALPVLGVLLGQLIGARPLDFLLGGQVGGWLLLVGATL
ACAGLLWADRIVDRVMA
118466208YP_880118.1 cytochrome p450 [Mycobacterium avium 104]MTDLAQVDYFTDADVAQDPYDYWDYLREQGPVFREPHYGVVAVTGYQEVQ
AAFKDVESFSAVNAIGGPFPPLPFTPEGDDISELIEAHRHEFPIFEHMVV
MDPPEHDKARSLLGRLLTPRRLQENKDYIWQLADRQFDEFIANGHCEFLS
EYAKPFATLAIADLLGVPDEDRPQIRRNLGAGNAPGARVGALDHEPVGSN
PLQYLDDLFSGYIADRRERPRDDVLTGLATATYPDGSTPPLLEVVRPATF
LFAAGQETVTKLLSAAVQVLGDQPELQAQLRADRGLIGPFIEEALRMQSP
TKVDFRLARKTTTLGGVHIPAGTVIMLCLGAANRDPRKFENPNEFRIDRK
NVREHIAFGRGIHTCAGAPLARVEGQITINRLLDRTSELRINEAKHGPAS
SRQYRYESTFLLRGLTELHIEFTQAG
118466207YP_880526.1 hypothetical protein MAV_1281 [Mycobacterium avium 104]MRVLVTGATGYVGSRLVTALLAGGHDVLAATRNPLRLKRFGWFDEITPVP
LDAADPASLRSAFAGCGPVEVVYYLVHAIGQPGFRDADKAAAANLAAAAK
DAGVRRIVYLGGFVPAGEVLSEHLTSRAEVAEALAVPDGPELVWLGAAMI
IGAGSTSFEMMRYVGDRFPLMPIPSWMDNPIDPISIRDVLHYLLAAADRD
LVPAGAYDIAGPDTTSYRRLLKTYARLSGRWHTGLPVGRVDTGLASLVTG
VALPVPPGLAGDLVESLDHPMVASGSDLRQRVPDPPGGLLGVDDAIARAL
DDRSYRRPRPVNALADPHHLADTDPGWAGGDARRIRQLAGRVTPAIARPT
LGLVNKVPGPVAGAVRTGLDILIALTPKVRPA
118466206YP_879505.1 phosphoribose diphosphate:decaprenyl-phosphate phosphoribosyltransferaMTEETQEAVAGPPANVVSGVIKAIRPRQWVKNVLVLLAPVAALGGPVQYD
YTDVLGQVSVAFVVFSLAASSIYLVNDARDVEADREHPTKRFRPIAAGVV
PEWLAYTLAVLLAAASLGIGWWLTPNLAAVMAVYIAIQLAYCFGLKHQAV
MDICIVSSGFLLRAIAGGAATNIRLTQWFLLMMAFGSLFMAAGKRYAELQ
LAERTGAKIRKALESYTSTYLRFVWTLSATALVVCYGLWAFDREHGEARW
FVVSMVPFTIAILRYAVDVDGGLAGEPEDIVLRDRVFQLLALAWMVTVGA
AVAFG
118466205YP_881326.1 AMP-binding enzyme- putative [Mycobacterium avium 104]MTFWSLIAEAARRGSPRPLLADEHGRSMTARQLYDAACVAAAALAERGVR
PGAVVSWQLPTTLETMVLMAALARLGAVQNPIIPVLRESEVRFITGQLNT
EYFVAPGLWRGFDHGGLARALSAERGFEVITVDLAAPPAAGALRLPGADP
DSLPAPPQSADEARWIYYSSGTTAAPKGIRHTDSSVIAGSAGVVGMVGAT
SSDVDPIAFPVAHIGGAAMLATALLTGMRLALFEAFDPAATPLAIAAHNP
TFLGTATPFFVAYLEAQRAQGNRPLFPSLRGCLAGGAPITAELSRRVRDT
FGVAGIANAWGMTEFPCATSPSLTAAPEVLDHTVGPPVPGVEVRVVDGAE
NELAAGQEGELRLKGPQCFLGYADPTLDADAFDDQGWLRTGDLGLIDADG
NVRVTGRTKDAIIRNAENISALEIENALAAHPAVADVAVIGIPDPRTGER
VCAVVVPATADGVTLESLVQHCRSRGLSRYKHPEHLVVVDTLPRNQFGKV
IKKDLRDAFG
118466204YP_883002.1 hydrolase- NUDIX family protein [Mycobacterium avium 104]MPTQNSSTARRAGTRVVYAAGAVLWRPGDAEPDGGDVEVAIIHRPRYDDW
SLPKGKVDPGETAPVAAVREVREETGQCAVLGRRLDTVRYPIEQGVKKVY
YWSARATGGEFVPGDEVDQLLWLPVTEAMQRLNYTQDRKVLRHFNKKPAD
THTVLVVRHGTAGRKSRFSGDDAKRPLDKRGRAQAEALVPQLLAFGASQV
HAADRVRCHQTVQPLAEELDVPVHNETTLTEEAYAKNPKRARHRMLEIAG
EPGTPVVCTQGKVIPDLIAWWCDRDGVRPDKSRNHKGSTWVLSLSAGRLV
AADHIGGALAANVRA
118466203YP_884025.1 nitrite reductase [NAD(P)H]- large subunit [Mycobacterium avium 104]MVGHRFVEALRARDTEGRWRITVFAEEADAAYDRVGLTSYTESWDRALLA
LPGNDYQGDPQVRLVLNQRVTEIDRATKSVVTADGQRHHYDTLVLATGSY
AFVPPVPGHELPTCHVYRTLDDLDAIRADAQRAAQTDHARAGVVIGGGLL
GLEAANALRQFGLATHVVEMMPRLMAQQIDEAGGALLARMIGDLGISVHV
GTGTEAIEPVEGPDGSTTVRVRLSDGQVIDAGLVIFAAGIRPRDELAVAA
GLARAERGGVLTDLSCRTSDPDIYAIGEVAAIDGRCYGLVGPGYTSAEVV
ADRLLDGSAEFGEADLSTKLKLLGVDVASFGDAMGTTENCLEVAINDAVN
RTYAKLVLSDDAKTLLGGVLVGDASSYGVLRPMVGSELPGDPLALIAPAS
SGGGTALGVGALPDSAQICSCNNVTKGDLKCAIADGCADVAALKSCTSAG
TSCGSCVPLLKQLLEAEGVEQSKALCEHFSQSRAELFEIISATEIRTFSG
LLERFGRGKGCDICKPVVASILASTGSEHILEGEQASLQDSNDHFLANIQ
KNGSYSVVPRVPGGDIKPEHLILIGQIAQDFGLYTKITGGQRIDMFGARV
DQLPAIWKRLVDGGMESGHAYGKALRTVKSCVGTDWCRYGQQDSVQLAID
LELRYRGLRAPHKIKMGVSGCARECAEARSKDVGVIATEKGWNLYVGGNG
GMTPKHAQLLASDLDTETLVRYIDRFVMYYIRTADRLQRTAPWVESLDGG
LDHVREVVCEDSLGLAEEFEAAMERHVRNYKCEWKGVLDDPDKLSRFVSF
VNAPDAVDSTVAFTEHAGRKIPVSIGMPKIRQG
118466202YP_879961.1 hypothetical protein MAV_0682 [Mycobacterium avium 104]MRDRETIDAELRRIALARRSIHRQGGQPSSREVDELLDELLAHSAGQAVP
DQAASQETAAAATPRRHGGALHRAGLLAALPLSLIAVAAAAVMIFFVHQR
DSTAPATEPAPSAAPPKAAAPKPPAPRIEMADMAFIAALKHEGVPVPSQD
YVMKQGHAVCDFLAQQHNFADAIGFVQRSSIWNAEQSAEVTAGAIVAYCP
QSQATAADLTGPAYQNTLSDLQAIEGKLQGIEGDLQGIQRDLDNIPGHR
118466201YP_879744.1 acetyl-CoA synthetase [Mycobacterium avium 104]MTASNTANPPSYPPPPQFVEQANAGEQLYREAERDRLAFWAEQANRLSWA
TPFTEVLDWSRAPFAEWFADGTLNVAYNCVDRHVQAGHGDRVAIHWEGES
PGDQRSLTYSELYTQVCKAANALTDLGLVAGDRVAIYLPLIPEAVIAMLA
CARLGVMHSVVFAGFTAKALQARIADAAAKLLITSDGQFRRGKPAPLKDA
ADEAVADPDSPVEHVVVVRRTGIDVSWTDGRDLWWHDVVDAAAPEHTPEP
FPAEQPLFLLYTSGTTGKPKGIVHTSGGYLTQAAYTHYYVFDIKADTDVF
WCTADIGWVTGHTYGVYGPLANGVTEVLYEGTPDTPTQHRHFEIIEKYGV
TIYYTAPTLIRTFMKWGREIPDAHDLSSLRLLGSVGEPINPEAWRWYRSV
IGADRLPIVDTWWQTETGATMISPLPGVAAAKPGSAMRPLPGISARIVDD
HGDQLVPGIHHGEHVTGYLVLDQPWPSMLRGIWGDPDRYVETYWSRFAEQ
GWYFAGDSAYYDRDGAIWVVGRIDDVMNVSGHRLSTAEVESALVGHHGVA
EAAVVGATDATTGQAICAFVVLCADYQVHDGIVDELRAEVAREISPIAKP
REVHVVPELPKTRSGKIMRRLLRDIAENRELGDTSTLLDPGVFDAIRAAK
118466200YP_881855.1 hypothetical protein MAV_2664 [Mycobacterium avium 104]MLCRCDDTGKWIHPPLERSRYTGGPVHFEEVSGDGTIFSYIVVRQALVPG
RTPPYVVGLVELAEQPGLRINAVIDVDPADVRIGQDVELRIVDLGESGYR
IPEFVIK
118466199YP_880259.1 cold shock DNA-binding domain-containing protein [Mycobacterium avium MPTGKVKWYDADKGFGFLSQEDGEDVYVRSSALPAGVEGLKAGQRVEFGI
ASGRRGPQALSLKLIEPPPSLTKARREGPAEHKHSPDELHGMVEDMITLL
ESTVQPELRKGRYPDRKTARRVSEVVRAVARELDA
118466198YP_880471.1 carboxylesterase [Mycobacterium avium 104]MAVDDLVVETGYGPVRGVPVDGVKAWKGIRYAAPPIGDLRFRAPQPPERW
TEVADATVFGPACPQPVFPNMPLDLGAPQGEDCLRLNVWASADTQPGDAK
PVMVWLHGGAYVLGSSSQTLYDGRRLVSHGDVVVVTVNYRLGALGFLDLS
SLNSAGRSFDSNVGLRDVLAALEWVRDNITAFGGDPRRVTLFGESAGAGI
VTTLLASPAAAGLFAAAIAQSSPATSVYDRDRAARVAEAFLGKLGITASE
SRRLIDMPMAAILAASQQVFDEVPVRNPGTLAFVPIVDGDVLADYPVKVA
QQGCSHPVPLIIGTNQHEAALFRLMRSALMPITPHAITSMFNQIAAEQPD
LQLPTEKQIGSAYSRFRRRARYLSIATDVGFRMPSVWLAEGHARVAPVYL
YRFDYSTPLLRLLMVKAAHATELPYVWGTLGAPKDPTLKLGGSKTAKAVS
KRVRTRWTNFAAHAKPAGPAGSPEWAPYQEQDRACLIIGKNDVLAHDVDA
KARAAWGSEMVSFR
118466197YP_883285.1 hypothetical protein MAV_4137 [Mycobacterium avium 104]MGMRPTARMPKLTRRSRILILIALGVIALLLAGPRLIDAYVDWLWFGELG
YRSVFSTVLVTRFVVFLIAGLLVGGIVFAGLAVAYRTRPVFVPSNDNDPV
ARYRALVLSRLRLVSIGVPVAIGLLAGIIAQSYWVRIQLFLHGGDFGIKD
PQFGKDLGFYAFELPFYRLLLSYLFVAVFLAFVANLLAHYIFGGIRLSGR
TGALSRSARIQLVTLVGLLVLLKAVAYWLDRYELLSHTRGGKPFTGAGYT
DINAVLPAKLILMAIALICAAAVFSAITMRDLRIPAIGLVLLLLSSLIVG
AGWPLIVEQISVKPNAAQKESEYISRSITATRQAYGLTSDVVTYRNYTGD
AQATAQQVADDRATTSNIRLLDPTIVSPAFTQFQQGKNFYYFPDQLSIDR
YLDRNGALRDYVVAARELNPDRLIDNQRDWINRHTVYTHGNGFIASPANT
VRGIANDPNQNGGYPEFLVNVVGANGNVVSDGPAPLDQPRVYFGPVISNT
SADYAIVGRNGADREYDYETSTETKNYTYTGLGGVPIGDWLSRSVFAAKF
AERNFLFSNVIGSNSKILFNRDPARRVEAVAPWLTTDSSVYPAIVNKRLV
WIIDGYTTLDNYPYSELTSLESATADSNEVAFNKLAPDKRVSYIRNSVKA
TVDAYDGTVTLYQQDEQDPVLKAWMQVFPGTVKPKSDISPELAEHLRYPE
DLFKVQRMLLAKYHVNDPVTFFSTSDFWDVPLDPNPTASSYQPPYYIVAK
NIAKNDNSSSYQLTSAMNRFKRDYLAAYISASSDPATYGRITVLTIPGQV
NGPKLANNAITTDPAVSQDLGVIGRDNQNRIRWGNLLTLPVGQGGLLYVE
PVYASPGASDAASSYPRLIRVAMMYNDKIGYGPTVRDALTGLFGPGAGAA
ATNIQPTEGGAPAASPPANAPAPAVTPGSAPPVAAPPVPDGSVTLSPAKA
AVLQEIQAAIGAAKDAQKKGDFAGYGAALQRLDDAITKYNNTK
118466196YP_881419.1 bifunctional RNase H/acid phosphatase [Mycobacterium avium 104]MKVVIEADGGSRGNPGPAGYGAVVWTPDRGTVLAENKQAIGRATNNVAEY
RGLIAGLDDALKLGATEAEVYLDSKLLVEQMSGRWKVKHPDLIELHAQAR
GLAARFDRISYSWIPRERNSHADRLANEAMDAAAAATGTAEKPEPAEKPG
RAEQSDPTAVDAGKTAAAPSPAAPGWTGARGTPTRLLLLRHGQTELSVQR
RYSGRGNPALTETGRRQADAAARYLAARGGISAVFASPLQRAYDTAAVAA
KALGLDVTVDDDLIETDFGAWEGLTFGEAAERDPGLHRRWLRDTSTAPPG
GESFDSVAERVSRVRQKIIAAQQGSTVLVVSHVTPIKMLLREALDAGPGI
LYRLHLDLASLSIAEFYSDGAASVRLVNQTGYL
118466195YP_880182.1 hypothetical protein MAV_0920 [Mycobacterium avium 104]MPPAPPDWYQPPPPYAPSFAGQDVPPPPPRPWWSPNEPMWSVRFHQWGTY
VAGTWVPF
118466194YP_881768.1 amidohydrolase [Mycobacterium avium 104]MTQFTDAPIFDADQHMYETPDALTKYLPKEFQPKVQFVQIGRHTRIAILN
KITDYMPNPTFERVAAPGAHEKFYSGQNPEGLSMREMSGRGIDTPPGARN
PEDRIAELDRQGVDACLNYPTLANLVEHSAAEDPDLTVAIIHALNQWMLE
HWGFSHANRVYSTPVLTLGLVDEARRELEYILDNGAKVALIKPAPVNGYK
GWRSPALPEFDPFWRDVEDAGLPIVLHASQPPLQEYIDRWEPPSTSSAFE
MSAFKWTALGHREIADMLTSLICHGTLTRFPKLRIASVENGSAWIKPLFD
DLQSTYGKMPQNFPEHPHDVFRRNIWVSPFWEGSVADVVQTVGWDKVMFG
SDWPHPEGLAEPKRYWQYAEGMDERRTYDFMGDNARRFMGLPIANPDPEA
VKPPQLANA
118466193YP_882276.1 hypothetical protein MAV_3092 [Mycobacterium avium 104]MADTSRPDHLPNLRDDGKPPHPSWLPRQRRGTTPQMIGRYPDFDVLQTAG
HWDEATRNVVLARLEPPGPLRFFGPEEEPCLRAFCDTVLAQDVEPRVPVA
ESVDAKLADGRLDGYQYADMPDDRDTWRLVLRGLDETASRRYGADSFAAA
EPPTREAIIDEFSRGELHGGSWDSLNVKRAWSVCMRMTLSGFYSHPWAWN
EIGFGGPAYPRGFMRLGGATGPAAAREPYETRGATDEDPVQVVQNGEL
118466192YP_881369.1 cytochrome P450 superfamily protein [Mycobacterium avium 104]MSSASRATVPSAYLHPRFQGQEPPGFPGRFTVAWNENYGGFWFLSSYDAV
SQTARNGDTFAHKYEPNAADGVDYQGEMGVPRPEGQPALGLGEVDGPYHQ
ALRHALAPFFSPGAVEKLKPFMEQSAHWFLDQQITTGQMDLVLDYASPVP
AILTMKLMGLPYDNWHLYANLFHSVMAVSQDSDEYATAIAKVPAMMHEVL
DYAATRRAKPEEDLTSFLIRFEFDGHRLTDEQLLNILWNLIGGGVDTTTS
QTALTLLHLGTHPDLRQQLIDHPELYRTATDEFLRYFSVNQTLSRTVTHD
VVLAGQRLRKNDRVVISWLSANHDENEFDRPDEIILDRSPNRHVAFGLGP
HRCIGSHLARLMSEVMVRAVLDRIPDYQVDVENVHQYLGNPSMTGLGQLP
VTFAPGKSRKTLLPW
118466191YP_882171.1 TetR family transcriptional regulator [Mycobacterium avium 104]MDKRRKPNPAERRRDLCDAAIRLLADDGAKGLSHLKVDRKAGVPDGTTSF
YFRTRSALLRAAAERLAELDLAELQEIADSSGPGPSPSRLSQVVAQAGAD
PQLYRTRARYELTLQATRDPALAAILQQATDAFTKLHREILVQLMPHGAQ
LDPAVVEDLSNVTLTFINGLLQRLVHGDRIVDSPEQLDGILSAIATGILK
SPDKGRLTRTGGQAAARRRADDSE
118466190YP_883689.1 hypothetical protein MAV_4559 [Mycobacterium avium 104]MRVDGRDIIVSGSLLQPLTRRTNDILRLGMALIFLAVVITGSVITRPQWI
ALEKSVSQIVGVLSPTQSDVVYLVYGLAIVALPFMILIGLIAAGQWKLLG
AYAAAGLSAIVLLSISGTGLAAPRWHFDVLDRLTTLPAQLLDDPRWIGML
AAVLTVSGPWLPARWRHWWWALLLAFVPIHLVVSAIVPARSLVGLAVGWV
VGALVVLVVGTPALEVPLDAAVRALAKAGFEVCRLTVVRPAGRGPLILSA
DGQDADHTALIELYGPHQRSGGALRQLWGKLKLRDAETAPLLTSMRRAVE
HRALMAIAIGEAGLANTATVAVATLDRGWMLYSHKPPRGTPIDRCAKTTP
VQRLWEALRVLNDHQIAHGDLRAHHITVDDGAVLFGGFGSAEYGATEAQL
QSDIAQLLVTTSAHYDPKSAVGAAIDVFGADTILSASRRLTKVAVPKSVR
RTVPDSGAVISGARAEVKRQTGADQIKPQTITRFTRSQIIQLVLFGALVY
VAYPFISTAPTFFSQLRTADWWWALLGLLVSALTYVGAAAALWACTDGMV
NFWMLSIAQVANTFAATTTPAGVGGLALSTRFLQKSGLSAMRATAAVALQ
QSVQVIAHLALLVLFSAAAGASMNLSHFVPSATMLYLIAGVALGIVGTFL
FVPTLRRWLATEVRPKLDEVVSDLAKLAREPRRLALILLGCAGTTLGAAL
ALWASIQAFGGDTTFVAVTVVTMVGGTLASAAPTPGGVGAVEAALIGGLA
AFGVPAAIGVPAVLLYRMLTCWLPVFVGWPVMRWLTKHEMV
118466189YP_879528.1 taurine catabolism dioxygenase TauD/TfdA [Mycobacterium avium 104]MEIVASGPGFAAELRGVTIADVAASPDVYAQVRAAFEEHSVLVFRDQHVS
DEAQLAFSRRFGPLGVTKVGAVGHGSHLVVLKTLDDDGNVVPADHRLALE
NKANQLWHTDSSFKRVPALASVLSSRIVPGRGGETEYVSTRIAFERLDPG
LRERVENSFAWHEYAYSRGKIAPDLARPEERAALPPQCWRLVWRNPVNGR
KALYLASHAYGIEGMEPAAARELLAALTEAATAPGASYLHSWRAGDVVMW
DNRATMHRGRPWPAHQPRCMVRSTIAATAADGLEAMYPPWHAVAR
118466188YP_879439.1 hypothetical protein MAV_0144 [Mycobacterium avium 104]MAIEIRVLEDEDDLIAAANVFRTAMVGFAPLAGLAPGQIGTLLEPGRTIG
AYAGGQLVGTADAVTSRLTLPGGALVGHAAVTHIGVLPSFTRQGIATALV
RHQLRDFAARNEVVATLRASEATIYGRYGYGVASSSQSVTVHTARAALRR
DVGPGGPVRLLDTAQAWEVLPRIYAEHRPARPGTIDRPRVWWQGVRLRTE
SAPGPTYVAVHGAPGSETGFVRYRPIDTERWFVSDERTIVVEDFFAPTAE
AYLGLLRFLLGLDLVDRVQFWMLPLDDPLPWLLADRRAVRVTAVHDETWL
RVVDARAALAARGYCSDETVTVAVNDPLLQDNSVCLRIAGGGVAVADGPA
DVDVDVEGLAAVLLGGTTWRDLAVAGLARARDPGALAVADRLFAVPEAPH
AGFFF
118466187YP_880294.1 hypothetical protein MAV_1038 [Mycobacterium avium 104]MTADDLARYRDRVTQLWPPDLIARLHRSHVEPGR
118466186YP_883266.1 hypothetical protein MAV_4117 [Mycobacterium avium 104]MTDTVKVSVDRSSVAMGDDVESHREFWVFPESATVDDLLVEISSHFLPGI
AGPAGWRVYLGTRRDEQQEIGLIYTRDDLGQQDQICRLSAGKTTLGELAR
RTGLPELDVYASYLTFDRARPLALDEITGGPTFTGCRPDKLESEAAADAK
RDWVMLRELDRRAAAVASTRRDWVRRTLLAAPPPWIDVFIARNFHYLTEL
HCPASMALAAKLLGVNESPPEDFAARAHAEVRPNVVILAMVLAAFEWGTE
RDTWRVGERPYRKAYLELLAHCGYRLSPIEQVMAGHIGIEQLKLSKADSA
RLDRIRQLRDQQYQLRMNRYYTKTLSEEQYRAAIEPVHAELSSLGELPGP
M
118466185YP_883593.1 sulfatase-modifying factor 1 [Mycobacterium avium 104]MRSELADLPGGSFRMGSTSFYPEEAPIHTVTVEPFAIERHPVTNAQFAEF
VAATGYVTVAEQPIDPALYPGADPSQLQPGAMVFRPTPGPVDLRDWRQWW
HWVPGASWRHPFGPDSDVADRADHPVVQVAYPDAAAYARWAGRRLPTEAE
WEYAARAGATTTYPWGDEPTSDGRLMANTWQGRFPYRNDGALGWVGTSPV
GVFAPNAFGLLDMIGNVWEWTTTEFSTHHRIGAATKPCCAPSGPADPGVN
QTLKGGSHLCAPEYCHRYRPAARSPQSQDSATTHIGFRCVAEVGSN
118466184YP_881165.1 MaoC family protein [Mycobacterium avium 104]MFVRYAGASGDLNPMHYDDELARSAGYPSVFAQGMFSAALLAGFATDWLG
ARNVRRFGVRFREQVWPGDVLTCSGTVTAVCEESDGDRLTVELTATRQTG
GVAVTGTAQFLIPRNAPQRVTAGPAGP
118466183YP_881307.1 CalR5 protein [Mycobacterium avium 104]MITPQHVVNVVLDDAAKLGGADETMVLVTDKVEATLRWAGNSMTTNGVSV
SRSVTVISVVRRGSGARIGTVVSAEADPRVLPGLVAASQQAAATAPEAGD
AAPLLADAGEPADWDAPVPGTGPLIFADLADSLGRGFRGTDRLYGFAHHS
VSTTFVATSTGLRRRFTQPTGAVEINAKRGDASAWAGVGTPDFVDVPTDS
LLEQLSTRLGWAQRSVELPAGRYETIMPPSTVADMMIYMAWSMAGRGAQE
GRTAFSAPGGGTRVGERLTDLPLTLFSDPMAPGLICTPFVAVSSSSETVS
VFDNGMPIDHVDWIRDGVITALAYPRAAAAKYDANLAVAADNLVMTGGTA
SQADMIAATERGLLLTTLWYIRVVDPTTLLVTGLTRDGVYLIEDGQVTAA
VNNFRFNESPLDLLRRATEAGVSEKTLPREWGDWATRAAMPALRIPDFHM
SSVSQAQ
118466182YP_882711.1 transposase [Mycobacterium avium 104]MNIISAYHQVGSYRGAAELCGTTHKTVKRVIERAEAGGAPPREPRPRNLD
AFTDLVATRVEKSHGKMSAKRMLPIARAAGYQGSARNFRRLVAEQKVLWR
NANRHQRRPAVWSPGDYLVMDWAEAAPGLMVFCAVLAYSRWRFVRFAADE
KASTTLAMIAEALEAIGGVPAKILADRMGCLKGGVVANVVVPTPDYVRFA
SHYGFVPDFCHGADPQSKGIVENLCGYAQDDLAVPLLTEAALAGEQVDLR
ALNAQAQLWCAEVNATVHSEICAVPNDRLVDERTVLRELPSLRPTIGSGS
VRRKVDGLSCIRYGSARYSVPQRLVGATVAVVVDHGALILLEPATGVIVA
EHELVSPGEVSILDEHYDGPRPAPSRGPRPKTQAEKRFCALGTEAQQFLV
GAAAIGNTRLKSELDILLGLGAAHGEQALIDALRRAVAFRRFRAADVRSI
LAAGAGTPQPRPAGDALVLDLPTVETRSLEAYKINTTDGTAS
118466181YP_880888.1 hypothetical protein MAV_1655 [Mycobacterium avium 104]MADRDPEAIKRDIDVARDQLATTVDSLAERANPRRLADDLKARVIGFVQK
PVVLASLAGVGALVVVVAVRRVRNR
118466180YP_882618.1 hypothetical protein MAV_3436 [Mycobacterium avium 104]MSQPPEYPGTPPEPPPGYGPPPGYGPPPGYGPPPGYGTPPPPPPGYGPPP
GYGAPPPGYGPPPGYGPPPGFGGPPKPAFSVGEAFGWAWNAFTKNPVALI
VPTLVYLVVLGGASTLIGLSQDVGTSGGGSGDDYFTFTANLNGGGMALLV
LGYLVAYLVGAFAQSAYLSGCLDLADGRPVTIGSFFKPRNFGMVFLAALL
VGILTSIASALCFLPGLILGLFAQFTIAYAIDRSESAVKALSSSFSTVTA
NLANALLVWLAEFALVVVGALACGVGLLLAAPVAALVGIYAYRKLSGGQV
APPPGYQPGPPPGYQPGPPPGAPPA
118466179YP_881334.1 glyoxalase [Mycobacterium avium 104]MQFTSVSPIVPVRDLDVALDRYRRLGFDARAYQGPERYGFADRGSVSIHL
TEWDEHDPSCTAASVYFYVSDADALYAEWAALDNLGGRLLAPHDTPYGLR
EFAYVDPDGTAHRVGSPRS
118466178YP_884115.1 hypothetical protein MAV_4995 [Mycobacterium avium 104]MSPGDSPPRDSQRSRVYAAEEFVRTLFDRAAEHGSPAVEFFGTRLTLPPE
GRFGSVPSVQRYVDQVLALPAVRQRWPDVPPLRVRPRRAATAAHYENRYG
AGVIAVPDRDTAEWALRELVVLHEVAHHLCRAGPPHGPEFVATICELTEL
VMGPEVGHVLRVVYAKEGVR
118466177YP_882733.1 cation efflux family protein [Mycobacterium avium 104]MHVINGVRDPAASFPLDTATDDAGERRQANRAVAVSAAGLALTGLVELVI
AVVSGSVALLGDALHNLSDVSTSALVFVGFRASRKLPTERYPYGYERAED
LAGIGVALVIWGSAVVAGFESVTKLLRHGGTGHVGWGIAAAVVGVVGNQL
VARYKLVVGRRIRSATMVADAKHSWLDALSSAGAVLGLIGVALGWGWADA
VAGIVVTGFICHVGWEVTADIAHRLLDGVDPDIVTTAEAVAVSVPGVTHA
HARARWTGRTLRVEVEGFLDAATSLSDSDRIGRSVAAALAPRLPQMQSFT
WTARAA
118466176YP_883784.1 hypothetical protein MAV_4655 [Mycobacterium avium 104]MTGPHSETESPGTRPISVAELLARNGTIGAPAVTRRRRRRRGDSDAVTVA
ELTGEIPVIRDDEPDDQPGATDTVDTAAPAQPVAEPAEPVAEDEPKTPYW
SEPEPRWPKSPPQPKRAPGPERSAYPRPLPEPGPSANGTGRRSSGAEDMS
PDPMDHYADIPVDVMDSEVREAEPALEDSAYVRSYLQSDSALDDDLDEDL
DDDHADAATLTDEDLDAAHLEDEDAEAAHPAPGRLEAIWRGSVVVLQSIL
AVAFGAGLFVAFDQLWRWNSIVALVLSVLVILGLVVGVRVVRKTEDIAST
LIAVAVGALITLGPLALSLQSG
118466175YP_883181.1 aminoglycoside phosphotransferase [Mycobacterium avium 104]MDSDAAELRPKLEGVLATALGAGTAVEQLRTLTGGASRTTWAFDAVTGGR
RRPLILRTGPPDDVHAGMELEAQAQAAAAAAGAPVPHILVADNSPAALGN
PFLICDEIKGETIARRIQRRLDATDGHAARAHLLGQCAHAVAAIHRAEID
RIEDPGLRRQDQLAEWRQRLDDMGDTTATFEWAFRWLAARRPRAAPAVLV
HGDFRMGNLIVDGAQLAAVLDWELVHVGQAYEDLAWFCIRAWRFGAPAGL
GAGGLGSIESFLRAYEQASATTVDRAAFHWWLVLATLRWGVICRYQAERH
LSGLHRSVELATIGRRVCETEWDLLNLLEGAA
118466174YP_883078.1 flavin-containing monooxygenase FMO [Mycobacterium avium 104]MTDVVTHTETAPTPAAKAAKPVHTRAVIIGTGFSGLGMAIALQKQGVGFV
ILEKADDIGGTWRDNSYPGCACDIPSHLYSFSFEPKPDWKNPFSYQPEIW
DYLKGVTEKYGLRRYIEFNSLVDRAHWDDDEHRWHVFTTDGREYVAQFLI
SGAGALHIPSLPDIEGRDEFAGPAFHSAEWDHTVDLTGKRVAVIGTGASA
IQIVPEIVGQVAELQLYQRTPPWVVPRSNPEIPPAVRAAMENVPGLRALV
RLAIYWGQEALAFGMTKRPNLLKVIEAYAKYNIRRSVKDKELRRKLTPHY
RIGCKRILNSSTYYGAVADPKTELVTDHIARITPDGIVTADGTHRPVDVI
VYATGFHVTDSYTYVQIKGLHGEDLVDRWNREGIGAHRGITVADVPNLFF
LLGPNTGLGHNSVVFMIESQIRYVADAIATCDKLGAQALAPTRAAQDRFN
DELQRRLGPSVWNSGGCSSWYLDEHGKNTVLWGGYTWEYWRATRAVKPEE
YQFYGIGSRAGV
118466173YP_883394.1 thiosulfate sulfurtransferase [Mycobacterium avium 104]MPLPPDPHPSLQEYAHPERLVTADWLSANLGAPGLVIVESDEDVLLYDVG
HIPGAVKIDWHTDLNDPRVRDYIDGARFAELMDRKGISRDDTVVIYGDKS
NWWAAYALWVFTLFGHPDVRLLNGGRDLWLAERRETTLDVPTKTSTGYPV
VTRNDAPIRAFKDDVLAILGSQPLIDVRSPDEYTGKRTHMPEYPEEGVLR
GGHIPTARSIPWAKAVDESGRFRSRAELEELYGFLRPDDKTVVYCRIGER
SSHTWFVLTHLLGKPGVRNYDGSWTEWGNTVRTPIVAGEEPGQAPAGV
118466172YP_884180.1 pyruvate- water dikinase [Mycobacterium avium 104]MTREVASWWRYATSAPGLARPVDQQFAQAFKMLEYAMRVHVTETFVAQGI
FDALGKLAESAGRPGLHLELSTGYGQMVETELVAALHEVAQGRAEMAEFL
ARYGYRCAGEIEVSNPSWRERPELVKRMVDKYKAAPTRKNLAAAATARTR
ARQQAERELLAALPRWKRPLGRLLIKLAATFIPLREEGKSALAMAFDGAR
AACGIRGAELAAAGVVDRSEDVFYLTIDEIRGTPPAEARALIARRRELRA
AYEQIDVPDAWIGPPVAVSVANSGNSRVGSLSGVAAAHGVAEGPARVLAS
ADDLDDLEPDEILVCRTTDPSWASAFHLAAGAVIDIGSTSSHGAIIAREM
GMPCVIGTGNGTQLLRTGDFIRVDGSTGIVTVLQEAKRA
118466171YP_879599.1 short chain dehydrogenase/reductase SDR [Mycobacterium avium 104]MGYAEQLFDLADRVVLITGGSRGLGREMAFGAARCGADVVIASRNLDNCV
ATAQQIEHETGRRAMAYQVHVGRWDQLDGLVEASYDRFGKIDTLINNAGM
SPLYDKLTDVTEKLFDAVVNLNLKGPFRLSALVGERMVAAGRGSIINVST
AGSLRPTPDIVPYAASKAGLNAMTEALAKAFGPAVRVNTLMAGPFLTDVS
RAWNLEAAQENPFRHLALQRAGDPREIVGAALFLASDASSFTTGSILRAD
GGIP
118466170YP_881717.1 hypothetical protein MAV_2525 [Mycobacterium avium 104]MTTMPKSDIVVLTKPTARRTGKPTPKSSGGDLALIRSRHGGEMK
118466169YP_881977.1 LysR family transcriptional regulator [Mycobacterium avium 104]MKDLCSSGMDVVQAGRVELRHLRAFEAVARLESFTLAAQELSITQPALSR
TIKQLEDALEASLLDRTSRHVATTPAGRVFLGHVERILTELGRGVDAVRQ
QASIRLGFSWLLPDPWAQDTVARFERTTRTTVSLIRTDDALGAVQQGRVD
IALVRGHVTSTAVRIVHLFDEPRVAVCSVHSPLAKRAKLDWAEVPRWPLV
INTASGTTGPWSWPAGDGPETIVETTNFDEWIESVAADRGIGVIPDVAIR
RNVHPGVRFVALRDAPDIPVALAFVKRASGPVLRRFIEAAVDAAANQ
118466168YP_881597.1 PimT protein [Mycobacterium avium 104]MSVTGPFIVGERVQLTDAKGRHYTMVLAAGAEFHTHRGSIPHDAVIGLEQ
GSVVKSSNGAVYLVMRPLLIDYVMSMPRGPQVIYPKDAAQIVHEGDIFPG
ARVLEAGAGSGALTCSLLRAVGPQGRVISYEQRADHAEHAQRNVSVFFGG
EAPDNWQLIVDDVADSDLPDRSVDRAVLDMLAPWEVLESVARLLIPGGVL
MIYVATVTQLSRAVEALRAQQCWTEPRSWETLQRGWNVVGLAVRPQHSMR
GHTAFLIFTRRLAPGVIAPAPLGRKREGRDG
118466167YP_880413.1 septum formation initiator subfamily protein- putative [Mycobacterium MPAKPDPKRRSPASRPGKAGDSVRRRRAAKPSQTVTARKTARAQHEPAVE
PIVRQAAESVEQRSEQRLGFTARRAAVLAAVICVLTLTIAGPVRTYFAQR
TEMNQLAAGEAALRRQIADLEQRKAKLADPAYIAAQARERLGFVKPGDIP
FQVQLPPTAAEPTQPGSPSAKPVNNDPWYTSLWHTIADAPHLPPANPAVP
QAPPAEPGPPGPVPPPAPNPAGPGG
118466166YP_883782.1 hypothetical protein MAV_4653 [Mycobacterium avium 104]MNALFTTAMTLREAGSGVYDGELDKRWTIGPKVHGGAMLALCANAARTAC
AGGPESAQQPVAVSASFLWAPDPGPMRLVTSIRKRGRRISVVDVELTQGE
RTAVHAVVNLGEPEHFPADGSAASAKPLLSANPVPALMPPEPPDDIEPIG
PGHPLAGLVHLGEGCDVRPVLSTMQPSADGRPPVIQMWARPRGVAPDALF
ALMCGDLSAPVTFAVDRTGWAPTIQLTAFLRGLPADGWLRIIATCTEIGH
DWFDEDHTVVDSLGRLVVQARQLALVPAAP
118466165YP_880635.1 hypothetical protein MAV_1392 [Mycobacterium avium 104]MSRVTPLRFRDWPPEMRDAMAALMPPNPRHPAPVTKDRPKAENALGTLAH
HPSLARAFCTLQGHLLMGTTLSMRHREMLILRTAAVRGSAYEWTHHNFIA
PDGGISTEDVARIAFGPTAPYWSEFEVALLRCVDELIRDGQMSDATWATL
ATEFDTQQLLDTMFTVTSYDALMRMLKTCQVHLEDDVRELRAKAGLSVDG
DGA
118466164YP_880704.1 hypothetical protein MAV_1462 [Mycobacterium avium 104]MTELQEVKRRVKAVRAVRRSTELEGSRSTNATRADQVDYARGTINAAELR
DRVRRRYNMR
118466163YP_881096.1 hypothetical protein MAV_1876 [Mycobacterium avium 104]MKVRLEQSKCVGHAQCYAVDPDLFPIDDSGYSILEAHEVKPGDEQKTRDG
VAACPELALILEED
118466162YP_879909.1 hypothetical protein MAV_0629 [Mycobacterium avium 104]MFSDPLTSAIAEAENLVAAAPHIETEADLLEGLQYLAGCISACIHLAVDY
ERDHPFLQSGTGPFTKMGLDNPDTLYFGTRVHAGYDYVVTGRRGTTTDLS
FQLLGGEYTDDNVPASQAAFDDRELDIAPDGSFEWRVRPTSNGQLVIREV
YGDWAAQRGTLAIAREDTAGTAPPPLTRETIEKRYATAGKQLVNRVKTWL
QFPQWFYFNIPVNTMVAPRLTPGGLATQYSSAGHYELRPDQALLITIPVT
DAPYLGFQLGSLWYISLDYINHQTSLNNTQAQADPDGKVRIVVAEQNPGV
TNWVETVGHRKGFLQFRWQRVSRQLTEADGPTVELVDFDAVPAKLPYYEH
NKISDDEWRARIALRQQQIAARMLG
118466160YP_882394.1 malto-oligosyltrehalose trehalohydrolase [Mycobacterium avium 104]MTEQKTEFRVWAPKPARVRLDVEGRPHAMSRTDDGWWHAAVACAPDARYG
FLLDDDPTVLPDPRSPRQPEGVHARSQLWDPAAATWTDSAWPGRSTHGAV
IYELHLGTFTAAGTFDSAIEKLDYLVDLGVDFVELMPVNSFAGTRGWGYD
GVLWYSVHEPYGGPDGLVRFVDACHARGLGVLIDAVFNHLGPSGNYLPRF
GPYLSSASNPWGEGINIADADSDEVRRYIIGCALRWMRDFHADGLRLDAV
HALVDTTAIHILEELATETDWLATQLGRPLSLIAESDLNDPRLITARERG
GYGLTAQWADDIHHAIHTAVSGERQGYYADFGSIATLAHTLRHGYFHAAT
YSSFRRRRHGRPLDTSAQTGIPATRLLAYTCTHDQVGNRALGDRPSQNLT
AGQLAVKAVLALLSPYTAMLFMGEEYGASTPFQFFSSHPEPELARATAEG
RKTEFAEHGWDASKKGEIPDPQDPQTFARSKLNWDEVGTGEHARLHRLYR
DLIALRHNDPDLADPWLEHLTVDYDEDQRWIVLARGRLRIVCNLGAEPVT
VPVGGELMLAWDEPTVDADTTALQGHSFAILSTPGQPVDN
118466159YP_881902.1 glyoxalase [Mycobacterium avium 104]MTLQAHNAPKLIDYYVETFGFVLAARYGDGETVDHAQLNWPEGSGGIMLG
SHKPGAEWCREPGTAGGYVVTADPDALYRRVRQHNAEIVRPLAETDYGAR
EFTVRDPEGNLWSFGDYGGANPPN
118466158YP_884374.1 caib/baif family protein [Mycobacterium avium 104]MGPAPFAHWRVVEFSNGLAVSYCGKMFADAGADVVKVESPQGDSMRRWSA
GGPPGALFGYLAAGKRSMVGRSRAEVAPLLAGADLVLTDLTDGWTLDEIT
GRTGPSAVVVAITPFGTTGPYVDQQVVANEFILQALCGSIAGRGWPGDEP
VQAGGRLGEWLAGTFAAAAAAATARHAARTGRGEVIDVSTYEAMVIAMGG
LSAMSASVLGADSLLHERSLELPSIVPTADGMVGFCTITAQQFQDFLVMI
DRADLVDDAELASFAGRVARRDEFLDMVSGWTRTRTTQEIVDLAVAFRIP
VAPIATPEILPKLDHFVQRGVFVESPAGVLAPRVPYRSDAITTRPPSEPP
ALGADNGRVHWPPRPGPARGEDAGTLPLSGIRVTDLTAFWAGPVATQLLG
ALGADVIKIEGVRRPDGMRFSAGRPPDWDQWWEWGPVFLCSNNNKRGISV
DLGTEAGRSIALGLIAASDLVVENFSPRVMANFGLEWDAVRAANPRAVMI
RMPAFGLDGPWRDRVGFAQTMEQATGMAWMTGHPDGPPVIPRGVCDPIAG
LHAAFAAVAALTVRDREGTGMQVEATMVEAALNVAAEMLVEYSCNGIALR
RNGNRGPGASPQGVYRCRGDDAWVALAALDDTARASLARLLGRAEPGDTG
WDEHADDVDKLISDWAAGRTVADAVDALRAAGVAAAPVTPAAALLADPQL
HARGFWETVDHPVAGSFLCTGMPFAFLGKPRRWLRRVPPRYGEHTAEVLT
ELLGHSDADLAELRASGTISDRPAGL
118466157YP_883558.1 hypothetical protein MAV_4423 [Mycobacterium avium 104]MSLPALEDIGDLIDGVTRIETSPREKATPIIMDMMRSVYPHDQVFGQYCT
VNDYIDCPPDDLFEYMADTRSLEEWTYSLRGFTPTDEPGLWLAHDRLGSE
TKIYTRTVANAQARTVDYHCAWDQGDHLWMIYLMRVVDAQTVLDKPGSVV
LWTNCHHPFYDHNPYPQTAPPQRPVWVGDFWDMFGAGHLLELRNLKAIAE
YRHRHGLPVTPVWMR
118466156YP_882902.1 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Mycobacterium avium 1MTNPTSDGQPRGRLRVLVLGSTGSIGTQALQVIAANPDRFEVVGLAAGGA
NLDTLLRQRAETGVTNVAVADEHAARRAGDIPFCGPEAATRLVEETEADV
VLNALVGALGLRPTLAALESGARLALANKESLIAGGPLVLAAAAPGQIVP
VDSEHSALAQCLRGGTGDEVAKLVLTASGGPFRGWTAEELEHVTPEQAGA
HPTWSMGPMNTLNSASLVNKGLELIETHLLFGIPYDRIEVVVHPQSIVHS
MVTFVDGSTLAQASPPDMRLPISLALGWPHRVPGAAACCDFSTASSWEFE
PLDNEVFPAVELARHAGQAGGCMTAIYNAANEEAAAAFLAGRVSFGAIVE
TIADVLHAADQWAPKFSETPANVDDVLDAQRWARQQAQRAVAQARPATVS
AKTPGVV
118466155YP_883888.1 F420-dependent glucose-6-phosphate dehydrogenase [Mycobacterium avium MAELKLGYKASAEQFAPRELVELAVAAEAHGMDSATVSDHFQPWRHEGGH
APFSLAWMTAVGERTTRITLGTSVLTPTFRYNPAVVAQAFATMACLYPGR
IFLGVGTGEALNEIATGYQGEWPEFKERFARLRESVRLMRELWRGDRVDF
DGEYYRLKGASIYDVPDGGVPIYIAAGGPAVAKYAGRAGDGFICTSGKGE
ELYKDKLIPAVKEGAAINDRNVDDIDKMIEIKISYDPDPELALENTRFWA
PLSLTAEQKHSIDDPIEMEKAADALPIEQVAKRWIVASDPDEAVAKVKDY
VDWGLNHLVFHAPGHDQRRFLELFEKDLAPRLRRLG
118466154YP_883577.1 methyltransferase- putative- family protein [Mycobacterium avium 104]MSEGRTDGDTWGPAQSVGATATMVAAARAVASQGPDALLDDPLAEPLVRA
VGLDPFIRIVDGKLDFPDDPLFNRRARAEQITVRTRFFDDFFIDATEGGL
RQAVILASGLDTRAYRLAWPAGTVVYEIDQPQVIAFKTDTLANLGAAPTA
ERRTISIDLRDDWPAALREGGFDVTRPTAWSAEGLLPYLPPEAQDRLFDN
ITALSAPGSRLATEHVPDPNAFSDERLARISERWQRLGLNLNAADLFYRG
ERNVVADYLTGKGWRVTPHPARQLYARNGFEFPEDEMRATFGEMSYVDAT
LTGGRG
118466153YP_883481.1 hypothetical protein MAV_4346 [Mycobacterium avium 104]MTAAFASSRHEETRAERLESLRRRMAEMSGRMSGAASGAAAPADLLGAES
LLAMPRWLAESVRVPRGSVAVLSGARSLLLSMVAAVTAAGGNAAIVGQPD
IGLLAAAEMGADLSRLAVIPDPGTDPVEVAAVLVDGMDLVVLGLGGRRVP
PTRARAVVARARSKGCTLLVTGGDWQGAPTRLAARVCGYEVTPAQWGKTA
PGFGRISGVRLQVSGMCAGRRVAAQARAG
118466152YP_882638.1 radical SAM domain-containing protein [Mycobacterium avium 104]MRWASQAVAVNGKPVEDGALPGLQRLGLVRSVRAPQFEGITFHEVLCKSA
LNKVPNASALPFRYTVNGYRGCSHACRYCFARPSHEYLELNCGNDFDTQV
VVKTNVAQVLRRELRRPSWRRETVALGTNTDPYQRAEGRYALMPGIIGAL
AESGTPLSILTKGTLLRRDLPLIANAAAQVPVSVAVSLAVGDADLHRDVE
PGTPTPQARLGLISAIRAAGLDCHVMVAPVLPYLTDSVEHLDDLLGQIAA
AGAGSVTVFGLHLRGSTRGWFMEWLARSHPELVGRYRELYSRGAYLPPSY
RDMLRHRAAPLIAKYRLGGDHRPFARAVAAAPAPEPAQPTLF
118466151YP_883935.1 hypothetical protein MAV_4809 [Mycobacterium avium 104]MSTDELDQLLLDRFNLRRSDLIAALKTLPAHRPWAATLTTDEARLLDDAG
FTEDPGAYAEIAADVTAHMARLYGTAYSAADVSKGLGVNDSRVRQRRLAH
TLWAIDDGGTWVYPAIQFEIVDRGRDEPLTLKQVRGLDAVLPALLARDLH
PTAVAGFLMTTQPDLRIDGQPKSVRDWLLHGESVGPVLELIEIADWTAT
118466150YP_880338.1 morphine 6-dehydrogenase [Mycobacterium avium 104]MSKVPTIELNDGARIPQLGFGVYQIKPDETAAAVRAALDIGYRHIDTAEM
YGNEREVAQGIRDAGLDRSEVFVTSKLNNGFHEPDAARRAFDATLKALGS
DYVDLFLIHWPLPTLYGGDFVSTWRVLEEFARDGRARSIGVSNFQVPHLE
RLATETDTVPAVNQVEVHPYFTNEKVRGYAREHGIAIEAWSPIAQGDVLG
DAVINRIADGLGRTAAPVVLRWHIQRGDIVFPKTVNPDRMKSNFELFDFE
LDERAMEAISALDRGESGRRGPNPDTFDYIPR
118466149YP_880697.1 ISAfe7- transposase OrfA [Mycobacterium avium 104]MPKEQSPGKPTTRRYSAEEKAAAVRMVRTLRAELGTEQGTVQRVARQLGY
GVESVRTWVRQADIDEGLAPGVTTAESKRVQELEQENRELKRANEILKRA
ASFFGAELDRQHKK
118466148YP_879593.1 DNA-binding response regulator [Mycobacterium avium 104]MSQPRASAERVVMCRADGNPINVLVVDDEAVLAEMVSMALRYEGWNIATA
SDGASAIAAARNQRPDVVVLDVMLPDMSGLDVLHKLREENPQLPVLLLTA
KDAVEDRIAGLTAGGDDYVTKPFSIEEVVLRLRALLRRTGVTTVDSGAQL
VVGDLVLDEDSHEVTRAGEPISLTSTEFELLRFMMRNSKRVLSKAQILDR
VWSYDFGGRSNIVELYISYLRKKIDNGREPMIHTLRGAGYVLKPAR
118466147YP_882328.1 hypothetical protein MAV_3144 [Mycobacterium avium 104]MAGRWATAAGELHVPAAPTASGLPSQASMAAVNAAHADVTAFTAGLATRV
QTHSRRVAEAGRRYASNEADSADAMAAVARSAAHSTVPV
118466146YP_880011.1 phosphoribosylformylglycinamidine synthase I [Mycobacterium avium 104]MTARIGIITFPGTLDDVDAARAARRVGAQPVSLWHADADLKGVDAVVVPG
GFSYGDYLRAGAIARFAPVMTEVVDAARRGMPVLGICNGFQVLCEAGLLP
GALTRNVGLHFICRDVWLRVASTSTAWTSRFEPDADLLVPLKSGEGRYVA
PADVLDELEGEGRVVFRYHENLNGSQRDIAGVSSADGRVVGLMPHPEHAI
EALTGPSDDGLGLFYSVLDGVLAG
118466145YP_881539.1 cell division protein FtsW [Mycobacterium avium 104]MGNALTRLLGRGKDTTKTAEPADDDGAAADTGAVPDGAPEADDEQDQQVT
DEPTKASQKASKKASTKASKKESKKAPKDKPKDGSSHSRFGAWLSRPMTS
FHLIIAIAGLLTTLGLIMVLSASGVRSYDADGSAWVIFGKQVLWTVIGLI
ACYASLRMSVRFIRRVAFTGYVVTVILLVLVLVPGIGNLANGSRKWFVVA
GFSMQPSELAKIAFAIWGAHMLAARRLDRASLRELLIPLVPAAVIALALI
VAQPDLGQTVSLGIILLALLWYAGLPLRVFITSLLAVFMAGAVLAMSAGY
RSDRVRSWMNPENDPQDTGYQARQAKFALAHGGIFGDGLGQGVAKWNYLP
NAHNDFIFAIIGEELGFIGAFGLLVLFGLFAYTGMRIARRSADPFLRLLT
ATTTMWVLGQAFINIGYVIGILPVTGIQLPLISAGGTSTAATLFMIGIMA
NAARHEPEAVAALRAGRDDKVNRLLRLPLPEPYSPTRLEAFRDRKRTGPQ
QAPKSAPKSRPAPRKGAKPAGRKPTRNAGRNATRNAGFHADAPLPPPLPR
TAGRAGRQSGGNTRARARHHGSGQRYASLGANSGANPAASSRAGQRQPRR
ARALEGQRYG
118466144YP_879543.1 DNA-binding protein [Mycobacterium avium 104]MNESTTPDIAAAVAALLAAVGQTQAPAPTAPVTMLTVSETAELLRCSESL
IYAQLRDGRLRGVKVGRRRLIPMREIDRLIAGDAAA
118466143YP_881814.1 carveol dehydrogenase [Mycobacterium avium 104]MAFITGAARGQGRAHAVRLAAEGADIVAVDICRDIDSMDYPNATPDDLDE
TIKLVENQGRRIIAHQADVRDADALKQAVNEGVREFGRLDIVLANAGIIR
LGGEGDRSQIFRDIVDVNLIGVWNTVEAAIPALIDGGRGGSIVLTSSSAG
LKGTGTDRAGGQAYTAAKRGLVGLMQVWANELAQYWIRVNTIHPTGVATG
MVMNETMGKLLEANDTAVAAMQNALPIQILMPEDIAGAVAWLVSDEAKFI
TGVAWPLDAGFAVR
118466142YP_881948.1 serine esterase- cutinase [Mycobacterium avium 104]MQVVFARGRNESPGPGVLGNAFISALRSRVNRTVGVYAVQYPADTEVAQG
ANDMSRHIQDMVNSCPDTRLVLGGYSLGAAVTDVVLAAPIGAFGFDSPLP
PGVDQHIAAVALFGNGSQWVGPITNFNPTYNDRTIELCHGADPICNPADP
NTWKQNWPQHLAGAYIDAGMADQAADFVAGKL
118466141YP_879669.1 FAD/FMN-containing dehydrogenase [Mycobacterium avium 104]MHGLLSKTRVYLVPVLGSALSAHQAGVDRLLESYRSIPATSAVRLAKPSS
NLFRARTKRDAPGLDTSGLTGVLGVDPETRTADVAGMCTYEDLVAATLPY
GLSPLVVPQLKTITLGGAVSGLGIESASFRNGLPHESVLEMDILTGAGEL
LTASRTQHADLFRAFPNSYGTLGYSTRLRIELEPVAPFVTLRHIRFHALA
DLIAAAERIIDTGGHAGTPVDYLDGVVFSADESYLCVGRRTTTPGPVSDY
TGQHIYYQSIRHDSPGDEPTKDDRLTMHDYFWRWDTDWFWCSRAFGVQNP
RVRRWWPRRYRRSSVYSKLVSLDRRLRISDRIEARNGRPPRERVVQDVEL
PVERTLEFLEWFLETVPITPIWLCPLRLRDHDGWPLYPMRPDHTYVNVGF
WSSVPAGATEGATNRLIEAKVSELDGHKSLYSDSFYTREEFDELYGGEAY
NTVKKTYDPDSRLLDLYAKAVQRR
118466140YP_883498.1 hypothetical protein MAV_4363 [Mycobacterium avium 104]MLLGLLWPHLHLPAPGASRRWPLSLSVCIVVGIVISIIGL
118466139YP_879734.1 metallo-beta-lactamase [Mycobacterium avium 104]MTEVAESPTHPAYGRLRAVTDTASVLLADNPGLLTLEGTNTWVLRGPGSD
ELVIVDPGPDDDEHIARIAALGRIALVLISHRHGDHTDGIDKLVERTGAT
VRSAGSGFLRGLGGELTDGEVIDAAGLRIKVMATPGHTADSLCFLLDDAV
LTADTVLGRGTTVLDKEDGSLTDYLESLRRLRGLGRRAVLPGHGPDLTDL
ESVAQGYLEHRRERLDQVRSAVRELGEDVSARRIVEHVYVDVDEKLWDAA
EWSVQVQLNHLRSEPST
118466138YP_883389.1 biotin-[acetyl-CoA-carboxylase] ligase [Mycobacterium avium 104]MDAAALRAELIGTGLGWRRLDVVEQTGSTNADLLARAAAGDDVAGAVLIA
EHQTAGRGRHGRGWSATPRAQVTMSVGVSVVDVPAAGWGWLPLATGVAVV
DTVAPLLQPAGVAVGLKWPNDVLAGPAGSPGKLAGILAEVSKPVVVIGLG
LNVTQSADEIDGPGATSLLDLGVAAPDRTALVSGLLRELGRRIVSWQAAR
GADWALAADYRARSLTIGTRVRADLPGGKHIEGTAGGIDDQGRLCLDSGG
QTVVVAAGDVVHLR
118466137YP_880225.1 TetR family transcriptional regulator [Mycobacterium avium 104]MTSASSGASSGASSGARRIGAPDAKNRGLLLDAAERLMLEEGYAAVTSRR
LASRAGLKPQLVHYYFRTMEELFLEVFRRRAEEGLAVQAQALQSDQPLWA
VWRFGTDPAFTQISMEFMALANHRKDMRAEIAYYAERFRDEQQRAVAAAL
ERYGVQNKDVPPVVWTVLMTSLSRFLVLEQAIGMSSGHAETVQLVESYLR
RLEGEPKPIAGAPSSWTVHQGRIEQSTPLGPSLDTTTAPSTVRSQ
118466136YP_882758.1 amino acid permease [Mycobacterium avium 104]MSKLSTATRRLLIGRPFRSDRLSHTLLPKRIALPVFASDALSSVAYAPEE
VFLMLSVAGVSAYALTPWIGLAVAAVMLVVVASYRQNVHAYPSGGGDYEV
VTTNLGETAGLVVASALMVDYVLTVAVSTASAMANIGSAVPIVAEHKVFF
CVAAILLVMALNLRGVRESGVAFAIPTYAFIIGVLTMIGWGLFRIFVLGN
PLRAESAGFEMHAQHGQVVGFALAFLVARSFSSGCAALTGVEAISNGVPA
FQKPKSRNAATTLLMLGGIAVTLLMGIIVLAEKIGVKLVEDPATQLSGTP
PGYYQKTLVTQLAQAVFGGFHIGFLLIATVTALILVLAANTAFNGFPVLG
SILAQHSYLPRQLHTRGDRLAFSNGILFLSGAALLAIIAFRGEVTALIQL
YIVGVFISFTLSQIGMVRHWTRLLRTETDPAARRKMMRSRAVNTVGLLST
GAVLLVVLITKFAAGAWIALFAMSLLFGIMKMINRHYNTVNRELAEQAAD
QDDVVLPSRNHAVVLVSKLHLPTLRALAYARATRPDVLEAVTVSVDDAET
RDLVHKWEEADISVPLKVIASPYREITRPVLEYVKRAREESPRTVVTVFI
PEYVVGHWWEQVLHNQSALRLKGRLLFMPGVMVTSVPWQLSSSERRKTLE
PHMAPGDARRGIFD
118466135YP_883801.1 hypothetical protein MAV_4673 [Mycobacterium avium 104]MRVPLAAPAALLLALCWPIAPAAAPDPAAGTADPPFIDHTEWAQWQGRSS
LRVFPTPAGRTAAKTPGSMAMADEAWAEVLALAPDADTAGMRAQFLCHWQ
FAELGRPGKVSWNLEPWRPVVDDAEMVASGCNPGGPEESFG
118466134YP_881559.1 hypothetical protein MAV_2356 [Mycobacterium avium 104]MAVTADRHMAQKEFAVEDMSTGIFASGYGQVGDGRSFSFHIENRSLVVEV
YRPRLAGPVPQAEDVVATAVRSLVDIDLTDERSLTAAVRDSVAHAEPVSR
118466133YP_879953.1 hypothetical protein MAV_0674 [Mycobacterium avium 104]MHRIPLTIGIAVVVLLAALAAPIKQRCGAPGLSCASTLDTEGNAHYYYEV
EPVGVYLAEIVTGSNIALFYQSGEDLVKAR
118466132YP_881782.1 acyl-CoA dehydrogenase [Mycobacterium avium 104]MTVALSDEETMLVETVRAFVDRDVKPTVRAVEHANEYPEAWIEQMKRIGI
FGLAVPEEYGGSPVSMPCYVKVTEELARGWMSLAGAMGGHTVVAKLISLY
GTEEQKQKYLPRMASGEMRATMALTEPGGGSDLQAMTTTARAEGNELVIN
GAKTWISNARRSGLIALLCKTDPQAQPRHKGISIVLVEHGQGLTVSRDLP
KLGYKGVESCELSFDECRVPAAAILGDEPGRGFAQMMKGLETGRIQVASR
ALGVASAALEDALKYAQERESFGQPIWKHQSVGNYLADMATKLTAARQLT
RYAAEKYDSGERCDMEAGMAKLFASEVAMEIALNAVRIHGGYGYSTEYDV
ERYFRDAPLMIVGEGTNEIQRNVIAAQLVSRGKL
118466131YP_880126.1 methylmalonyl-CoA mutase [Mycobacterium avium 104]MAVRILVAKPGLDGHDRGAKIVARTLRDAGFEVIYTGIRQRIEDIASIAV
QEDVAVVGLSILSGAHLALTARTVEALRACDAADIAVVVGGTIPHADVPK
LLAAGAAAVFPTGTPLDKLVREIRALTGTGEPDDKEAITEEQCASE
118466130YP_880075.1 gp32 protein [Mycobacterium avium 104]MSEYDSFEAAREQAADYLGYVASEKIRTPRGDVFEIPNPSLLDDDQQQRY
DALQLEVESWDRHPDVLNDDGTVKTRGALKDPARKTDADGNTVLVENYSI
QLAKAIFGDRYEAFKAAGGRANDVSFIWAKMNRVIANKRASDSKSAGSDQ
AVAAVPDPDSV
118466129YP_883751.1 hypothetical protein MAV_4622 [Mycobacterium avium 104]MGDTPGIAAGRRGSELSRRGRDLAAGKVITAADVQCAAERAETSRQRDLD
AHRRDEHRHYQAAIAHERVAEVEDRAVAEGLGDVAAHQRAADREREAARR
NFMAAQQANSYDAD
118466128YP_884091.1 hypothetical protein MAV_4970 [Mycobacterium avium 104]MPHDAPAHNLDLPREQTSRGRYWWVRWVILGVVAIVLAVEVSLGWDQLAK
AWMSMYEANWWWLLASVVAAAASMHSFAQIQRTLLKSAGVHVKQLRSEAA
FYAANSLSTTLPGGPVLSATFLFRQQRLWGASTVVASWQLVMSGVLQAVG
LALLGLGGAFLLGAKNNPFSLLFTLGGFVALLLLAQAVASRPELIEGIGS
RVLAWVNSVRGRPAETGLDKWRETLMQLESVSLGRRDLSVAFGWSMFNWI
ADVACLGFAAYAAGDHASVAGLTVAYAAARAVGTIPLMPGGLLVVEAVLV
PGLVSSGMSLPSAISAMLIYRLISWLLIAAVGWVVFFFVFRTENIADSDD
EPITGPLPVLPTPGGPPDPTDTALQGPLPPDRSPADPNPDKDV
118466127YP_880535.1 GntR family transcriptional regulator [Mycobacterium avium 104]MELGDWLRVDMKAGKPLFDQLRTQVIEGVREGALPPGTRLPTVRELAGQL
GVAVNTVARAYRELESAAIIETRGRFGTFVARYDPTDAAMAAAAREYVRV
ARGLGLDKADAVRYIESVPDE
118466126YP_880625.1 NAD-dependent malic enzyme [Mycobacterium avium 104]MSELLESIQSRAEQGAITDAEIFAAHVGGKLSVSLTSPLDTQRALSIAYT
PGVAQVSRAIAADHRQAAHYTWANRLVAVVSDGSAVLGLGDIGPAASLPV
MEGKCALFQAYGGLNAIPIVLDTKDPDEIVETLVRLRPTFGAVNLEDISA
PRCFEIERRLIEALDCPVMHDDQHGTAIVVLAALMGAGKLLGRDMSSLKV
VVSGAGAAGVACTNLLMAMGVSDITVLDSRGILHAGRDDMNDVKAALARR
TNPAGLTGSLAEAIRGADVFLGLSGGVVPEEMIAAMAPGGIVFALSNPDP
EIHPQIAAKYATVVATGRSDFPNQINNVLAFPGVFRGALEAGARRITEKM
MVAAAEAIFSVVSDDLAPDRIVPSPLDTRVGDAVATAVALATEVSDAPAG
118466125YP_881027.1 2-hydroxyhepta-2-4-diene-1-7-dioate isomerase [Mycobacterium avium 104MTISILRTADAWWVQTATGAVKVNTDATTTRELLADRAAIDAAASSSDAV
PVEGLNLLSPVTAPCRVVAQMTNFASHVKDAGMDPNTIPLTFFRKASGSI
TGPFDDIVKPDHVRFLDYEVEIGLVIGRELPVGAAVSEANLADYTAGAVV
TNDVSARDIQLPKTQFYESKSYPTFTPVGPALVLLDADELKRFGDLRLQL
RVNGQVRQDMRVDGDMIYPPVQALQALARFQRLDPGDLVLTGTPVGTALS
APPKPVQIIASLLPPAVKWKAFFNAQAKNPKYLRDGDVVETAIATDDGAI
DLGTQRNVVRFAK
118466124YP_881896.1 TetR family transcriptional regulator [Mycobacterium avium 104]MVMTNPRATNEDLTAKARIRNAALDLYAQYGEDRISLRDIASAAGVTLGL
VQHHFKTKAGVRDAVDQLVVDYFAHALAQVPAEGSARHVAAARDEAVARM
LRDNPPVVNYVRRAVLDPSEDRLHLLDALIELTRREITALRGSGVASTKR
PESTQILGVLIRQMGELLLQPMVDAVWDRVAKPTDARKPRLRITVEN
118466123YP_881515.1 hypothetical protein MAV_2311 [Mycobacterium avium 104]MSGAHPDIGPELRRLAQSILDGIDPAVRAAAALTAGAGPGTGKCQQVWCP
VCALAALATGDQHPLLTAIADHSIALLEVIRDIVADIDRASGPTPGPPPD
GPPGGAPDTPDTGQAPRTRYQPIPVTFEE
118466122YP_880441.1 enoyl-CoA hydratase [Mycobacterium avium 104]MTDSTDRTFETILVEREERVGIITLNRPKALNALNTQVMNEVTTAATDFD
ADPGIGAIIITGSAKAFAAGADIKEMAELTFADAYGADFFAPWGKLAALR
TPTIAAVAGHALGGGCELAMMCDVLIAADTAKFGQPEIKLGVLPGMGGSQ
RLTRAIGKAKAMDLILTGRTIDAAEAERSGLVSRVVPADDLLTEAKKVAT
TISQMSRSAARMAKEAVNRAFETTLAEGLLYERRLFHSTFATADQSEGMA
AFVEKRAPNFTHR
118466121YP_883251.1 ANTAR domain-containing protein [Mycobacterium avium 104]MREASTTIVTQLVELVTSLERENSDTAAGLHELIDNGVHHVTGSQYAGIT
LAEKSKSVNSVAATHRYPMVLDAIQNKYGEGPCLAAAWEHHVMHIADLAA
EQRWQRYRRHALEQTPIRSILSFELFVDRTSMAALNFYADPPHAFTEESV
ELGTVYATHIALAWSMMRRQDQFRSALASRDIIGQAKGVIMERFDLDAVE
AFELLTRLSQQSNTRVVDIAAALIDSEHPLKQRRR
118466120YP_879794.1 hypothetical protein MAV_0514 [Mycobacterium avium 104]MVVVLLSATGAAVYLGAAVVARHRAQAAADLAALAAAARLPSGADAACAR
AAAVAHSMRVDDIGCVADGLDVVVTARVAVGAVGTAVAAARAGPATG
118466119YP_882105.1 secretion protein Snm4 [Mycobacterium avium 104]MTAVVEVPQPDVEGISQPQAVVVGVMAGAGVQIGVLLDANAPVSVMTEPL
LKVVNSRLRELGETPLEATGRGRWALCLVDGSPLRATQSLSEQDVYDGDR
LWIRFIPDTEHRSQVIEHISTAVAANLSKRFAAIDPVVAVQVGATMVAVG
VTAASGLLGWWRWHHNSWLPTVYAGVIGVLMLGVSVLLLMRATTQQERRV
GDTLLLSSLAPVSVAAAAAPPGGVGSPQAVLGFGVLTIAAVLALRFTGRR
LAIYTAIVTVSAIAALAALARMVAMTGAVTLLTCVVLVSVLIYQSAPAIS
RRLAGIRLPVFPSATSRWVFEARPDLPTTVVRSDGGPPVLEGPASVRDVL
TQAERARSFLSGLLIGLGVLMVVSLTALSDPRTGQRWLPVLLAGFCAGFL
LLRGRSYVDRWQAITLAGTAVLIVGAVVVRYALVLQSPLAVSISAAILVL
VPVAGLTSAAVVPNTVYSPLFRKFVEWIEYLCLMPIFPLALWLMNVYAAI
RYR
118466118YP_879492.1 FAD dependent oxidoreductase- putative [Mycobacterium avium 104]MNDYDAIVIGAGHNGLTAAVLLQKAGLRTLCLDAKLYAGGMASTVELFDG
YRFEIAGSVQFPTSQAVVDELGLDTIPTIDLDVMSVAVRGVGDDPLVQYS
DPVKLFTHLNEVHGADAVNGMAGLMAWAQAPTRALDRFEAGTPPKSLDEM
YACATNEFERSAIDDMLFGSVTDILDRYLPDREKHGALRGSMTVLAVNTL
YRGPATPGSAAALAFGLGVPDGDTMQMKKLRGGIGALTSHLCDVLERHGG
ELRLRTKVTEILVEHAGSGGRVTGVRTESGETLSAPIVVSGIAPDVTLNE
LLDPAALPADLRARYARIDHRGSYLQMHFALQEAPVFAAPYQVLNEPAMQ
ASIGLFCTPEEVQQQWEQARRGVVPADPTVVLQIPSQNDPGLAPEGKHAA
SAFALWFPIEGEVDYGQAKIEMGQRVIDKITRLAPNFEDSIIRHTTFTPR
HMGVMFGAPGGDYCHGLLNANQVGPNRPGPRGFLGQPIPIEGLYLGSAGC
HGGPGITFIPGYNAARQALTDRSG
118466117YP_879785.1 transposase [Mycobacterium avium 104]MWLCHHEGLRRIEPSVLKWAGQALTAAAADYRNTHGHQPTSITDLSAATI
VRHAMLVFEKRNARLPSPGARRNVTHLIEHLHLYLSVRTTDTDWWAHDTW
DLRADPRIPQREHEPGHDQSVKIGAITPDWLREGVRFWLRTALDAELLRW
SSAVERARDMARHFGAFATEHGYADPALADDPAQLRLIFTAFTEYLRSPA
AAATPDKPLTPSAIDATQSYTQVFYTFMVDHAPEAAAATGNPRWLALTDA
HTRLWGPAFRARRANRVRELSWYSTGELQQMLAYLDVLAADRGTLVALTH
PDGTASIIKGLGDPQAARIWLLQALTGRRASEILMLDHQPLQPIPGAERP
TDSDDPDAFVAKLRYQQTKVDDVTPTILVEQAVVNVVTEQQRWLTTTYPG
LTPKYLFIGVKQNLAGRRPRPYASYNLSLAKLDNIHGLTDAAGNPLRFTQ
THRLRHTRATELLNDGVPIHVVQRYLGHKSPEMTMRYASTLAATAEAEFL
KHKKIGAHGVEIAISPSDILDMTQLSARTDRVLPNGVCLLPPLKTCDKGN
ACLSCGHFATDITHAAELRDQHTKTAALIELRRQQYRQRTGRELTDDNVW
IRERLRELNSLQAILERLAADAGTPESAISGAGTFRRLPLHVIATRGAHD
SALRKADPRADA
118466116YP_880508.1 NAD dependent epimerase/dehydratase [Mycobacterium avium 104]MIVGGHGKVALQLSAILTQRGDAVTSLFRNPDHADDVAATGAKPVVADIE
RLDTDALAGLLAGHDAVVFSAGAGGGNPARTYAVDRDAAIRVVDAAARSG
VKRFVMVSYFGAGPDHGVPQDDPFFPYAESKAAADAHLRASDLDWTILGP
GRLTLDPPTGRIAVGRGKGEVSRADVASVAAAALADDSTIRRTIDFNNGD
VPIAVALAG
118466115YP_884367.1 hydrolase- alpha/beta hydrolase family protein [Mycobacterium avium 10MSTIDISAGTIHYEATGPADGRPVVFVHGYLMGGQLWRQVGDRLAGRGLR
CIAPTWPMGAHPEPLRRGADRTITGVAAMVAELLSALDLEDVVLVGNDTG
GVVSQLVAVHHRERLGALVLTSCDAFEHFPPPVLRPVILAAKSKATFRAV
AQAMRAPAVRKRAFDGLAHSNIDALTELWVRPALSLPAVAEDLRRFTLSL
RTEVTTAAAARLYDFDKPTLIAWSADDVFFAQEDGARLAATIPNARHEVI
AGARTFSMVDQPDRLADLLSTVAVRT
118466114YP_881603.1 PcrB protein [Mycobacterium avium 104]MTWQFPDRLSTNSALPGPAFSGQPAVDLSSFADFLRRQAPELLPAALGGA
QSGPASSSGGTGQLPHGTTIVALKYPGGVVLAGDRRSTQGNMIAGRDVKK
VYITDDYTATGIAGTAAIAVEFARLYAVELEHYEKLEGVPLTFAGKVNRL
AIMVRGNLAAAMQGLVALPLLAGYDIDARDPEGAGRIVSFDAAGGWNLEE
EGYQSVGSGSIFAKSSMKKLYSQVVDADSAVRVAIEALYDAADDDSATGG
PDLVRGIYPTAVTIGAEGALEVPESRIAELAREVIQSRSRADTFGPDAAG
GDK
118466113YP_881304.1 ABC transporter permease [Mycobacterium avium 104]MTSPDRARANIAIYAGLLVGALITLAPFTLGLLTAFTSAHQFVTGTPLQL
PRPPTLSNFADLAGAGFGRAGAVTALMTAVILVGQLTFSVLAGYAFARLR
FPGRDALFWVYIATLMVPGTVTIVPMYLMMAQLGLRNTFWALVLPFMFGS
PYAIFLLREHFRMIPNDLVNAARLDGAHTLDVIVHVVIPSSRPVLAALAL
ITVVSQWNNFMWPLVITSGHKWRVLTVATADLQTRFNAQWTLVMAATTIA
IVPLVTLFVIFQRHIVASIVVSGLK
118466112YP_883945.1 glucose-1-phosphate thymidylyltransferase [Mycobacterium avium 104]MRGIILAGGSGTRLHPITTGISKQLLPVYDKPMVYYPLSTLMMAGIRDIL
VITTPHDAAGFVRLLGDGSQFGINITYVTQERPDGLAQAFVLGADHIGND
SVALVLGDNIFYGPGLGTSLRRFQTITGGAVFAYWVANPSAYGVVEFSDD
GMALSLEEKPKTPKSNYAVPGLYFYDNDVIEIAKGLKKSERGEYEITEVN
QIYLSRGRLSVEVMARGTAWLDTGTFDSLLDASDFVRTLERRQGLKVSVP
EEVAWQQGWITDEQLSERAQSLLKSGYGGYLLDLLERSRFH
118466111YP_881749.1 thiolase [Mycobacterium avium 104]MRKVAIVGAGMTPFAEHFELGIKDLVPMAYAEAVANVDKGIQKSELEAAW
FGELATTDGFPSGILADTLDLTDIPVTRVENACATGNDAIRNGTLAIASG
LYDVVLVVGADKVRETSSNTTFWDWAAMTRDNAWDYPLGLVAPANFALHV
MRYLHESPATKEHMAMVAVKNHFHAVNNPKAQLRYEITVEQALAAPIVVE
PFGLYDCTPQSDGAAAVILAAEDVVDRYTDRPVWVRGVGLGMDRVMHQHK
TDMTTFPPTVRAAKAAMAMAGVTPRDIDVAEVHDCFTGVELISYEDLGFA
HRFEAYKLVEGREHYVGGSIPINPSGGLKAKGHPPGATGVAQCYELFNQL
RGEAENQVDGARIALAHNIGGPTAVSAVTVLSNQKN
118466110YP_880621.1 ABC transporter ATP-binding protein [Mycobacterium avium 104]MAEIVLDHVSKSYPDGATAVRDLNLTIADGEFLILVGPSGCGKTTTLNMI
AGLEDISSGELRIGGERVNEKAPKDRDIAMVFQSYALYPHMTVRQNIAFP
LTLAKMKKPEIAQKVAETAKILDLTDFLDRKPSQLSGGQRQRVAMGRAIV
RHPKAFLMDEPLSNLDAKLRVQMRGEIARLQKRLGTTTVYVTHDQTEAMT
LGDRVVVMHSGVAQQIGTPDELYENPANLFVAGFIGSPAMNFFPATLTPI
GLKVPFGEVMLTPEVQQVIAEHPEPDNVIVGARPEHLSDAALIDGYQRIR
ALTFEVKVDMVESLGADKYVYFSTAAWAAHSTQLDELAAEADAHENQFVA
RVPAESKAAIGQTVELALDTTKLMVFDADSGVNLTVAPSDSP
118466109YP_879933.1 hypothetical protein MAV_0653 [Mycobacterium avium 104]MRVIVDRDRCEGNAVCLGIAPDIFDLDDEDYAVVKLDPIPADQEQLAEQA
IAECPRAALSRGD
118466108YP_882862.1 hypothetical protein MAV_3685 [Mycobacterium avium 104]MFANVRLLGALGALLTAAIAGTAGVLSAPPAPDGGAAGPVELRSTAQPLE
TTMKSPIVATTDPRPFDPCEDIPFDAVQGLGLAFTPPEHEDGLRCHFDAG
NYQVAVEPIIWRTYEQSLPADAVETTIAGHRAAQYWVLKPTYHNSYWFYS
CMVAFKTSYGVLQQALYYSTVYSNPEVDCMQTNLQRANDLAPYYKF
118466107YP_883656.1 transcription antitermination protein NusG [Mycobacterium avium 104]MTTFDGDPSAGDAVDLRETDEATEAADEAAETTEDAAESAETQGEPAEEV
DPAAALKAELRSKPGDWYVIHSYAGYENKVKANLETRVQNLDVGDYIFQV
EVPTEEVTEIKNGQRKQVNRKVLPGYILVRMDLTDDSWAAVRNTPGVTGF
VGATSRPSALSLDDVVKFLLPRGATKKVAKGAASTAAAAEAGGLERPAIE
VDYEVGESVTVMDGPFATLPATISEVNGEQQKLKVLVSIFGRETPVELTF
SQVSKL
118466106YP_883138.1 hemerythrin HHE cation binding domain-containing protein [MycobacteriuMADMIVKSPDEVVAFLKAQHNLIEDMFDQVLHATDPKAREEPFATLRQLL
AVHETAEEMLVHPRARKEADAGDAVVDARLHEEHSAKELLSAIEKLDSTT
DQFLDEVTKLREAVLEHATREENEEFPALQRLDSDDLKRMGTAVRAAEAI
APTHPHPGVESATLNFAVGPFASMLDRARDLIGRAIG
118466105YP_882570.1 orotidine 5'-phosphate decarboxylase [Mycobacterium avium 104]MTGFGARLAAAKAQRGPLCVGIDPHPELLRAWDLPTTADGLAAFCDICVE
AFAGFAVVKPQVAFFEAYGAAGFAVLERTIAALRSAGVLVLADAKRGDIG
TTMAAYAAAWAGDSPLAADAVTASPYLGFGSLRPLLEAAAAHDRGVFVLA
ATSNPEGATVQRAAFDGRTVAQLVVDQAAVVNRSTNPAGPGYVGVVVGAT
VLQPPDLSALGGPVLVPGLGVQGGRPEALAGLGGAEPGQLLPAVAREVLR
AGPDVAELRGAADRMLDAVAYLDV
118466104YP_882369.1 histidinol-phosphate aminotransferase [Mycobacterium avium 104]MTGQRATPQPTLDDLPLRDDLRGKSPYGAPQLAVPVRLNTNENPHPPSRA
LVDDVVRSVARAAADLHRYPDRDAVQLRSDLARYLTAQTGVQLGVENLWA
ANGSNEILQQLLQAFGGPGRSAIGFVPSYSMHPIISDGTRTEWLQAARAD
DFSLDVDAAVAAVTERTPDVVFVASPNNPSGQSVSLSGLRRLLDAAPGIV
IVDEAYGEFSSQPSAVQLVGEYPTKLVVTRTMSKAFAFAGGRLGYLIATP
AVIEAMLLVRLPYHLSSVTQAAARAALRHADDTLGSVAALIAERERVSTA
LTGMGFRVIPSDANFVLFGEFTDAPASWQRYLDAGVLIRDVGIPGYLRAT
TGLAEENDAFLRASAQLAATELAPVNVGAIASAAEPRAAGRDHVLGAP
118466103YP_881310.1 hypothetical protein MAV_2095 [Mycobacterium avium 104]MFGGAVLSAPPAAAACSLTPADDQYINLLAQNKMVHNADFSDCHEAAEGR
WFADQVRSNPNPYGKAKELVNMVTNTTPLSPDQAEWEVESAIYVYAPDLI
PKIKAQAGQPAPPAA
118466102YP_882251.1 segregation and condensation protein A [Mycobacterium avium 104]MNATANGEAQPQTGFQVRLTNFEGPFDLLLQLIFAHRLDVTEVALHQVTD
DFIAYTREIGPKLELEETTAFLVVAATLLDLKAARLLPAGQVDDDEDLAL
LEVRDLLFARLLQYRAFKHVAEMFAELEASALRSYPRAVSLEDRFTQLLP
EVMLGVDAERFAQIAAVAFSPRPVPTVSVGHLHEVKVSVPEQARKLLAIL
EARGSGQWATFSELVADCEGSMEVVGRFLALLELYRSRAVAFEQSEPLGV
LQISWTGERPVGETLVEVRDEL
118466101YP_882346.1 integral membrane protein [Mycobacterium avium 104]MLPHLWKSALLSGILSLALGVLVLVWPGISILVAAVAFGVYLLITGIAQV
VFAFSLHVSAGSRVLLFISGAASLILALLAFRHFGQGYAILLLAIWIGIG
FIFRGVATTISAVSDPNLPGRGWNIFLGVISLLAGIVVLASPFESIVTLA
IVVGAWFVVIGVFEIISSFGIRKASKTLAG
118466100YP_882950.1 hypothetical protein MAV_3778 [Mycobacterium avium 104]MSAGSKSGGVPHIRRTGHNGHISHRLGARSPSETRWCRR
118466099YP_881935.1 PPE family protein [Mycobacterium avium 104]MDFAVLPPEVNSARMYAGPGSGPMLAAAMAWDELAATLHSTADSYQAEIT
ALTSGPWVGPSAAAMIAAITPYLTWMRTTGAQAEETANNARAAAFAYETA
FAETVPPPVVTANRTLLAQLVATNILGQNTPAIATTEAEYAEMWARDAAA
MYGYAGAAAAATRLTPFTQPDPTTNSGADQSQAVSKAAATAAGSTRNTVT
QQPFSAVPNMLNNLAVSPNALGDPSVTDLLGLESDLIAIFLDAPASVVGM
GVDAPSATIALPFDIAGALTGFHTDDIVSGWAGVQPWPGTGAVPPSPFPV
ITNPAGGFGTLASAGLGQAKTVGTLSVPPTWTAAAPAIRPAALALPATTV
TAAAETAATAAPAGTGSLFGEMAAAGLAGRAMAGTTGLGRERARAEAAKA
PREPGQEPGKAPKQEPAAPAVSAGGPITSIAAELRELASLRDAGILTQQE
FEEQKKRLLPS
118466098YP_881899.1 short chain dehydrogenase [Mycobacterium avium 104]MPSRRVLITGASRGIGRAVADRLAEGGHEPIGLARSAPEDFPGEFYEVDL
ADPYATAATLDKIVGHAAVHAVVNNVGFARFGRLGSIELDHLFDTYDLNV
RAAVQVVQAALPGMLDAEWGRIVNVTSLTTLGTPERTPYAAAKAALEACT
RIWAGELASAGITVNAVAPGPTETDMYRERSPVGSEREARFLQSIPLHRV
ARPREIAHAICFLLDEDAGYITGQILRVDGGGSIAA
118466097YP_881662.1 hypothetical protein MAV_2470 [Mycobacterium avium 104]MERLDVVVGPNGAGKSTFIALTLAPLLPGSVVVNADEIARQRWPQDPASH
AYDAAKVAADTRAKLIDLGRSFIAETVFSHPSKLDLLHAARRAGFTVVLH
VLLIPEDLAVERVRHRVRAGGHDVPETKIRERHRRLWTPVAEAMTLADLA
TGYDNSRLRGPRVVARLSGGLTVGAVDWPAWAPETLRSRWPV
118466096YP_882333.1 formamidopyrimidine DNA-glyxosylase [Mycobacterium avium 104]MPELPDVEGFRRQLADALPGRRVRRVKVHDPGILRNTTATTLARRLTGRR
FAGPRRHGKWLVLPTDGPTLLIHSGMTGRPYYCADGAAEDRYQRLVVSLD
QGELRYTDLRKLRGVWLADDPDDLVPITGRQGPDSLGLGLRDFRDALTAR
SARRRQLKSALMEQSVLAGLGNLLVDEICWRARIRPTRAVADLDDDEVKA
LHRAMTQVLRTAVRHGRVPGLPRWLTGARDAPDPHCPRCGGRLDHARVGG
RTTLWCPRCQPG
118466095YP_882364.1 imidazole glycerol phosphate synthase subunit HisF [Mycobacterium aviuMSPNSSGLAVRVIPCLDVDDGRVVKGVNFENLRDAGDPVELAAVYDAEGA
DELTFLDVTASSSGRATMLDVVRRTAEQVFIPLTVGGGVRTVADVDVLLR
AGADKVSVNTAAIARPELLEEMARQFGSQCIVLSVDARTVPPGAVPTPSG
WEVTTHGGRRGTGIDAVEWASRGADLGVGEILLNSMDADGTKAGFDLEML
QAVRSAVTVPVIASGGAGAAEHFAPAIEAGADAVLAASVFHFRELTIGQV
KAAMAEAGIPVRMVR
118466094YP_882152.1 hypothetical protein MAV_2966 [Mycobacterium avium 104]MNSLQRLARSRAVYRLLMGRGRPIVEGVEALLRFATKGRLGVLDLAGLPN
VRITVSGRQTGLARSATVQYVPFRDGLLLVGSNWGRRRHPSWSANLKAAQ
RVTVRRRGHRFVAAVQLLSGQERDAAWAAALAHWPNYGLAQELAGARRFR
LFLLTPTG
118466093YP_880782.1 alpha-amylase [Mycobacterium avium 104]MPGRVEIDNVQPVVSCGTYPAKAVVGEVVPVSASVWREGHEAVAATLVVR
YLGPAYPPVTETRRVKAVQAPVADREGRVDQQRIKPLSLPMTMGPEPYVF
HGQFTPDQVGLWTFRVDGWGDPIHSWRHGLVAKLDAGQGETELSNDLLVG
AELFERAATGVPRTRREPLLAAAAALRTAGDPVTRTALALAPEIEEILAE
YPLRDLLTRGEQYGVWVDRPLARFGSWYEMFPRSTGGWDDDGNPVHGTFA
TAAAALPRIAAMGFDVVYVPPIHPIGKVHRKGRNNSPTAGPTDVGSPWAI
GSDEGGHDAVHPDLGTIEDFDAFVARARELGMEVALDLALQCAPDHPWAR
EHRNWFTELPDGTIAYAENPPKKYQDIYPLNFDNDPAGLYDEVLRVVRHW
IDHGVKFFRVDNPHTKPPDFWAWLIAAVKGIDPDVLFLSEAFTPPVRQYG
LAKLGFTQSYTYFTWRTAKWELTEFGNDIAALADFRRPNLFVNTPDILHA
ILQHNGPGMFAIRAVLAATMGPAWGVYSGYELFEHRAVREGSEEYLNSEK
YELRPRDFAGALAEGRSLEPFITQLNTIRRLHPALQQLRTIHFHGVDNDA
LLAYSKFDPATGDCVLVVVTLNAFGPEEATLFLDMAALGMEPYERFWVRD
EITGQEFQWGQANYVRIDPAQAVAHVINMPLIPDEARMTLLRRR
118466092YP_883815.1 dihydrolipoamide dehydrogenase [Mycobacterium avium 104]MTSHYDVVVLGAGPGGYVAAIRAAQLGLSTAIVEPKYWGGVCLNVGCIPS
KALLRNAELAHIFTKEAKTFGINGEATFDYGAAFDRSRKVAEGRVAGVHF
LMKKNKITEIHGYGRFTDPHTLAVELNDGGTETVTFDNAIIATGSSTRLV
PGTSLSANVVTYEEQILSRELPESIIIAGAGAIGMEFGYVLHNYGVEVTI
VEFLPRALPNEDADVSKEIEKQFKKLGVKILTGTKVESISDDGSQVTVVV
SKDGNSQELKAAKVLQAIGFAPNVEGYGLEAAGVALTDRKAIGITDYMRT
NIEHIYAIGDVTGKLQLAHVAEAQGVVAAETIAGAETLALGDYRMMPRAT
FCQPNVASFGLTEQQARDEGHDVVVAKFPFTANGKAHGVGDPSGFVKLIA
DAKYGELLGGHLVGHDVSELLPELTLAQKWDLTATELARNVHTHPTMSEA
LQECFHGLTGHMINF
118466091YP_882798.1 hypothetical protein MAV_3621 [Mycobacterium avium 104]MLSVIAIVPSAPVLVPELAGTAADELAELSAATLAAAALLPDRWLIVGTG
AADQELGDDAVGTFAGFGMDVPVRLSPPADGRAETAPAALPLCVLLGGWL
RGQVQPRAAARARIYRADYDADTAVRRGRQLRAELDALPEPVGVLVVADG
ANTLTPAAPGGHHPGDAAAQQALDDALAGGDIAALRRLPGQILGRVAFGV
LAGLAEPGPRSAKELYRGAPYGVGYFAGAWQL
118466090YP_879768.1 hypothetical protein MAV_0486 [Mycobacterium avium 104]MAVRTPNISGLRTLLVIGTFLGGGVATAIPARAQGADDFLTDINRIGIGN
RDDPHNFDLVGLGNAICWRLYSGEAPGHVADELVTGSRSNGPAALTHAQA
TAAVGFARADLCPDAAP
118466089YP_884037.1 3-ketoacyl-(acyl-carrier-protein) reductase [Mycobacterium avium 104]MAPKVSSDLFSQIVNSGPGSFLAKQLGVPQPETLRRYRPGDPPLAGSLLI
GGEGRVVEPLRAALAKDYDLVGNNLGGRWADRFGGLVFDATGITTPEGLK
GLYEFFTPLLRNLGHCARVVVVGTTPDAAAGTHERIAQRALEGFTRSLGK
ELRNGSTVALVYLSPAAKPAATGLESTMRFILSAKSAYVDGQVFYVGEAD
STPPADWERPLDGKVAIVTGAARGIGATIAEVFARDGARVVAIDVESAAE
TLAETASRVGGTALWLDVTAPDAVDKITEHLREHHGGHADILVNNAGITR
DKLLANMDDARWDAVLAVNLLAPLRLTEGLVGNGSIGEGGRIVGLSSMAG
IAGNRGQTNYATTKAGMIGLTQALAPELYDKGITINAVAPGFIETQMTAA
IPLATREVGRRMNSLLQGGQPVDVAETIAYFASPASNAVTGNVIRVCGQA
MLGA
118466088YP_881583.1 mce related protein [Mycobacterium avium 104]MIRAVAGFANLVVRAVRTGHRQQVWLSVAGLVLILVVATAYLLIGALRVT
PFASSYRVTVQLPESGGLLPNQDVALRGVRIGRIESLQITDNGVNAVAAI
TSKVRIPANTVAHVSALSPAGEQFINFEAASDAGPYLHDGSFITSERTTV
PVSLAQLLGDADGLLAQVDPRKIELIKKELSLSKEGPAKLTAIVDGGLFL
LSTLDSVLPETTSIIKTSRVVLNLASDKNNGLGAAATELNHTLTGVARMQ
AGYRRLTSQTPQTLSAVDNLFADNSDTMVQLLGSMATMSQLLYLRVPALN
ALFPDYRGSVLDAVTSVFHDHGVWATADLYPRYVCDYGTPAHASSAADYY
EPFMYTYCRDDDPAVSIRGAKNAPRPGGDDTAGPPPGADLGRRTDPTPRG
RYTIPTPYGGPQLPIEPPH
118466087YP_883663.1 metallo-beta-lactamase [Mycobacterium avium 104]MSDDRLYFRQLLSGRDFAAGDMFATQMRNFAYLIGDRQTGDCVVVDPAYA
ASDLLDTLEADGMHLSGVLVTHHHPDHVGGSMMGFTLAGLAELVERAPVP
VHVNSHEALWVSRVTGISASDLTAHENHDKVSIGDIEIELLHTPGHTPGS
QCFLLDGRLVAGDTLFLEGCGRTDFPGGDSDEMYRSLQRLAKLPGDPTVF
PGHWYSAEPSASLSEVKRSNYVYRASDLDQWRMLMGG
118466086YP_880580.1 hypothetical protein MAV_1335 [Mycobacterium avium 104]MTRTANRTLRWQDISVGEEVTPLEIPITTTMIVAGAIATRDFMPVHHDRD
YAKKQGSPNLFMNILTTNGYCVRFLTDWAGPEAMVKKLSIRLGVPCFPDD
PLRFTGSVTGKTRGPAGPPPAENFVEVTFKASNSLGDHVSGTAVLSLLDG
AGS
118466085YP_884244.1 hypothetical protein MAV_5128 [Mycobacterium avium 104]MSLVAGRGPLSSDPAGRFSPPIPAEVVYVEPHPRRVQAVKDGRSVIDTER
ALMVHRRGRPLSYVFPADEVAGLPGEPEPEAPGFVHVPWDAVDTWWEEGR
KLVHYPPNPYHRVDCRGTRRRLRVRVGGTTLVDTDHTTIVFETALPPRLY
VDPAHVRTDLLRRSETTSYCNYKGFATYWSLVDGDRVVDDVGWCYPDPPP
ESLPIKGFLSFDETRVELLAELPVSARS
118466084YP_882813.1 DNA-binding protein [Mycobacterium avium 104]MPPLVREVIGDVLREARTTQGRTLREVSDTARVSLGYLSEVERGRKEPSS
ELLNAICDALDVPLSSVLTDAGERMASEERAAVAAPAGPSIDASTKVVIP
PVASLALA
118466083YP_881614.1 hypothetical protein MAV_2417 [Mycobacterium avium 104]MLRSDPQSYFIMTRGDTPYSHILPLSYDELNASLLEGFPDNVVSRFKSEM
N
118466082YP_883461.1 ABC transporter ATP-binding protein [Mycobacterium avium 104]MVVGRDLRADMRITHPLISRAHLLLRYDQGKWLAIDNGSLNGTFVNGRRV
PVVEIHDGCAINIGNPDGPLLTFDVGRHQGMAGRPPRTESMGIPVAAHPP
APAAWSAQPAPPVAAPPPPAGRTPNWAAPPRRPQPAPRPGPPGQTMYGGR
PPGGYPPAAPPPPPVAPAPAAPHTQMAPAASKPPEVANLATKMFQALMPS
RSGAIQKPAGSQTIGRATDNDIVIQDVLASRHHAFLIQTPLGTEIRDAHS
VNGTFVNGVRVGSAVLTEGDVVTIGNVDLVFTRDGLIRRTEAATRSGGLE
VNSVCYTVDHGKQLLDHISLTARPGTLTAIIGGSGAGKTTLSRLIVGYTT
PTSGTVTFEGHNIHTEYASMRSRIGMVPQDDVVHRQLTVNQALGYAAELR
LPPDTSKEERARVVAQVLEELDMTQHAETRVDKLSGGQRKRASVALELLT
QPSLLLLDEPTSGLDPALDRQVMLMLRQLADAGRVVLVVTHSVSYLDVCD
QILLIAPGGKTAFCGPPDQVEPALGTRNWADIFAKVGADPDEANRRFKER
NQQSSQPPTPQSPADLGEPPQTDLWRQLSTIARRQVRLVVSDRGYTIFLA
VLPFLIGALSLTVKGPHPGLGPADPLGPAPTQPQYIMVLLNIGAVFMGTA
LTIRDLIGERAIFRREQAVGLSTTAYLLAKIAVFCVFATAQAAIATIIVR
LGKGAPTAHPQFFGNSTFSLFVTVAGTCIASAMLGLLLSALAQSNEQIMP
LLVVSIMSQLVFSSGMIPVYQRIGLEQLAWLTPARWGYAAGASSIDFPSL
VKVKQIPTNDPIWQHSKHIFVFDMAMLALLSIGYTGFVRWHIRLKR
118466081YP_883821.1 enoyl-CoA hydratase [Mycobacterium avium 104]MPSDFETLLYTTAGPVATITLNRPDQLNTIVPPMPDEIEAAVGRAERDPA
IKVIVLRGAGRAFSGGYDFGGGFQHWGEAMMTDGRWDPGKDFAMVSARET
GPTQKFMAIWRASKPVIAQVHGWCVGGASDYALCADLVIASEDAVIGTPY
SRMWGAYLTGMWLYRLSLAKAKWHALTGRPLTGVQAAEIELINEAVPFER
LEARVAEVAAELARIPLSQLQAQKLIVNQAYENMGLASTQTLGGILDGLM
RNTPDALEFIKIAETRGVRAAVERRDGPFGDYSQAPPELRPDPSHVIVPD
RDG
118466080YP_883931.1 MerR family transcriptional regulator [Mycobacterium avium 104]MAKNRKGHESRTFLISVAAELAGMHAQTLRTYDRLGLVSPQRTSGGGRRY
SEHDVDLLREVQRLSQDEGVNLAGIKRIIELTNQVEALQARVKELTEELA
QVRAGQRRDLAVLPKSTALVVWQPRKGGTRT
118466079YP_881442.1 hypothetical protein MAV_2237 [Mycobacterium avium 104]MAPFARSARRVIGERIAAGAAGVAMTVAGLVATLVLTAGPAAADWPMDDP
EPAPASLPNCTAADLAQVSAGVAAATSAYLFSHPDVNAYFTSLKGQPRDE
MRAQLKQYMDANPQTHADLEGIRQPLTDFQDRCR
118466078YP_881686.1 universal stress protein family protein [Mycobacterium avium 104]MRTIRTAAAFSSGLYLRVVGFPGDCSFGIAPSSFPRSGASRISRAIHYSA
PVPALLELSGAVRMLVLGSAGHGLLARGLLGSVSSAVVRHANCPVAVVRD
EELPDPHSAPVLLGTDGSPASELATEIAFDEASRRGVDLVAIHAWSDTAV
TEVFEIDWPIVEAEAERHLAESLAGWQERYPDVTVHRLVARDRAAQHIIS
SSETAQLVVVGSHGRGGLARLLLGSVSNAVLHSVRVPVIVARPPA
118466077YP_879456.1 hypothetical protein MAV_0162 [Mycobacterium avium 104]MTIVVTGATGNVGRPLVTALLAAGAPVRAVTRRSGPAGFPAQVELFDTAA
DALPGASAVFLNARALGGQLEDVVARCARGGVTKLVALSAINADDDFSRQ
PSRFRGDRNREVEQLAVGSGLAWVSLRPTVFATNFAGMWSAQLREGDVVA
GPYAAASSAPIVETDIADVAAHALLTDDLVGQRIPLTGPQALSNAQLVEV
IGTVLGRSLRYREIPAAAVRRRFVGLGLGAGFADAYLAMLAETLDKPALV
THDVEKILGRPAVPFAHWVATHRDLFDRRNERKEGV
118466076YP_881898.1 metal-dependent phosphohydrolase [Mycobacterium avium 104]MTTTSSIETIADIAIPDTALVREITEFIRDAEDDLLFHHSRRVFLFGALQ
GRRRGLQPDLELLYAGAMFHDLGLTERYRDSALRFEVDGANAAREFLLHR
GVSKADADKVWLGIALHTTPGVPEFLDPEIALVTAGVETDVVGVGRDDLA
PEALAAVIAAHPRPDFKTRILQAFNDGMKHRPHSTFGTMNADVLEHFDPT
FARDNLVDLILNNGWPE
118466075YP_879338.1 hypothetical protein MAV_0038 [Mycobacterium avium 104]MSNLEVAPAEVACAASRDRDASPAVQILRPREVPLGGPRALRVQRTLPQR
ERSLIGAWCFIDHYGPAHTRMDVPPHPHTGLQTVSWLFSGEVEHRDSAGV
HAAVRPGELNLMTAGAGICHSEVSVGSGALHGVQLWVVLPDSDRDTARDF
AHYAPAPISLPGAQARVFLGELHGSRSPVRTFTPLVGAQIDLGAGAQLDL
DLDPDFEHGLLCDAGAVHVDEKPLSVAELAYLGPGRAAVQLRNAGDTPGR
VLLLGGTPFSEQLVMWWNFVGRSHEDIVGYRRLWEDGDERFGAVRGYRGA
LSRLPAPPLPTARLRPRPIPERKGSTNDNR
118466074YP_881411.1 hypothetical protein MAV_2203 [Mycobacterium avium 104]MKRPATRVADLLNPAATLLPAANVIMQLSLPGVGYGVLESPVDSGNVYKH
PFKRARTTGTYLAAATIGTDYDRALICAAVDVAHRQVRSRPSSPVSYNAF
DPKLQLWVAACLYRYFVDQHEFLHGPLDEASADAVYRDAARLGTTLQVPE
RMWPPDRAAFDEYWKRSLDELRIDPPVREHLHGVASLAFLPWPLRVLAGP
FNLFATTGFLAPEFREMMQLDWTPGQQRRFGWLLFSLRLADRLIPHGVWI
LGYRIYLWDMRSRARRGRRVV
118466073YP_883399.1 RsbW protein [Mycobacterium avium 104]MKDAGLHADKRPRGHRAVELHVAARLENLAMLRTLVGAIGTFEDLDFDAV
ADLRLAVDEVCTRLIRSATPDATLIVVVDPQDDQLVVEASAACDTHDVVA
PGSFSWHVLTSLADDVQTFHDGREPNEAGSVFGITLTARRAASSR
118466072YP_883411.1 hypothetical protein MAV_4271 [Mycobacterium avium 104]MTSTQIRKRARPRSLVVAGLLPLAGLLGVITTPAYATSADDAFLAALKAK
GINYESPDAAVNSGHTVCHELDMGQTPEQVANNVLSSSTLDSYHAGYFVG
VSIKAYCPKYAAAAAGS
118466071YP_881507.1 hypothetical protein MAV_2303 [Mycobacterium avium 104]MVIDCDDCAARGPGCRDCVVSVILGVPDTLLQDERAALEVLADAGLAPRL
RLVPIRRDRGTGVA
118466070YP_882953.1 GlcNAc-PI de-N-acetylase [Mycobacterium avium 104]MATVVAFHAHPDDEVVLTGGTIARAVAAGHRVVVVTATDGRVHNEDTDHR
LDELRSSARILGAQRVECLGYADSGYGPLFYPDPPGRTRFGRADLDEAAG
KLAGILRDEHADLLLSYQANGGYGHRDHVRVHHVGKRAAELAAVPRVLEV
TMPREMLLRISDLAHLLRLPGPYEADIVGSAYAPRAAITHRINVFRFARQ
KRDAFAAHRSQIGRSGPAARLFGLLLRLPPQVFGALFSHEWFVDPALPTG
TVRRDIFD
118466069YP_882823.1 hypothetical protein MAV_3646 [Mycobacterium avium 104]MQVGSDELQVVLDQLRAAAGQWQGLSAQLAEVAPPSPGQPFQATTAAVSG
VNAAIAVARAAFASRIQAEAARVTSAAADYANQEATGAGEMAAVTRVAVV
118466068YP_879847.1 DNA integrity scanning protein DisA [Mycobacterium avium 104]MTRPTLRETVARLAPGTGLRDGLERILRGRTGALIVLGNDENVEAICDGG
FALDVRYAPTRLRELAKMDGAVVLSTDGSRIVRANVQLVPDPSIATDESG
TRHRSAERAAIQTGYPVISVSHSMNIVTVYVGGERHVVADSATILSRANQ
AIATLERYKIRLDEVSRQLSRAEIEDFVTLRDVLTVVQRLELVRRIGQVI
DNDVVELGTDGRQLRLQLDELLGGNDNARELIVRDYHASPEPLSEAQMTA
TLDELDALSDTELLDFTALAKVFGYPTTTEAQDSAVSPRGYRALAGIPRL
QFAHADLLVRSFGTLQNVLAASASDLQSIDGIGAMWARHVREGLSQLAES
TITDSLS
118466067YP_880958.1 GTPase ObgE [Mycobacterium avium 104]MPRFVDRVVIHARAGSGGNGCASVHREKFKPLGGPDGGNGGRGGSIVFVV
DPQVHTLLDFHFHPHISAPSGKQGMGNNRDGAAGADLEVKVPDGTVVLDE
NGRLLADLVGAGTRFEAAAGGRGGLGNAALASRARKAPGFALLGEPGETR
ELTLELKTVADVGLIGFPSAGKSSLVSAISAAKPKIADYPFTTLVPNLGV
VSAGEHTFTVADVPGLIPGASAGRGLGLDFLRHIERCAVLVHVIDCATAD
PGRDPISDIDALEAELAAYTPTLQGDVTLGDLTERPRAVVLNKIDVPEAR
ELAEFVRDEIAERGWPVFLVSTVAREGLQPLIFGLWQMISEYQSAQPEIV
PRRSVIRPVPVDDSGFRVEPDPRQPGAFVVSGARPERWVRQTNFDNDEAV
GYLADRLARLGVEEELLRLGARPGCAVTIGDMTFDWEPQTPAGQQVVLSG
RGTDARLERTERVGAAERKAARRQRRTGDDAERGTTERGENT
118466066YP_880268.1 SpoU rRNA methylase [Mycobacterium avium 104]MPDSDARLASDLSLAVMRLARQLRFRNPSSPVSLSQLSALAMLANEGPMT
PGALAVRERVRPPSMTRVIASLAEMGLVDRTPHPVDGRQVLVSVSEAGAE
LVKANRRARQEWLAKRLVHAGRRRARNPAPRGRSDAGPGRRRPVNTDALD
VRDVDDPDDPRLDDFRDLNSVDRRPDLPSGKGLVIAEGVLVVQRMLASRF
RPHALLGTERRLAELRDDLAGVPVPYYRTSADVMARVVGFHLNRGVLAAA
RRVPEPGVAELLAGSRTVAVLEGVNDHENLGAIFRNAAGLGVDAVIFGSG
CADPLYRRAVRVSMGHALLVPYARATDWPAELKTLKEKGFRLLAMTPQGS
ACGLAEAMTAARGDRVAVLVGAEGPGLTPAALRLSDVRVRIPMSRGTDSL
NVATAAALAFYERSRPVGGHRAAAGGGDGQSG
118466065YP_882736.1 hypothetical protein MAV_3558 [Mycobacterium avium 104]MLCKNHRFMKLFLIVAGFAAVIGLAVPARADSTDDAFVASLDKAGIKYGD
ADKAAGAGKWVCTTLQGGKQMSDVVSTLQSKNSNLSDDHANTFAAIAVNA
YCPDQASSITPASPTDTPPSTS
118466064YP_882526.1 hypothetical protein MAV_3344 [Mycobacterium avium 104]MPITKPVTQPVTQPHTVPDTADQQQADYFMRLLTGRRGLIDQRLDGYRQK
IAKAEAKGDADAVAGLRRLTRIAEQDRQAVDGLIDKLRRRFARRA
118466063YP_881276.1 TrnB1 protein [Mycobacterium avium 104]MNATAIAKPMTALGQFFLLSAEALAAAVRGPWAWREILEQIWFVARVSIF
PTIMLSIPYTVLIVFVLNILLVEIGAGDLSGAGAGLASVTQVGPVVTAMV
VSGAGSTAMCADLGARTIREEIDAMKVIGVNPVQALVVPRIIAATFVAVM
LYAVVAVTGLTGSYIFVVFVQHVTPGAFVAGMTLVTGLPQVVISLIKATL
FGLSAGLIACYKGLSVGGGPTGVGNAVNETVVFSFMALFFINILTTALGV
KVTAK
118466062YP_883615.1 hypothetical protein MAV_4480 [Mycobacterium avium 104]MPYSGRECDSDPSSSRPQERQGPVEHETETDAQLVTETLVEEVSIDGMCG
VY
118466061YP_882475.1 ferrochelatase [Mycobacterium avium 104]MDFDAVLLLSFGGPEGPEQVRPFLENVTRGRGVPPERLDHVAEHYLHFGG
VSPINGINRALIEQLRAAQALPVYFGNRNWEPYVEDTVKVMRDNGIRRAA
VFTTSAWSGYSSCTQYVEDIARARAAAGPGAPELVKLRPYFDHPLFVEMF
AGAIADAAAKVPAGARLVFTAHSVPVAADERVGPRLYSRQVAYAARLVAA
AAGYAEHDLVWQSRSGPPQVRWLEPDVADHLRALAESGTPAVIVCPIGFV
ADHIEVVWDLDEELRAQAESAGMLMARASTPNAQPRFARLAADLIDELRC
GRTPARVTGPDPVPGCLASVNGAPCRPPHCAAQATG
118466060YP_880640.1 cytochrome P450 superfamily protein [Mycobacterium avium 104]MSVEVAGSDSRKALQFHFDRHAPEYRERFLDVTQEMHQRCPIAWTDTYGG
HWVAAGGDAVFELARCPHVSNDHDVNNERRGYRGVTIPLTTESDQIRGGM
LEMDDPEHRIYRSLLNPYLSPAAVSRWQPFIDDVVRACLDERIESGRIDF
VDDLANVVPAVLTLAMLGVPLRKWTMYNEPVHAMVYTPPDSPEAAKVHDM
WVSVVVDLFANLTEIREHPRPGIINALAQLRIDGEPAPDMEIIGMLTLLI
GGGFDTTTALTAHALEWLSEHPDQRARLHGELDVLLNPATEEFLRYFTPA
PGDARTISADMELDGIRFAEGERLWLSWAMANRDPSLFDNPNELMLARKA
NRHFSFGIGVHRCIGSNVARTVFKSMLTAVLERMPDYRCDRVNTVHYDTI
GIIQGMRNLPADFTPGKRRGPGLDETLDRLQSVCDSQGLARPITEYKEQA
RIHE
118466059YP_881723.1 TrnB2 protein [Mycobacterium avium 104]MTAAPARHRPMSVIPAPPRLARLSITLHRLVAGWNRLGSQTAFYVKALSL
MWDAVARYKAETLRLIATMSLGVGALAVIGGTVVVVTTLVMSTGSFIGIQ
LYRSLSDVGVEALSGFASAYLNTRFAAPLTSAIGLAATIGAGATAQLGAM
RINEEIDALEVMGIRAISYLASTRIVAGVLVTVPLWCLSSLAGYLATRTL
VVVAFGQAPGVYDHYFNTYLQPTDLIWSLLQVMATATVVMLVHTYYGFNA
TGGPAGVGEAVGRSVRASLVVAVTVQLAVAMAAYGVSGNFNLSG
118466058YP_882612.1 Holliday junction resolvase-like protein [Mycobacterium avium 104]MTQHRVPDRPGDPDQDPGRGRRLGIDVGSVRIGVACSDPDAVLATPVETV
RRDRSGKHLRRLAALVTELGAVEVVVGLPRTLADRTGASALDAIDLADQL
ARRIAPTPVRLADERLTTVAAQRSLRAAGVRAKEQRAVIDQAAAVAILQS
WLDQRRAAVREAGDG
118466057YP_879526.1 membrane protein [Mycobacterium avium 104]MVASPNLKLTTQVMRFVVTGGLAGIVDFGLYATLYKVVGVQVDVAKAISF
IVGTITAYLINRRWTFQAAPSTARFVAVMALYAVTFAVQVGLNHLCLAFL
HYRGWAIPVAFVIAQGTATVINFVVQRAVIFRIR
118466056YP_881545.1 hypothetical protein MAV_2341 [Mycobacterium avium 104]MSVRIRRVTTTRAGGVSKPPFDSFNLGDHVGDDPAAVAANRARLAAALGL
KPDRVVWMNQVHGDRVEVVHGPRDGAVDATDALVTGTARLALAVVTADCV
PVLLADARAGVAAAVHAGRVGAQRGVVVRTVEAMRALGAQPADMSALLGP
AVSGANYEVPAAMADEVEAALPGSRTTTAAGTPGLDLRAGIACQLRELGV
TAIDIDPRCTVADPALFSHRRDAPTGRLASLIWME
118466055YP_881246.1 hypothetical protein MAV_2027 [Mycobacterium avium 104]MPAKLSRLRILAAAAIAFAPLSVVVDGPVAQAAPCAGAGSNPVSCQHCMF
YVNAYHTANVCNEDRRGVQGPPSNAPTRPPEVPVPAYEPPPIPVPVQSPL
VLPPPNAGQGAVPVLEINPPGPDAPRDAPVVAPPRGLDAPSLAIAAAKAA
PVTRVDPANPPKPPTQVDFNQQVQNVVAAHRENVDVLKVDEQRLIRPRHW
DYIDYDDAYRRPTLYNPLNSAVTFRYFYNGAYQQAYLARGARMVLDAATV
GVVPFTAVGDSYVAAGSFYGGGSIPLNGYNGPPPPDYKPPAPPKLYENVT
AFIPAKGETVEVGHVAVVGHDGSQPAGSQDTFLLDDSTLAWGQIDNSSSA
PAQIRVIKTQPLPGAGPTDDGGFLVLLAVHHQEPGQPRQSGWGLALRFGG
FAVVVGVIAWLLARRSRSEEQNADS
118466054YP_882642.1 histidyl-tRNA synthetase [Mycobacterium avium 104]MPEFSAPKGVPDYVPPDSAQFVAVRSGLLDAARGAGYGDIELPIFEDTAL
FARGVGESTDVVSKEMYTFADRGDRSVTLRPEGTAGVVRAVIEHGLDRGT
LPVKLCYAGPFFRYERPQAGRYRQLQQVGVEAIGVDDPALDAEVIAVADA
GFRSLGLDGFRLEITSLGDDSCRPQYRELLQDFLFGLDLDEETRRRARLN
PLRVLDDKRPEVRAMTADAPVLLDHLSDAAKQHFDTVLAHLDALGVPYVI
NPRMVRGLDYYTKTTFEFVHDGLGAQSGIGGGGRYDGLMRQLGGQDLSGI
GFGLGVDRTLLALRAEGKSVGSAARCDVFGVPLSDQAKLRLAVLAAGLRA
AGVRVDMAYGARGLKGAMRAADRSGARIALVLGDRDIDAGTVGVKDLQTG
SQVSVELDSVVAEVLSQLSR
118466053YP_884083.1 sensor histidine kinase [Mycobacterium avium 104]MTAEQVSQPPASGSSRFAVYDYVDGMERLVHAVQELSLARSLPDIQRIVR
SSARELTGCDGATFVLRDNDRCYYADEDAIAPLWKGSRFPMTSCISGWAM
LNRDAAVIPDIYRDPRIPHNLYRPTFVKSLVMVPIRKLDPIGAIGNYWAE
PHQPSEHEVRLLQALADSTSMAMENVAIYSEMEQRVRDRTAALERANEEI
RRLSVTDELTGLNNRRGFYLLAGQKLSGSHRLGHACVLAFLDVDGLKQVN
DEQGHDAGDMLIKDVAEVLRSIRRESDILARIGGDEFCVMVTESDQDSAP
LRERLAEAFAAFNATGDRPYRLSASVGLVRAPVFDTASVDELLARADELM
YVEKKARRTAG
118466052YP_883694.1 galactokinase [Mycobacterium avium 104]MTVRYAAPGRINLIGEHTDYNLGFALPIALPQRTVASFTPADDDAITVVS
DRADAPVRIPIDTGPGDVTGWAAYPAGVMWALRTAGHPVPGGAMSITSDV
PMGSGLSSSAALECAVLGAISSAAGIRIDATEQARLAQRAENEYVGAPTG
LLDQLAALYGRPAAAVLIDFADLAVTPVAFDPDAAGVALLLIDSRERHTH
AGGDYAARRLSCERAAADLSASSLRAAADRGCTDLAAVRDPVDARRARHV
LTENGRVIDCVAALNNSDYTEAGRIFTASHASMRDDFGITTERIDLIADT
ALRAGALGARMTGGGFGGCVIALAPVQRAEAIGQAVRRAATQAGFAQPVV
TRTRAAAGAGPCR
118466051YP_883957.1 hypothetical protein MAV_4833 [Mycobacterium avium 104]MIRLLRPLPEHNLPAGSRGTIVMDYTKDSDSTLPSAYEVEFSDADGVTQA
LVTLSGDDLEVVWRPDPDA
118466050YP_881031.1 virulence factor Mce [Mycobacterium avium 104]MAVVALAGVGLMIFPVLKLHEKWLGVGRYTVTVQLPEAAGLYERANVTYR
GYNVGQVQSVQLTDTGVEAKVLLNSDTKIPSEVNAEVHSVSAIGEQYIDL
LPRSADAPPLKNGDVIARDRTTVPPNISSLLDATNKGLQAIPRDNLKTVV
DEAYIAFGGLGPELARFVQGATALAIDARANINELTTIVDDSKPILDSQI
DTSESIQAWAANLATVTEQLRSEDQNLAKVLQDASPAVDEARALFDQLQP
TLPIVLANLVSVTEVLAVYRGNLEQLLVLLPHGAAAIQAVGVANRNTKQD
YNGGYLSFNLNLNLPPACTTGFLPPAQRRSAALEDYPPPPDGDLYCRVPQ
DAPFNVRGARNTPCVEKPGKRAPTAAICESDENYMPLNDGYNWKGDPNAT
LSGQDVPAPRDPSAPGAGPPPAAPAPPPPPIAVAEYDPSSGSYVGPDGRM
YTQKDLAIGGEPKVWQDLLVPPAGN
118466049YP_880045.1 fatty acid desaturase [Mycobacterium avium 104]MSAELTNLQLLQELEPFVEKYLNRHESMHKNWNPHDYIPWSDGKNFYALG
GQDWEPGQSKLSDVAQVAMVQNLMTEDNLPSYHREIAMNFGMDGPWGQWV
NRWTAEENRHGIALRDYLVVTRAVDPVELEKLRIEVVNRGFSPGQNHQVR
EDLFAESLFDSVIYVTFQELATRISHRNTGKACNETIADQMLAKISADEN
LHMIFYRDVSEAGFAIAPNQAMKSLHKVLRNFQMPGYQVPEFRRKAVMIA
VGGVYDPRIHLDDVVMPVLKKWRIFEREDFTGEAAALRDDLALLIKELET
TCDKFEISKRRQLEREARTGKRTTALELHTTAGTLTMSRR
118466048YP_880325.1 ATP-dependent DNA helicase PcrA [Mycobacterium avium 104]MSVHVTDAKPVSEAEQLLEGLNPQQRQAVVHEGSPLLIVAGAGSGKTAVL
TRRVAYLIAARGVGVGQVLAITFTNKAAAEMRERVVRLVGNRARAMWVST
FHSTCVRILRNQASLIEGLNSNFSIYDADDSRRLLQMIGRDMGLDIKRYS
PRLLANAISNLKNELIDPAAAVANLTDDSDELSRTVASVYGEYQRRLRAA
NALDFDDLIGETVAVLRAFPQIAQHYRRRFRHVLVDEYQDTNHAQYVLVR
ELVGTDTEDGVPPGELCVVGDADQSIYAFRGATIRNIEDFERDYPDATTI
LLEQNYRSTQNILSAANSVIARNSGRRDKRLWTDAGAGELIVGYVADNEH
DEARFVAEEIDALAQKGEITYNDVAVFYRTNNSSRSFEEVFIRAGIPYKV
VGGVRFYERKEIRDIIAYLRVLDNPGDAVSMRRILNTPRRGIGDRAEACV
AVYAENTGASFADALVAAAEGKVPMLNSRAEKAIAGFVELLDDLRGRLDD
DLGDLVESVLERTGYRRELESSTDPQELARLDNLNELVSVAHEFSTDRAN
AAALDESLDAADDEDVPDTGVLAEFLERVSLVSDSDEIPEDGAGMVTLMT
LHTAKGLEFPVVFVTGWEDGMFPHMRSLDDPVELSEERRLAYVGITRARQ
RLYLSRAIVRSSWGQPMLNPESRFLREIPQELIEWRRTAPAPSFSAPVSG
AGRFGTPRAAPTRAAMSKRPLLVLAPGDRVTHDKYGLGRVEEVSGAGESA
MSLIDFGSSGRVKLMHNHAPISKL
118466047YP_880731.1 flagellar hook-length control protein [Mycobacterium avium 104]MTTMTPEDAIKAASSVARDIADGTLSPTDLEGQAVAELRALVGEVVGPDD
PAWSLQCDIARQVLALDGVPADELAEWLAVARQRAGEPVGTPALAETPPE
PVSLPTEAHGPETVPAADDVPDPAPVALAVVPPPPTSPRQADGYDPLTGW
SPGGRR
118466046YP_879825.1 dihydroneopterin aldolase [Mycobacterium avium 104]MADRIELRGLRVRGQHGVFDHERVDGQDFVIDVTVWIDLVGAAASDELAD
TYDYAALAQLAADVVAGPARNLIETVGAQIADQVMDDERVHAVEVMVHKP
QAPIPQQFADVAVVVRRSRRGGRGSVVPAGGAL
118466045YP_879653.1 cytochrome P450 superfamily protein [Mycobacterium avium 104]MTVANDTAVYYDPYDIGIITDPYPTYARLREEAPIYYNERYDFWALSRHS
DVERALANWQVFSNRRSDILELIQSKFDMPGGVMMFQDPPEHTVLRGLMS
RVFTPRRMAALEDQIRQYCIRCLDPLVGSSSFDIIAELASMMPMRVIGML
LGIPESEQVSVRDANDANLRTKPGAPLRVADADSIADGRIYADYVEWRSK
NPSDDLMTTLLNVEFDDEDGVRRKLTRKEVLHYTQVVAGAGNETTGRLIG
WLAKVLAEHPDQRREVYRDRSLLTRTVDETLRFEPTGPHVARWMAADFEC
YGTTVPAGSAMLLLFGAANRDPRRYTDPDTFNIHRDNISHITFGKGVHYC
LGANLARLEGRVALDELLNRWPEWDIDYDTAQLASTSTVRGWERLRIVVP
118466044YP_883390.1 3-ketosteroid-delta-1-dehydrogenase [Mycobacterium avium 104]MGTVQWTAECDVLVAGSGAGGVTGAYTAAREGLEVLLVEATSKFGGTTAY
SGGGGVWFPCNPVLIRAGTDDTIEDALTYYHAVVGDRTPRELQETYVRGG
APLIEYLEADPHLAFVPLPWPDYYGKAPKARLDGQRHIAAKPLPVAAAPE
FRTVIRGPLDTDRLGAEPPSDYYLGGRALIARFLRAIGEFPTATLRRDTA
LVELVRTDGRVVGAVVETGGERRAVRARRGVLLAAGGFEANPDLRRAYGV
PGQARDTMGGPGSRGLALQAGIAVGADTDLLDQAWWSPGLTHPDGRSAFA
LWFTGGIFVNQSADRFVNESMAYDRAGRQILAHLRDGSLRLPYWMIYDDK
EGAVPPVKATNVSLVETEKYVAAGLWHTADSLPELAAKIGVPAQRLTATV
LRFNGFAAAGVDEDFGRGDEAFDRAFSAGASPLVPIDTPPYHAAAFGVSD
LGTKGGLRTDTAARVLDTAGRPIPGVYAAGNTMAAPSGTTYPGGGNPIGT
SMLFSHLAVLDMRDRRP
118466043YP_882831.1 glycosyltransferase GtfE [Mycobacterium avium 104]MLLSAYDSRGGVQPLAALAVQLRALGVDARVSAPPDAEFAELLARAGVPL
VAFGDSLRAMKTAATTPSEEQLRRQLDGLIAAQFDAAAAARECDALVVAG
FPPAAAAARSAAEKRGAHYVYVSYQPTILPSPHYPPPGYADAAIDNRLLW
QLDGRDNRLLWQLDGRYMQALFGETLNARRASIGLPPLDDLRGYALTERP
WLATDPTLDPWRPPGDLDVVQTGAWLLADDRRLPAELDAFLDAGAPPVYV
GFGSMPMRACRDVARVAIEAVRAQRRRAVVSRGWAGLGPIDDGEDCLVVG
EVNHQALFGRVAAVVHHGGVGTLTAAALAGAPQVVVPQGADQPYWAARVA
ELGIGAAHDGPAPTVESLSAVLGTALTERTRARAGAVAATIRTDGAARAA
RLLVARLAG
118466042YP_879818.1 limonene 1-2-monooxygenase [Mycobacterium avium 104]MSAPLRFGVFITPFHPVGQSPTVALEYDLERVVALDRLGFDEAWFGEHHS
GGYELIACPEVFIATAAERTKHIRLGTGVVSLPYHHPLMVADRWVLLDHL
TRGRVMFGTGPGALPSDAYMMGIDPVDQRHMMQESLEAILALFRAAPTER
IDRHSDWFTLRDAQLHIRPYTWPYPEISTAAMISPSGPRLAGALGTSLLS
LSMSVPGGYAALETTWDVVREQAAKAGRDEPDRGDWRVLSIMHIADSREQ
AIDDCTYGLQDFANYFGAAGFVPLANSVEGTQTPHEFVAEYAAKGNCCIG
TPEDAIAHIEDLLDRSGGFGTLLMLGHDWASPEATYHCYDLMARKVIPHF
KRQLDASRASHDWAKGMRDQLLGRAGEAVVKAISEHVDEHKDAVH
118466041YP_879626.1 GntR family transcriptional regulator [Mycobacterium avium 104]MAAIDISGTVRERAARELRDRILTGALPAGSRIDLDAITAEFATSRTPVR
EALLELSFEGLVQVAPRSGVTVIGISPEDVLDSFTILGVLTGQAAAWAAE
RIGPEELATLRELAAEVVAKSGDDSIGEANWHFHQMIHRAAHSPRLANQI
KHAARVVPTNFLTLFPEHEKHSLDEHAQLLDALGDKDVERARAIAERHVL
DAGRSLAEWLEQRRDGER
118466040YP_881280.1 virulence factor Mce [Mycobacterium avium 104]MLGVLGTVILACVTVVAFQYNKLPFIKNTDDYAAYFSEAGGIKPGNAVRV
SGMGVGRVSDLRLEGTKVRIGFTVRKGVVLGDRTEAAIKTETILGAKMLE
LTPRGDGRLSGVIPLERTTSPYDLPDALGDLTTTISGLDTTQLSAALTTL
ADTLKATPENLKPALQGVARFSDTLNSRDAQLRSLLGNANHVSAVLGRRS
QQIAGLVANSNALLAALLDERDSLDALMNHLTAVSHQISGLVNDNRTQLK
PALDKLNGVLEILDNRKEELQKTLPKFKRYAMSFGECLGSGPFFKAYVAN
LVPGQFGGPVLDADMYDRFLDPDQKLPSEVVDPPTGTPPVPPENAPVPLW
SQPPSPPPSTPPVRTIPPPSPHEFDQP
118466039YP_882528.1 acyltransferase domain-containing protein [Mycobacterium avium 104]MTDSDNADGGDIGKFDPVLTQRLMTVMRPVLKAYFRSEVHGLESFPPGGA
LVVGNHSGGMFPMDVPIFSVHFYDKYGYDRPIYTLSHDILMTGPTGDFFR
RTGYIRANRENAAAALRSGGVVIVFPGGDYDAYRPTLAENVIDFDGRKGY
VRTAIEAGVPIVPAVSIGGQETQLYLTRGTWLAERLGIKRLLRSAILPVS
FGFPFGLSAVIPPNLPLPAKIVTRVLDPIDIAKQFGEDPDVDEVDEYVRS
VMQQALNELAAERRFPILG
118466038YP_882460.1 methylmalonyl-CoA mutase- small subunit [Mycobacterium avium 104]MSIDVPELADLEQVRGRWRSAVAGVLAKSTRKDPEQLGDAPERLLETPTY
DGIAIRALYTALDELPEPPLPGEWPFVRGGDALRDVRSGWKVAEAFPATP
VPGVAAKDINSAVLDALGNGAGAVLLRIGESGVAPDQVADSLQGVYLSMA
PLILEAGADYPGASDAVLGLADEIEPDQRATVSIDLAGDPLTAGLSGRPA
PELKDVVAVAKRAAGHTGVRAITVDGPAFHNLGANASWELGASIAAGVNY
LRVLTESGLTIAAALRQISFRFAADDDQFMTIAKFRAARTVWARVAEVVG
EPDAGAAVVHAETSLPMMTQRDPWVNMLRCTLAAFGAGVGGADSLLVFPF
DVAIDGGFPGTATSFARRIARNTQLLLLEESHVGRVLDPAAGSWFVEDLT
QRLAEQAWQHFQAIEARGGFAEARDFIAGQIAEIAARRRDDIAHRRTAIT
GVNEFPNLAEPALPHSDSSYSPLAAGKLIRYATDFEALRDRSDAYLARTG
SRPQALLLPLGPLAENNIRATFASNLLASGGIEAVNPGTVDAAGVAKAVK
EAGSPAVAVICGTDKRYQDEASDVVQAARGAGVSRVYLAGPEKAVADAEH
RPDQFLTAKINAVEALSDLLTRLGA
118466037YP_882355.1 prolipoprotein diacylglyceryl transferase [Mycobacterium avium 104]MTKLLAYFPSPPQGVWHLGPVPIRAYALFIIAGIVAALLIGDRRWEARGG
ERGVIYDIALWTVPFGLVGGRLYHLATDWRTYWGPGGAGFGAAVRIWDGG
LGIWGAVALGAVGAWIGCRRHGIPLPAFADALAPGIILAQAIGRLGNYFN
QELYGRETTLPWGLEIFYRRDPSGYIDPHSLDGVSTGQVALVVQPTFLYE
LLWNLLIFVALLYADRRLTLGHGRLFALYVAGYCVGRFCVELLRDDTATH
IAGIRINSFTSTFVFIGAVVYLMAAPKGREDPESLRGNQYVEEEPAEPEP
ATVAATTEAATEGVAAPADGAEAAGADATAQRPEESAEPDVEKPESEETE
AEAAEEPESEETEAAEEPGEPEAEEPEEPEAEEPEEPETEEPEADSDEEP
EEESGEAPEQPVAEEPEPAPQQPETKRRWGARLRDRLSGR
118466036YP_882770.1 inositol-1-monophosphatase [Mycobacterium avium 104]MRLRSVAETLAAEAAAFVRRRRAEVFGTEPGGASAPDGGAVRSKSTPTDP
VTVVDTETERLLRDRLAQLRPGEPILGEEGGGPAEPSAPGDGTVTWVLDP
IDGTVNFVYGIPAYAVSVGAQVDGESVAGAVADVVGDRVYSAAAGLGAHV
SDGAGRQPLQCAAVDDVSMALLGTGFGYARQRRAAQAALLARMLPVVRDV
RRIGSAALDLCMVAAGRLDAYYEHGLKVWDRAAGALIAAEAGARVVLPAP
DGDGAGLVLAAAPGIADELLAVLERFDGLDPILD
118466035YP_881595.1 mercuric reductase [Mycobacterium avium 104]MTKHFDAIIVGAGQAGPPLAGRLTAAGQRVAIIERKLIGGTCVNTGCIPT
KTLVASAHAAHLARRGADYGVGTGAISVDMAKVKARKDEIMLGDRKGVED
WLAGMAGCTVVRGHARFRDPHTLQVGEDLLRAERIFLNVGGRAVVPDIPG
LAEVDFLTNVSILELDRLPTHLVIVGGSYIALEFAQMYRRFGAAVTVVER
GPRLASREDEDVSAAVQEILRAEGIDIVVNADDVRIAKTGNGFELTSRDG
APPIRGSHLLLAVGRRPNTDDLDLAVAGVRTDARGYILVDDQLKTNVEHI
WAMGDCNGRGAFTHTSYNDFEIVAANLLDDDPRRVSDRITTYALYIDPPL
GRAGMTVAQVRASGRRALVGKRPMTRVGRAVEKGETQGFMKVVVDADTRE
ILGAAILGVGGDEAIHGILDVMSAKAPYTTLSRTMHIHPTVSELIPTMLQ
QMSPLA
118466034YP_879951.1 oxidoreductase [Mycobacterium avium 104]MKRLEGKRILVTGAASGIGQATALRLLDEGAAVAASDVAVDGLERTRDRA
AQAGTAERLVTVTMDVGREDAVVDGVRVAVEQLGGLDSLVNAAGMLRAAH
THQTSLQLWNQIIGVNLTGTFLVVREALPALLDNARSAVVNFSSTSASFA
HPYMAAYAASKGGIQAFTHSLALEYARRGLRAVCVAPGSIKSGITDATGG
YIPEDADWSLFSRLLPVLPTTVESSGTGMAEPTAVAGVIAMLVSDDGAFI
TGTEIRIDGGTHA
118466033YP_882157.1 peptidase- M24 family protein [Mycobacterium avium 104]MATEVLPDAPALRLARRQRALAAMDEHGLDMLVLGRQANIRYVTGAPQLW
IAGTRPFGPMCVLVRATGDIYLNSTDDEGVPEEIDHDHLYGLAWNPVTLI
DVLRKVEGAESARRVGTDALTPTFAALLPEAFPNAELVDAEPAMRAARRI
KTPDEITAMGAALRVAEHGLAAALAELAPGAAERTLAGAMMEAMAAGGVS
TPATQDAAWVTSRERPWRRAGSGEVRPGDLVAFAAGALADGYVAEVGRTW
PAGDTVGGQVRALFGRSNALYDRMLAACRPGASTGDLLAAYRAVDEPVPP
MPVAHGLGLGFDPPVVSETLAAAGERDRMEAGMVLAITGYVWQRGIGAVF
RRDTVHITEGGVQVLTASPTWTGPLP
118466032YP_880549.1 nitrate reductase- beta subunit [Mycobacterium avium 104]MKVMAQLAMVMNLDKCIGCHTCSVTCKQAWTNRSGTEYVWFNNVETRPGQ
GYPRTYEDQERWRGGWIRDKRGRLRLRDGGRFQKLLRIFANPKLPVIGDY
YEPWTYEYENLTTAPAGDTFPTAAPKSLISGEPMKVSWGPNWDDNLAGSP
EILAEDPILKKVSEEVKLSLEQTFMFYLPRICEHCLNPSCVASCPSGAMY
KRSEDGIVLVDQDRCRGWRMCVSGCPYKKVYFNHKTGKAEKCTLCYPRME
VGLPTICSETCVGRLRYLGVVLYDMDRVLEAASVENDTDLYRAQCDILLD
PNDTDVIAGARAQGIPDEWIEAAQRSPVYALIHTYRVALPLHPEYRTMPM
VWYIPPLSPVVDAVSRDGHDGEDLGNLFGALDALRIPMQYLAELFTAGDT
AVVEGVLRRLAAMRSYMRDINLGRETQPHIPHSVGMTEEQIYEMYRLLAI
AKYEERYVIPTAFAPQARDLEQMGCSLTGDGGPGMYESEPVAVETFHALK
QRGGPTEAEPGSTRPRVNLLNWDGGQVPAGMFPEAQRR
118466031YP_880944.1 pyruvate synthase [Mycobacterium avium 104]MEGNDVDPNGSGAGSDSQNGASPNGSSRQRLEQVVIRFAGDSGDGMQLTG
DRFTSEAALFGNDLATQPNYPAEIRAPAGTLPGVSSFQIQIADYDILTAG
DRPDVLVAMNPAALKANIGDLPRGGMVIANSDEFTKRNLTKVGYVTNPLE
TDELSDYVVHSVAMTTLTLGAVESIGASKKDGQRAKNMFALGLLSWMYGR
PIETSEKFIREKFARKPEVAETNVLALKAGWNYGETTEAFGTTYEVSRAT
LPAGEYRQISGNTALAYGIVAAGQLADIPVVLGSYPITPASDILHELSKH
KNFNVITFQAEDEIGGICAAIGASYGGALGVTTTSGPGISLKSEALGLAV
MTELPLLVVDVQRGGPSTGLPTKTEQADLLQALFGRNGESPVAVLAPRSP
SDCFETALEAARIAVSYHTPVIVLSDGAIANGSEPWRIPDVSTLPRITHA
FAKPDEPFQPYARDPETLARQFAVPGTPGLEHRIGGLEAANGSGNISYEP
VNHDLMVRLRQAKIDGISVPDLEVDDPTGDAELLLIGWGSSYGPIGEACR
RARRKGIKVAHAHLRYLNPFPANLGEVLRRYPQVVCPEMNLGQLALLLRG
KYLVDVQSVSKVQGVAFLADEIGRVIRAALGGTLAEVENDKTMVARMAAA
TVGASA
118466030YP_881217.1 PPE family protein [Mycobacterium avium 104]MDFGALPPEINSGRMYSGPGPASLLAAAAGWESLAAELADGAGNYQAVIA
GLTNESWLGPASLSMAGAVMPYVSWLTAVAEQCGRAAAQATAAASAFEAA
YAMTVPPPLIAANRARLLALVQSNIFGQNTPAIMATEAEYSEMWAQDATA
MYGYAANSASASALSPVPSPPQPTNPAAAGHLAAAAHAAVQSGSSAHTTT
AHWMSSVPQTLQGLSTPGSTPGNGLSPTAMGTGAALGSSGPFSSLSSLTG
ASGKGATKSASTGAGAGLASALAAGPAADGAAAGLAEEAAGYGADGAGLI
ADGGGIGIDLYGLDLDYQGLALDEAGAGSILGAEAGTGIAGTAGLGSLEP
PAGLGQGASASVGQAGALSTLSVPPSWATTVSTVTPLPSPNSGPVPGGWA
AAPTASPGPAVSRLPLGGMVGRESEGPVHRVGQRVSLIPQVIG
118466029YP_879533.1 cysteine desulfurase [Mycobacterium avium 104]MAYDVARVRGLHPSLGDGWVHFDAPAGMLIPDSVATTVSTAFRRSGPTTV
GAHPSAQRSAAILEAARAAVADLFNAEPAGVVLGADRAILLSALAEASSS
RAGLGYEVIVSRLDDEANIAPWLRAAHRYGAKVKWAEIDIETGELPTWQW
EGLIGKSTRLVAVASASATLGTVTDLRAMTKLVHDVGGLVVVDHSAAAPY
RLLDVKETDADVVAVNAAAWGGPPIGAMVFRDPALLNSFSSISADPKATG
AARLEIGAHQFGLLAGVVASIEYLASLDESARGTRRERLAVSMQSATSYL
NRIYDYLMVSLRSLPLVMVIGRPEVRIPVVSFALHGVPAERVVQRLADNG
ILAVTNESSRALDVLGVNDVGGAVTVGLAHYSTTAEVDQLVRALASLG
118466028YP_882929.1 ribonuclease HII [Mycobacterium avium 104]MIRKSSGLRTLESALYRSGLGPVAGVDEVGRGACAGPLVVAACVLGPGKL
ESLAALDDSKKLTESVRERLFPVIRRYALAYHVVFIPPAEVDRRGVHVAN
IEGMRRAVAGLSLRPGYVLSDGFRVPGLAVPSLPVIGGDAVAACIAAASV
LAKVSRDRLMVAMDAEHPGYGFADHKGYSTPAHSAALARLGPCPQHRHSF
INVRRVANGSGGRVVADCKPDLPLQRDEGR
118466027YP_880355.1 GalU protein [Mycobacterium avium 104]MVVPRTAIVPAAGLGTRFLPATKTVPKELLPVVDTPGIELVAAEAAEAGA
ERLVIVTSEGKDGVVAHFVEDLVLESTLEERGKTAMLDKVRRAPRLIKVE
SVVQSEPLGLGHAIGCVEPRLADDEDAVAVLLPDDLVLPTGVLGTMSKVR
AHYGGTVLCAIEVTPEEISAYGVFDVEPVPDDDPDVLRVKGMVEKPKAED
APSMFAAAGRYVLDRAIFDALRRIDRGAGGEVQLTDGIALLISEGHPVHV
VVHRGSRHDLGNPGGYLKAAVDFALDRDDYGPDLRQWLVARLGLSEQ
118466026YP_883702.1 methyltransferase [Mycobacterium avium 104]MTVPNDDTWGPATSVGTTATMAAAARAIATRDGVINDPFAEPLVRAVGVN
FLTRWAIGELVASDVDVEGSPWGLAQMPAAIAARTRYFDEFYADAAAAGI
RQAVILASGLDTRAYRLDWPAGMTVFEIDQPAVVEFKTTALARLAAEPKA
DLRTVAVDLRDDWSTALATAGLDSSKPTAWIAEGLFGYLAPEAQDRLLDA
VTALSTPGSRLGSEAVPDTADMDPHAARQRMRAATAKWRDHGFELDVDVI
SFAGERHDVGAYLQALGWTTVATPMAELLADQGLPAIARADDDRQTMNGV
TYYTSTLGTGRQR
118466025YP_880054.1 hypothetical protein MAV_0781 [Mycobacterium avium 104]MSEETETAESADETVAGASHGAGGDETEVVPPVTEVAPELAWSGCEDEAG
LEPAPAAGRSWARTCGYAALIGVVPAGLLILIFGFPWYWFSPRSSAPAPS
VAAPTPAPTVAALPPAGSAPPPAVRTLGPVAVPPPSTVTVTAVPPATVTV
QAAPTLPPTDSSWTPEQLATSTCDVLWGGGSQADAIQFVRNKTGWDFGPA
QRWTAQATSITCPGAGH
118466024YP_882449.1 hypothetical protein MAV_3267 [Mycobacterium avium 104]MEIACHDQSRSRLPPGSDEVSVMASGSPKPSMRFPHSRYKLA
118466023YP_880803.1 pyridoxamine 5'-phosphate oxidase [Mycobacterium avium 104]MKPFSESERQEFLAGTHVAVLSVEATDGRPPAAVPIWYDYTPGGDIRIMT
GASSRKARLIERAGKVTVVVQREEPPYQYVVVEGTVVDATKPAPSDVQLA
VAIRYLGEEGGRAFVQSLEGVEEVLFTIRPDRWLSADFTGDL
118466022YP_882062.1 hypothetical protein MAV_2875 [Mycobacterium avium 104]MAAAWEYDWPTPRWRRHLGAQLQGSYSLPLIGSMRGVDLAYLELYWGAKD
LISRYYDAEPYDLGLHAAIADVKLVNRGLGPMLLPRIVASVFATEPRCRR
VMFDPDHRNTTARRLCEYAGCRFLGEHDTTNRRMALYALDAPTTDR
118466021YP_881490.1 glycerate kinase subfamily protein [Mycobacterium avium 104]MAPDCYADSMSALEASAAIATGWTRSRPGDRFIVAPQSDGGPGFVEVLAS
RLGETRRLRVSGPLKAMVEAEWVFDRGSATAYLECAQACGLALLGGPPTP
ETAMAAHSKGVGQLIAEALRVGATRIVVGLGGSACTDGGQGMIAELGGLD
TARRQLGNVELIAASDTEYPLLGPWGAARVFGPQKGADTATVAALEVRLQ
AWALILEAVAGRDVSAEPGAGAAGGIGAGLLALGGRCESGAAIIAEHTRL
SDDLDTAELIVTGEGRFDEQSLHGKVVGFLADAARPRGIPVIVLAGQVDL
DTATVRSAGIMAALSMAEHAGSARLAQADAANQLMGLASVAAARLGNSGP
SRYR
118466020YP_879379.1 acyltransferase domain-containing protein [Mycobacterium avium 104]MNSPARQLLSATADDQRARRQAAIERALFGLARQWDRVRPVYKPYVDGLE
NLPSDGRFLLVANHSYTPSSEILLLLYEVQRHLGRRVRALMDRRFGRFAG
LAADVLAAGGGIVGTREGTAELMRANEPILVFPGGAREIGKGKDQLNTLQ
WGDRAGFARLAIEHNYPIVTAAVVGGDDMYKILTTSDGTWAQLNKKVSIW
LGSDADLLLPLSRGIGPTLLPRPQRLYARFSRPIDTTRPKGTPHDEWLTK
VRETAKTDLESNLAALLAIRATDPFRNLAPWAWRKAVMPHPAQDR
118466019YP_884110.1 dihydroxy-acid dehydratase [Mycobacterium avium 104]MPTTDSARAADIKQPDIKPRSRDVTDGLEKAAARGMLRAVGMGDEDFAKP
QIGVASSWNEITPCNLSLDRLAKAVKEGVFAAGGYPLEFGTISVSDGISM
GHEGMHFSLVSREVIADSVETVMQAERLDGSVLLAGCDKSLPGMLMAAAR
LDLASVFLYAGSILPGVAKLSDGSEREVTIIDAFEAVGACARGLMPREDV
DAIERAICPGEGACGGMYTANTMASAAEALGMSLPGSAAPPATDRRRDGF
ARRSGQAVVELLRRGITARDILTKEAFENAIAVVMAFGGSTNAVLHLLAI
AHEADVALSLDDFSRIGSKVPHLADVKPFGRHVMTDVDHIGGVPVMMKAL
LDAGLLNGDCLTVTGATVAQNLAAIAPPDPDGKVLRALSDPLHPTGGITI
LRGSLAPEGAVVKSAGFDSDVFEGTARVFDGERAALDALEDGTITKGDAV
VIRYEGPKGGPGMREMLAITGAIKGAGLGKDVLLLTDGRFSGGTTGLCVG
HIAPEAVDAGPIAFLRDGDRIRLDVANRVLDVLVDPAEFDSRRTAFTPPP
PRYKTGVLAKYVKLVGSAAIGAVCG
118466018YP_879844.1 A/G-specific adenine glycosylase [Mycobacterium avium 104]MADIMPQPPAVGSPLISVTDLLEWYRVARRDLPWRAPGVSAWQILVSEFM
LQQTPVSRVLPIWPDWVRRWPTPSATAAASAADVLRAWGKLGYPRRAKRL
HECATVIARDHGDVVPRDIDTLLTLPGVGGYTARAVACFAYRRPVPVVDT
NVRRVVARAVHGQADAGAPSAGRDHADVAALLPGDGSAPEFSVALMELGA
TVCTARAPRCGLCPLRRCAWREAGHPPPTGPARRVQTYAGTDRQVRGRLM
DVLRGNDSPVTRAELDVAWLTDTAQRDRALYSLLADGLVTQTADGRFALA
GEE
118466017YP_882230.1 PadR family transcriptional regulator [Mycobacterium avium 104]MASETDPASQKPALAATSWALLGMMSYEEEVSGYDLKKWIDWSVDLYYWS
PSYSQIYTELKKLEALGLVTSRVERDEGTRSRRLYKITPAGMDAVTQWTN
HAPVDPPVLKHSVLLRVTFGHLSNPGRLKELLQEHVAYAEARHRKAMEDA
EGAEAEPAWAYSVLALRWAAKYYAAEREFALEMIKEIDEADAILQRAAKG
GYGKPRPTPGYWREVEKQVQAKREAE
118466016YP_879652.1 hypothetical protein MAV_0364 [Mycobacterium avium 104]MSLLTLPSSRPMPTSTDRMLGDRPNLCRRPCLAASRRVRQDAAGGRRSVK
ICGIGVKASLRTRHRPAPTGTVTGMTVVEFTGGAAPRGARPRRSTLPGPG
SVRVTAAYAAALLVVYLVLAALGPHARQVAVSRMSTNVHNLGRGQLGTLI
GSAFVDDGGQLFFWLPGLVCLLALGELLWRGKGLLVTFAVGHIGATMIVA
VGLVAAIESGMLPASVARASDVGISYGAMCVLGAITAALPVRWRGVWAGW
WLGTAVVATVGADFTAVGHVVALLLGIGLSFRLRSTASWTPVHLALLCVG
ATFGYLLLAGAASMAPIGGLAGAFIGVLARRPLAGRPDERVDVVAAGRPG
R
118466015YP_883869.1 hypothetical protein MAV_4742 [Mycobacterium avium 104]MSYRNTALRLVSAAAFTGSLALAGSAPALAEPNTGSASDMNTLAASLSKG
YGLNNCKPQELTESGELAELLCGQSPDPSGPGSGVYALFSNGTNLASAFS
STIKDVSLANCGDAGQSPGTWKQNGQTGGQIACGTYKNYATLTWTTDAKN
VLGHLTAANSDVNALYQWWRTNG
118466014YP_879357.1 MarR family transcriptional regulator [Mycobacterium avium 104]MADSESNAAEVAELAEGLHRALSKLFAMLRRGDPSGAAAGDLTLAQLSIL
VTLLDQGPIRMTDLAAHERVRTPTTTVAIRRLEKVGLVKRSRDPSDLRAV
LVDITPRGRAVHGESLANRRAALAAMLSQLPASDLDTLMKALAPLERLAS
GDPTSGPAGVPPARKEA
118466013YP_884348.1 hypothetical protein MAV_5234 [Mycobacterium avium 104]MPKDRGLNRWELVTCALAGHATYAPDEPALADRLSGTTGLGQVWRCLRCG
EFTVGPAHRRGPAEDAPMIMRGKALRQAIIIRVLAVERLFRALVIALAAY
AVWKFRGARGAIQATLDRDLPIFRAAGFKVDQMTIVHELEKALATKPSTL
ALLTLMLVGYALVEVVEGVGLWLLKRWGEYFAVIATSVFLPLEIHDLAKG
ITMTRVVTFAINVAAVIYLLISKRLFGLRGGRAAYDAERRGEQLLDVERA
AAGS
118466012YP_880367.1 TetR family transcriptional regulator [Mycobacterium avium 104]MRRHGWSGDIPADDEEAVARILTATRRAIDERGTVSVSQVASTLGVTRQT
IYRYFPTHEALLGATALSAVEGFLDRLAAHLGSITDPTEAVVEGIAYTFE
QLAHDRYLSLVFQPGKASAFTAGVTSDIAISFGRSILQRFEVDWGAAGFA
DAGLDELVEVMLRTLQSLIVDPGRPPRTGAELRRFLQDWVAPAVRAHAIS
R
118466011YP_879728.1 transglycosylase [Mycobacterium avium 104]MATALLFPVAGGIGLVSNRASEVVANGSAQLLEGEVPAVSTMVDAKGNTI
AWLYSQRRFEVPSDKIANTMKLAIVSIEDKRFADHNGVDWKGTLTGLAGY
ARGDVDTRGGSTIEQQYIKNYQLLVTAKTDAEKRAAVETTPARKLREIRM
ALTLDKTFTKPEILTRYLNLVSFGNNSFGVQDAAQTYFGINASDLNWQQA
ALLAGMVQSTSALNPYTNPEGALARRNLVLDTMIENIPQEADALRAAKAA
PLGILPQPNELPRGCIAAGDRAYFCDYVQEYLSRAGISKEQVARGGYLIK
TTLDPDVQIPVKAAIDKFASPTLPGISSVMSVIQPGKTSHKVMAMASNRT
YGLDVDAGQTMRPQPFSLVGDGAGSVFKIFTTAAALDMGMGINATLEVPG
RFQAKGMGSGGAKGCPKDTWCVVNAGNYKGSMNVTEALATSPNTAFAKLI
QQVGVTRTVDMAIKLGLRSYADPGTARDYNPDSNESLADFVKRQNIGSFT
LGPIEVNALELSNVAATLASGGTWCPPNPIDKLIDRKGNEVAVTTETCDQ
VVPEGLANTMANAMSKDAVGGGTAAGSAGAAGWDLPMSGKTGTTEAHRSS
GFVGFTNHYAAANYIYDDSPNPTDLCSAPLRHCGEGDLYGGNEPARTWFT
AMKPIATNFGPVQLPPTDPRYVDGAPGSRVPSVAGLDIDAARQRIKEAGF
QVADQNNFVNSSAKQGEVVGTTPSGATIPGSIITIQVSNGIPPAPPPPPE
GAPPPVGSQVVEIPGLPPITIPLLAPPPPAPGQPPP
118466010YP_881324.1 mebrane associated protein [Mycobacterium avium 104]MSSTPHPAEPHIGSVSSKLNWLRAGVLGANDGIVSTAGIVVGVAAATALR
APILTAGSAGLVAGAVSMALGEYVSVSTQRDTEKALLIQEHQELRDDPAA
ELDELAALYEAKGLTAATARTVAEELTDQNPLLAHAEVELGINPEELTNP
WHAASSSALSFAIGALLPLIAILLPPPTWRIPVTVVAVLIALVITGAVSA
RLGGAPQLRAVARNAIGGSLALAVTYTIGHVVGAAID
118466009YP_883156.1 cell division ATP-binding protein FtsE [Mycobacterium avium 104]MMITLDHVTKKYKASARPALEDVNVKIDKGEFVFLIGPSGSGKSTFMRLL
LGEENPTTGDIRVSKFHVNKLRGRHIPKLRQVIGTVFQDFRLLQQKTVYE
NVAFALEVIGKRTDAINRVVPEVLETVGLSGKANRLPHELSGGEQQRVAI
ARAFVNRPLVLLADEPTGNLDPDTSKDIMDLLERINRTGTTVLMATHDHH
IVDSMRQRVVELSLGRLVRDEQRGIYGMDR
118466008YP_883605.1 50S ribosomal protein L4 [Mycobacterium avium 104]MALKLDVKAPGGKVEGSIELPAELFDAPANIALMHQVVTAQRAAARQGTH
STKTRGDVSGGGRKPYRQKGTGRARQGSTRAPQFTGGGVVHGPKPRDYSQ
RTPKKMIAAALRGALSDRARNGRIHAITELVSGQTPSTKSAKAFLGTLTE
RKQVLVVIGRSDEAGAKSVRNLPGVHILAPDQLNTYDVLRADDVVFSVEA
LRAYIAANTGTPEEVSA
118466007YP_879782.1 hypothetical protein MAV_0501 [Mycobacterium avium 104]MLSKTFNATAAVIGTAVISACTAHAEPPKFPDLDAFQPVDPAPYTASGRA
GGGAYFVTPDGIQCSVPHPDHPGEHVSVSCAGPLPGLPDDAPRGKDGCSA
VGSPTSLPTDLGPYSFQEGTGCPILTTPPLNVGQKITTAGITCAVGGDRL
TACIDPVLNRGFVLEPSGSWTF
118466006YP_883215.1 AraC family transcriptional regulator [Mycobacterium avium 104]MGLTTMTVRDDGAPVGAPAEAARSDYGPVDPVLAVNGERRARPVAVEYKQ
FRGADAQSARRFFATAYDPGWRIAGVTNHCVVSHRRSDTGSMTVDEVAIQ
GRMTLEIPAGDTVVVIQPRAGALNVAGGPLATPDFPLLVAHGMACVLHCH
GARFDVVTIAAEVLQKVAAEWHTALSQQTQFLNWRPRSRAAVRAWHRALD
YAMLTLASPDTARQPLIAAGMAGLLAGALLECYPSNLTEQDPVSDLALPE
TLKEAVSFIHRHAAEDIGINDVAAAVHLTPRAVQYLFRRQLDTTPTEYMR
RVRLSRAHQELVAATTASSTVTEIAQRWGFAHTGRFAVLYRQTYGQSPHT
TLRQQTAV
118466005YP_883409.1 LpqC protein [Mycobacterium avium 104]MAYARWLWLAVLAVCVVGCGVRHVSAASARDISGTFRSGGMDRTYMLHVP
AGDPVGLVLSLHGGGGTGIAQRGLTGFDAVADAHNLLVVYPDGYEKSWAD
GRGASPADRHHVDDVAFLVGLVTKLQNDYRVAPGHVFVTGMSNGGFMSNR
LACDRADVFAAVAPVAGTLGVGVACNPSRPVSVWAAHGTADPLVPFKGGA
VRGRGGLSHAVSAEAMVDKWRKVDGCQGDPSMELLPDARDGTVVHRFDST
SCAASTEVVFYRIDKGGHTWPGGKQYLPAAVIGPTTHTLDGSEAIAEFFL
AHARD
118466004YP_883608.1 hypothetical protein MAV_4473 [Mycobacterium avium 104]MTVDAVTRTANVARATLYRHFPSGNDLLAAAFNSLIPASPTPPAEGSLRD
RLVAVVLAQAEAVAQAPTMMTAMTWLALGRDLEAWPQPRADDSVAITTLR
ERIAQQYSEPFDVIFDSPEAAELGEVDRSRAIALLIGPLVLGRLSTLPDF
DYRECALAAVDGFLHVQSARARAARVESAGA
118466003YP_884004.1 hypothetical protein MAV_4881 [Mycobacterium avium 104]MSNVLDLADQTLFLGERATGATSLLQCVWVYDRAIDLAGLRRFHRHLGAG
RLARRIECSPLPFGRHRWVSTGAQGALEVVAVPRPRDAVDAWLTEQAGRR
PDAEHGPGWHLAVLPLTDGGAVVSLVTTHCLTDGVGLCEALADAARGRAD
TVRWPAAAARPRWSALAEDARQTARDTGDVGRAVRAAARMLRQGRGGAAL
ARGRATRRRGTQDRVTVPAQTIFVDADEWDARARALGGTSNALLAGLAAR
LAQRVGRVARDGSVTVGMPVNERVAGDTRANAVTNVDVLLGPAAIGTDLR
AIRAAVKHALVRHHDLPDERWALLPLVPLIPKRVFRRLLGVVTGGATTVV
SSNLGALDPAANRPDGTDADYFAMRSVYPGVTDATMQRTNGALALLSGRV
HDRVFVSVLGYELGRQNSNEALRQALSGALNDFSLTGATGWNPVRAVATR
118466002YP_880685.1 TrkA domain-containing protein [Mycobacterium avium 104]MRDDSPRMSPRRHIIVSGDDVLATTIAEELNRAGATIVKLPSEELAGADL
ARASAIVCAGRDDAKNLEIALLARKTNPHVRVVARLGNDVLRGAVAADNG
PGAILDVADLAAPSVVEACLSSSTHPVRAAGIDFLVSGAEAPRDATLREI
YGDLAPVAVIHGNDGATPGEVVPCPGRDHRVRAGDWTAMIGSADELAARG
IRTPRPPATRSRQTWLRRVLDAARAMRDDVNPMLFPAILLALTLLLVSTV
IVHFSYTKPRLSWLDALYFTAETITTVGYGEFTFAHQSAWLRIFAVGLMF
AGVTTTALLVAFLADLLLSRRFLQSAGLRRARHLRNHIIVVGLGSFGSRV
VADLTAAGYDVAVIERDENNRFLSTAAELDVPVIFGDATLRQTLESARVD
RARAVAVLTQDDMVNIEIGIVLREMLGPRVMPEVNRPDVPIVLRIYDRTL
GDAVAKRFGFENVRSTVDLAAPWFIGAAMGLQVLGTFSVGQRSFMVGAMH
VAAGSELDGLRMFEMSTQTRVIAITRRDTPVELHPRRDAWLRAGDTVYLV
GPYRELLETLRKGQPPQQPANEERPADKATT
118466001YP_879568.1 trypsin domain-containing protein [Mycobacterium avium 104]MAGQPVAVQSSATTISTTAAQQPLRWVDVEAEAPQLDHDSVGARFGSAVY
PGIGLTQVGPDKSTVDCSAGPAVTGGVVVAAHCDAAPGGRVQIYPNAKGS
SPIPVGVITDRVLQQVDPVRDFALLRSTTVASGSTVIAGRWAIAGVLTEE
AAPSALPVGSPVCVNAAYTGIRCGAVLSTDDDGELLFNVRTEIGDSGAAV
FAVNADTGAATLIGIVRGGDEMTSTATYLAPALDKLGVSALVDPTASANT
VADSRYSRMTTPAP
118466000YP_879815.1 PPE family protein [Mycobacterium avium 104]MLNFGQLDFAQLPPEINSGLMYSGPGAGPLLAAAAAWNGLAAELRSAAAS
FGSVITGVGDAGWQGPAASSMMAAAAPQLAWLSGTAGRAELAAGQALAAV
SAYETAFAETVPPPVIAANRALLLQLLATNFLGQNTPAIADVEAQYGEMW
AQDAAAMYGYALASAAASTLPPFEPAKPATDPAGLARQAAATAQAAGTGA
GDSAQGLGAAPQSMSTLAAGTNNPPAANPGFSLGGISLNPEGDGLVIGGP
LGDLLEGLTGSQTLDASTPFDAFIRLISPTRLFTTSFKDIQGIAQGMMPA
AKSAGEGVAKAAEAVLPAAVPGAGLGSLGSLGSIGGSVGKAASIGGLSVP
ASWASAAPTPPSVAVALNGATTAGAAEHAASAVGGVPMMPAGAAGRGAGA
HFVVPRYGFKPTVIAQPPAGG
118465999YP_882624.1 hypothetical protein MAV_3442 [Mycobacterium avium 104]MTDIPDTGTINAFNQSIIDEFRANDGKVGGQFEGADLLLLHTTGAKSGQP
RVSPLAYFRIDGKLLVIGSFAGAPVSPAWVHNLRANPAARVEIGTDSFDV
TARELPREERDALFAQVAAAAPGFAEYQAKTSRVIPLFELIRT
118465998YP_880776.1 HAMP domain-containing protein [Mycobacterium avium 104]MSATQSTAQRIGRVLEKITRQSGRLPETPAYGSLLLGRVTESQHRRRIRI
QIIMTVMVLGANLIGIGAALILVIVAIPAPSVFNDAPAWITFGVGPAYVA
SALAVGTYWITRRTVLALRWAIEERKPTPTDERNTFLAPWRIALVDLVLW
GAGTLLLTVLYGLVDTMFIPRFLFGVSFCGVLVATACYLLAEFALRPVAA
QALEAGPPPRRLTAGIMGRTMTVWFLGSGVPVIGIALLALFEIWLRNLTE
TEFAVGVLIVSTAALIFGCLLMWILAWLTATPVRVVRAALKRVERGDLRG
DLVVFDGTELGELQRGFNAMVDGLRERERVRDLFGRHVGREVALAAERER
PKLGGEERHVAVVFIDIVGSTQLVTRRPPAEVVSVLNQFFGIVVEEVDRH
CGLVNKFEGDATLAIFGAPNHLDCPEDAALTAARAIADRLANEMPQCRAG
IGVAAGQVVAGNVGARERFEYTVIGEPVNEAARLCELAKSHSGRLLATGD
AIEGASEKERARWSLGDTVTLRGHERPTRLASPAGAADRPAGTD
118465997YP_880497.1 glucose-6-phosphate 1-dehydrogenase [Mycobacterium avium 104]MADDDSHPSDLLVIFGITGDLARKMTFRALYRLERREELEHPIIGVASDD
ITLDQLLDRAREAIKATGETFDDAVFDRLAGRLSYLSGDVTDTGLYSELA
EKIGGDSRPLYYLEMPPSLFAPIVENLAKADLLERARVAVEKPFGHDLES
ARDLNARLRAVLDEDQILRVDHFLGKQPVEELQYLRFANNALAKLWDRDS
ISEIHITMAEDFGIEDRGKFYDAVGAVRDVVQNHLLQVLALVAMEPPVGA
GADDLNDKKAEVFRAMPSLDPEHCVRGQYRGYTEVPGVAKDSTTETYVAL
RTEIDNWRWAGVPIFLRAGKALPHKVTEVRMFLHHVPGFSFLPNRRPPEP
NQIVLRIDPDPGMRLQLSAQVGDSWHDVHLDSSFAVDLGEPVRPYERLLY
AAFNGDRQLFAREDAIEETWRIVQPVLDKPSRIHQYEQGSWGPEAAQALV
HGRHAWQQPWLPQSTSTKR
118465996YP_883401.1 UsfY protein [Mycobacterium avium 104]MGDTFHDPVDHLRTTRPLAGESLIDVLHWPGYLLVVAGVVGACGSLAAFA
TGHHHEGMTAGVTAVIAAVLGLVWLAVEHRRIRRIADRWYAEHPEVHRQW
PAS
118465995YP_883269.1 alpha/beta hydrolase [Mycobacterium avium 104]MTTEVASTTVTATDGVRLAVHTYTGIDPARPTVLAIHGYPDNHHVWDGVA
AALRRRFNVVAYDVRGAGQSSTPPERSGYRLEQLVADVDAVIGRLGVDSV
HLLAHDWGSIQGWAAVTDESVMGKIASFTSISGPHLNYAGRFLRSARTPG
GVLDVVKQILASSYIWFFLAPGAPEWAIRSGATVKVFEAVERIGSTTAGA
QRGAGYRSTDDYLNGLNLYRANMPGPILSPPARLPQTSVPVQVLVARRDY
FVSPALQRFTGSIPDGSRVVPIDGGHWVVNSHPDVIARLTGDWVDLTTRP
AGGHHTGQT
118465994YP_880068.1 hypothetical protein MAV_0795 [Mycobacterium avium 104]MITGFMMIAPTVSAQPGLSAKIVFPHPNTETGPFNYEVTQTDLTADATGA
AELSGDPIVDGDTVTLTVTGLVDGHEFAFTYTVTGADGITATSAASTPIT
ATA
118465993YP_879450.1 hypothetical protein MAV_0156 [Mycobacterium avium 104]MRITDLAAPRKIPPGSGWRKFIYTISFHKINPGESPRERHYRDLQNRIRR
HIRRQYVITVVSGKGGVGVTTLVACIGGVFRECRPQNVIAIDAVPGFGTL
ADRIDESPPGDYTAIINDTDVQGYADIREHLGQNAVGLDVLAGNRTSDQP
RPLVPAMFSGVLSRLRRTHTVMIVDTSPDLEHEVMKPVLENTDTLVFVSG
ITADRSRPVLRAVDYLRSQGYHELVSRSTVIVNHTDQITDKDALAYLTER
FTKVGATVEALPFDPHLAKGGIIDTVHELKKKTRLRLFEITAGLADKYIP
DAERAVP
118465992YP_883981.1 sulfatase [Mycobacterium avium 104]MTQLTPGDAGDRNDAGRKDNVLIVHWHDLGRYLGAYGHRDVSSPRLDRLA
AEGILFTRAHATAPLCSPSRGSLFTGRYPQTNGLIGLAHHGWEYRSGIRT
LPQILSEAGWYSALFGMQHETSYPKRLGFDEFDVSNSYCDYVAQRADEWL
RQSAEGVVGQPFLLTAGFFETHRPYPEDRYPPADSAEVQPPDYLPDTPEV
RGDLAAFYGAISTADAAVGRLLDTLADTGLDASTWVVFFTDHGPAFPRAK
STLYDAGTGIGMIVRPPTGRGLPPRVYDELFSAVDLVPTLLGLLGISVPP
DVDGVSHASALLRPDPDAAPVREHVYTMKTYHDSFDPIRAIRTKDYSYIE
NYASRPLLELPWDIEESPSGMAVAPLVTAPRPERELYDLRADPTEITNLL
AGDDADADEVAANLAVLLHDWRQRTGDVIPSEFAGTRIAARYTETYLQIH
HGARPTARSAIAADRGIEEEGNPAQR
118465991YP_880545.1 hypothetical protein MAV_1300 [Mycobacterium avium 104]MITEPATAFSRVFRGYDPAAVDAYVEALLAKQKLLIDEVQNLRAQRNESG
DQLAALRIEVACLKDEVAHLSDTSPTPYAIQHRMTKMLRRTLEEISRMQA
EAQAEAESMIAAAAAQVEASHREHQELLADMAAQREALETEREEAKKELE
AELATMRAEARASIDEARREAERECARLLAEAKQKADDLDERARRTVEEA
NQQRIMILEELMDVARDLQGLPASLESAYQERTSPSEASVVVPLDPKNQA
PGPAVAS
118465990YP_881208.1 transposase- Mutator family protein [Mycobacterium avium 104]MVKRPRITTERNIAMALDQSALLEVLDALRTADAGERITQAAETIYQALI
DAELTAFIGASPHERTETRSNQRNGSRPRTLSTVAGDLELRIPKLRTGSF
FPALLERRRRVDQCLFAVVMEAYLHGTSTRKVDDLVKALGTDTGISKSEV
SRICKDLDTEVAAFRDRPLGDQRFPYVFLDATYCKARVNHRVVSQAVVIA
TGVAADGRREVLGFEVGDSEDGAFWTAFLRSLKSRGLAGVQLVISDAHAG
LRSAIDAVLIGAAWQRCRVHFLRNVLAQVPKGSAEMVAAAIRTVFAQPDA
EHVREQLDTIAGMLGRQFPKVETMLREAAADITAFADFPVAHWKKIWSTN
PLERLNKEIKRRTDVVGVFPNPAALLRLAGSVLVEAHDEWQVADKRYLSE
TSLALLDVSDQSAETIAPTAALTA
118465989YP_884239.1 zinc-binding dehydrogenase [Mycobacterium avium 104]MWCYRIVAPYRFEPTAIDDKTPECLADGQVLLRFSAAGVCGSDLPAFRGA
RGRLPGDDGRSGPEKDGFPIHEVAGEVIASRHPAHRPGDRVVGWASGFDG
LMERVVSDGDGLAPYDPALSPAQAVGLQPLACVLYACEQLELAGKHVAII
GQGSIGLLFSYVAKAAGARRVTGVDPIDRRDVARAFGVDDPVRATSDRWV
SQLDPADRADVVIEAVGHQVATLAHAIDAAAPGGTVFYFGVADDDTYPIS
MRTMLRNNLTLKSGVTLDRRRMLELAGKFAAEHPWLLGAYLTHTFGVDEV
QDAFELACRPVADRIKIAIAG
118465988YP_882323.1 Mg2+ transporter-C (MgtC) family protein [Mycobacterium avium 104]MQIWLTGAPLLGGSVQGARHAVELFAAFGLTALIGLERTIQGKSAGLRTQ
TIVGTSSALIMLVSKYGFSDVLSAGSIVLDPSRVAAQVVSGIGFLGAGII
ITRRGAVHGLTTAAAVWESAAIGLATGAGLLLLAIAVVGLHFVSALAFNA
VERQLNARLRGTVRLRIIYANGRGVLRELLRLSGQRDWQLTELDADPHDI
DDGEVAVSMTLSGAKIADAAHVFAEVDGVAAVLSADDATD
118465987YP_884421.1 hypothetical protein MAV_5311 [Mycobacterium avium 104]MTGPARSGAAIRGAGRTVARGLIFLIQLYRHMVSPLRPATCRFVPTCSQY
AVDALDEYGLIRGSWLAAARLTKCGPWHQGGWDPIPERPGCRVNCQDASD
AWAVRATRGESGSLV
118465986YP_883524.1 hypothetical protein MAV_4389 [Mycobacterium avium 104]MIEAALDAIDDPVALVGERPVAVEALWKTALRSACCACDGAVVVHPSWWP
PARVRTVSAAAATLAGEARARPRSWLLARASRAAPEDTVVVEVAERVVAI
CKPAPATVTAVPRTAPPRSVADGVARAVASLAPAVVLIDLPDPIAGAAEL
GPLIADALRGRIRAEMVHINDIRLARLACSASDGDDAPAGADRSAAAPAR
SRPRLLSGLGAAAVIAAAAAPLAITAAPDRARPMPGASLVEGRVALSVPN
DWPTQRLVGGPGSARVQVTSPTDPEVALHITQSPVVGETLGDTARRLKQA
IDAAPAGVFVDFDPTATSVGRPAVTYREIRPAHQVRWAVLLDGPVRISIG
CQSRPGAEQAVREACELAVRSAHAIG
118465985YP_882793.1 hypothetical protein MAV_3617 [Mycobacterium avium 104]MAPFAATPVLRLRRAGRDGAGKGPTHDPPCRRARITLLQPTRNAKSNYEF
YKNGYRIDVEPMRGHVRIATRRAPGRAKR
118465984YP_881813.1 acyl-CoA synthase [Mycobacterium avium 104]MDRVPLSSDVVDTRAMLELAAAVHGDIEAYVEPGARITFAEWIGRARSVA
TQFADLGVGKGDVVVLWLPSGIDYATCYAAAAMIGAITTGLNPRLGRREI
ESILQQADPALVVADGLLDALPGTGHRLLSRDALCSDTSRSAPPSVELNR
RDVVALIFTSGTTGTPKGAAFDADRLAAGAAASGVMSAPYDRRLTSTPFS
HAGYMFKLWDQLVWGSTLVVPPTPWSAQGMFDVLRNERVTVAGAVPTQWA
KLLDVDGVTSKALPHLRIGVVATAPAPPELVRRVAEGIGVPLVVRYAMTE
CPTISGTEPDDAPEVQFRTVGRPAAGMDVRIGSDGVLEVSGPCVMRGYWR
NSELTAEVLRDGWLRTGDVGVLGDDGNITLVGRRGDMYIRGGYNVHPGEV
ERTLTGHPSVKHAAVIGRSAPVIGEIGVACVVPADATAPPTLAELRAHVA
SELADYKAPDELLIVDELPLTAMLKPDRLALRELITQRDRDIQRRQPTR
118465983YP_879591.1 hypothetical protein MAV_0302 [Mycobacterium avium 104]MRGSGIIGTVALVWLLIGVFAAWQRDYFKNDQTTCASAGTVAVTVIAGPL
NYFGVNPKVTDCHLPQPSSMQSINI
118465982YP_884135.1 virulence factor Mce [Mycobacterium avium 104]MARPVQTNAPRTPPYKLAGLAILVVGALALTLIYGQFRGNFTPKTSLTML
ASRAGLVMDPGSKVTYNGVEIGRVGTISETVRDGKPAAKFTLEVYPRYLK
LIPSNVNADIKATTVFGGKYVSLTTPANPSPQKITPHTIIDARSVTTEIN
TLFQTITSIAEKVDPVKLNLTLSAAAQSLSGLGEKFGQSVVNANALLDDV
NPRMPQARKDIQGLAALGDTYADASPDLFDFLNNAVITSRTINAQQKDLD
QALLSAAGFGNTGADLFTKGGPYLARGAHDLVPTAQLLDTYSPELYCTLH
NYHDIVPITGASEGGFNGYSLNMNTEVTSGLGLLLNPVATIPVLASLVGG
IAGLVGGAPNPYIYPENLPRVNARGGPGGAPGCWQPITHDLWPAPELVID
SGNSLAPYNHLDTGSPYAIEYVWGRQVGDNTINP
118465981YP_881741.1 short chain dehydrogenase/reductase SDR [Mycobacterium avium 104]MHYGIDGRSALVVGGSKGIGFEVAKLLAAEGARVAILARTKTDVDAAVEA
IRTEGGTAIGVTADVADDGQLTDAVREIAARHGAPLIVVGQAKYQRPGDF
ADITDVNVYRESFELHTMSQILLLHAVLPAMQDAGWGRFVHIGSATAKEP
AGNIHHAVANTSRPSTIGLLKTVSDEYAQFGITVNTVAPGWIETENALAY
LEQHLGASTDQERREFMLREARVPAARMGKPSEIASLIAYLCSEPAGYLT
GSWIEVDGGLHRSAF
118465980YP_883790.1 hisitidine protein kinase SenX3 [Mycobacterium avium 104]MFSALLLAGVLSVLALAAGVAVGTRLSPRAAQRRQRISTEWTGITVAQML
ERIVALMPLGAAVVDAHRDVVYLNDRAKELGLVRDRQLDDQAWEAAQQAL
TGVDVEFDLRPAKRSGGRSGLSVHGQARLLSEEDRRFAVVFAHDQSDYAR
MEATRRDFVANVSHELKTPVGAMALLAEALLASADDSETVRRFAEKVLVE
ANRLGDMVAELIELSRLQGAERLTNVTEVDVDSVVNEAISRHKVAADNAN
IEVRTDAPSGLRVLGDETLLVTALANLVSNAIAYSPPGSPVSISRRRRGD
NIEIAVTDRGIGIALEDQERVFERFFRGDKARSRATGGSGLGLAIVKHVA
ANHNGTIGVWSKPGTGSTFTLSIPAAVASHRGDGESEQPQGREVRPNRSQ
REEELSR
118465979YP_879574.1 hypothetical protein MAV_0285 [Mycobacterium avium 104]MTVEAAPWPSTFPSYVASWYRWSMDSDATDAGIRNELARVLAIVEVVTER
PDHHAETSSDLAADEARFPDIWAATVARRGLVHAAENFEAACLLMLNGDW
TAPQYALLRAAYESAGAATWLLQPGDIDTRLARLLWQHRESWRYSTKAYG
GTPLDHDREERQRWADDAAARLGIDLRAGRSGGFENLIEEIDDLPGQPES
PADRMAAVLRREPREDVGPERGDHGDRQRRDLRARTDQSANPEPGAVPHR
PERGAASGAAGVGLVPHPHHDAAA
118465978YP_879897.1 acyl-CoA dehydrogenase [Mycobacterium avium 104]MASETTMDFDPSPTQQAVADVVTSVLDRELSWEALVDGGVTALPVPERLG
GDGVGLPEVATVLTEVGRRGAITPALATLGFAVLPLLELASEEQQDRFLA
GVARGGVLTAALNEPGTPLPDRPATTFADGRLSGTKIGVGYAAQADWMIV
TADSAVVVVSPKADGVQVVQTPTSNGSDEYTVSFTGVAVADSDVLAGATA
ARVNQLALAAVGAYADGLVSGALRLTADYVANRKQFGKPLSTFQTVAAQL
AEVYIASRTIDLVAKSVVWGLSEGRDVDHDLGVLGYWVASQAPPAMQLCH
HLHGGMGMDITYPMHRYYSTIKDLTRLLGGPSHRLDLVAIASTAQPGAAG
RHADDLVGAQCS
118465977YP_879565.1 hypothetical protein MAV_0276 [Mycobacterium avium 104]MTTIAFRTTTTRRSSDLSKHSAEVFAEAEDHPVTVTRRDGAPLVLMSQRE
AEGRARLLEFAAQLIGVAVDDDGPLAGRMSKAFPWMLALSPEDRATCAQD
LVDAARASFSTDQPHLALSELTSWRETATAIAAGLGQADLDWLDDGDTVV
ERP
118465976YP_882801.1 hypothetical protein MAV_3624 [Mycobacterium avium 104]MSAGRPAAHPVVVPPPPSDPHRFGRVDDDGTVWLISAAGERVVGSWQAGD
REAAFAHFGRRFDDLATEVTLMEERLASGTGDARKIKAHASELAESLPTA
TVLGDIDALAARLASIAEQAEAAVAAERSRREEHRAAQTARKEALAAEAE
ELAANSTQWKAAGDRLRAILDEWKTITGLDRRVDDALWKRYSAAREAFNR
RRGAHFAELDRERSSIRQAKERLCERAEELSGSTDWTATSAEFRKLLAEW
KAAGRAAREVDDALWRRFKQAQDVFFTARNAATAEKDAELRANAAAKEAL
LAEAEKLDTGNHDAARAALRAIAEKWDAIGKVPRERSAELERRLRAVEKK
VREAGDAGWSDPQAQARAEQFQARAEQYEQQARKAAAAGRTKEAEEARAN
AEQWRQWAQAAVEALSRKP
118465975YP_883649.1 alpha/beta hydrolase [Mycobacterium avium 104]MVQVRTGHAISGDLKLYYEDMGDIDDPPVLLIMGLGAQLLLWRTAFCEKL
VGRGLRVIRYDNRDVGLSSKTEHRSSGQPLVTRLLRSWLGLPSQSAYRLE
DMADDAAAVLDHLGIDDAHIVGASMGGMIAQIFAARFRQRTKTLAVIFSS
NNSALLPPPAPRALLALLKGPPPDSPREVIIDNAVRVGRIIGSTRYRVPE
EQARAEAAEGYDRNYYPQGVARHFSAVLGSGSLRRYNRRTTAPTVVIHGR
ADKLMRPFGGRAVAGAIDGARLVLFDGMGHDLPQQLWDQVIGVLANNFAK
AS
118465974YP_883015.1 acetolactate synthase 3 regulatory subunit [Mycobacterium avium 104]MSPQTHTLSVLVEDKPGVLARVAALFSRRGFNIESLAVGATEQKDMSRMT
IVVSAEETPLEQITKQLNKLINVIKIVELEDGNSVSRELALIKVRADAGT
RSQVIEAVNLFRAKVIDVSPEALTIEATGDRGKIEALLRVLEPFGIREIV
QSGVVSLSRGPRGIGTAK
118465973YP_882595.1 hypothetical protein MAV_3414 [Mycobacterium avium 104]MLRGLVYAAAMVVVRLFQGALINAWQTQAGLFSVVLLLLFVIAVAVWGVF
DGRADAIANPDPDRRGDLAMTWLLAGLVAGVLSGAVSWLIALVYKGLYTG
GLINEVTTFAAFTALCVFLPGIIGVTIGRWRVDRNPPPRRPGHDDERADT
DVFSAVRGDDAPTGEIPAAGAQTEAHTAAVATAEREAESPTETIPSAGDD
PKTEVIRTEPEPGGEPGKA
118465972YP_884277.1 cytochrome P450 monooxygenase [Mycobacterium avium 104]MSEVATAPLAAVHLPPAVRGPKLLQGIGFAVSRRTMMRRLSRRYGNVFTL
RLPMWGPVVMVSDPQLAKQIFTTSPDELGNIQPNLSRLFGSGSVFGLEGD
DHRRRRRLLAPPFHGKSMKNYESIIEEETLRETAGWPEGESFPTLPPMMR
ITLNAILRAVFGAEGAELDELRRLIPPWVTLGSRLAALPKPQRYPRFGPW
GQLDRWRRQYDGVIERLIAAEQADPNFAERTDVLALLLRSTYDDGAAMSH
KEIGDELLTLLAAGHETTASTLAWAFERISRHPELLARLVEEADNGGNEL
RQAAILEVQRARTVIDFAGRHVYPDVYRLGEWVIPRGYSIIVGIAQIHDN
PDVFPDPRRFDPQRFIDNKPSALSWIPFGGGTRRCVGAAFANMEMDVVLR
TVLRHFTIETTDAPDEPWHCRGVAFTPKHGGRIVVHRR
118465971YP_883148.1 hypothetical protein MAV_3993 [Mycobacterium avium 104]MSRSIDVSTESPASVEQIHAAFGREDYWLARIAPAAATTTLDSLVVDGDG
TVTVRVTQHLGRQLLPGAVAKFVRGDVKIVQTETWRRDGDGQVRGQVDVS
ASGGLGSGRAESWLEPAEDGGSRLRSAVRVEVKIPLVGRKLEKTIGADLA
KGIPEMLRFTTTWIDENA
118465970YP_881808.1 2-oxo-hepta-3-ene-1-7-dioic acid hydratase [Mycobacterium avium 104]MSRPAEDELSDIARRLYEAEQTRTPIRQLSLDYPDMTIEDAYAVQRALVA
LKVADGREVKGRKIGLTSKVMQRAVSIDEPDYGALFDDMFIEDGGRIPLG
RYIRPRVEVELAFVMGEQLSGPGVTLFDVLRATEFVTPALEILDARVQMS
DPETGHLRTIVDTIADNAADAGLVLGGRVFRPLDVDLRWVAALLLRNGTI
EESGVAAAVLNHPGNGVAWLANRLAPHGVWLERGEVILSGSFTKPVFAEP
GDTFVADYGPLGTVSVTFDSEAS
118465969YP_882173.1 NAD binding oxidoreductase [Mycobacterium avium 104]MSAMAEVHAPKLRIGILGAARIAPLALIKPSAENPDVVVAAVAARDASRA
RAFATRHGIATVHDHYEALIADPDIDAIYNPLPNGLHGRWTRAALAAGKH
VLCEKPFTANAAEAREIADLAEHSDRVVMEAFHYRYHPLTLRAEEIIASG
ELGTLQHVEAALCFPLPKFSDIRYDYALAGGATMDAGCYAVHMARTFGGR
SPEVVSAQAKLRGPKVDRAMTAELRFPAGHTGRVRCSMWSTRLLQISARV
VGEHGELRIVNPVLPQAFHRLTVRSRDGRRTERFERRASYAYQLDAFAAG
VLRGEPVKTSARDAVDNMTVIDAIYRAAGLPLRYPT
118465968YP_879885.1 hypothetical protein MAV_0605 [Mycobacterium avium 104]MSAVAVLLTALGVADLCRRAVAAAWVPLAAGPIVVAACAALGGLWRGADI
ALLALAAVAVVAWEWLCARSELSGAQQAAPVAVLAAALMLLTVLSGWSSP
VAGAISRWSAWAHLPLSHVPPTRALMVVGVVLVQFATANQLVRLVLGSVG
AVRPAGQPQPSDRLKGGRLLGPMERLLILSLGVGGQLAAAGAVVAAKGII
RFPELNAQKGQNGDVGIDEVTEYFLVGSFTSWLLALGGIGLVLATR
118465967YP_880096.1 gp78 protein [Mycobacterium avium 104]MPRIRTLKPEFFRSPSTAKVDPLVRLFYQALWCWADDFGIGETNIYGWLG
FAFPDGQEIYDPELRGFRALSAQDLRRFCADVARHFEITFYIVRGRHYYA
IGNWDQHQKTERREGRRKNPRPDDPEAIPDLQFQDCAESAPICAGKPAQN
PRKTGAGTGEQGNRGTGEKDDDSPTNATHHNATTVEAIVVENAAKPARNH
PSSAARTVVRQTLGYAGYPRSTIDRLATQVDRLTREGQPDTLIRQALTAW
DRRPNCERPEYLPTVLSDVLKASRASPATNGHDDKVNGYLAFANQPRQPE
IEP
118465966YP_880201.1 cytochrome P450 superfamily protein [Mycobacterium avium 104]MSVDDGVNDSDRKKNRYHFDRHSPDYRSRFKAITEEMHAKCPMAWTDTYG
GHWVAAGSHEVFELARCPAVSNDHDINGERRGYKGISIPTASRVSAVRGG
ILEMDDPEHRIYRTVLNPYLSPAAVKRWEPFIDEVTRAALDEKIEEGSID
FVDDLANIVPAVLTLAMLGIPLKKWKMYSEPVHAAVYTPEHSPDIERVTA
MHREMGLDMVNNMLEIRENPRPGIVNALLQMRIDGEPAPDLEILGNLGLV
IGGGFDTTTALTAHSLEWLSEHPEQRQLLSDERKTLLDPATEEFLRYFTP
APGDGRTFSEDFELDGTVFKEGERLWISWAMANRDPAVFHDPDEVILDRK
GNRHFSFGLGIHRCIGSNVARTVFKSMLIAVLDRMPDYRCDPEGTVHYET
IGVIQGMRKLPATFTPGRRIGAGLDETLEKLQRICDEQELARPITERKEA
AVID
118465965YP_881736.1 iron-sulfur cluster-binding protein- Rieske family protein [MycobacterMQTLPSMLPTGWFQVAWSADLAVAEVIPMHYFGRDLVAFRQLDGVVKVLD
AHCQHLGASLAHGGCVVEEGIQCPFHGWVWNGAGRNVHIPYQDRPNKARR
VRSYPVAELNDSILIWHDSAGREPLWDAPDAFAVLGDHVRSRRFHPFGAD
CRTRHERVKVHPQVIAENAVDPHHFQFVHRTPISPVVLRESTDSSTWSAK
VGFGRRWSDGLDRTGDTMNTIEIYWSGIGLSYNGEHVRDGIRVISICATP
VDDTRSDIFAGYWISEETSEGPGDFEARLAAAKLALPDDIRIWEHQKYLE
PPGLATSEAAGFRALRRWASGFYPEPEAAAEPVAHGV
118465964YP_880166.1 Xaa-Pro dipeptidase [Mycobacterium avium 104]MQTIKAAGLFDVDAGEIVRPGLLRVDGDRIVGVGDSGPTGADDNVIDLGE
AILLPGLMDMEVNLLMGGRGEKPGLSQVQDDPPTRVLRAVGNARRTLRAG
FTTVRNLGLFVKTGGYLLDVALAKAIDAGWIDGPRVVPAGHAITPTGGHL
DPTMFAAFAPHALELTVEEGIANGIDEIRKAVRYQIKHGAELIKVCCSGG
IMSLTGPPGAQHYSDEELRAIVDEAHRRGMRVAAHTHGADAVKHAVAAGI
DCIEHGFLIDDEAIASMVEHGTFLVSTRRLAEGMDVSHAPPELQAKAAQM
FPKSRTSILAAHRAGVKIAVGTDAPAIPHGRNADELVTLVEWGLPPVAVL
RAATVTAAELINSSDRGRLAEGYLADVIAVPGNPLEDITVTQHVSFVMKG
GKVYVHNQN
118465963YP_883987.1 hypothetical protein MAV_4864 [Mycobacterium avium 104]MDPAPNAVELTVDHAWFIAETIGAGSFPWVLAITCPYRDAAERNAFLDRQ
RAELSEMGLVSDAGLINPAVAEWIKVVCFPQRWLDLRYVGPAKDTGEGGG
SELLRGIVAQRDGAGGRSITVVALRSAQLITFTAMDIDDPRALVPVLTVG
LAQRAPASFDEFSMPTRVGARADERLRAGAPLSEVLDYLGIPQSARPVVE
SVFNGPRSYVEIVAGCHRDGRHSTTEVGMSIVDAREGRVLVSPSRAFDGE
WVSTFSPGTPFAIAVAIEHLTALLPDDGWFAGHRLARDFSVQH
118465962YP_883102.1 enoyl-CoA hydratase/isomerase [Mycobacterium avium 104]MTMPSTLELAAPGDGVRVLRLNRPHRLNAIDEAMQTELRLVLDDLAADHA
VRAVVLTGAGRGFCAGIDMRDFGPSMVGADAPALERMRFQERMAALAEAV
WALPQPVIAAVNGPCVGAGLALCLAADIRICSAAATFANAAILLGLSGAE
MGMSYHLPRIVGTGVAADWMLTGRTVSAAEADRRGLVSEVVEPDRLVERA
VELARLIAGHAPLGAQLTKRALQVNTDAASLASAMELENRNQVIAHATDE
AAARRQKWSR
118465961YP_882535.1 PPE family protein [Mycobacterium avium 104]MMDFGTRAPESNSGRMHSGPGAGSLMDAAKAWGVLGAQLADTALTYRAVI
AELDRRDQRASTSAITQAVAPYLAWLDATAARARQTATQATAAAGAYGLA
LAAVVAPHVIAANRLRRISLAEANCLGQLSPAVADADADYERMWAQDAAA
MYAYARASAGFWKLTPFDSPPPAADPAPAGVTSPSRNWALTAAPEVITTG
RQVISTISDALGALSVSPLATFDTSLLSATGALSKLSSLSAPLDFALNHL
SALNKAAALGRAAVMCSPRPGGGGGTNSAAPRVSVGRGAAIGILSVPRAW
TRSVPSPASPNSPAAPLDRSQ
118465960YP_883756.1 major facilitator superfamily protein [Mycobacterium avium 104]MAATLPAPAPAGLADGHPLDESAEQQRRRLRIVVAASLLGTTVEWYDFFL
YATAAGLVFNKVFFPNESSLVGTLLAFATFAVGFVMRPIGGLVFGHIGDR
IGRKRSLALTMLIMGGATALIGVLPTAAQIGAWAPVLLLVLRVLQGFALG
GEWGGAVLLAVEHSPGDRRGRYGAVPQVGLALGLALGTGIFAFLQIVLGP
ARFLSYGWRIGFLLSVLLVAIGIVVRLRVEETPAFRELQDLQAASTVPIR
DILRERRSRRNTVLGLLSRWAEGSAFNTWGVFAISYATGALGLNRVSVLI
AVTIAALLMAVLLPVSGVLTDRFGARRVYLAGIACYGLAAFPAFALFGTK
KLLWFGLAMVIVFGVVHALFYGAQGTLYSALYPTNTRYTGLSFVYQFSGV
YASGVTPMILTALIAALGGAPWLACGYLVATAVISVLATALIRDRDLYL
118465959YP_882486.1 HTH-type transcriptional repressor AcnR [Mycobacterium avium 104]MPKVSEDHLAARRRQILDGARRCFAEFGYDKATVRRLEQAIGMSRGAIFH
HFRDKDALFFALAHEDAERMAEVASRAGLIQVMRDMLAAPDQFDWLATRL
EIARKLRNDPAFSRGWAERSAELAAATTDRLRRQTEAHRVRDDVPGDVLQ
CYLELVLDGLVARLASGEDPQRLSAVLDLVENSVRRNDSRPG
118465958YP_881191.1 transposase [Mycobacterium avium 104]MKNIAAGSRVKVSADGHGVVSHAGMGMLRELADRTGLSAQVSAALADTYR
GPWVYAPGDVFADLAAAVADGADCIDGVGQLCGDREHVFGAKASTTTMWR
LIDKRIDAARLPGVRAARAGARAAAWAAGATPTGDGWLHIDIDATLVIDH
SDNKTGATPTWKKTFGLHPLLAFLDRPEISGGEALAGLLRTGNAGSNTAS
DHIIVLKQALASLPPRWRPHPGARADPDASGVLVRCDTAGATHKFADACR
AAGVGFSFGYPVDVRVQDAVDTLNLADGWYPAIDTDGGIREGAWVAEATD
LVNLSSWPAGTRLILRKERPHPGAQLRFTDADGMRVTAFITDTEPGVIAG
QVAGLELRHRQHARVEDRIRELKATGLRNLPCHSFWANAAWLEIVLAAAD
LVTWARLIGFRAHPGLARAEIATFRYRVLHVAARITRGARQQRLRIDATW
RWASAIATAWQHLRTAFG
118465957YP_883362.1 hypothetical protein MAV_4221 [Mycobacterium avium 104]MATLTFVYSDSTAVVGPLATAREPHSWDLCVNHAGRITAPRGWDLVRHAG
PLPTHPDEDDLVALADAVREGGSAERTLPYAGAAVPRNGFGDPHLHPGGA
QATAPSSSLIAPPEQRSGRRRGHLRVLPDPSD
118465956YP_879680.1 hypothetical protein MAV_0395 [Mycobacterium avium 104]MSAAHTRLVARCSLALTLLAPQWFTAARADPPAPEPEPIVGPLAPGQVLR
IGPTAGTGTPTGDYGIGATDLCEFVEFPTELLQVCGDSFAGQGVGFGGWY
APVALRVDTASVDDPAGVRYTGVTGISNPLLADPAPPGASQLPAGVVQIN
RRNYLMVTTTKSLEPQSSRLVTAEPVRAGWQTIPGSTRPASYQGGSQTQI
SGYYDPIPTEESPSGWVYIVADSFTRRDPVVLYRATPQAFTDRSRWQGWA
AGPQGGWGKPPTPLWPDAVGEMCIRQIDGKAVLSYFNATTGNMEVRVADD
PRMLGDAPVTTVVQHDEWPEPAESLPPPYDNRLAQPYGGYISPGSTLDEL
RIFVSQWDTRARVAAPYRVIQFAVNPFKPGQP
118465955YP_880004.1 EmrB efflux protein [Mycobacterium avium 104]MLSGAMEKTRSAAFSVPLATASGPSLRDDEYPDKLDAALFRIAGVCGLAC
IMAVLDSTVVAVAQRTFIAQFGANQAIVSWTIAGYMLAFATVIPITGWAA
DRFGTKRLFMGSVLIFTLGSLLCAVAPNILLLILFRVVQGVGGGMLLPLS
FVILTREAGPKRVGRLMAVGGIPILLGPIGGPILGGWLIGAYGWKWIFLI
NLPIGLTAFALAALLFPKDRSAPSEALDITGALLLSPGVAIFLCGVCSIP
GRHTVADRYVLVPALVGLVLIAAFILHAWYRTEHPLIDLRLFRNPVVTQV
NVTLLVFAAASVGVGLLVPSYFQIVGHETPMQSGLHMLPIGVGAVLTMPL
GGAVMDKHGPGKIVLTGLPLMAVGLAVFTYGVARQAAYSPVLVCGLAIMG
LGIGLTTTPLSAALMQALAPHQVARGTTLISVNQQVGGSIGAALMAVILT
NQFNRNPALMAANEAAGMHPVTGKRGLPVDPSTVPRPAMTPELAGHVSHH
LSHAYTAVFVLAVVLVACTIIPASFLPRKPPSPPAGD
118465954YP_883419.1 L308_f3_97 [Mycobacterium avium 104]MPLYAAYGSNMDPEQMLKRAPHSPMAGTGWLHGWRLTFGGEDIGWEGALA
TVVEDPGSKVFVVLYDMTPADEKNLDRWEGSEFGVHKKIRCRVDRISSDT
TTDPVLAWLYVLDAWEGGLPSARYLGVMADAAEIAGAPADYVHDLRTRPA
RNIGP
118465953YP_879736.1 hypothetical protein MAV_0454 [Mycobacterium avium 104]MSWLLVAGVPVLLMLAALGLGRLEKELVRDPAAVADVDEFLERTGGVDMH
TLAAEGMPEALEYLHRREAQQSAGPAPGGRSGGPRHAAPSFAAGFVDPDE
MTLPTRIGGHSHVNPQFRAPRHANRV
118465952YP_881851.1 hypothetical protein MAV_2660 [Mycobacterium avium 104]MAPNLFIALTNPIEGEDDAFNKWYDAQHVPEVLDVPGVVAAQRYDITELK
VPDDEDLPAQLPPPTHRYMVIYELDNEPDVVMAEFLKRVMAGTLTLGEWL
DLTTVSLTGWTPRGERVQADR
118465951YP_880400.1 long-chain-fatty-acid--CoA ligase [Mycobacterium avium 104]MSRFTEKMYRNARTAKTGMVTGEPHNPVRHTWGEVHERARRIAGGLAAAG
IGPGDAVGVLAGFPVEIAPTAQGLWMRGASLTMLHQPTPRTDLAVWADDT
MNVIGMIEAKAVVVSEPFLVAIPVLQEKDIKVLTVADLLASDPIDPVEVG
EDDLALMQLTSGSTGSPKAVQITHRNIYSNAEAMFIGAQYDVDKDVMVSW
LPCFHDMGMVGFLTIPMYFGAELVKVTPMDFLRDTLLWAKLIDKYKGTMT
AAPNFAYALLAKRLRRQAKPGDFDLSTLRFALSGAEPVEPADVEDLLDAG
KPFGLKPSAILPAYGMAETTLAVSFSECNAGLVVDEVDADLLAALRRAVP
ATKGNTRRLATLGPLLQDLEARIVDENGDVMPPRGVGVIELRGESVTPGY
LTMGGFIPAQDENGWYDTGDLGYLTEEGHVVVCGRVKDVIIMAGRNIYPT
DIERAACRVEGVRPGCAVAVRLDAGHSRETFAVAVESNAFQDPAEVRRIE
HQVAREVVAEVDMRPRNVVVLGPGTIPKTPSGKLRRSNSVTLVT
118465950YP_879965.1 hypothetical protein MAV_0686 [Mycobacterium avium 104]MCGYLEAGHSRDEATQQVLANDPTFTPWQASGMVNASTAAYCPDQ
118465949YP_880395.1 methionyl-tRNA synthetase [Mycobacterium avium 104]MRPFYVTTAITYPNGDPHVGHAYEYIATDAIARFKRLDGFDVRFLTGTDE
HGLKMVETAAAEGIGTAELARRNSDVFQRLQERLNISFDRFIRTTDPDHH
EASKAIWRRMQAAGDIYLDSYSGWYSVRDERFFVESETKVLDDGTRVAAE
TGAPLTWTEEQTYFFRLSAYTDKLLAHYEANPDFIAPEVRRNEVVSFVSG
GLRDLSISRTSFDWGVKVPDHPDHVMYVWVDALTNYLTGVGYPDTESEMF
RRYWPADLHMIGKDIIRFHTVYWPAFLMSAGIELPRRVFAHGFLLNRGEK
MSKSVGNIVDPITLVDTFGVDQLRYFLLREVPFGQDGSYTKDAIITRINT
DLANELGNLAQRSLSMIAKNLHSVVPEPGDFTGDDRELLQTADGLLPRVR
ASFDSQAMHLGLEAIWLMLGEANKYFSAQQPWVLRKSESEADQTRFRTVL
YVTCEVVRIAALLVQPVMPDSAGKLLDLLGQGQDRRAFDALGARLAPGTV
LPPPTGVFPRYQAESEKVD
118465948YP_884126.1 hypothetical protein MAV_5006 [Mycobacterium avium 104]MEDQQPAAGDLTAEENPAADQNEATVAAAGDDRENGDAATESEAAKTSDA
APADGAEDSHSAETVETAGAAPAAGRRTKRLAGKAWAVAAMVAALLFVGS
AGFAGAMVQPYLADRAVAATKLKVARTAANAITTLWTYTPENMDTLADRA
SAYLSGDFEAQYRKFVDAIVAPNKQAKITNHTDVTGAAVESLDDTNAVVI
VYTNTTSTSPLTKNVPSLKYLSYRLFMKRAKSRWLVTRMTTITSLDLTPK
V
118465947YP_882071.1 MerR family transcriptional regulator [Mycobacterium avium 104]MSEQPRQEQLNLAEDGNAGTGERSVTAAAAPVQPGLFPDDSVPDELVGYR
GPSACQIAGITYRQLDYWARTSLVVPSIRSAAGSGSQRLYSFKDILVLKI
VKRLLDTGISLHNIRVAVDHLRQRGVEDLANITLFSDGTTVYECTSAEEV
VDLLQGGQGVFGIAVSGAMRELTGVIADFPGERADGGESIAEPEDELASR
RKHRDRKIG
118465946YP_884266.1 methyltransferase- putative- family protein [Mycobacterium avium 104]MSSLRTHDDTWDIKSSVGTTAVMVAAARAVETEQPDPLIRDPYAKLLVTN
SGAGVLWEAMLDPDIAARVEALDEESAAHLHHMRGYQAVRTHFFDTYFAD
AVAAGIRQIVILASGLDSRAYRLDWPAGTTVYEIDQPQVLAYKSTTLAEN
GVTPSADRREVAVDLRQDWPAALRAAGFDPTQRTAWLAEGLLMYLPAEAQ
DRLFTLIGELSPAGSRVAAETAPNHADERRQQMRERFKKVADEIGFEQTV
DVGELMYRDDHRADVTEWLNAHGWRATAEHSTAAMRRLGRWIENVPLADD
KDAFSDFVVAERR
118465945YP_881112.1 L-carnitine dehydratase/bile acid-inducible protein F [Mycobacterium aMGPLSGVTVVSLEQAVAAPYATRQLADLGARVIKVERPDGGDFARGYDHS
VHGDSSYFVWLNRGKESLTLDLKTLEGQRILRQLLANSDVLVQNLGPGAT
TRLSLDATTLTPEYPRLIVCDITGYGGTGPWRDRKAYDLLVQAEAGLLSV
TGSGDEVARTGVSIADIAAGMFAFSGILTALYVRATTGDVRPVSVSLFES
LVELVSQPAYYAHYGGTAPPRTGARHATIAPYGPFTAGDGGTVLLAVQNQ
REWRRLCDEVLATPGLCEDPRFVTNPDRVTHRDELEAIIHAAIASMTADE
LAHRLEAAGIANARMNDVETLWSHPVLAGRDRWREVRAPGGAIEALLPPA
TLRDVEPQLGDVPGLAAHSRMILRELGYTNEAIADLVRSGVTTVASDH
118465944YP_882809.1 hypothetical protein MAV_3633 [Mycobacterium avium 104]MTELTGTTVANTRTVEGFLNALQDADYDAAEAALADDLVYENVGLPTIHG
RARAMKLFRRMEGRAAFEVKIHRIAADGGAVLTERTDALIFGPLRLQFWV
CGVFEVQNGRITLWRDYFDFFDMLKATARGVAALLLPSLKATF
118465943YP_882370.1 histidinol dehydrogenase [Mycobacterium avium 104]MDTVSPTPASPMARIDLRGAELTAARLRSALPRGGADVETVLPKVRPIVQ
AVAERGADAALEFGASFDGVRPAAVRVPEAALDKALADLDAAVADALRVM
IDRARAVHADQRRTDVTTTLGPGATVTERWVPVERVGLYVPGGNAVYPSS
VVMNVVPAQAAGVASLVVASPPQAQFDGLPHPTILAAARLLGVDEVWAVG
GAQAVALLAYGGTDTGAEWPGFSSDRARSASSPGADAELVPVDMITGPGN
IYVTAAKRLCRSRVGIDAEAGPTEIAILADHTADPAHVAADLISQAEHDE
MAGSVLVTPSEELAAATDAELAAQLPTTVHRERVTAALGGRQSAIILVDD
LDAGITVVNAYAAEHLEIQTADAAAVAGRIRAAGAVFVGPYSPVSLGDYC
AGSNHVLPTAGSARHSSGLSVQTFLRGIHVVDYTEAALKDVSGHVITLAQ
AEDLPAHGEAIRRRFER
118465942YP_880211.1 virulence factor Mce [Mycobacterium avium 104]MLKYRGSGLVKAGLIGVVLAVMVILVGLSPDRFIAWATMVRYQALFTEAG
GLATGNPVVVSGMKVGTVSDVKLHRGDALVTFALKGNILLGSETTAHIRT
GTLLGERMLTLESAGTGTMHPMALIPVSRTSSPYSLTEAVSDLTTDTAGT
NTTALNQSLDTLAATLDQIAPQMGPAFDALTRLSRTLNSRNKNLGELFKS
AGDVTGVLSERSQQVNKLILNSDVLLQVLVARRQEIVDLLANTSAVAKQL
TALVHDNESKLAPTLERLNSVTAMLEKNRDNISKALPGLKKFEITVGEAI
SSMYAYSAFVPNFLAPQLFQPFLDYLWGFRTFDTARGPGHPSPVPRSLIP
WPYNGIPVCPGCTLGGRVGGSQ
118465941YP_882248.1 cytidylate kinase [Mycobacterium avium 104]MSADVVVAIDGPAGTGKSSVSKGLARALGARYLDTGGMYRMVTLAVLRAG
IDPADADAVGRAAQAVRMSVDYHPDGDRYFLGGEDVSTEIRGDKVTAAVS
AVSSIPAVRTRLVGLQREMASGPGSIVVEGRDIGTVVLPDAPVKIFLTAS
AETRARRRNDQNVAAGLADDYEAVLAEVRRRDHLDSTRRVSPLRAAPDAV
VVDTSDMTEAQVIDHLRDLVRQRSEVAR
118465940YP_879500.1 N-acetylmuramoyl-L-alanine amidase [Mycobacterium avium 104]MSRSRAPTTLLTAIAATVVLVSWVGDATRDRGAAGAPPARGTQLTEQPLI
GLGAGVTVREISQQTPFSLVALTGDLAGTSTRVRARRRDGSWGPWYQTEY
ETAAPDPGHAGEATEGPRGTDPVFVGTTTTVQIAVTRPLDAPATQPPPRP
ADDLGYRPASREQPFGQNISAVLISPPQAPSETHWTPPSGVVMPGQAPPI
ISRAEWGADESLRCGSPQYDNGIRAAVVHHTAGNNDYSPLESAGIVKAIY
TYHSKTLGWCDIAYNALVDKYGQVFEGSAGGLTKAVEAFHTGGFNRNTWG
VAMIGNFDDVPPTPVQLRAVGRLLGWRLGMDGVDPKGTVQLESAGSHYTT
YAAGTVATLPTIFTHRDVGNTDCPGNAAYALMDEIRDIAAHVNDPPEELI
KALQGGAIYAHWQEIGGMNSVLGAPTAPEDSAADDARFVTFVRGAMYWSP
QTGAQPVTGAIYDAWGSQSYERGPLGLPTSAEIQEPLQITQNFQHGTLNY
ERLTGNVTEVLDGITTPLATQLPSGPTVPAEHFSLPTHPAAT
118465939YP_883637.1 DNA-directed RNA polymerase subunit beta [Mycobacterium avium 104]MPGAPNRVSFAKLREPLEVPGLLDVQIDSFEWLIGAPRWREAAIARGDAE
PKGGLEEVLDELSPIEDFSGSMSLSFSDPRFDEVKAPVDECKDKDMTYAA
PLFVTAEFINNNTGEIKSQTVFMGDFPMMTEKGTFIINGTERVVVSQLVR
SPGVYFDETIDKSTEKTLHSVKVIPSRGAWLEFDVDKRDTVGVRIDRKRR
QPVTVLLKALGWTNEQITERFGFSEIMMSTLEKDNTAGTDEALLDIYRKL
RPGEPPTKESAQTLLENLFFKEKRYDLARVGRYKVNKKLGLHAGEPITSS
TLTEEDVVATIEYLVRLHEGQPTMTVPGGIEVPVETDDIDHFGNRRLRTV
GELIQNQIRVGMSRMERVVRERMTTQDVEAITPQTLINIRPVVAAIKEFF
GTSQLSQFMDQNNPLSGLTHKRRLSALGPGGLSRERAGLEVRDVHPSHYG
RMCPIETPEGPNIGLIGSLSVYARVNPFGFIETPYRKVVDGVVTDEIHYL
TADEEDRHVVAQANSPIDDKGRFAEARVLVRRKAGEVEYVPSSEVDYMDV
SPRQMVSVATAMIPFLEHDDANRALMGANMQRQAVPLVRSEAPLVGTGME
LRAAIDAGDVVVAEKSGVIEEVSADYITVMADDGTRHTYRMRKFERSNHG
TCANQSPIVDAGDRVEAGQVIADGPCTENGEMALGKNLLVAIMPWEGHNY
EDAIILSNRLVEEDVLTSIHIEEHEIDARDTKLGAEEITRDIPNVSDEVL
ADLDERGIVRIGAEVRDGDILVGKVTPKGETELTPEERLLRAIFGEKARE
VRDTSLKVPHGESGKVIGIRVFSREDDDELPAGVNELVRVYVAQKRKISD
GDKLAGRHGNKGVIGKILPQEDMPFLPDGTPVDIILNTHGVPRRMNIGQI
LETHLGWVAKSGWNIDGNPEWAVNLPEELRHAQPNQIVSTPVFDGAKEEE
LAGMLSCTLPNRDGEVMVDGDGKAVLFDGRSGEPFPYPVTVGYMYIMKLH
HLVDDKIHARSTGPYSMITQQPLGGKAQFGGQRFGEMECWAMQAYGAAYT
LQELLTIKSDDTVGRVKVYEAIVKGENIPEPGIPESFKVLLKELQSLCLN
VEVLSSDGAAIELREGEDEDLERAAANLGINLSRNESASVEDLA
118465938YP_883372.1 dTDP-4-dehydrorhamnose reductase [Mycobacterium avium 104]MIAGAGGQLGGYVSALAADQGRDVVALTSAQWDITDPAAAERIVRPGDVV
INCAAYTDVDGAESDEAGAFAVNEAGPGHIARACARAGARLLHVSTDYVF
GGESPAGAPDRPRPYEPGDPVAPQGVYARSKVAGERAVLAALPDPAQGVV
VRTAWVYTGGTGKDFVAVMRRLAAGEGPVQVVDDQIGSPTYVGDLAAALL
QIVDDRVPGPVLHAANEGAVSRFEQARAVFEECGADPARVRPVGTEHFPR
PAPRPTYSALGSRESAAAGLRPLRPWRPALVAALTNAGSPAAADRPLPST
RD
118465937YP_881987.1 competence damage-inducible protein A [Mycobacterium avium 104]MPVSARAGIVVTGTEVLTGRVQDANGPWIADRLLELGVELAHITICGDRP
HDIEAQLRFLADQGVDLIVTSGGLGPTADDMTVEVVARFCGRELVLDAEV
EEKIANILKKLMARNPAFQSALDPGTFESLRAANRKQAMVPAGAQVLDPV
GTAPGVVVPGKPAVIVLPGPPRELQPMWHTAIQTPAAQQAIAGRTVYRQE
MLRMFGLPESGLAETLREAEAAVPGFGQLEITTCLRRGEIEMVTRYEPTA
ATAYAQLTKLLRDKHGDQLYSEDGSRVDDLVARLLAGRRIATAESCTAGL
LAARLTDRPGSSDYVAGGVVAYSNEAKAELLGVDPALIETHGAVSEPVAQ
AMAAGARQRFAADTAVAITGIAGPGGGTEEKPVGTVCFSVQVGPPGATAR
SDTRTLRLPGNRLDIRERSTTVAMHLLRRLLTDA
118465936YP_883872.1 sulfur carrier protein ThiS [Mycobacterium avium 104]MIVVVNEQKVDVDAHTTVAALLDELGFGGRGVAVAVDDAVLPRSRWTTEL
SEGARLEVVTAVQGG
118465935YP_880197.1 esterase [Mycobacterium avium 104]MPSNHISLVHGWLPVAIQAVAGITLSLAAGWRSWRWRLLWLPSAAVLGVT
TAVGAHRCIITRAPQALFVWIALAGMAIAILLLGWRGARWWRRGLSILAV
PLCLLCSLLVLNQWVGYFQTVQSAWSQFTSGPLPDQTDRATVTTLAARGA
KPPHGSLVPVQIPEDASHFKHREELVYLPPAWFASYPPPQLPTVLMIGGM
VNTPADWVRAGNAVDTVDAFAAAHGGNSPVLVFADPGGALDNDTECVNGS
RGNAADHLTKDVVPYMISTFGVSKDPSRWGIVGWSMGGTCSVDLTVMHPA
LFSAFVDIDGDLTPNTGTREQTIADLFDGSADAWATFDPATVIARHGRYT
GVSGWFAISSTGSPSPRRDVDSTAMAVAGRAAADPGDQAAAAASLCALGR
ANGIDCAVVAQGGHHDWPTAGTAFATALPWLAGQLGTPGASRISLPGNAS
RQAL
118465934YP_882149.1 RNA polymerase sigma factor SigF [Mycobacterium avium 104]MTNAIAPTPTAARPTTQSDDSYEDVVEMFLELRRMPAESHEYRRQRERIV
ARCLPLADHVASHFARRGEGLDDLVQVARLGLMNAVNRFDPAKGPSFIGF
AVPTMMGEVRRYFRDYSWGMRVPRRLRELHVQISRTTADLAQQLGRAPNA
GELSQVLEVPREEIVECLVAGDAYRLDSLDAPQGADSSGTPRSVADSVGD
IDPQIEHITNREALRVLVATLPHREREVLRMRFFESMTQSQIAERIGVSQ
MQVSRILANTLRCLRDQLE
118465933YP_882154.1 cytochrome P450-SU2 [Mycobacterium avium 104]MTQPSTDADTDIPDFPMTRAPGCPFAPPPKVLQLNADKQLSRVRIWDGST
PWLVHGYQAIRALFADARTSVDDRLPGYPHWNEGMLATVHKRPRSVFTSD
AEEHTRFRRMLSKPFTFKRVEALRPAVQKITDDHIDALLRGPNPGDIVST
VSLPVPSLVISELLGVPYEDAEFFQTQAQRGMGRYATEEDTAQGAASLAK
YLANLVRAKMQSPSEDLVSDLAERVNAEEISVREAAQLATGVLIAGHETT
ANMISLSVAALLEHPDQRALLCDTDDPKVIATAVEELMRYLSIIQTGQRR
IAIEDIEIGGETIRAGEGIILDVAPANWDARQFPNPDRLDLRRQDGPHVG
FGYGRHQCVGQQLARMELQIVLPTLLRRVPTLRLAAPLDELPFKHDALAY
GLYELPVTW
118465932YP_881346.1 hypothetical protein MAV_2136 [Mycobacterium avium 104]MLGYPCGLGDFACRGASVVLPGKAGPGRVEQQLARRRRGAGRIEAGAAAA
PRLVDGRWATWLSSRRWLTLG
118465931YP_883826.1 DipZ protein [Mycobacterium avium 104]MQTIALIGFLGGLITGISPCILPVLPVILLSGMDGDRRGVGSAARPYLVI
AGLVCSFSVATLIGSALLTALHLPQDAIRWTALVVLTAIGLGLIFPPLQQ
LIERPFAYLPQRQSRPGADGFGLGLTLGALYVPCAGPVLAAIVVAGGTSS
IGPGALVLTATFAAGNALPLLAFALAGRRVAQRVAAFRRRQRAIQVAGGI
AMIVLAVALVFNLPAMLQRAVPDYTTAMQNRLGANDLQRSLSPPGPPPTQ
GGALQLSPGDVTGGGALSDCSDGLAELQRCGPAPALTGITGWLNTPDGKP
LDPAAVRGKVILIDFWAYSCINCQRAIPHVIDWYDRYHDSGFLVIGVHTP
EYAFERVPGNVASGAADLHIGYPIALDNDYATWNNYQNLYWPAEYLIDAT
GQVRHTKFGEGDYDGTERLIRELLAAAHPGARLPAPANTADTTPQSRLTP
ETYLGVGKAGNYGGTGDYRSGTATLSYPATLGEDRFALRGRWTLDDQGAT
AAGDDCAVRLNYTAKDVYAVVGGTGTLTVTRDGTTTTTPIGGAPTLHRIV
ADDSAHRDQLDMRVSPGLQVFSFTFG
118465930YP_883851.1 hypothetical protein MAV_4724 [Mycobacterium avium 104]MDSAMARANRSGDDAEIADGLTRREHDILAFERQWWKFAGVKEDAIKELF
SMSATRYYQVLNALVDRPEALAADPMLVKRLRRLRASRQKARAARRLGFE
VT
118465929YP_883767.1 uroporphyrinogen-III synthase [Mycobacterium avium 104]MGSGPGDPGLLTARAAAVLANAALVFTDPDVPEPVLALIGKDLPPVSGPA
PAEPAPNGEGAGSEQGQAQPAVISGGPDIRPALGDPAEVAKTLTAEARTG
VDVVRLVAGDPLTVDAVITEVNAIARSHLHIEIVPGLAPTNAVPTYAGLP
LGSSHTMADVRGDVDWEALAAAPGPLILQATASHLADAARTLIEHELAEN
TPCVVTAHGTTCQQRSIETTLQGLTDSAVLGGTDPAGPLTGPLVVTIGKT
VSARAKLNWWESRALYGWTVLVPRTKDQAGEMSERLTSYGALPIEVPTIA
VEPPRSPAQMERAVKGLVDGRFQWVVFTSTNAVRAVWEKFGEFGLDARAF
SGVKIACVGESTADRVRAFGISPELVPAGEQSSLGLLDDFPLYDSVFDPV
NRVLLPRADIATETLAEGLRERGWEIEDVTAYRTVRAAPPPAETREMIKT
GGFDAVCFTSSSTVRNLVGIAGKPHARTIIACIGPKTAETAAEFGLRVDV
QPETAAVGPLVDALAEHAARLRAEGALPPPRKKSRRR
118465928YP_881356.1 hypothetical protein MAV_2147 [Mycobacterium avium 104]MKVRLLATVAALILSTVLGCHFESRNPPSTKTLQVPMNDVLTQSDISQNI
TLAVGNTLVVQLGSNYTTPYRWTPDAKIGDSAIVKQTSHEFVPPTSDALG
APGTEVWTFAALKPGSTTITTSYSSFVDKNAKPACTYTLSVTVR
118465927YP_884068.1 hypothetical protein MAV_4947 [Mycobacterium avium 104]MWIIELNVAGYQFTREMPDLRRRTFRFSPRHMHWPALRHSHAA
118465926YP_882541.1 hypothetical protein MAV_3359 [Mycobacterium avium 104]MDAHLENGAGIDVVLVTGLSGAGRGTAAKVLEDLGWYVADNLPPQLITRM
VDLGMDAGSRITQLAVVMDVRSRGFTGDLDSVRTELATRNIAPRVVFMEA
SDDMLVRRYEQNRRSHPLQGDQTLAEGIAAERRMLAPVRATADLIIDTST
LSVRALRETIERAFGGGASATISVTVESFGFKYGLPMDADMVMDVRFLPN
PHWVDELRPRTGQDPAVRDYVLGQPGAAEFLDAYHRLLSLVVDGYRREGK
RYMTIAIGCTGGKHRSVAIAEALMQRLQAQHGEAQLSVRVLHRDLGRE
118465925YP_882240.1 asparagine synthase (glutamine-hydrolyzing) [Mycobacterium avium 104]MAAVLTPRGPDAGGAWSQGRVALGHRRLKIIDLTEAGAQPMVDSELGLSI
AWNGCIYNYKELRSELSGYGYRFFSHSDTEVLIKAYHRWGDDFVSHLFGM
FAFAIVERDSGRVLLGRDRLGIKPLYLTEDSHRVRFASTLPALLAGGGVD
TRIDPVALHHYMSFHSVVPAPATILRGVRKVPPASLVAIEPDGKRTVTTY
WAPDFTRHADRADWSERDWEDAVLSTLRLAVKRRLVADVPVGCLLSGGVD
SSLIVGLLAEAGQHGLSTFSIGFESAGGVKGDEFQYSDIVAQRFETNHHQ
IRIDSARMLPALDGAIGAMSEPMVSHDCVAFYLLSQEVARHVKVVQSGQG
ADEVFAGYHWYPPMGDPAAATLDGAVAQYRRAFFDRDTAGVAQLVGPGIL
APGDPSLRFVTEHFAQAGAETGIDRALRLDTTVMLIDDPVKRVDNMTMAW
GLEGRVPFLDHELVELAATCPPEYKIAHEGKGVLKQAARRVIPSEVIDRP
KGYFPVPALTHLEGPYLDMVRDALYAPTAKERGLFNTDAVDALLANPNGK
LTPLRGNELWQIALLELWLQRHGVTGPVA
118465924YP_884332.1 hypothetical protein MAV_5216 [Mycobacterium avium 104]MESPDPGGTGVVERYLQCLAAHDWDGLADTIADAGLTREGPFRDVIEGKA
EYLDYLRRVLTELPGHRLEVQRVSHVDAGRCYVELTEAFDIDGATRRWPE
CILFERGGDGLISHISVFFKQGR
118465923YP_881826.1 3-hydroxyisobutyrate dehydrogenase [Mycobacterium avium 104]MPNTVGFLGAGQLGEPMVERLLGAGHDVSVYARREEIRRRLEAKGAVAAA
SVADLARGSDVLISCLFSDAQLRETGFGPEGFIANAKPGAVFVSHTTGTL
STLEALRDSSAAAPIVLDAPVSGTVENIDAGTLTVLIGGPSDAVASVTPI
LAAYADPVVATGALGSALALKLINNLLFAANAQLLCAATQLGVRLGVDPS
VLLSTLQVCSAGSHVAAHAHRIGGMDRFEELAGPFLRKDISACREAAAEA
GVELGLLGTAVLEGPLALDVDSATAGSDR
118465922YP_883276.1 diguanylate cyclase [Mycobacterium avium 104]MSGRLASQPSAGRWHAIGLIAFLWLVGIYSVKARLGGAGDPRLYGLLGGA
ALAAVAAALVGRLRGRQESRVLLAGWPVASLLLTTVVGAVDPPVTRDFPG
TITITFAYIGLTCPRWRSLAFVPLGVAAFVVGGAKALPDGSTSVLLAAAM
WVIVAEVPAWLIARLEEQSALLRKVAHTDALTQLLDRSTLGPRLSAHASE
SAVVVIDLDNFKRYNDTHGHSAGDELLVAFADALRWSVGADDAVFRIGGD
EFLIMLVDADREQAERVLDRLRGRWAELGEPVGFSAGIAAGAQDLMRLAD
EHMYANKRSRDLSAD
118465921YP_884104.1 alpha/beta hydrolase-1 [Mycobacterium avium 104]MATVVSPDGTVIGYESVGAGPPLLLVHGSTGTRARWRPVTPELARRYTVH
AMDRRGRGLSTAEAEPYSLGREAEDVAAVAEAVGGDVYVVGHSYGALAVL
DAAPITRAFRRIVLYEPPIPSLGLDVGSPGGWARITALSDPRDILEAFYR
ETLQLSESAIKDLANREFPYLAGSIRHTAGRELAQTRAYRLTERHANITT
PVRMLLGTESPAYLRAATAVLAAKIPGATIVALHGQGHQAIDYDPDQFAR
AVLEFDSEEVDSGGVGAVTA
118465920YP_883989.1 PE family protein [Mycobacterium avium 104]MLDAHIPQLVAAQSAFSAKAALMRSTISQAEQEAVSAQAFHQGESSAAFQ
AAHARFVEVAARVNTLLDIAQANLGDAAGTYVAADAAAASGYTAF
118465919YP_880693.1 hypothetical protein MAV_1451 [Mycobacterium avium 104]MGQDSLQVVPAELVATAAQWQALSSQFIGAPPSPGPSFEATTAAVNALNA
AIAATTASFVARTQETVGGVTTASGGYLSQEATSAAAMNDVTNVRVV
118465918YP_883772.1 hypothetical protein MAV_4643 [Mycobacterium avium 104]MAEAFRVDPAALADAVQRMAEFQRYAEDMIAEIDSRVTRLHQTWTGEGAA
AHAEAHQHWVRGEAMMREALAQLGKAASTAHGNYTGAMSKNLGMWS
118465917YP_883176.1 hypothetical protein MAV_4023 [Mycobacterium avium 104]MKHEYDRIPYLVAFQNNSGVRDVYGGLAEITVLESYLLKPKNKPSDTVLV
FMHPIGGGAYLPMINALARAGHHVIYCNSRFRGTDSALLMEKVVEDLGEC
IKDAKKRLGYTKVVLAGWSGGGSLSVFYQQQAQNPTITSSPSGDGPDLTK
LDLIPADGIMLLAAHISRHGTLTEWLDASILDESDPTKRDPELDLYDSDN
PNQPPYSQEFLDRYRQAQIERNRRITAWVKAKLAELKAAGRPDDEFGFVV
HGTMADPRWLDPTVDPNERTPGTCYLGDPRVVNMSPVGLARFCTLRGWLS
QWSYDDARGDALACGPDIAIPALVIGNLADDACTPSHTRRLFQAIGHHDK
EMHEIPGATHYYAGPDQRDALRSAVGIVTDWLVRHDFAEKA
118465916YP_882304.1 phenylalanyl-tRNA synthetase subunit alpha [Mycobacterium avium 104]MDLSETALAEAVGAARQAFARAGDLDALARLKTEHLGDRAPLALARQALG
GVPKDQRADAGKRVNAARAQAQQAYDERLAELRAERDAAVLVAERIDVTL
PSTRQPVGARHPITILAEHIADTFIAMGWELAEGPEVEAEQFNFDALNFP
ADHPARSEQDTFYIAPEGSRQLLRTHTSPVQVRTLLARELPVYVISIGRT
FRTDELDATHTPVFHQVEGLAVDRGLSMAHLRGTLDAFARAEFGPQARTR
IRPHFFPFTEPSAEVDVWFVGKKGGAGWVEWGGCGMVHPNVLRAAGIDPD
VYSGFAFGMGLERTLQFRNGIPDMRDMVEGDMRFSLPFGVGA
118465915YP_882586.1 hypothetical protein MAV_3404 [Mycobacterium avium 104]MPRQRVGAPLMMLPPMGLREQPIHECPTMWFNRDFFESPWPGWTVDVDLT
RPATFVSHTDPGETLLGHPVRIRLEDPGVLWVATNRFARMGGPFAEVLIE
ARWPD
118465914YP_880694.1 transposase- Mutator family protein [Mycobacterium avium 104]MIGAGPHERSASRTNQRNGSRPRTLSTIAGDLELRIPKLRSGSFFPALLE
RRRRVDQCLFAVVMEAYLHGTSTRKVDDLVKALGADAGISKSEVSRICAD
LDTEVGAFRDRPLSEQHFPYVFLDATYCKARVNHRVVSQAVVIATGVAAD
GRREVLGFDVGDSEDGAFWTAFLRSLKTRGLSGVQLVISDAHTGLRSAIE
AILIGASWQRCRVHFLRNVLAQVPKGSAEMVAAAIRTIFAQPDAEHVREQ
LDTIAGMLGRQLPKVETMLREAADDITAFADFPVLHWKKIWSTNPLERLN
KEIKRRTDVVGVFPNPAALLRLAGSVLVEAHDEWQVAEKRYLSETTLALL
HPRSDSADQSVAVPAAITA
118465913YP_884208.1 dehydrogenase [Mycobacterium avium 104]MMSKVIQPPRAADVIVVGSGHNGLVAAAYLAKAGLDVLVVEASPTAGGMT
STNSFAPEAPEYTINEASIQASLFRTTTIDADLELSRKYGLRQTVIDPAH
FQLAADGSSLGLWRDPRKTAAELEYFSKKDARALLELYEVIDAAVAIGLP
MMQTNVVQPDIKAILKSARALVKNRKQLAALGRWMSSSQAEAVEESFEHD
MIRAPLLTSLPFMPFDADLSGWSLIYLGVLSRYGVAMFHGGTGSLPKALI
AVIKHYGGDVITSSPVEELIITGNRCTGVRVRGGTEIHARRAVLTACSPR
TTLTRLLPRGVLEPKKQNAADHIPTRKRGIADAKVNVALSGRIDMSKHEK
WRGDGIDLRLACNCYHTYEQALQAARSCVRGQVPDAIPGLAQVTNAFDPS
MSPPGKDLWWFWTGLTPSYPEEGWDVARKKITDSIIKDAQEYYKGVEDLQ
VAVRPLVLPDIEERFWAIDGSVYHVDPTISRFGPNKPVAGFAGYRTPVEG
LFLTGSGTHPVAGISGMPGQNAARTMLKQFRLEHTGGRVGALRARLRRDR
NAAADPYSSGPNDPFPGAR
118465912YP_880171.1 acetyl-CoA acetyltransferase [Mycobacterium avium 104]MRETVIVEAVRTPVGKRNGALSGMHAADLSAIVLNELVERTGIGPELIDD
VVWGCVSQVGDQSSNIGRYAVLAAGWPESIPGTTVNRACGSSQQALDFAV
QAVMSGQQDVVVAGGVEVMSRVPLGAARATGTPYGPKVLARYDDFSFNQG
LSAEMIAKKWGFSRTQLDEYSVRSHERAAAAQDAGAFTDQIVPVFVEDAE
NKVVAADEGVRRGSSVEKLAALKPAFAEDGVIHAGNSSQISDGAAALLVT
TAEMAVELGLTPIVRYVAGAVTGADPVLMLTGPIPATEKVLKKAGVALSD
VGVFEVNEAFAPVPLAWLAETGADAARTNPLGGAIALGHPLGASGAVLMT
RMAHHMRDNGIRYGLQTMCEGGGTANATLVELVS
118465911YP_882841.1 hypothetical protein MAV_3664 [Mycobacterium avium 104]MHSIEVPAEVRAALDALDTADAAIRALDFDALHPVVRLRALERMEASRRR
QIAVSHDVIAGLAGEGPANVGGPVHKVIADRLRISYAEACRRLREAKQLS
PRLTLTGQELPPELPATAGVWREGMLDGQHLRVIEKFVRDLPETTPVRAL
EEAERFLAHQATLLRPDQLEKVAHQCALRINPDGKFSDADRARQRGFTWC
GQRADEMSLGKLWASPELRANLDAWLARFAAPGMCNPDDEVPCVAGEPDE
ESATKDSRTPAQRQHDALNALVRGRLGDPKLGLHNGLPVTVIVSTTLREL
TTGAGRAVTGGGTLLPMRDVIRMARHAYHYLAVFDEHSSRPLYLGRSRRV
ASPDQRVVLYAKDRGCTHPGCDAPGYWCEVHHLDEWATGGLTDVDNLTFA
CGTHHKLIENGWRTNKLADGRTAWIPPPQWDRGARTNEFHHPERAFDGED
P
118465910YP_882424.1 actinomycin synthetase II [Mycobacterium avium 104]MELDAQALPLTRGQLDIWLAQATGHSSTEWQLGLFVRIDGRVERDALHWA
IRQAVQEAEPARVAFFEVDGAVYQRAIEHPDVELTFDDLSGLDDPVAEAR
RRALAIQRTPMPLSGPLFRFALFATRRDQFYLFACCHHIVIDGTGVGLVG
HRIASIYSAIVAAGPIPTAVFGSLRELVECESHYESSADYRDDEAYWLAN
LPPETTRLPAAPAQRDPWPSAPVPLDADVVRRVRRLSEVWGVSQTSVITA
ACALLVRAWDGDGSGVVLDFPVSRRVRPELKTLPGMVAGVVPLVLSLAPQ
CTVAAFCRHVETRIDEAIQHQRFPVHALERKVRGLARPPERVSVNFIPSA
FTLPFGGVTASASYTNSGQADGFGLIFSSDGDELFFSTAGSWAPWSGLDA
AELADRLQGVLTAMTADPTRPLRSLQLLDQSERDRLDLFGRRAALSEPLA
PVSVVDLFAAQVARTPDAVALTCRGRSMTYRELDLAANRLAHALIDRGAG
PGELVALVFSRSAEAIVAILAVLKSGAAYLPIDPALPAARIEFMLADAAP
IAAVGTAALAGTLDGFELPVIDVDDPALAGQPGTAPPTPAPDDLAHLIYT
SGTTGVPKGVAVTHHNVAQLFDDLRIGIELSAQQVWTQFHSYAFDFSVWE
IWGALLHGGRLVVVPDAVTQAPDELHALLVDEGVTVLTQTPSAVSTLSPH
GLDSVALVVGAEPCPAELVDRWAPDRVMVNVYGPTETTMWASHSAPLTAG
SGVPPIGSPLRGAAFFVLDGWLCPVPVGVVGELYVAGVGVGVGYWGRGGL
TASRFVACPFGGVGVRMYRTGDLVRWGVGGGLEFVGRVDEQVKVRGYRIE
LGEVRAALLGVEGVEQAVVLAREDGVGERRLVGYVTGAADPVEIRARLGQ
RLPSFMVPSAVVVLDVLPLTVGGKVDVGALPAPVLGGGGFRAPVGVVEEV
LAGVFGQVLGVGRVGVEDSFFDLGGDSLSAMRLIAAVNGVLGAGVSVRTL
FEAPTVAQLAPRVRGGGRTLARVVAGERPAVVPLSFAQSRLWFLDQLHGP
SPVHNMAIALHLRGSLDTDAMGAALLDVVGRHESLRTVFAVCDGTPHQVV
IPAEQADIGWRVIDANGWPASRLNDAIDAIARHRFDLCHEIPLRAQLFRL
AEDEHVLVAVAHHIAADGWSLTPLVRDLGAAYVRRSSGRGPDWGPLPVQY
IDYALWQRAQFGDLEDPDSPIAGQLRYWQEALAGLPERLALPTDRPYPAV
ADHRGARVDIDWPASLQQQVSALARVHNATSFMVVQAGLAVLLAKLGASC
DVAVGFPIAGRGDPALDDLVGFFVNTLVLRVDLSGDPTVETPWKSRRLLT
LETRMQVCRRNSRPGSRRHVDTVPRRRPPRCGWSAPCARSWAPSRAQCSG
SLASSATEWNRCAPGSVRSTSTKAWLLG
118465909YP_880937.1 endonuclease VIII and DNA n-glycosylase with an AP lyase activity [MycMPEGHTLHRLARLHQRRYAGAPVAVTSPQGRFAEAAAVVDGRVLRRTSAW
GKHLFHHYAGGPIVHVHLGLYGSFSEWERPGDGPLPDPVGQVRMRMVGAS
HGTDLRGPTVCEVIDEGQVSDVLARLGPDPLRDDADPSWAWQRIAKSRRP
IGALLMDQTVMAGVGNVYRSELLFRHGIDPYRAGRDVGEAEFDAAWTDLV
ALMKVGLRRGKIIVVRPEHDRGAPSYRPDRPRTYVYRRAGEACRVCGEPV
RTAVLEGRNVFWCPTCQK
118465908YP_883629.1 hypothetical protein MAV_4495 [Mycobacterium avium 104]MKWTTVAGSLAACALAVLAGAVAPPRVAQAKNGDTHIIGQDTEQTIDCND
ATLLVNGTGNVVTALGNCYAVTVMGSSNTVIADSVSHDITVYGYDQTVFY
KSGQPFLWDRGRELGMTNRLQQVPG
118465907YP_882402.1 glycerol-3-phosphate acyltransferase [Mycobacterium avium 104]MTGGPAGSAREIGRVGMRKLLQRTGILDEATSPLATDPAEVVQLLGAPWY
DERLRSLAGELGRDPADVRAEAAGYLREMAASLDESAVAAWRGFSRWLMR
AYDVLIDEDQIAALRKLDRKATLAFAFSHRSYLDGMLLPEVILANRLFPA
LTFGGSNLNFFPMGAWAKRTGAIFIRRQTKDLPVYRFVLRAYAAQLVQNH
ANLSWSIEGGRTRTGKLRPPVFGILRYLADAVDEIDGPEVYLVPTSIVYD
QLHEVEAMTTEAYGAAKRPEDFRFLIRLARQQGTRLGRAYLDFGEPLPLR
KRLEELRAEESGSQTEIERIALDVEHRINRATPVTPTAVVSLALLGADRS
LTLSEVLATVRPLASYIAARNWVVAGAADLTNRSTIRWTLHQLVASGVVN
VYDAGTEAVWGIGTDQHLVAAFYRNTAIHILVDRAIAETALLAAVEVSET
SGDGSVLPATVRDEALKLRELLKFEFLFSARAQFEKELADEVRLIGPAED
PVDTGKAAGAAVVRGLLEQADLLLAHLVLRPFLDAYHIVADRLACYEDDS
FDEQAFLAECLQVGKQWELQRRIANAESRSMELFKTALRLARHRELVDGF
EDPDIARRRRQFADEIATAIRRVNTIAELARTR
118465906YP_883071.1 hypothetical protein MAV_3909 [Mycobacterium avium 104]MIGRRDQFVDEVPFGTGAVRVRTNGLEFSQGGRFGCQQLLQTSGSDTGPT
SLFQRILAVDHDDVRAGPTNCRKRLTGAAGLSARRDHAGRMLASEPCCSA
118465905YP_881634.1 TetR family transcriptional regulator [Mycobacterium avium 104]MRRAILDAASTTLRRQGVDGLSIAAVLSRASLSTRAFYRHFGSKDELVAA
VFLEHARAEKRRLRRRMTGAASEAEAVAAWIDGRLDLAFDDRIGNDLRRL
SLEAQSQAMGPAELIQPAYAEMLEPLRDALQRGSQNGVFHDVDPVTQAQF
IHGVVWTGIARQWASGDCDRDDLRRRVQRFCLRGLGIADEVIDRVCFVME
RG
118465904YP_883967.1 hypothetical protein MAV_4843 [Mycobacterium avium 104]MSSPTRPAVPAALDPWIVAALAAAVSLAGAARPSFWYDEAATISASYSRS
LTQMWHMLGNVDAVHGLYYLLMHGWFRLVPPTEFWSRAPSGLAVGAAAAG
VVVLGRQFSSRTVAVASGVFCAVLPRTTWAGVEARPYALSMMAAVWLSAL
LVFAARRQSRWPWLCFGLALVCSVLLDAYIALLLAAYAVFVGVCCRTRTV
LWRFGISSVVAVGVLLPFLLTVAGQAHQISWVAPIGHRTIEDVVMQQYFE
RSPPFAVLSALLICAAIALWLSRSAPLGPSERQLLVLATCWVGIPTAAIV
AYSALVHPIYTPRYLCFTAPAMALILGVCSAAIAAKPWVTTAVVGVFAIA
AAPNYIRAQRNPYAKYGMDYSQVADLITAKAAPGDCLLVNDTVTFMPAPM
RPLLAARPDAYRKLIDLTLWQRAVDRNDVFDTNLIPEVVAGPLSHCAVLW
IITQADPSEPAHQQGPALPPGPVYGATPAFAVPHDLGFRLVERWQFNLVQ
VFEATR
118465903YP_884043.1 secreted protein [Mycobacterium avium 104]MLGAAAIFGVTLMVQQDTKPPLPGGDPQSSVLNRVEYGNRS
118465902YP_882948.1 signal recognition particle-docking protein FtsY [Mycobacterium avium MSQGLWIAVAVLVVIAVLVVIAALVLGLARYRRRRISFSTRPEPGAIDRS
GGYTASSGITFSQAPTAQPAERLDTTGLPAVGDDATVPRDAPRRTISEVE
LPEPETPAAPAPEAPAPEIEEIAPTEGRLERLRGRLARSQNALGRSLLGL
IGGGDLDEDAWQDVEDTLLVADLGPVVTESVIAQLRGRLASSDVRTEADA
KAVLRDVLINELRPDLDRSIRALPHADHPSVLLIVGVNGTGKTTTVGKLA
RVLVADGRRVVLGAADTFRAAAADQLQTWASRVGAEVVRGAEGADPASVA
FDAVDQGIAAGADVVLIDTAGRLHTKVGLMDELDKVKRVVTRRAAVDEVL
LVLDATIGQNGLAQARVFAEVVEITGAVLTKLDGTAKGGIVFRVQQELGV
PVKLVGLGEGPDDLAPFEPAAFVDALLG
118465901YP_880185.1 hypothetical protein MAV_0923 [Mycobacterium avium 104]MRIGLMVGSDKERSRAERLAGLVDDAAAAERGGFTAFWMPQVPGYLDALT
AVALIGQATERIEIGTAVVPIQTRHPMALAQQALTTQVACGGRFTLGIGP
SHHWIVNGQLGLPYERPARLTRNYLQVLGAAFAGPGSVDVDNESYCVHSP
VDVTDSFGVSILLSALGPTMLQLAGERADGTILWMADERAIGEHVVPRIT
AAAGGAGRPAPRVVAGVPVAVCSNSEIDDARAYAGEMLGHAEFSPNYVRL
LQHGDAEDVGDTMAAGDESAVLRRLRRYRDAGATDLAARIVPLGNDARER
AESRRRTHEFLSAVCPAL
118465900YP_881257.1 glycyl-tRNA synthetase [Mycobacterium avium 104]MASVIDTVVNLAKRRGFVYPSGEIYGGTRSAWDYGPLGVEFKENIKRQWW
RSVVTAREDVVGLDSSIILPRQVWVASGHVEVFHDPLVESLITHKRYRAD
HLIEAYEAKHGHPPPNGLADIRDPDTGEPGRWTEPREFNMMLKTYLGPIE
TEEGLHYLRPETAQGIFVNFANVVTTARKKPPFGIGQIGKSFRNEITPGN
FIFRTREFEQMEMEFFVEPSTAKEWHQYWIDTRLQWYVELGIDPQNLRLF
EHPADKLSHYSDRTVDIEYKFGFAGNPWGELEGVANRTDFDLSTHSKHSG
VDLSFYDQATDSRYIPYVIEPAAGLTRSFMAFLIDAYVEDEAPNAKGKME
KRTVLRLDPRLAPVKAAVLPLSRHADLSPKARDLAAELRRFWNIEFDDAG
AIGRRYRRQDEIGTPFCVTVDFDSLEDNAVTVRRRDDMSQERIGMDAVAD
YLSARLKGC
118465899YP_881134.1 thioesterase [Mycobacterium avium 104]MTKEATVQGGFPPMRSWQEPTVRSPGGGAEYGDMIAALRDFLDNVAAAAP
ETATTVELATDLKAWADRLAQDQVPERQQIFARRLDLPGRGQTMSPNFIP
VAGDHESVSGVVTFGRYFLGGGGAVHGGAIPLLFDEVLGRLASSGDRAPA
RTAYLHTDFRSITPVGEELTVRAWFVSEQGRKRILRAELRHGDTLCAEAE
GLFIALRPDQP
118465898YP_879411.1 hypothetical protein MAV_0115 [Mycobacterium avium 104]MVAVLVVSAGLVACGGSGGLQLVVQENQHVLQRFTISQLQQLPQVEVETP
QSHGAQIQKGPSVRSILNAAGATGVVRVRVEGRDPAQSLTAAELDDRTIL
GFTKRDTLKLTGAKLGRDQWVRDVTDLVINP
118465897YP_884058.1 ribonucleotide-diphosphate reductase subunit beta [Mycobacterium aviumMNRTRSASMVQGGLNWDSLPLKLFAGGNAKFWNPADIDFSRDRADWERLT
DDERSYATRLCAEFIAGEESVTQDIQPFMAAMRAEGRLGDEMYLTQFAFE
EAKHVQVFRMWLDAVGVTDDLHHFLDDVPSYRTIFYEELPDCLNALTIDP
SPAAQVRASVTYNHMVEGMLALTGYFGWHKICVERGILPGMQELVRRIGD
DERRHMAWGTFTCRRHVAADDANWGVFETRMNELMPLGLRLIEEGFALYD
PMPFDLSVDEFMAYASDKGMRRFGTIASARGRPLAEIDLDYTPVQLEDTF
ADEDARALAAV
118465896YP_882973.1 hypothetical protein MAV_3802 [Mycobacterium avium 104]MHTPWIERCTVQRVSLRDGLVLDLDDYNELVIATPIRLTLPPIGSSYPEE
QVLIDPGNVSVQQRPLLDLAGAVCTGAWCDEGGGLHLGFSRGHRIDVAPQ
EAATSWELYGKRHGYMACLPRGRVRVVRHDLPDDESEDTAS
118465895YP_880243.1 hypothetical protein MAV_0983 [Mycobacterium avium 104]MELTGVGIWSSQLRYGDPAESADAAAELDELGFPALWIPDVGGPVFDAVG
HLLGATKRTVIATGILNLWMHSPAEVAESYAALTAEHGDRFLLGIGVSHA
PLIDAGQPGRYRKPLAATARFLDGLDGAPRPVPIERRVLAALGPKMLKLS
ASRAGGAHPYLVTPDHTASARATLGHGPLLLPEQTVILTDSAEEARRIGT
DWLRAYLALPNYANNLLRSGFSEDDLSQVSDRLFNAIIAWGDEEAVMRRV
AEHRSAGADHVCVQVLLADPTAFPREEWRRIAAASR
118465894YP_880561.1 ferredoxin [Mycobacterium avium 104]MTYTIAEPCVDIKDKACIEECPVDCIYEGARMLYIHPDECVDCGACEPVC
PVEAIYYEDDVPDQWSQYTQINADFFAELGSPGGAAKVGLTENDPQVVKD
LPPQGEGD
118465893YP_884031.1 fumarate reductase iron-sulfur subunit [Mycobacterium avium 104]MTYNAKMRVWRGDDANGALQDFTVEVNEGEVVLDIIHRLQQTQTPDLAVR
WNCKAGKCGSCSAEINGYPRLLCMTRMSTFAEDEVVTVTPLRTFPVIRDL
VTDVSFNYEKAREIPSFAPPKDLQPGEYRMAQEDVQRSQEFRKCIECFLC
QNVCHVIRDHDENKKAFAGPRFLMRIAELEMHPLDTRDRRNDAQDEHGLG
YCNITKCCTEVCPENIKITDNALIPMKERVADRKYDPVVWLGNKLFRR
118465892YP_883628.1 TetR family transcriptional regulator [Mycobacterium avium 104]MAAQPEPPTAAGRQRAGRPAARPAKLSREGIIDGALTFLDREGWDALTIN
ALATQLGTKGPSLYNHVDSLEDLRRAVRIRVIDDIITMLNRVGEGRARDD
AVLVMAGAYRSYAHHHPGRYSAFTRMPLGGDDPEYTAATRGAAAPVISVL
SSYGLDGEEAFHAALEFWSALHGFVLLEMTGVMDDIDTDALFSDMVLRLA
AGLERRTAHG
118465891YP_881573.1 cytochrome p450 [Mycobacterium avium 104]MSAPENRDFFTDKSVVDDPYDYYDAIRRCPVWREPAHGVVMVSGYDEALA
VQRDTDHALSVCNIVSGPWSGIPANTGTDDISELIERYRKKVTFGDYFIT
FDPPMHTAHRSLLSRLFTPKQLKNNEDFLWRLADEQLNRFIANGKCEMVI
DYNFPFTLDAITDLLDVPEADRERFRRAAIASRLEGDRSGFVGVKEEWFV
EYVEERRRNPRDDVLTELALAKFPDGTTPEPIDVARVATFMFAAGHGTTI
DLLSLSMLTLAERPDLQDLLREDNSKIPAFIEEMLRIESPIKSNFRLARR
TTRIGDVEVQAGTSILVMNGAANRDPRRFDEPNEFRLDRPNILHHMAFGR
GIHTCPGAPIARAEVRVSLERILSRMADIRLSEAKHGPAGARRLRWDPTL
LFRRLKELHLEFTPIR
118465890YP_884053.1 glyoxalase [Mycobacterium avium 104]MRRVDYVIQYVESLERSVMFYRDVVGLEVRIEGDGYVEFEMPNTKFSLFE
RSKLPELIGREGGTAPCGEIGFLVDDVDEEATRLRGLGVEILSGPVDRPW
RERTLHIADPDGNVIEFAQKLR
118465889YP_880414.1 hypothetical protein MAV_1166 [Mycobacterium avium 104]MLAIAYRCPNGEPGVVKTAPKLPDGTPFPTLYYLTHPALTAAASRLETTG
LMREMTERLSQDAELAAAYRRAHESYLAERDAIEPLGTTFSAGGMPDRVK
CLHVLIAHSLAKGPGVNPFGDQALSILAADPALAGVLQEGRW
118465888YP_882207.1 biphenyl-2-3-diol 1-2-dioxygenase 1 [Mycobacterium avium 104]MSDLKSLGYITVSTADIERWRHFAFGVLGFAEGKGPDESALYLRMDERAA
RIIVVPGDVDRVVTVGWEVRDHQALQRVKATLDGAGVAFKELSLQEADAR
RVEEVITFEDPAGTTLEVFHGAVLDHSPVITPFGAKFVTGDQGLGHVVVP
ATDPNGLFDFYTEVLGFRSRGAFRVPLPAEFGPIRVRFLGINARHHSLAI
CPAAQQRDPGLVHVMVEVDSLDAVGQALDRVNADGFTVASTLGRHTNDKM
VSFYVRAPGDWDIEFGTDGMRVDETYYTAEEITADSYWGHEWIPEPPAAM
RM
118465887YP_883933.1 heat shock protein GrpE [Mycobacterium avium 104]MTQGNQKTEGNPPEQVTVTDKRRIDPETGEVRHVPPGDTPGGTAPQAATA
ESGGAAADKVAELTADLQRVQADFANYRKRALRDQQAAADRAKAAVVNQL
LGVLDDLERARKHGDLESGPLKSVADKLESALTGLGLTAFGEEGEEFDPV
LHEAVQHEGDGSKPVIGTVMRQGYKLGDQVLRHALVGVVDTVTEEGDGEA
AATDEPTAAAAETRPPESDDNAGASGD
118465886YP_883263.1 hypothetical protein MAV_4113 [Mycobacterium avium 104]MRFPDAAEVAARTPADRDRVLDVIRIVSLGGVVLGHTVMAASIIRDHVLI
WDNLLTTSALFQAMTWLLQIMPLFFFAGAAACVSSWTPGTDWGGWLMRRC
TRLFRPVFYYLAFWAVTLTVLYQALPQHIYEPIAGVSTQLLWFLGAYVLV
LAAMPVLYRITTTGRLAAGVAAVYGAIALIDVIRLHWPALMPLGYLNLAV
WLIPAMFGAAYRRGLLGGRAALAVAAAFFAADVALVRWGPYQLSMVGTGD
HHLSNTSPPSLLLAGHAIILSALAIAAAPAIARWAQRPRVWWWTAIGNSG
AMTLYLWHMPVLLGVHLAFDYLGCPRFPGAPDFLAISVAQVLLVVVAVAV
LFVALRPLENNPLSGWDGAPAVMSRGWGAAVGALLCVAGVALLAAIRWGL
KDDGLVCMAVVVAALVAARIVAQHAGPAGHGSSSRPCSMA
118465885YP_880833.1 oxidoreductase- short chain dehydrogenase/reductase [Mycobacterium aviMKYQGRVVVVTGAGSGIGRALTQALTAGGAHVAASDIDDNGLAETQASCG
PGQVTPYRIDVADRDAVLGFADEVRRKHGPASMVFNNAGVDLFASVADMS
WEDFDWLMGINVGGVVNGTKAFLPQLIEAGSDRRPSRLVNLSSAFGLIAV
PYQGAYSTSKFAVRGFTEALRQEMIIERHPVTVHCVHPGVVRTNFGANMR
TSDTEDPDLAAQLFDRAALTTPARAARLILRGAEKNRARILIGADGRAMA
ALPRLLGVAYAGLLARAARLTDSRAAHSGR
118465884YP_883055.1 MarR family transcriptional regulator [Mycobacterium avium 104]MTKGGAADRRLDRTELEKLMSADMRAITAQSDRIGRHFARQNNVSGTDFH
ALLHIMVAETTGTPLTPAQLRQRMDVSPAAITYLVDRMIDAGHIRREPDP
QDRRKTLLRYEKPGMALAHSFFTPLGAELRDALAHLSDRDLAAAHRVFTA
MIEAMTAFESRLAASTSKPPAAPGRKRATTAGRRGAPR
118465883YP_880710.1 transposase- Mutator family protein [Mycobacterium avium 104]MVKRPRITTERNIAMALDQSALLEVLDALRTADAGERITQAAETIYQALI
DAELTAFIGASPHERTETRSNQRNGSRPRTLSTVAGDLELRIPKLRTGSC
FPALLERRRRVDQCLFAVVMEAYLHGTSTRKVDDLVKALGTDTGISKSEV
SRICKDLDTEVAAFRDRPLGDQRFPYVFLDATYCKARVNHRVVSQAVVIA
TGVAADGRREVLGFEVGDSEDGAFWTAFLRSLKSRGLAGVQLVISDAHAG
LRSAIDAVLIGAAWQRCRVHFLRNVLAQVPKGSAEMVAAAIRTVFAQPDA
EHVREQLDTIAGMLGRQFPKVETMLREAAADITAFADFPVAHWKKIWSTN
PLERLNKEIKRRTDVVGVFPNPAALLRLAGSVLVEAHDEWQVADKRYLSE
TSLALLDVSDQSAETIAPTAALTA
118465882YP_883221.1 hypothetical protein MAV_4070 [Mycobacterium avium 104]MPRSSIKNEKMYQDLRKKGESKEKAARISNAAAGQGKSSVGRRGGKSGSY
QDWTVPELKKRAKELGISGYSGLTKDKLVAKLRNH
118465881YP_880336.1 hypothetical protein MAV_1082 [Mycobacterium avium 104]MREITKRTAAFSVALAAFALIGGACSKSNNAGQTTSPASSSATSSATSGT
SGTSASAAPSESTGTSGAPSSTQINGANGTPYTVEGPILAKYNALDDKAR
KDLGAPTGNEQKNPDGGVYQQFDGGVIVSKTQAYVVWGKIRDKWNQLGGS
QGQLGYPTSDEVDTPDGAKKSTFEHGTITWKPGDAEATVTTG
118465880YP_881720.1 transposase [Mycobacterium avium 104]MSFPGAEGLGGDGDSANCHLITAQGALLKSARERMNIISAYHQVGSYRGA
AELCGTTHKTVKRVIERAEAGGAPPREPRPRNLDAFTDLVATRVEKSHGK
MSAKRMLPIARAAGYQGSARNFRRLVAEQKVLWRNANRHQRRPAVWSPGD
YLVMDWAEAAPGLMVFCAVLAYSRWRFVRFAADEKASTTLAMIAEALEAI
GGVPAKILADRMGCLKGGVVANVVVPTPDYVRFASHYGFVPDFCHGADPQ
SKGIVENLCGYAQDDLAVPLLTEAALAGEQVDLRALNAQAQLWCAEVNAT
VHSEICAVPNDRLVDERTVLRELPSLRPTIGSGSVRRKVDGLSCIRYGSA
RYSVPQRLVGATVAVVVDHGALILLEPATGVIVAEHELVSPGEVSILDEH
YDGPRPAPSRGPRPKTQAEKRFCALGTEAQQFLVGAAAIGNTRLKSELDI
LLGLGAAHGEQALIDALRRAVAFRRFRAADVRSILAAGAGTPQPRPAGDA
LVLDLPTVETRSLEAYKINTTDGTAS
118465879YP_881177.1 short chain dehydrogenase [Mycobacterium avium 104]MKIRDKVFVVTGGANGMGRQVALLLVAKGARVAVVDVDVAGLKETAALTA
PQAGRISTHVVDVAERSATSALPDAVVAAHGAVDGLVNVAGIIHRFARLN
DLEFGEIERVLNINLYGVLNVTKAFLPHLLKRPTAHITIVSSMASYAPVP
GQAIYGASKAAVKMLAEGLNSELRDTNVRVSVVFPGAVKTDIAVNSGAMT
PDENEATARSMRMLPSTVAAAKIVRGIEKDSRRVFVGLDALLLDKLNRLT
PASAAKLIWSQMRDVLPPAGQSLR
118465878YP_880956.1 50S ribosomal protein L21 [Mycobacterium avium 104]MATYAIVKTGGKQYKVAVGDVVKVEKLDSEPGSNVSLPVALVVDGAKVTS
DAAALAKVAVTGEVLEHTKGPKIRIHKFRNKTGYHKRQGHRQQLTVLKVT
GIK
118465877YP_883310.1 isochorismate synthase DhbC [Mycobacterium avium 104]MNDEPTFALCGPTQTLVADGVRRSYRDVAAAQAALRSQEVSIVLGALPFD
VRRPAALLTPDTVSVSDGPPDWPARKLPSMRVAAALPPPIDYRDRICRAR
EQLAATDNPLHKVVLARALHLVADAPLDARTILRRLIAADPGAYGYLVDL
SAAGHDHAGVALVGASPELLVARTGDRVECRPFAGSAPRAADPDTDAANG
AALASSAKNRHEHQLVIETIRAALEPLCDDLSIAAQPQLSRTATVWHLCT
PISGRLRDKSTTAIDLALALHPTPAVGGVPTDAAVELIAELEGDRGFYAG
AVGWCDARGDGRWVVSIRCAQLSADRRSALARAGGGIVAESDPDDEVAET
TTKFATILNALDVR
118465876YP_881261.1 [Cu-Zn] superoxide dismutase [Mycobacterium avium 104]MKKISGSPCIATLLMGLPVLAMTACSSPQHASTQPGTTPPVKSAAPTSSG
ATTTPAPGGGALTAELKTPDGRSVATATFDFTGGYVTVTVKTVTNGVLTP
GLHGLHVHEIGKCEPNSVAPTGGAPGNFLSAGGHYQAPGHTGKPESGDLA
TLQVRQDGAAYLVTTTDAFTRDELLAGNKTALMLHGAEDTENAMDRVACG
VIGTG
118465875YP_879554.1 hypothetical protein MAV_0265 [Mycobacterium avium 104]MTLAVATLNTPVAAAEPVVRCRTLAGGGDYVCVTETPTAPATTGSTGTSS
GSNGLGDWFSEHAGTVMFVIAVAAVIAIAAMVKSGTSKDKAAEAAAVHAR
GRQIALDASVEPAAQSPEDLKRFGAFGWAVPWIPGTAFGNLVTRDGSTDR
VNAAWAQAAEIARLGHVDVQGSFAPAATVVNVNGYADGTGDLELSVNTAD
YTVGEAQLNRVLAHLVRTARVETATGFTRDAVRDWHVTRLSMIPAAVQQY
AAASEQEQTVAPDPTVNWEW
118465874YP_883194.1 NADH dehydrogenase subunit J [Mycobacterium avium 104]MSAFAGHAVAATLASSYSQDTIVRTSTGEAVTFWVLGALAVIGALGVVLA
VNAVYSAMFLAMTMIILAVFYMIQDALFLGVVQVVVYTGAVMMLFLFVLM
LIGVDSAESLKETLRGQRVAAVAAGVGFGILLIAAVGNVASGGFAGLTTA
NANGNVEGLAALIFSRYLWAFELTSALLITAAVGAMVLAHRERFERRKTQ
RELSQERFRAGGHPTPLPNPGVYARHNAVDVAALLPDGSYSKLSVSPILQ
SRGGDGKDVAAPEPSPSLSQGGAS
118465873YP_881956.1 acyl-CoA dehydrogenase domain-containing protein [Mycobacterium avium MTSIADTDDRVVALARGMRDLVQDQAAESERMRTLTPAIVDAMWASGLMS
AFNTIEAGGVEPSFTEMIETWIEMAWQDGSFGWVGIANLPSSFAAAAYLP
DDGFAEVFTAHDNHVTMGGQFFPNGQGAAVDGGYLVSGAWNFGSGIGHSQ
YVAAGFLPMDDGEMRWISEGFPEMRVAVIPREQISFDDGWYVQGLKGTGS
YDYSARDVFVPAARTFELFTRAPFRGASPATRMGLMPVTAAGHASWALGV
AKSMLDDVQELAATKFRMSDMASLASRPTFQKGLAHHRAAWRAARLLVLD
AFTTAEAAVAAGQELTPALRADMRVAAVYATDTARGCAEWAHLVAGTSSI
REGSRLERAFRDIYTGTQHAFISEKVAIDVAQIWLGIIEDQPGL
118465872YP_879409.1 hypothetical protein MAV_0113 [Mycobacterium avium 104]MDQQVSSDPPARPEDAQKATEEQRKLQEQLDHQDEDPDGPGLHQSRHDLP
DESTR
118465871YP_881169.1 cytochrome P450 126 [Mycobacterium avium 104]MTTDALPKVCTDDLPMPEARDDAWHQLDKHPLVEVEDGYAVTRRDVVELV
LKNPSLFSSKRAFDVLASPVPLVPIAFDPPEQTRYRRILQPFFSPRMIKP
LEPDLRRQVVDLIEPIARRGQCDFIAEVAAVFPIQVFLTLFGLPLDMRDQ
FIEWKDAVLNLSAAAGQTSVDEAAQEGMQKALELFMYLTDLIQKRRGAPG
DDVLSQVLSIEPPDALSDEEAVGLCFLFVLAGLDTVMDALGFGMQRLAEN
PDKRQEIVNDPSLIPAAMEELLRLDPPAPFVPRVSTQEVTVAGHTLPEGT
RITNYLAVANRDERQFPNPYDIDFHRTENRHVSFGMGVHRCLGSHLARLE
MAVLYEEWHKRIPNYHITPGTTPRVHWPRGTVGLDSLHLTIEAGDRA
118465870YP_882096.1 PPE family protein [Mycobacterium avium 104]MLDFGAYPPEYNSGRMYVGAGSGPLLAAAAAWDELAAELQSVGASYGSTV
ETLTTGPWTGPSSIAMAAAAAPYVAWLQATGAQAEQAGAQAKLAAAAYET
AFAATVPPPVIAANRALLATLVATNILGQNTPAIAATEAHYMEMWAQDAA
AMYAYAASSASAAQLTPFTEPPRTTNESAGPLQSAAVAQSAAQSGSNTAA
HLSQLSATAQPAAQAAGNAASTTAASTQLTTPSFITNWNEFWSVVTGVYS
PQSWTTIPGGPFLSFGQAYAWGQNGQGAAAYLAGPKAISGALAPLASGGN
AVKPMLSSAVGAGQVSGSMGKAALVGSMSVPQGWTEAAPAIRTLAQVLPG
NMAAAPAAMAGEEGVFSQMALSSLAGRAVAAAATRPVGGAASAASSLGGV
AAEADPAAATIIVIPCIEE
118465869YP_880366.1 hypothetical protein MAV_1114 [Mycobacterium avium 104]MTSKTGSAPISTNLKIWNMLQRLPFGNRIFSQAVCFKAPYFSTVHPVIVE
LRPGLCRAKAPNRRGVHNHLGSFHAIASCNMAELVAGVMTEVTVPPTHRW
IPAGMTVEYKAQARTAVTATARVDAIPEFTDEPFEFVVPVDVSDAEGNVF
VTARITMHVSPRPR
118465868YP_880903.1 acetyl-/propionyl-coenzyme A carboxylase alpha chain [Mycobacterium avMFETVLVANRGEIAVRVIRTLRRLGIRSVAVYSDPDAAARHVLEADEAVR
LGPAAARDSYLNIDKVVETATRTGAQAIHPGYGFLSENADFAAACERAGV
VFLGPPARAIQVMGDKITAKNAVAEFDVPVVPGVAEPGLGDDELVAAADE
IGYPVLIKPSAGGGGKGMRLVEEPGRLREALVGARREAASSFGDDTLFLE
RFVLRPRHIEVQILADTHGNVVHLGERECSLQRRHQKVIEEAPSPLLDPE
TRARIGAAACNTARSVDYVGAGTVEFIVSADRPDEFFFMEMNTRLQVEHP
VTEAVTGLDLVEWQLRVAAGEKLVFAQDDIELRGHAIEARVYAEDPARGF
LPTGGRVLGVFEPSGDGVRVDSSLLPGTVVGSDYDPMLSKVIAHGADRDE
ALARLDRALSHTAILGVQTNVEFLRFLLADERVRAGDLDTALLDARLADF
TPLPAPDDVLAAAGLYRQSALAARARRFAGNPWAAPTGWRAGGSPAPVRT
DMRTALRTETVSVWGPPEAAEVQVGAGERLAASAHLGPDRISVTLDGRRR
DYRWAEADRHLWIADERGTWHLREAEQTTIHRAAGPQRAEILSPMPGSVI
AVQTPSGSDVSEGDVVVVVEAMKMEHSLAAPVSGRVEVLVCVGDQVSVDQ
VLARVVPEESDPPADSSKDET
118465867YP_883681.1 virulence factor Mce [Mycobacterium avium 104]MRITGTAVKLVVFWSVLAMFTVMIIVVFGQVRFDRTTGYSAVFTDAGGLR
AGQFVRASGVEVGKVAAVTLSGKDSRVLVEFNVDRSLALDQGTTASIRYL
NLIGDRYLELKRGTSGRRLPPGGRIPVEHTQPALDLDALIGGFRPLFQAL
DPNKVNSIAQSIITVFQGQGATITDILDQTAALTAALADRDKAIGEVINN
LNTVLATTVKHEKEFDRTVDKLELLITGLKNRADPLAAAAAHISDAAATV
AGLLGEDRPSLHGTLGHLEGIQQALINDLPTADNVLEKLPGAFRVIGRAG
GIYGDFYNFYLCDISIKVNGLQPGGPVRTIKLFGQPTGRCTPQ
118465866YP_881118.1 enoyl-CoA hydratase/isomerase [Mycobacterium avium 104]MTDVENLQTIEFQVTDHVATVALNRPEKLNSFTEQMAADLATVWARVRDD
DDIHVAVLCANGERAFCTGIDVSEGTWWKHKTIFNQEDPGQLLGPKAHKV
WKPVIAALHSIVAGGAMYFVNECDFAICGETATFFDPHANAGIVSALEPM
GMLALGVPYGEVMRWALLGSEERMTAQTALRIGIVTEVVPDDQLRSRAIE
LAREIAARRPLGVQGTVRAMWEARDLPPTIAARHGKFYTDLGNAGATPDS
LNNKKRPRTR
118465865YP_879305.1 DNA polymerase III subunit beta [Mycobacterium avium 104]MRESFADAVSWVAKSLPSRPAVPVLSGVLLSGTDEGLTISGFDYEVSAEA
QVAAEIASPGSVLVSGRLLSDIVRALPNKPIDFYVDGNRVALNCGSARFS
LPTMAVEDYPTLPTLPEETGTLPADLFAEAIGQVAIAAGRDDTLPMLTGI
RVEISGDTVVLAATDRFRLAVRELTWSAASPDIEAAVLVPAKTLAEAART
GIDGSDVRLSLGAGAGVGKDGLLGISGNGKRSTTRLLDAEFPKFRQLLPA
EHTAVATINVAELTEAIKLVALVADRGAQVRMEFSEGSLRLSAGADDVGR
AEEDLAVDFAGEPLTIAFNPTYLTDGLGSVRSERVSFGFTTPGKPALLRP
ASDDDSPPSGSGPFSALPTDYVYLLMPVRLPG
118465864YP_882634.1 class II aldolase/adducin domain protein [Mycobacterium avium 104]MASTFTDSKSELMRRAAEQLTALQGRDAAESPLTTRQKLALTCRALFDAG
HDSGLAGQITARAEADGTYYTQRLGLGFDEITDGNLLLVDEDLNVLEGDG
MANPANRFHSWIYRARPDVQCIVHTHAFHVAALSMLEVPLVVSHMDTTPL
YDDCAFLADWPGVPVGNEEGEIITAALGDKKAVLLAHHGHVIAGASIEEA
CSLGILIERAAKLQLAAMAAGTVKQLPEELAREAHDWTLSPQRSRANFAY
YARRALARHPDALTS
118465863YP_881443.1 3-methyl-2-oxobutanoate hydroxymethyltransferase [Mycobacterium avium MSEHNVYGAAQPAQPAQPAQPRTRIRTHHLQKMKAEGHKWAMLTAYDYST
ARIFDEAGIPVLLVGDSAANVVYGYDTTVPVSIDELIPLVRGVVRGAPHA
LVVADLPFGSYEAGPAAALAAATRFMKEGGAHAVKLEGGERVAEQIAHLT
AAGIPVMAHIGFTPQSVNSLGGFRVQGRGDAAEQTIADAIAVAEAGAFSV
VMEMVPAGLATQITGKLTIPTIGIGAGPNCDGQVLVWQDMAGMSSGKSAR
FVKRFADIGGELRRAATQYAHEVAAGVFPADEHCF
118465862YP_883904.1 adenylosuccinate synthetase [Mycobacterium avium 104]MPAIVLIGAQWGDEGKGKATDLLGGRVQWVVRYQGGNNAGHTVVLPTGEN
FALHLIPSGVLTPGVTNVIGNGVVVDPGVLLDELKGLEDRGVDTSRLLIS
ADAHLLLPYHVAIDKVTERYMGNKKIGTTGRGIGPCYQDKIARIGIRVAD
VLDREVLTHKIEAALELKNQILVKIYNRKALDPHQVVECLLEQAEGFRHR
IADTRLLLNTALEAGETVLLEGSQGTLLDVDHGTYPYVTSSNPTAGGAAV
GSGIGPTRITAVLGILKAYTTRVGSGPFPTELFDENGEYLSKTGGEFGVT
TGRRRRCGWFDAVVARYATRVNGITDFFLTKLDVLSSLETVPVCVGYRID
GARINEMPMTQSDLHRAEPIYEELPGWWEDISAAREFDDLPAKARDYVLR
LEELAGAHVSCIGVGPGREQTIVRRDILAARP
118465861YP_880281.1 MFS transporter [Mycobacterium avium 104]MTATPRACNRDRVALQAVHFFMADMEAGMGPFLGVLLQSRGWTTGAIGAA
MTLGAIVGMVTVAPAGALVDATRHKRGCVIVVGLAAVAASAVILTSRQFW
TVATAQAVMCISGATIAPAMIGITLGVVGQAAFTRQNGRNQAYNHAGNMA
GAALGGVAGWVFGYAGIFWLAAGFAVATIAAVLAIPGGDIDHHVARGEAR
AAGEAPVKAMRVLARSRPLLVLAAAMVLFHLGNAAMLPLYGLAVVATHAN
PFTTVASTVVVAQAVMVPASLLAMRIAATRGYWPAILIALTALPVRGVLA
ASVITSWGVIPVQVLDGIGAGMLSVAVPGLVARILDGTGHINVGQGAVMA
AQGLGGALSPVLGGAVAQHLGFRAAFLLLAGLSLGALIIWVTFAPMLRRA
ARLPAAPSDRAGAPPTATADNQAK
118465860YP_881008.1 sulfate ABC transporter permease [Mycobacterium avium 104]MTSSPGVRYGLRFVALAYIFVLLVIPVSLILWRTFRPGFGQFYAWVSTPA
AISALNLTLLVVAIVVPLNVFFGIPTALVLARNRFRGKGVLQAIIDLPFA
VSPVIVGVALIVLWGSAGALGFVEKDLGFKIIFGLPGIVLASIFVTLPFV
VREVEPVLHELGTDQEEAAATLGSGWWQTFWRITLPSIRWGLTYGIVLTI
ARSLGEYGAVLMVSSNLPGKSQTLTLLVSDRYNRGAEYGAYALSTLLMGV
AVLVLVFQVVLDARRGRAARQA
118465859YP_881613.1 hypothetical protein MAV_2415 [Mycobacterium avium 104]MAPLAVDPEAMYAAGSAVAAIGDSLAANLTILTAGVSAHTGVDRAGEVFG
LGYQDSAESMLKAAAGVVNACRKCGALIQQGASNYSAAEAASTLGGGSGA
LPAPSAPADLAAPGPPGTWGKGEPPPLLWAVIQALVSEVWPDGDEAGLHA
AASRWHGFAAAMNGVQGTLNASKALFDSQQIPEGEKIDHALAEIGAAAAA
IGQQCDALARTVDEFADRVGHAQQAIRDLLHRIEALGDIGHDIMLIIDGD
AWDEIQKIARDVNAVLQHLGQEARAFEQEIRLLMQAADREIVTCQKYARR
GLITFLGEDVGNPVATALDFGINVQEGVVKGAVGMGLGLVDLSPHWIALD
PEGAGATWGGLVKNAWKESFVNAAVNPQEFAQARLQELKGLVHADDWTRD
RPGLGAGEVAFDAATLIAPGLGEAGAAADGASAAARGAEAEADAAGAAGR
VGGIAGARGALTDIAKSTADLPKNLEGVTKDLPEIKPPTGGAPVGLGPGG
KPIEAPVESAPRPPDGTPGAQRGSPPVATSPASPGPAGDSGAGPHGPSSS
PAPAAPPGGPVGPHDPAPAPAPAASPGGPGGSGGVHDPAPAPAPAPAASG
GPGDPASVPSGGPHEPASVPAEEPREPVSVPAGGVHDPVAEPTGGPHEPA
SVPAAGSRLASVQAAAGDGLPSATPQLFDHTPSQVPVPAGGSSGEAASVG
AHSPSSASSAAPHFESPGGRPSEVPAPNGGAHGPGESGPAGGHPPGEPPH
GGKPSGDGGPPDEDSHRDGTPGNGDDGAAGEIDDGPAGVDGQSTPAKVAG
VDYPLPPSDALRVLEHPGAELQRLADGGVPSSILEGYEPLAGRSVDDFNR
EFTIETSNGERGWDWEAQAPENGFAGNPIESNHIPAGLHFDRIGPNGGGF
LSPEGVPLAERATPPGLAAQYHVFEGTGREIPAGKDWVVQHGPAKEAFGQ
PGGGDQWIVLDRATNRPVPVDELIRRRLLREITPPNDKLAIGYRGS
118465858YP_879390.1 glyoxalase [Mycobacterium avium 104]MVEPSTGAWPAQLPAVQVRFARPTAQLDRIVEFYRDVLHLPQLHSAGDDE
WSVVMFGLPGDQYHLEFVARRDGIDGAAPTRENLLVFYFESAAQQQSVAA
RCREAGAEEVVLDNPWWRRNGADAFLDPDGWTIVLMPRPVPLPAPTA
118465857YP_881556.1 dihydroorotate dehydrogenase 2 [Mycobacterium avium 104]MARQLFFLVPAERIHTLVFALLRGVTAVGWPRRLLRRLLAPTDPVLASTV
FGVRFPGPLGLAAGFDKDGLGLHAWGALGFGYAEIGTVTAGPQPGNPAPR
LFRLPADRALLNRMSFNNLGAGALAVRLARRQPDIPIGVNIGKTKATPPD
QAVDDYRASARLLGPLASYLVVNVSSPNTPGLRDLQAVGSLRPILSAVLA
ETSTPVLVKIAPDVSDSDVDDIADLAVELGLAGIVATNTTVSRDGLRTAG
VDELGAGGISGPPVARRAVEVLRRLYGRVGDRLVLIGVGGIETADDAWER
ITAGASLLQGYTGFVYGGGLWAKQIHDGIAQRLRDGGFASLRDAVGSAAR
ESG
118465856YP_880763.1 F0F1 ATP synthase subunit delta [Mycobacterium avium 104]MSTFIGQLVGFAAIVFLVVRYVVPPVRRLMAARQEAVRQQLQDAAAAADR
LTESTTAHSKAVEAAKAESKRVVDEAQADAKRITEQLAAQAGLEAERIKS
QGSRQVDLLRTQLTRQLRLELGHEAVRQAGELVRNYVADPAQQSATVDRF
LDDLDAMAPAAADVQYPLMTKMRSSSRVALVNLTERFTTVAKDLDNKALS
ALSSELVSVAQMLDREIVVTRYLTVPAEDAGPRVRLIERLLSGKVGDVTL
EVLRAAVSERWSANSDLIDALEHLSRQALLEVAERENKVDEVEEQLFRFS
RILDVQPRLAILLGDYAVPVEGRVGLLRKVLDSASITVNPIVAALLTQTV
ELLRGRPAEEAVQFLAEVAVARRGEVVAQVSAAADLSGAQRSRLTEVLSR
IYGHPVSVQLQIDTELLGGLLIAVADEVIDGTLASRLAAAEAQLPD
118465855YP_883493.1 hypothetical protein MAV_4358 [Mycobacterium avium 104]MTVPESLDEFARTDLLLDALAQRRPVPRGQVEDPDDPDFQMLTTLLEDWR
DNLRWPPASALVTPEEAVNALRAGLAERRRGHRGLAVVGSVAATLMLLSG
FGAMVVEARPGSTLYGLHAMFFDQPRVNEKDQVMLAAKADLAKVAESIDK
GQWDQARTQLTEVSSLVASIDDPATKQDLMTQLNLLNAKVDTRNPNATLP
AAAPSMAPSVAVPAAPPPAASIAPTPAAPPAPLSPAPVSTPSPSPSVGKH
HHHGQPPAVAPVNPNQ
118465854YP_880930.1 hypothetical protein MAV_1701 [Mycobacterium avium 104]MDQVSFYDAVGGAETFQAIVSRFYAQVPEDEILRELYPLDDLEGAEERLR
MFLEQYWGGPRTYSDRRGHPRLRMRHVPFRITPLARDAWLRCMHTAVASI
DSKTLDDEHRRELLDYLEMAAHSLVNSPL
118465853YP_883082.1 ribonucleotide reductase stimulatory protein [Mycobacterium avium 104]MDSTGRNLVYFSSVSENTHRFVQKLGIPAIRIPLHGRIEVDHPYVLLLPT
YGGGRATPDLNAGGYVPKQVIAFLNNEHNRSLIRGVIAAGNNNFGAEFAY
AGNVVSRKCGVPYLYRFELMGTQDDVDAVRAGLAEFWKEQTCHQPSLQSL
118465852YP_881377.1 acyl-CoA dehydrogenase domain-containing protein [Mycobacterium avium MVEHHPLHGITDEFVARLGERAEEAERLRRLPAATVDEFRQTELFRLLLP
ARFGGLEASFPELLQPIRRMAQGCASSAWTLGFYALHNWMLSLFDPQAQR
EVFASGPVLAPAPLAPTGRATPADGGVRLTGRWSWATGAMDADWLIVGAL
IERTDRIDPALVVVPAGQVEVVDTWHTAGMRGTGSHDVVIADVFVPEHRL
VAVADIYGGTAPGAREHAAATYRWPMVPALALTAAMPVLGAAERVVQLFA
DRLGERVLAYSAVAQKDQPAAQIRLGEARVRLDALRALVAQTADRIEAIV
AGGDRVSRSVRAEARLAAARTVHESRAIIADVTEASGASAHFLSSPMQRA
KRDVDIAAGHVVFDYDTSRELAGALAIGAKISPISMI
118465851YP_883292.1 hypothetical protein MAV_4144 [Mycobacterium avium 104]MTSAPLTVYTTSWCGYCHRLMTVLKSNGIPYEAVDIEHDPAAAEFVSSVN
GGNKTVPTVKFADGSTLTNPSAAQVKAKLAEVGN
118465850YP_883562.1 methyltransferase- UbiE/COQ5 family protein [Mycobacterium avium 104]MRFRNVLFPYVYRFGQPVFDRLFYQRYRRQAMSHATGRLLMVGLGPGTDL
MFLPAAVTSVAAVEPEASFRRMAARLAARQGVAVDVVAGSGESIPFPDNS
FDSVHIGLVLCSVRDVGATLAEIRRVLVPGGRLVVLEHVRGDGLTGRLQD
LIARPWSWLAGGCEPNRRTGAAIAAAGFDTSMLRSVPRTPVPFPCKPHLQ
GFAVLSSR
118465849YP_881317.1 hypothetical protein MAV_2105 [Mycobacterium avium 104]MPHRQPLYLLADSQLLFWKRHDRPLVQAALDGLARDKPLSAAYIGASNGD
RPEFYDIFEAAMEATGVTERRMIASSFGPADRAFLDGAHLIVLAGGDVQR
GWNTFERTGMKDAILDRYAKGAVLVGISAGAVQLGRYGIIGTPPEHRLLD
VFNLVPAVIDTHDERTGWARLSRAIQSLKGAALGVGIPSGGGAVVHADGT
LEPVRRPAHEFRVVNAHLAHKLLPVGTGD
118465848YP_881404.1 hypothetical protein MAV_2195 [Mycobacterium avium 104]MNDNPFAGPFAKHPRSPLETLDTVPESVLRRLKQYSGRLATEAVSVMQDR
LPFFADLEASQRASVSLVVQTAVVNFAEWMQDPKSNVRHTAQAFELVPQD
LARRIALRHSVEMVRVTMEFFEEVVPLLARSEEQLTALTVGVLKYSRDLA
FTAATAYADAAEARGTWDSRMEASVVDAVVRGDTGPELLSRAAALNWDTT
APATVVVGTPAPGRDGSTGPGDSERASQHVRDIAAQHGRAALTDVHGTWL
VAIVSGQLSPTDKFLGDLLEAFSDGPVVVGPTAPMLTAAYHSASEAISGM
NAVGGWRGAPRPVLARELLPERALMGDASAIVALHTDVMGPLADAGPTLI
ETLDAFLDSGGAIEACARKLFVHPNTVRYRLKRITDFTGRDPMQPRDAYV
LRVAATVGQLNYPTHPPSAAGAAMPAVPLPVNGAARGQSGG
118465847YP_882898.1 hypothetical protein MAV_3723 [Mycobacterium avium 104]MATSASGLLLVAVIALSGCTPRPDGPGPAAEKFFRALAVGDTATAAQLSD
NPNEAREALNAAWSGLQASHLDAQILNAKYAEDTGTVGYRFTWHLPKNRT
WTYDGQLKMARDEGRWEVRWTTTALHAKLGEHQTFALRADRPRRASVNEL
GGSDVLVPGYLYHYTLDATQAGNGAALFGTAHAVVDVLRPFNGALADPQL
LAEQASSSTQPVDLVTLHPDDNDKVFPAIGRLPGIVVTPQPEMLPTDPHF
APAVVAAVKKAVIDQLDGQAGWRVVSVNQNGVEVEVLHEVEGSPAPSVSL
TIDRAVQNAAQHAVDTRGGKAMIVVIKPSTGEILAIAQNGGADADGLPAT
NGLFPPGSTFKMITAGAAVDRDMATPNTMLGCPGHLDIGHRTIPNYGGFD
LGVVPMSRAFASSCNTTFAELSSKMPPRGLTQAATRYGIGLDYQIDGITT
VTGSVPPTVDLAERTEDGFGQGKVLASPFGMALVAATVAAGKTPVPQLIV
GRQTAVQGDTTPISPKMVDALRPMMRLVVTNGTAKEIAGCGAVYGKTGEA
EFPGGSHSWFAGYRGDLAFAALIVGGGSSEYAVRMTKVMFESLPPDFLA
118465846YP_881434.1 transposase- Mutator family protein [Mycobacterium avium 104]MLTVVHDQDSSNEDACGSRSLLDEIVRDGARQMLAAALAAEVAAYIDAHA
GEVDENGHRLVVRNGYHREREVLTAAGAVTVIAPRVNDKRIDADTAERRR
FSSAILPAWARKSPQMTEVLPLLYLHGLSTSDFGPALEQFLGSGAGLSAT
TITRLTAQWQDEAKAFGERDLSGTDYVYLWVDGIHLKVRLEQEKLCLLVM
IGVRSDGRKELVGLADGYRESTESWADLLRSCRRRGMTAPVLAVGDGALG
FWKAMREVFPATREQRCWFHKQANVLSCLPKSAHPGALAAMREIYNAEDI
DHAQVAIKAFEVDYGAKYPKAVAKIVDDADVLLEFYRYPAEHWIHLRTTN
PIESTFATVRLRTKVTKGPGSRAAGIAMAYKLIDAAQARWRAVNAPHLVA
LVRAGAVFHKGKLLERPVDITPPEPAESAETEVA
118465845YP_880646.1 cytochrome P450 130 [Mycobacterium avium 104]MSHNVPVAFELPNADTWADPWPMYRALRDHDPVHHVVPPKRPEHDYYVLS
RHADVWAAARDHETFSSAKGLTVNYDDLELIGLQDNPPFVMQDPPVHTEF
RKLVSRGFTPRQVEAVEPKVRDFVVERIERLRAAGGGDIVAELFKPLPSM
VVAHYLGVPEEDRAQFDGWTEAIVAANTADGGVAGALGSAGDAVTSMMAY
FTGLIERRRTDPEDDTISHLVSAGVGADGDIAGTLSVLAFTFTMVTGGND
TTTGMLGGSMPLLHQRPDQRQRLVDEPELIPDAVEELLRLTSPVQGLART
TTRDVTIGRTTIPAGRRVLLLYGSANRDERQYGPDAGELDVARCPRNILT
FSHGAHHCLGAAAARMQSRVALTELLARCPDFEVDESGIVWAGGNYVRRP
LSVPIRVKS
118465844YP_884259.1 alanine dehydrogenase/pyridine nucleotide transhydrogenase [MycobacterMTNAQANAVKVGVVAESGADERRVALVPKAVASLVGSGLAVVVESGAGER
ALLPDALYTEAGADIGDAWAADIVVKVAPPTADEVAKLHSGQTLIGFLAP
RNADNSIGALKQAGVQAFALEAIPRISRAQAMDALSSQGNVAGYKAVLLA
ASESTRFFPMLTTAAGTVKPASVLVLGVGVAGLQALATAKRLGARTSGYD
VRPEVADQVRSVGAQWLDLGIDAAGEGGYARELTEEERAQQQKALEEAIA
GFDVVITTALVPGRPAPRLVTAAAVESMKPGSVVVDLAGETGGNCELTEP
GKTVVKHDVTIAAPLNLPATMPEHASELYSKNITALLDLLIKDGKLAPDF
DDEVVAAACVTRESA
118465843YP_879866.1 acyl-CoA dehydrogenase [Mycobacterium avium 104]MVATVTDEQFAARALVRDWARNASTGPGGTAAIRDVEQGNPDAWRPVFAR
LAELGIFGVAVPEEAGGAGGSVEDLCAMVEEAAKALIPGPVATTALATLV
LSDAELLAALAAGERFAGLALQGDITFDGAASTASGTLPFVLGAADGGVL
LLPADGRWLVVDTASDGVHIEPLAATDFSRPLARVVLDSAPATVLAQTPE
RVEELAATVLAAEAAGITRWSLQTAVDYAKVREQFGKPIGSFQAIKHLCA
EMLCRAEQAEVAAADAARAAAEDDPAQFSLAAALAAATAITAVKANVKDC
IQVLGGIGCTWEHDAHLYLRRAHAIGRFLGGAERWLRRITALTQAGVRRR
LGIDLTEVEDQRPQIAEAVARIAALPAEQRQAALAEAGLQAPHWPAPYGR
GASPAEQLLIDQELAAAGVARPDLVIGWWAAPTILEHGTPEQIERFVPGT
LRGEFLWCQLFSEPGAGSDLASLRTKAVRTDGGWLLTGQKVWTSAAHKAR
WGVCLARTDPDAPKHKGITYFLVDMSAPGIEIRPLREITGDSLFNEVFLD
NVFVPDEMVVGEVNDGWRLARTTLANERVAMASGTALGNPMEELLELLST
LPLDSAQQDRLGRLIVTAQTGALLDQRIAQLAVGGQDPGAQSSVRKLIGV
RYRQALAEYTMDVSEGGGLVHNRAVYDFLNTRCLTIAGGTEQILLTVAAE
RLLGLPR
118465842YP_879440.1 acyl-CoA dehydrogenase [Mycobacterium avium 104]MTFSLQLSDDVIEVRDWVHQFAADVVRPAAAEWDEREETPWPVIQEAAKV
GLYSPDLFAQQAAEPTGLGMLTVFEELFWGDAGIALSIMGTGLAAAALAG
NGTPEQLGRWLPEMFGTADEPKLGAFCSSEPDAGSDVGAIRTRARYDEAT
GEWVLNGTKTWATNGGIANVHIVVASVYPELGARGQATFVVPAGVKGLAQ
GQKFKKHGIRASHTAEVVLDDVRLPADHILGGREKFEERIARVKSGASAR
GQAALKTFERTRPTVGAMAVGVARAAYEYALEYACQREQFGRKIGEFQAV
AFKLADMKCRIDAARMLVWRAGWMARNNQAFDAAEGSMAKLVASETAVYV
TDEAIQILGGNGYTRDYPVERMHRDAKIFTIFEGTSEIQRLVISRALTGL
PIR
118465841YP_879963.1 hypothetical protein MAV_0684 [Mycobacterium avium 104]MYVRGWQRLNGSIEREIVVHELHADHGLTIQHARQVARALIAAADEAEAA
AALDGGAR
118465840YP_883589.1 50S ribosomal protein L24 [Mycobacterium avium 104]MKVRKGDTVLVIAGKDKGAKGKVLKAYPDRERVLVEGVNRIKKHTAISTN
QRGAQSGGIVTQEAPIHVSNVMVVDSDGKPARVGYRLDEETGKRVRISKR
NGKDI
118465839YP_880883.1 hypothetical protein MAV_1649 [Mycobacterium avium 104]MTSAAAPVVRSGAADFIGCTKSVIRIGPSFRVLIGYW
118465838YP_879723.1 restriction endonuclease [Mycobacterium avium 104]MDKALGALLLLGLGVPWYFTQHTTGSLPAGCAAGLAGLAAAVGALWWLSL
QRDRLRADAHRRRDVKHARAGLRAIDRMSGAEFEDFVAAQLRVAGYVVTP
TAGTGDFGVDLIAKKDGVRMAVQCKRLAKAVGVAAVQQVVAGARQHGCDR
TVVVTNQTFTKAARRLAITHRCRLVGRTQLRSWTRVAPIPVRGPRVS
118465837YP_883137.1 HpcH/HpaI aldolase/citrate lyase- putative [Mycobacterium avium 104]MYEQVNSSAAEPDDIGSRIDPVLARSWLLVNGTHPDRFQSAVDSRADIVV
FDIEDAVAPKDKNAARDNVVSWLRAGNVDWVRINGFGTPWWADDLTALAG
TPVGGVMLAMVESVDHVTETAKRLPDVPIVALVETARGLERITEIAATKG
TFRLAFGIGDFRRDTGFGEDPATLAYTRSRFTIASKAADLPSAIDGPTIG
SNPLKLIEATAVSTQFGMTGKICLTPDQCSVVNEGLSPSQDEIAWAKEFF
AEFERDGGEIRNGSDLPRIARATKILELARAYGIEALDIDEEERDHSPAP
SDTYHY
118465836YP_881270.1 hypothetical protein MAV_2053 [Mycobacterium avium 104]MTILSEPDRALAPVATRRRCVVRPATALNRMTRYRGGTYSHTVDRVVFAD
GSWARTDLIRLNPNVHAYSLDFAGIAPAHPSRYRVDTWSALPHLRTSGHE
PKVDWILRNSFPLRSTAELSRQVREAGYPLGPANITEHEAIAATQAAIWF
FTNGLALDTRPLNVPIAVHRAPGPVLTFEFDGQPQLGGYSVWSSSAGDAT
LKLQKSTNGVVWQDVSGSHLRLGPGQRRYQRTLGEGSTLSSSSHGRGGRG
YRYYRLVATSETATPTIEHVNFRLTGARHYRNADKVVHLYNYLLAQAGRA
VHHADDALLLDDRQATADAGLIGPFRVRIPLLLSADDGHQLVDADGFAVG
QVVEPGTDFYIREAPGGSGITLTAKTVGDLHGRVLTGVALDEASQRFTPV
ALAIPTEMAIEFDISWQADEAWSYIVGDKR
118465835YP_884413.1 N-acetylmuramoyl-L-alanine amidase [Mycobacterium avium 104]MSSPRREYGDALRCGDRSAAVTEIRATLASLGLLASADEDLSTGRHVALE
LFDAELDQAVRAFQQHRGLLVDGIVGEATYRALKEASYRLGARTLYHQFG
APLYGDDVATLQARLQDLGFYTGLVDGYFGLQTHNALMSYQREYGLSADG
ICGPETLRSLYFLSSRVTGGSPHALREEELVRRSGPKLSGKRIIIDPGRG
GADHGMIMQGPSGPISEADVLWDLASRLEGRMTAIGMETFLSRPVNRSPL
DAERAATANNVGADLMISLRCEAQKSPAANGVASFHFGNSHGSVSTIGRN
LADFIQREVVARTGLRDCRTHGRTWDLLRLTRMPTVQVDVGYVTNPHDRA
MLVSTQTRDAIAEGILAAVKRLYLLGKNDRPTGTFTFAELLAHELSVERT
SQMGGS
118465834YP_883330.1 transcriptional regulator [Mycobacterium avium 104]MTLLQGPLADRDAWSAVGECAIEKTMAVVGTKSAMLIMREAYYGTTRFDD
FARRVGITKAATSARLAELVELGLLKRRPYREPGQRSRDEYVLTQAGIDF
MPVVWAMFEWGRRHLPGRHRLQLTHLGCGAEVGVEIRCAEGHLVPPDELG
MRLAKKSG
118465833YP_884405.1 tRNA adenylyltransferase [Mycobacterium avium 104]MPDAAQDAELLTAAAVALNKHAPMLRELGSAFDAAGHQLYLVGGSVRDAL
LGRLSPDLDFTTDARPDQVQQILRRWADNLWDTGIEFGTVGVGKGDRRLE
ITTFRADTYDQVSRNPQVRFGNRLEDDLVRRDFTTNAMAVRITPDGPGEF
LDPLGGLAALRQRVLDTPATPEESFGDDPLRMLRAARFVSQLGFTVAPRV
REAIERMAPQLARISAERVAAELDKLVLGDDPVAGIDLLVHSGMGEVVLP
EIGGMQMAIDEHHQHKDVYQHSLTVLRQAIALEDDGPDLVLRWAALLHDI
GKPATRRHEPNGGVSFHHHEVVGAKMVRKRLRALKYSKQMVDDVSQLVYL
HLRFHGYGDGKWTDSAVRRYVTDAGPLLPRLHKLVRADCTTRNKRRAARL
QASYDRLEARIAELAAQEDLARVRPDLDGNQIMEILGIPAGPQVGEAWRF
LKELRLERGPLDPDEATAELLSWWRSRGNG
118465832YP_883121.1 NAD-dependent epimerase/dehydratase:short chain dehydrogenase/reductasMRVAVVTGGASGMGEATCHELGRRGMKIAVLDVDEHAAQRVTDDLRTGGA
TALGVGADVTDRAAVEQAFAKVRSELGPVTVLVTSAGMFGFSPFLDITAE
SWSRIIDVNLTGTFHCCQVALPDMVAANWGRIVMISSSSAQRGSPFAAHY
AASKGAVITLTKSLAREYAPHGITVNNIPPSGIETPMQHQGQAAGYLPSN
EQIAANIPLGYLGTGADIAAAVGFLTSDEARYITGQVLGVNGGAVMLTVR
IR
118465831YP_881648.1 MorD protein [Mycobacterium avium 104]MTERSEYSDGRAMALERSCAVTAVALSEQRREGVRLVTGERRGFGLNAAL
TFVHVPYPAPSDWTRRTLTCGVALQCSPSKERVTEFRLNELSARELRALT
LVEGAVALGWIASRWPGLLPEVQRLLPDVHPQAAGMDGAQMLDRAIGLAA
TGLELTVPPLLGALPLAYTAPQGLTDRLRRSFGRMPWTTTQKRRPRPYSV
PVGGDGGVRNPNLPPPSRPQDNDLDVTPQHRPGIPYPEWNMWTQRFMRDH
VAVVEHADGRRLRRPVPVAVDVRKWFEEHTHRAMTGRLEDGSDLDVDQYV
SHYIDLTTGEAKEPRVFRDLLPSGRDVTTALLLDGSSSLGVHGGRVFQLE
LACADALSRAMTLARERHGVFVFTGNTRHRVEVRCLKDFEDRRFVPPSTL
GLSTRGYTRLGAPLRHLTSRLLAEPSERRLLIVIGDGLISDEGYEGRYAW
ADAAHAVAEANDAGVSMYYVGVGPTRVDPLPEVFGPRRSQRIRRIEELPR
VLAHVHRELVAA
118465830YP_881222.1 hypothetical protein MAV_2003 [Mycobacterium avium 104]MARLALLDQAAFLRLRATGQGSTVQCAWIYDRDVNIAELRAFNDNLRFGL
LGRRIERSPLPFGRHRWVLDRRPPDIAWEPRQPRCEIGAWLERRARVAVD
PEHGPTFHLGVLPLDDGGAAVTLVASHCVVDGLGLVTAVAEAVKGERRDL
GYPQPNSRSRWRAVREDLADAVAALPSATRALIATLLLLLRVSPDRRVQP
RAQRRGDFVPRDDASNTSGSVTIHTDAAAWEARARALNGSGNSLFVAFAA
RLAHRMGRVLADGKSVTVVLPVSDRAPDDDRANALTSITLTVDGAAVADD
LTDVRADVKRSLASLQHRPNEMLAGLPLIPFIPRWLVRRGESLAMASSQL
PVGCSNVGSLDGAVGRIDGADATEVSMRLVVLTTDVRYGVVW
118465829YP_884051.1 formate dehydrogenase [Mycobacterium avium 104]MMVLYPDPVDGYPPKYARDSIPVINSYPDGSSLPTPSKIDFTPGELLGCV
SGALGLRKFFEDGGHELVVTSDKDGPDSEFERELPDADIVISQPFWPAYI
TKERFAKARNLKLALTAGIGSDHVDLTEAQARGVTVAEETWSNSISVAEH
TVMQILALVRNFVPSHQWIRDGGWNIADCVQRSYDVEGMDVGVIAAGRIG
RAVLERMKPFGVNLHYFDVHRLSPEYEKQLGVTYHPDVESLARSVDVVSI
HSPLIAQTHHMFNEKLLKSMRRGSYIVNTARAEETDHKAIVAALESGQLA
GYAGDVWFPQPPPPHHPWRTMPNHAMTPHISGSSLSAQARYCAGTREILE
DWFAGRPIRSEYLIVEGGKFAGTGAKSYAQ
118465828YP_879485.1 hypothetical protein MAV_0191 [Mycobacterium avium 104]MRMDPQRFDELVSDALDLIPPELAAAMDNVVVLVDDRHPEEPDLLGLYEG
VALTERDSDYSGALPDAITIYRAALLDVCESEQQVIEEVAVTVIHEIAHH
FGIDDERLHQLGWA
118465827YP_883655.1 50S ribosomal protein L11 [Mycobacterium avium 104]MAPKKKVVGLIKLQIQAGQANPAPPVGPALGQHGVNIMEFCKAYNAATEN
QRGQVIPVEITVYEDRSFTFALKTPPAAKLLLKAAGVGKGSAEPHKNKVA
KVSWDQVKEIAETKKADLNANDIDAAAKIIAGTARSMGITVE
118465826YP_879393.1 hypothetical protein MAV_0095 [Mycobacterium avium 104]MPLTTASAVTFFYALGYPIGTLAVVAMTPMAALVLRFGLAAMVLAVWTAI
AKAGWPRGARLGHVIVAGLLIQGVQFCCLYEAVQLGAPAVLCAVMIAMNP
VATAILAATFLREPLGVQRTVALVLGVLAVLAACSQRLMSTHGVDPVIVL
LFVALLGLSAGGVYQQRFCGGVDFRAMSALQNGVALLPAAGLAMLTPFGV
HDGRKALVAVAAMVLLNATLAVSLYVRAINAHGAAAVAMLFAVIPAVAAV
LSWIILGQRPDQGVAAGLVLGGLACWVNTRAASRPRTQRDGVPAAAPAEL
QSVSR
118465825YP_883954.1 hypothetical protein MAV_4829 [Mycobacterium avium 104]MASTRLSKGFGDGQPVAASRYHTRSRFLPAGVAPERGLQVRTILTARSIS
AEFPQIHEIGGVRPDPLPWHPLGMAIDVMIPDPESAQGIALGNAIVAYVL
QNADRFGIQDAIWRGVYYTPNGAQTSRLGHYDHVHVTTIGGGYPTGDEVY
LR
118465824YP_881897.1 alpha/beta hydrolase [Mycobacterium avium 104]MATHDGAQLHVRSYGSAFGQPIVLIHGFGCRIEYWNPQINALAAKYRVIA
YDQRGLGRSTLGSDGVRPDVLGRDLAAVLDAVLAPGERAVLVGHSFGGIT
IMAWAQRFAAHAVSAVLLANTIAERFSATTMLLPFADRYRHIRRPLITAL
AGSTMTLPSIRWSRWPLQRMALSRYADRQAVDFVYEILADCRTDVRAVWG
AGLSGLDVTAGLEKLTVPTTVVTGTEDRLTPPAVAHRIAEALQVRGSLHR
FARFPRAGHCTNIEVPYAFNAEIEQLADATR
118465823YP_880867.1 NAD dependent epimerase/dehydratase [Mycobacterium avium 104]MRTALVTGGSGGIGKGCARKLVERGYDVLLCARREAPLRAAAEEIGARYM
VADASDPIGFPAALSTLETVDLVVHAAGALGGTYARKQTFEQWRAIISAN
LDSCFVVTSAVLPKMKAGSRLVFISSSAAHEPMPARTAYSASKAGMNAFA
RALALEVDRDGISVHLVTPGPVATEMLQDVPFEMYAIAVSDVAEAVVFLD
TVDPSVDLPEIRLSAVQRGPFARPPVVPTEARRRAQRG
118465822YP_879377.1 hypothetical protein MAV_0078 [Mycobacterium avium 104]MSVGQGADILAVSHPLARRRDDVRRCWLVGEGGAVHEAVHGVCISVDTCV
ERGVENLWINAKGKDIGADTGHTTPRNPCGQESLRRVGPGYRPGRVGFPP
YFRCVTAR
118465821YP_879979.1 HIT domain-containing protein [Mycobacterium avium 104]MASIFTKIINRELPGRFVYEDDDVVAFLTIEPMTQGHTLVVPREEIDNWQ
DVGSAAFNRVMGVSQLIGKAVCKAFRTERSGLIIAGLEVPHLHVHVFPTR
SLSDFGFANVDRNPSPESLDEAQAKIKAALAQLA
118465820YP_881069.1 acyltransferase- ws/dgat/mgat subfamily protein [Mycobacterium avium 1MKRLGGWDAVLLYNETPNLHQHTLKIAVVDATDCDGFGFDLFRQTLARRL
HLLEPLRYQLTEIRGRIHRAMWLENCDVDLDFHVRRTQIRSPGGRRELDA
AIGEVASTPLDRSRPLWEFHFVEGMADNRFAIIGKVHHALADGVASANLL
ARGLDLPNAPQPARDDYRADPYPSNGVLIRAALRDHAEHVRELPRLVRDT
VKGVRRVRRKSRSAPGLARNFNPPATFLNHVVSPGRTFASTTLDLAAVKA
VGKQLGVTINDMVLAITAGALRALLLEYDGHADQPILAGVPMSIDTSLER
ISGNALGTVVVSLPVHVADPLEWVRLARIGATIGKENTALLGPDLVSRWA
GYAPPRLTERLFRRIATSGSGNKLINVPVSNVPGPRQPGRIACAPVVQFL
SVGPLTFGAGVNITVWSYVDQLNISVLADDVTFEDPHQVTDTMVEAFDLV
RQAAGMPAETRP
118465819YP_883925.1 hypothetical protein MAV_4799 [Mycobacterium avium 104]MSAVLARSDFLRAPVLATARPAGFKEWHHFVVHGRGVRLLINFSFNNEAF
GADGARLTPRVIVIARDERWTGAVARFDERAVHVSADLGELSVGGNRMTI
VPDGYRVAIDLPDKDIHGELHFTSTSRPFVVRNEPAGEGRVSWLFVPRLR
ADGWLRIGGADHRVRDDLAYHDHNWGRFRWGDDFGWTWGTILPAGPDDPW
SMVFAQITDRSRLRCVSRSLYVWHRDEPAAIFRHAAVRARTEGPLDRPAD
CTLPPPMRLLLDGEVPGVPERIEITATRAADTVRAEFRSRSYVRLAQPSE
TRLDRSTVLCETDGTVAARGTVRGEKFDFAGTGVFEFLHG
118465818YP_883317.1 RNA polymerase sigma factor RpoE [Mycobacterium avium 104]MVSTATSLLGEEQLAGFLASPGALSVLSGDTAAEGTGFIEMADSPDGPDG
VTSPEVPEAHAEPAAHEETREETDAELTARFERDAIPLLDQLYGGALRMT
RNPADAEDLLQETMVKAYAGFRSFRAGTNLKAWLYRILTNTYINSYRKKQ
RQPAEYPTEEITDWQLASNAEHSSTGLRSAEVEALESLPDSEIKDALQAL
PEEFRMAVYYADVEGFPYKEIAEIMDTPIGTVMSRLHRGRRQLRGLLADV
AKERGFNRGQQTHEEVSS
118465817YP_882000.1 hypothetical protein MAV_2813 [Mycobacterium avium 104]MASDDAWTIGPADGELLLHTGVTGRAARMGHRLTIAMTRWRGGVGWAGSR
PVRAELAVEVDSVEVLRGEGGVKGLSTAEKALVRSNALKSLNASRFPEIR
YTSDVIEHTGDGYRLTGTLQIRGTARNRVIDLRTEDLGEAWRLSVETTVR
QSDYGIKPFSLLMGSVQVADDVSLSFTAVHAKDRAEDR
118465816YP_879326.1 hypothetical protein MAV_0026 [Mycobacterium avium 104]MVDGKTAHLQAEVDRIAARLNVPPIKVGVVLKNDDRNIYIDDDGRYHYDY
WERGRQRFDRVGDIDEALYGFATDAAFDIGYSYSARFSPPDQDRRILLWA
KQYELLNQLNPGWAKRCVRERADQLRGWGLHEAVELLPDIPERDG
118465815YP_883907.1 hypothetical protein MAV_4780 [Mycobacterium avium 104]MTQQDRAAAVLQFGRRRGYRPLRGMPTHRVAGDTDVDAAIGPYRRLIVLG
GDAELALVLTRLLRAERLDVEVAFVPRRRTRATRNYRLPTGFRAARRAAR
GAARRVPLIRDETGSAIVGRACWAAPGGQGWLHGEAVVDDTTLFDGDVTA
VWIEPTAAMPGLRAAVAGRPWRRWVTGRAAQLGSTGATVLRDGVPADRPA
RRSAFYRNIEGWLLVR
118465814YP_882195.1 hypothetical protein MAV_3009 [Mycobacterium avium 104]MPTVEMRLREDLRNYAVELRQLAYTLPLGVGEHDLLQLSDRMRAAADQLV
RKGA
118465813YP_879801.1 DNA polymerase III subunit delta' [Mycobacterium avium 104]MKAELLGAARAARGDAGHSDAGAGTMTHAWLITGPPGSGRSVAALCFAAA
LQCTADGEPGCGRCHACTTTLAGTHADVRRVVPEGLSIGVDGMRAIVQIA
ARRPATGNWQIVVIEDADRLTEGAANALLKVVEEPPPSTVFLLCAPSVDP
EDVAITLRSRCRHVALVTPSTEAIARVLVDSDGLTPETADWAASVSGGHV
GRARRLATDPEARQRRERALGLVRDAATPSRAYAAAEELVAAAEAEAVVL
TAERAEAETEELRTALGAGGTGKGTAGAMRGAAGAIKDLERRQKSRQTRA
SRDALDRALIDLATYFRDALMASSGAGAVRANHPDMAERVAALAAHAPPE
RLLRCIEAVLECREALAVNVKPKFAVDAMVATIGQQLG
118465812YP_880304.1 phosphate ABC transporter permease [Mycobacterium avium 104]MTRAVDALDRPVKTEVFRPLSVRRRITNNAATIFFLGSFVVALVPLIWVL
SVVLERGWYAVTRSGWWTHSLHGVLPEQFAGGVYHALYGTVVQAGVAAAM
AVPLGLMTAVFLVEYGSGRLVRLTTFMVDVLAGVPSIVAALFIFSLWIAT
LGFQQSSFAVSLALVLLMLPVVVRSAEEMLRLVPDDLREASYALGVPQWK
TIVHIVFPIAMPGIVSGILLSIARVIGETAPVLVLVGYSRSINLDIFHGN
MASLPLLIYTELTNPEHAGFLRIWGAALTLIIIVAVINVVAAATRFLAGR
RR
118465811YP_883086.1 DNA polymerase IV [Mycobacterium avium 104]MLHVDLDQFLASVELRRRPELAGLPVIVGGNGDPNEPRKVVTCASYEARE
FGVRAGMPLRAAARRCPPDSGVTFLPSDPAAYDAASDQVMGLLRDLGHPV
EVWGWDEAYLAVTATDPIEVAEQIRGVISSETGLSCSVGISDNKQRAKIA
TGFAKPDGVFVLTDANWMALMADRPVDALWGVGPKTAKKLADLQITTVWQ
LAHSDAELLTATFGPRTGLWLLLLAKGGGDDHVSAQPWVPRSRSHVVTFP
RDLTDRAEMETAVTDLADQAVAEVLAAGRVVTRVAVTVRTATFYTRTKIR
KLDAPSTDRDVIVAAALRVLDLFELDRPVRLLGVRLELVMPD
118465810YP_881863.1 acyl-CoA synthase [Mycobacterium avium 104]MRRDVERYPPDQSGSITRMTWLERICAVHERSERVAVIGEVGSVSGRELI
SKAVAAADLLCDLNVPAGQPIPALLTTNACALALLLGGAAANRPLALLGP
RQTPTELAAMVRRSGSPVLLVEAEFAGAARQVADAVGIRAVTIPFLPVSD
RSLHPEPGPTAIYLHTAGTTGFPKAVPLTERVLDARATLLRRLIEIDPDD
RYATGSPLHHIGGLGNVLVALTAGAAVICTNRFSFDWWHSLKQLGATHCL
LVPTMIEMLLGKGLLDAVPLKTLIYGASPITVDTLRRVLDVLPDVAMVSL
YGQTEGSPITSLGPADHRLAAVKDRDILSTVGRPVDGLRLQIDEPDPAGI
GEVFAAAAHLSGQAADGWLRTGDLGVVDADGYLRLCGRRHDMVVRGGENV
YPLEVENVLSAHPGVAAVGVVGVPETRLGETLAAFIVPTDLVHPPRPEEL
GSFARVKLAGFKIPQYWYSVTELPLNSAGKVVRATLRAAHLERQHGAST
118465809YP_879581.1 integrase [Mycobacterium avium 104]MILPAVTAGAELPDLPVDVVERIRIATIDSQSEGTRRAYSSAWRRFEGWC
RRNGYESLPAHPTVIAAYLVDAAETVTENGERAYSTVSLGKWCAAIFDRH
RRAGVEPNPAAHELVRQTASGIRRQYAARGDRPRQPRTPLLTDDVMLLVS
TAREQATGWASQVCERRDSALLLMGFAGAFRRSELSGLTGGDVELHAADG
IHVHLRKSKTDQLGEGGTYPLPRTKDALRCPACAYVRWAAVVSAHEDGGN
GAVIRLLTDSPEFGSRHTCRSRAPKIDRRAPLFRSCRNGVLSEGPLSGAG
IHAVIRRRALRAGFDREAVERLGGHSLRAGFVTQAARAGADHHAIMRQTG
HRTPAMVTRYVRESAPLIGNAVTVLGL
118465808YP_882868.1 DHH family protein [Mycobacterium avium 104]MDAHGAVELLSRAGTVAVIAHVHPDADTIGAGLALGLVLDKCGKRVEVSF
AEPAGLPESLASLPGCRLLVRPDEIRRDADLVVTVDVPSVKRLGVLSELA
VTGREVLVIDHHASNDVFGTANFIDVAADSTTMMIADILDAWGKPIDPDV
AHCIYAGLTTDTGSFRWASARALRLAARLVDIGVDNAAISRALMDTHPFG
WLPLLSRVLASAQLLPDAVGGRGLVYAVVGNQDWISSRPEEVESIVDIVR
TTQQAEVAAVFKEIAPGQWSVSMRAKAQVDLAAVASGFGGGGHRLAAGYS
TTGSIEDAVASLRAALG
118465807YP_879312.1 cytochrome P450 [Mycobacterium avium 104]MAVLDSATRFFGSEAIQDPYPLYERMHAEAPVHRIGDSVFYAVCGWDAVH
EAIERVEDFSSNLTATMVFHEDGTVTPFDMGAPGAPMHALATADDPVHAV
HRKILLPHLSAKRIRIIEEFATQTADRLWDENLSDGRIEWMSAIANRLPM
MVVCRLLGLPDDDVDKLIRLGYATTTLLDGIVAPEQLEQAGMAAIELSGY
VLEHFEKASEKPESSLMADLAARCAAGELEQLPALGIMLTLFSAAGESTA
SLLGSAAWILADRPAIQRQLRENPELLSTFIEETLRFEAPFRGHYRHVWR
DTTLGGIELPEGAHLLLMWGAANRDPTHFKDPNEFRLDRAAAKSHLSFGK
GVHFCVGAALARLEAHIVLRRLLERTSWIDATDVGDWLPSILVRRRERLG
LAVR
118465806YP_883097.1 3-hydroxyacyl-CoA dehydrogenase type-2 [Mycobacterium avium 104]MEINGKKAVVVGGASGMGRASAELFAARGADVAILDRESSDGKAVAEGIG
AAFYPVDVTDFAGTEETLQSAVDKLGGLHVIVTTAGGGIAKRTLTKNGPH
DLESFQSVIDLNLIATFNISRLAAAHMAKNEPEDEERGVIINTASIAAFE
GQIGQVAYTAAKAAIAGMCLTMARDLGSVGVRVLAIAPSLFATGLTQGIP
DEFATQLTKDAAFPKRLGRPEEYAKLALAIVDNPMLNGQCLRLDAGQRFA
PK
118465805YP_880612.1 Mrp protein [Mycobacterium avium 104]MSRHDSSDSAADLSAAVRAALGKVIDPELRRPITELGMVKSIDTEPDGAV
HVAIYLTTAACPKKTEISDRVTRAVADVPGTGAVKVTLDVMSDEQRTELR
KQLRGDAREPVIPFAQPNSLTRVYAVASGKGGVGKSTVTVNLAAAMAARG
LSVGVLDADIHGHSIPRMMGTTDRPTQVESMILPPIAHDVRVISIAQFTQ
GNTPVVWRGPMLHRALQQFLADVYWGDLDVLLLDLPPGTGDIAISVAQLI
PNAEILVVTTPQLAAAEVAERAGSIALQTRQRVVGVVENMSGLTLPDGST
LQVFGEGGGQQVAERLSRAVGAEVPLLGQIPLDPALVEAGDSGTPLVLSA
PDSPVGKALRAVADSLSSRRRGLAGVSLGLDPTRR
118465804YP_883673.1 exodeoxyribonuclease V- gamma subunit [Mycobacterium avium 104]MPLHLHRAERTDLLADGLGALLANPPADPFALELVVVPARGVERWLSQRL
SHVLGRARDGDGVCAGVQFRSPGSLIAEITGTAEDDPWSPDALAWPLLEA
IDCSLDEPWCRTLATHLGHFHSGAEAELRRTRRYEAARRLAGLFAGYARQ
RPRLLVDWLDGDPGDLDEDLRWQPPLWRALVARVAADPPHVRHAETIARL
RRAPSDLPQRLSLFGHTRLACTDVELLDALATHHDLHLWLPHPSDRLWRA
LAGTNGVIPRRDDTSHRAVAHPLLATLGRDLRELQRGLPADPRTDEYLAG
DARPDTLLGWLQSDIAANAIRPVGRSLAAGDRSVQIHNCHGPARQVDVLR
EVLLGLLADDPTLQPRDILVMCPDIESYAPLIMADFGLGDVVHGAHPAHQ
LRVRLADRSLIQTNPLLGVAAQLLALAGGRVRASEVLNLAQTPAVRARFG
FTDDDLEAITGWVRQANIRWGLDRQHRRPYHVDFVHNTWRFGIDRILAGV
AMSDDSNAWIDATLPLDDVSSNRVQLAGQLAEFVARLQHVLDSLTGARPL
TEWLTAVADGIALLTRVRDADEWQSGQLQREFAAVSAQAGSRADTVLRLP
DVRALLTRHLSGRPTRANFRTGTLTVCTMVPMRSVPHRVVCLVGLDDGLF
PRLGVVDGDDALSRCPMTGERDIRSEDRQLLLDAIGAATEKLVITYTGAN
EYSGQPRPPAVPLAELLDTLDITTAEPVRDRIVVRHPLQPFDIRNVIPDE
LVPGVPFSFDPTVLRAARAATGEHCEPPKFISAPLPPPPPADVILADLVG
FFKDPVQGFFRALQFTLPHDVDGVQDAMPVDIDALQEWTVGDRMLRDMLR
GMTPEDARQAEWRRGTLPPGQLGWRRVTEIRDQAARLAREAHQHRAEQPG
GAHDVDIDLGRGRRLTGTVTPVYGNRLVAVTYSRLDGRHLLESWIPLLAL
AAHDRGRDWSAVCIGRMRRGTGIRVQRLGSPDDDPVELLHELVSIYDAGR
REPIPLPLKTSYAWAAARYGGDDPVAEARYRWKSSDRYPGEDQAPAHVRA
WGRGAPLDDLMQPVRPGEECDGEDNRLGAYAARLWLPMLRAERTTA
118465803YP_883032.1 methionine synthase- vitamin-B12 independent- putative [Mycobacterium MSAFARPFATASGVGSWPGTVAREAAEVVVGELAGALAHIVELPARGVGA
DMLGRAGALLVDVAIDTVPRGYRLVARPGAVTRRAISLLDEDMDALEEAW
EAAGLRNDGRVVKVQAPGPVTLAAEIELANGHRAITDPGALRDLAASLGE
GVAAHRARLSRRLETPVVVQFDEPSLPAALGGGLPGVTALSPVPPLDEAL
ARGLLDGCVHTVGGEVLLHCCGPDMPWNLLQDSAFSAVSVDASALGAADL
DGMAAFVESGRAVALGVVAVGVPPRRPSAEQVAGAVVAVTDRLGFTRSAL
RDRIGVTPACGLAGATPEWARTAIGLARRAAELFAEDPDAIE
118465802YP_881446.1 hypothetical protein MAV_2242 [Mycobacterium avium 104]MLTPQVSPNVHWRRASRGFFALSARSAAAGSAVRPETKA
118465801YP_884185.1 hypothetical protein MAV_5067 [Mycobacterium avium 104]MMFDGPGRSAADPGHNLSQSTLLRSSTRSCGTPTIGQRPRGSPIA
118465800YP_882857.1 acyl-CoA dehydrogenase [Mycobacterium avium 104]MIEWSDTDLMVRDAVRQFVDKEIRPHLDELESGAMSPYPIARKLFSQFGL
DTMAAEAVKKMLDRERSGADENGDSSGAANEFSGGGAQGSMIAVLVSEIA
RVSIGLLSTASVSLGLGAATIASRGTLAQKERWLPELMTLEKIAAWAITE
PDSGSDAFGGMKTSVRRSGDGDGAYILNGQKTFITNGPYADVLVVYAKLD
EGDPSVDKRNRSVLVFVLDAGMPGLTQGKPFKKMGMMSSPTGELFFDNVR
LTPDRLLGESEQHTEGDGRDSARANFAAERIGIAMMALGIIDECHRLCVD
YAKSRTLWGKNIGQFQLIQLKLAKMEIARMNVQNMVFHTIERQQAGKPLT
LAEASAIKLYSSEAATEVAMEAVQLFGGNGYMAEYRVEQLARDAKSLMIY
AGSNEVQVTHIAKGLLSS
118465799YP_884223.1 isocitrate dehydrogenase- NADP-dependent [Mycobacterium avium 104]MSAKPPTIIYTLTDEAPLLATYALLPVVQTFAAAAGINVKTSDISLAARI
LAEFPDHLTEDQRVPNNLAELAELTQLPDTNIIKLPNVSASVPQLLAAIK
ELQAKGFDLPNYPGDPKTDEEKEITQRYARCLGSAVNPVLREGNSDRRAP
KPVKQYARKHPHSMGEWSMASRTHVATMKHGDFYHGEKSMTLDRARGVKM
ELKTKGGKTIVLKPKVSLRDGDVIDSMFMSKKALCEFYEAQMQDAYETGV
MFSLHVKATMMKVSHPIVFGHAVKIFYKDAFAKHQELFDELGVNVNNGLV
DLYSKIETLPASLHDEIVRDLHACHEHRPELAMVDSAKGITNFHSPSDVI
VDASMPAMIRLGGKMYGADGRTKDTKAVSPESTFSRIYQEIINFCKTHGQ
FDPTTMGTVPNVGLMAQQAEEYGSHDKTFEIPEDGVANIVDVDTGEVLLT
QDVETGDIWRMPIVRDDPIRDWVKLAVDRARNSGMPVVFWLDQERPHENE
LRKKVNTYLADQDTEGLDIQTMSQERAMRHTIERAMRGQDTIAATGNILR
DYLTDLFPILELGTSAKMLSIVPLMAGGGMYETGAGGSAPKHVHQLVEEN
HLRWDSLGEYLALGACFEDTGIKTGNKRATILAKSLDAATGKLLDNNKSP
SRKTGELDNRGSQFYLALYWAQELAAQHDDEELRKHFAALADELRNHEDT
ILAELAKAQGESVDIGGYYRPDDEKLTAVMRPSKTLNDALVTHRADAGRA
KLVQ
118465798YP_884219.1 transcriptional regulator [Mycobacterium avium 104]MPTKVPFMGNGASRSAYFEKGLEILSEVGYGGLKLAEVCLRVGVSTGSFY
HFFDNWPKYTRELIEHWQQTNTIRLAEWIEAEPDPRRRIDRIIDIGLNLP
HGAEAAIRAWSSTDPEVYAVQKEVDQERHRILRDSAVQILHDDRQAQLFA
DWAVYLLVGYEQATLPPDKEALQWIVGQLLDALDAGRFASAPLKKG
118465797YP_880531.1 hypothetical protein MAV_1286 [Mycobacterium avium 104]MWIDDTSADVIKVDFEALYHGDVLVEGETSEQFDELQAAS
118465796YP_882760.1 TrkB protein [Mycobacterium avium 104]MKVAVAGAGAVGRSVTRELLANGHDVTLIERNPDHVDVDAIPAAHWRLGD
ACELSLLESVQLQEFDVVVAATGDDKANVVLSLLAKTEFAVPRVVARVND
PRNEWLFTDAWGVDVAVSTPRMLASLIEEAVAVGDLVRLMEFRKGQANLV
EITLPDDTPWGGKPVRRLQLPRDAALVTILRGPRVIVPEEDEPLEGGDEL
LFVAVAEAEEELQKLLLG
118465795YP_881382.1 LppN protein [Mycobacterium avium 104]MRVRRLRTRCGLAAVAAVGCWASVPTTVTAAPLPPGSHTEKWIDLQPGQC
VADLPPADGSRVDVTVVDCATAHLAEVYLRAPMAVDAAIASVANRDCAAG
LPGYTGGDGGRFSITYLIDSNQDRTGANPTPSTVICLLQSSDGQPLTGSA
HRRAG
118465794YP_882772.1 RNA polymerase sigma factor [Mycobacterium avium 104]MKRTATKSPSSPAKRPAAKAANGSAPAKRATKTASRSAKSEAGAAAEPAK
KTRSSAKGADAKAPSGRGTKAAKGGPADPDALDTDGAVEDLDTEPDLEGE
PGEDLDIDTDLNLDDLEEDVAADDADIEPGDAEEGEDEEAAAPKAAGATA
ADEDDEIAEPSEKDKASGDFVWDEDESEALRQARKDAELTASADSVRAYL
KQIGKVALLNAEEEVELAKRIEAGLYATQLMSEMAERGEKLPAAQRRDMM
WICRDGDRAKNHLLEANLRLVVSLAKRYTGRGMAFLDLIQEGNLGLIRAV
EKFDYTKGYKFSTYATWWIRQAITRAMADQARTIRIPVHMVEVINKLGRI
QRELLQDLGREPTPEELAKEMDITPEKVLEIQQYAREPISLDQTIGDEGD
SQLGDFIEDSEAVVAVDAVSFTLLQDQLQSVLETLSEREAGVVRLRFGLT
DGQPRTLDEIGQVYGVTRERIRQIESKTMSKLRHPSRSQVLRDYLD
118465793YP_881340.1 haloalkane dehalogenase [Mycobacterium avium 104]MPVHAEELNMHVLRTPDSRFENLEDYPFVAHYLDVTARDTRPLRMHYLDE
GPIDGPPIVLLHGEPTWSYLYRTMITPLTDAGNRVLAPDLIGFGRSDKPS
RIEDYSYQRHVDWVVSWFEHLNLSDVTLFVQDWGSLIGLRIAAEQPDRVG
RLVVANGFLPTAQRRTPPAFYAWRAFARYSPVLPAGRIVSVGTVRRVSSK
VRAGYDAPFPDKTYQAGARAFPQLVPTSPADPAIPANRKAWEALGRWEKP
FLAIFGARDPILGHADSPLIKHIPGAAGQPHARINASHFIQEDRGPELAE
RILSWQQALL
118465792YP_883046.1 polyprenyl synthetase [Mycobacterium avium 104]MFGPGGTGQAVPSGRERWDTMGALSFSPTTTVAAPAWTRIDDFGGWRAHV
RAMVLDEVADFVGVRRADELDRAGIGAAGDILVQFVSGGKCLRSTFVYLG
WLCGAPRDRAALRAAASFELLHAFALLQDDVMDGAQERRGRPAAHLQFGR
WHQDRGLSGSPRRFGESAAILLGDLCLIWAEQMLRDSGLEARRLQRAFPR
YDAMRVELAVGQFADLTNDIRQSPGLDAVLEVARRKSGNYTVRRPLEIGA
TMAGCDDRTVARLSRYGAAVGEAFQLRDDVLGVFGSPAVTGKPCAADLFE
RKATAVVVSAHQLADPPVRRELIELATRDVLDAAAIERWKALIVETGAVR
LIERMISDRVASAREQLCGLPVDESVRAALAEMAAVCTDRAE
118465791YP_879627.1 nitrilotriacetate monooxygenase component A [Mycobacterium avium 104]MRTDKMALVAFMQAGSTSVYAGSWRHPANEHRYLDAAYYAKIGRQLEEGC
FDLMFFDDRLAMPGVYGGSVGEAVRYGARPVKLDLGVILGVLAQATSRIG
LGATYSTTYYPPFHVARTFASLDHLSGGRAAWNVVTSVNDSEAQNFGVDA
HLGHDERYDRADEFMDVVTGLWDTWEDDAVLHDRVSGRYADPAKVHELGH
VGEFFSARGPLTVPRTPQGRPVIIQAGSSGRGREFASRWAELIFTGDPGI
DVARSHYADQKDRIADAGRDPAAVRICPMAYAVVGESEAHAKDREAMLLN
DLVHPMASLTLLSELMNYDFAQHDLDDPVTDDILASVSGIRGLVQNLRAH
IGGDAVTVRDLANHRATLLQGPRFVGTGPQVADQMADWFQTGACDGFVLA
ATHLPGAFEDVVRMVVPELQRRGLFRTEYRSATLRGHLGLPRPANARVAH
A
118465790YP_881338.1 hypothetical protein MAV_2128 [Mycobacterium avium 104]MIGIVAAVLIGVLTAVGMQLTRGDHGATAPAAGPPPTPESYAIPGCYNPS
VLPVERPKKLNVLGCASVAVALQDMSWSSWGPQGADGTGRAVFKLCDPNC
ATGSQLTEPVVVHAWNPQPPRREAICQAGLKIFADMILAFPKDVPPPDVQ
KMNTQYHGMPAVHFANYSSGDTRGTQFIGYTFCN
118465789YP_881291.1 FdhF protein [Mycobacterium avium 104]MNTMCAYCGVGCGMVLQITTDPQTGRRHVAKSVGNKEHPANFGRLCTKGA
TTADLLAAPGRMDSAHARAGRGEPLEPIGTDQAITRCAKQLRAIIDEHGP
DAFAMYVSGQMSLEAQYLANKLTKGFIGTNQIESNSRLCMASAGSGYKLS
LGADGPPGSYQDFEHADVFFVIGANMADCHPILFLRMMDRVKAGAKLIVV
DPRRTATAEKADLFLQIAPGTDLALLNGLLHLIVENGHTDGEFIAEFTEG
WEVMPSFLEQYTPDRVSEITGIPEQDIRAAAQLIGEADNFMSCWTMGLNQ
STHGTWNTNAICNLHLATGAICKPGSGPFSLTGQPNAMGGREMGYMGPGL
PGQRSVASAADREFVEDVWGVPRGRLRTEVGTGTIDMFSRMADGQIKACW
IICTNPVASVANRKTVLAGLERAELVIAQDAYLGTETSEYADVLLPAALW
AETEGVMVNSERNITLSQPAVAAPGGAMPDWQIIARIACEMGFSEAFSYS
CAEEVFEEIKRFWNPTTGYDLRGVSYERLRRQPLQWPCPPQSTADRNPIR
YLNDGVSQTQLVREDGTVPRLAFPTPSGRAVFFARPHLQPEEMPDDDYPF
LLNTGRLPHQWHTMTKTGKVAKLNKLNPGPFVEIHPDDAARLGIGEHDRV
EIASRRGRAVLPAVVSDRVRPGNCFAPFHWNDAFGEYLSINAVTNDAVDP
ISNQPEFKACAVTLTKVAVSHPDSAIGTGPSAGHDTPESAPTEVREISVS
QVDALGELLGVATSFKPEFNELGRSYLAGMLTGLRSDVGRRAGGVPTLPP
SAPFDSRTRLWVDGLLAGLFSRADASQQAALPEPPQPAAQQPPAAPAGAT
PAPERAPVVVLWASQTGNAEELAADVAAQLAAAELPVALHSMDDFPAAEL
AATRELLLITSTTGDGDAPDNGSGLWRALTGDAAPRLGNTRYAVLALGDS
NYDDFCGHGRKLDARLAELGATRIAERVDCEPDYEQAAAKWVADVIEALT
RTPTAVGGDGGATVSARTSPVAAPSRPNTPAPHTYSKKHPLITDMVRNTT
LNGPKSTKDVRHLVFNLPEDAVSYEAGDALGVWPRNSDELVDEWLAVTGL
DGQTPVEVGEHGLMSLRSALTERIEIAHISRDLVRFVQERTGDAKLAELL
KPENKRALADWTWGRQSIDLLAQLPVSASAHEWLRVLKRLQPRLYSISSS
PKACPGEVHLTVSPVRYNFQGVPRRGVCSTYLAARSPGDRVAVYLQPSSN
FRPPSDPDTPMIMIGPGTGIAPFRGFLQERRALGHRGPNWLFFGEQHAAT
DFYYRDELEQMREDGFLTELDLAFSRDQQHKVYVQHLMRNRGKQLWSWLQ
DGAQLYVCGTADPMAKDVDRALCDIAAEFGNLDPDAAKAYVQSLSADKRY
HRDVY
118465788YP_884300.1 antigen 85-C [Mycobacterium avium 104]MSFIEKVRKLRGAAATMPRRLAIAAVGASLLSGVAVAAGGSPVAGAFSKP
GLPVEYLEVPSPSMGRNIKVQFQGGGPHAVYLLDGLRAQDDYNGWDINTP
AFEEFYQSGLSVIMPVGGQSSFYSNWYQPSSGNGQNYTYKWETFLTQEMP
LWMQSNKQVSPAGNAAVGLSMSGGSALILAAYYPQQFPYAASLSGFLNPS
EGWWPTLIGLAMNDSGGYNANSMWGPSTDPAWKRNDPMVQIPRLVANNTR
IWVYCGNGTPSDLGGDNVPAKFLEGLTLRTNEQFQNNYAAAGGRNGVFNF
PANGTHSWPYWNQQLMAMKPDMQQVLLSGNTTAAPAQPAQPAQPAQPAQP
AQPAT
118465787YP_884321.1 oxidoreductase- short chain dehydrogenase/reductase [Mycobacterium aviMAVVTGAGRGLGRAYAHLLAARGAKVVVNDVGGALDGAGVDTGPAAQVVD
EITAAGGDAVACTESVATPEGGRAIIETALAHYGRLDVLVHNAGNVRRAS
LKQMSYEDFDAVLDVHLRGAFHVLRPAFPVMCRAGYGRIVLTSSIGGLYG
NQGVANYAAAKAGVIGLSNVAALEGAAEGVRCNVIVPAALTRMADGIDTS
AYPPMGPELVAPVVGWLAHESCSVSGELFIALAGRVARAVIAESPGVCRP
GWTVEDVGEHLDAIRYVEAPLIFPVVPDGHAEHIRYSFELAQRANEQGAL
HG
118465786YP_879321.1 PbpA protein [Mycobacterium avium 104]MNASLRRISVTVMALIVLLLLNATMTQVFAADSLRADPRNQRVLLDEYSR
QRGQIVAGGQLLAYSVATDNRFRFLRVYPNPAQYAPVTGFYSLRYSSTGL
ERAEDPLLNGSDERLFGRRLADFFTGRDPRGANVDTTIRPRVQQAAWDGM
QQGCGGPPCKGAVVALEPSTGKILAMVSSPSYDPNLLSSHDPEVQAQAWQ
RLRDDPDNPMTNRAISETYPPGSTFKVITTAAALQAGASDTEQLTAAPSI
PLPNSTATLENYGGQACGNDPTVSLQQAFALSCNTAFVQLGILTGADALR
SMARSFGLDSTPSVIPLQVAESTIGIIPDAAALGMSSIGQKDVALTPLQN
AEIAATIANGGVTMQPYLVDSLKGPDLTTISTTTPYEQRRAVSPQVAAKL
TELMVGAEKVAQQKGAIPGVQIASKTGTAEHGSDPRHTPPHAWYIAFAPA
QTPKVAVAVLVENGADRLSATGGALAAPIGRAVIEAALQGGP
118465785YP_879891.1 short chain dehydrogenase [Mycobacterium avium 104]MVLVTGGVRGVGAGISSVFAAQGATVVTCARRAVEGLPYEFHSCDVRDDD
AVKALIDTIADRHGRLDVVVNNAGGSPYVLTAESSAKFNRKIIELNLIGA
LSVSQHANAHMQKQAQGGSIVNICSLSGRRPSPGTGAYGAAKAGLESLTQ
TLAVEWGPKVRVNACVVGMVETEQSELFYGDADSIAAISKNVPLGRLAKP
ADIGWAAAFLASDAACYISGASLEVHGGGEPPHYLATTNASAIK
118465784YP_881480.1 hypothetical protein MAV_2276 [Mycobacterium avium 104]MTVRRLIIGVGAVLLLAGVIGLLAPVSVSDGNGHSIGCGNAVVTDLSAAR
NANDNSVANVPILNQIVPHTDYVAQCQSSVGGRRAWTIPLAVLGIIAIGA
TLLTGRRGAATGA
118465783YP_882958.1 hypothetical protein MAV_3786 [Mycobacterium avium 104]MPDLMAGIAWPWRLVFLVGVSALFAQQAVIVGRRASHEYVAATRGLDRAE
RAQAIAASVRGDVPASAAVLVAAIRIAHLRLGFGRSTPNRIAVSYGLLTV
SWLALTATNADGPGRMALKGVVAAFLAVTGVRGWLVARRVERRIILLQDA
SQRLPGAAAALRAAPRTEPASPRWRPTVALLTAVVLVTTGALAAVYLAHR
RSPDCRTANDMARFVASHPDMLDPAFIPANSGGPTLADYQLWSEQLDRYA
ALSGGDVAPGLRSAAALSARATAVVREARADPADWQDPRQQRRRNDYATI
AGQLVTEVRALESHCPPRSSLLTRRT
118465782YP_883603.1 50S ribosomal protein L2 [Mycobacterium avium 104]MAIRKYKPTSPGRRGASVSDFSEVTRSTPEKSLVRPLHGHGGRNAHGRIT
TRHKGGGHKRAYRVIDFRRNDKDGVNAKVAHIEYDPNRTANIALLHFLDG
EKRYIIAPQGLSQGDVVESGPNADIKPGNNLPLRNIPAGTVIHAVELRPG
GGAKLARSAGSSIQLLGKEGSYASLRMPSGEIRRVDVRCRATVGEVGNAE
QANINWGKAGRMRWKGKRPSVRGVVMNPVDHPHGGGEGKTSGGRHPVSPW
GKPEGRTRHPNKASNKLIVRRRRTGKKHGR
118465781YP_883725.1 naphthoate synthase [Mycobacterium avium 104]MAGFDDLTDITYHRHVDDATVRVAFDRPEVRNAFRPHTVDELYRVLDHAR
MSPDVGVVLLTGNGPSPKDGGWAFCSGGDQRIRGRSGYQYASGETADTVD
PARAGRLHILEVQRLIRFMPKVVICLVNGWAAGGGHSLHVVCDLTLASRE
HARFKQTDADVGSFDGGYGSAYLARQVGQKFAREIFFLGREYTAEQMHRM
GAVNAVVEHAELERAGIEWAREINAKSPQAQRMLKFAFNLLDDGLVGQQL
FAGEATRLAYMTDEAVEGRDAFLEKRPPDYSRFPRYF
118465780YP_880117.1 hypothetical protein MAV_0848 [Mycobacterium avium 104]MRVRVDPRLCEAHALCVEIAPEVFRLDDDTASCADDPAESLRHSVQAAVA
ACPRQAISVLTEQPPYAPDEGN
118465779YP_883230.1 hypothetical protein MAV_4079 [Mycobacterium avium 104]MKISSIVARRKVAGVSAGCLLGGMAMGIVGAPSAAAAPDCSPSGVNSTVS
AVEGSAQQYLAAHPDANQVVTAAYGQPRPQAESSLRSYFTGHPQEYNDLR
GILAPIGDTERQCNVTALPPYLESAYQEFMAG
118465778YP_880714.1 ISSoc3- OrfA transposase [Mycobacterium avium 104]MSLLHAHLVFVTKFRRKLFTDPMLTFAETTMRTVCAELDVELVEFNGEAD
HVHLLVAYPPTLAISALAQRLKGRTAYAVRREFTGAKTGTAVPMPRSSMP
STSDGRRFTKSESPWF
118465777YP_881237.1 low molecular weight antigen MTB12 [Mycobacterium avium 104]MNTVKTIATGVAALAIVGGAAAGLAAAAAPSAPGTVRLAAVGAPLPQDPP
PAQPVAGANVPTSDQLTGLLNSLADPSVPFANKSNLVQGGISGVEAHVAD
KKLQKAAKNGDLPLSFDVTNIQPTASGAATADVSVSGPKLTSPVTQNVTF
VNQGGWVLSRASAMELLQAAGQ
118465776YP_882518.1 phosphoenolpyruvate carboxylase [Mycobacterium avium 104]MVEASEGTLEPIGAVQRTLVGREATEPMRADIGLLGAILGDTVREQNGQQ
VFELVERARVESFRVRRSEIDRAELARMFAGIDIHQAIPVIRAFSHFALL
ANVAEDIHRERRRAIHVAAGEPPQDSSLAATYAKLDRAQLDSATVAEALR
GAVVSPVITAHPTETRRRTVFVTQHRITELMRLHAEGHIETDDGRNIELE
LRRQVLTLWQTALIRLSRLQITDEIEVGLRYYAAAFFKVIPRVNAEVRNA
LRARWPGADLLDEPIVAPGSWIGGDRDGNPNVTADVVRRATGDAAYTALA
HYLAELTACEQELSMSARLVAVTPELAALAEDCAEKARADEPYRRALRVI
RGRLTATAAEILDRRPQHELDLGLPPYATPAELRGDLDTVDASLRAHGSA
LLADDRLALLREGVRVFGFHLCGLDMRQNSDVHEEVVAELLAWAGVHPDY
RSLPEDERVELLAAELGTRRPLVGDRAELSELADKELGVVRAAAHAIRRY
GPAAVPNYVISMCRSVSDVLEAAILLKEAGLIDASGPEPYCPVGISPLFE
TIEDLHNGAAILHAMLELPLYRALVAARGQSQEVMLGYSDSNKDGGYLAS
SWAVYRAELALVEVARKTGIRLRLFHGRGGTVGRGGGPSYEAILAQPPGA
VNGSLRLTEQGEVIAAKYAEPQVAQRNLESLVAATLESTLLDVEGLGDTA
EPAYAVLDEVAVLAQRAYAELVHETPGFVDYFMASTPVSEIGSLNIGSRP
TSRKPTESIADLRAIPWVLAWSQSRVMLPGWYGTGSAFEQWIAAGPQSRA
ERVDILHDLYRRWPFFRSVLSNLAQVLAKSDLGLAAQYAELVDDAALRRR
VFGKIADEHRRTIAMHKLITGQDNLLADNPALARSVFNRFPYLEPLNHLQ
VELLRRYRSGDDDELVQRGILLTMNGLTSALRNSG
118465775YP_881184.1 hypothetical protein MAV_1966 [Mycobacterium avium 104]MTSSALQPPIPVPDPDTAPYWEGLKNGKLMLCRCDDTGKWIHPPLERSRF
TGGPVHFEAVSGRGTVYSYIVVRQALVPGRVPPYVVGLIELDEQPGLRIN
AVIDCDPADVRIGQRVELRVVDLGESGYRIPEFVATDSA
118465774YP_884249.1 senescence marker protein-30 (SMP-30) [Mycobacterium avium 104]MIPEPLVNGFCFGEGPRWFEGLLWFSDMLGEAVHTTTMGGALTTLPLPGH
CPSGLGFRPDGSLLIASTRDRRVLRYDGETVVTVAELADIAPADLGDMVV
DRAGRAYIGCQAFTRGAIIRLDPDDRAKVVADDLDFPNGMAITPDGATLI
VAESTGRRLSAFAIDDDGALSGRRVFADGLDGPPDGIALDADGGVWAAMT
LAHQFERIVAGGAVTDRIDIGDRVAIACALGGPQRRTLFLLSSTDAYPQR
LVGTRLSRLDAVTVTTPGAGLP
118465773YP_882660.1 hypothetical protein MAV_3478 [Mycobacterium avium 104]MSRNRLFVIAGALAVAAVVCLVTGIILLQKNIASYVAGHYHEYARDVNGT
RYQCTGSSEQVADTLSEYAEPAARADDNKTEYLRYSNDIVIVGPDGNYPC
SIRVEPLSAGYSHRAFVFLGPGFFPGSPSGGAGGTPGGPGGTK
118465772YP_881149.1 phosphotransferase [Mycobacterium avium 104]MAYSSTRGDVGDRVGEVLRAWLPHRLTTADATAFNISEFTAPPAGYSGKT
AFFTASWTDGSGTVHADDLVLRTQADDHQLFTTPDAPRQAEVMQRLGAQG
IPVPDVIGIERDASILGSPFYVMRRVRGRTPPDVPSWHKRGWTVDLSSDE
RQLLCHNGLRALVDVHRVDDSDTLRFLRGDGDVSRTALQRYLDKLAGWYD
WCRDNLVVGADTLAQAIEVIQLSAPDNSAETVVWGDARVGNMCFGDDLSV
VALFDWETAGTGPPDIDLGWWLMFERFLCEALGFTRLPGVPDDDEFVRRY
LQFGGTLTGDIVYYQLVAAFVLSLINNRLARLLVRDGLDAPTAMSYPQTS
VALVERYLDQI
118465771YP_883124.1 hypothetical protein MAV_3966 [Mycobacterium avium 104]MNTMSMLPAEFADLEPFADWCLPSEPERYAKRLASSMTEMKAFYDAITPR
AEEALAFCDKFSLDDLPDDVLNLMHMLYSMIMVSFPVECWKQPRVPDSGA
STLDCVSEPVP
118465770YP_882143.1 thiopurine S-methyltransferase [Mycobacterium avium 104]MGEADRHRWDERYAANGPPPLSSVAPPGVFARHADVFPAAGRALDLACGQ
GTAAVWLALRGLRVLGLDVSPVAIGQARDLARRAGVGERCRFDVADLDRG
LPVGPPADVIVCCKFRDRRLDRAIVERLAPGGLLAIAVLSEVGAGPGPFR
AAPGELTAAFADLQPIAAGEADGQAWLLARASQSEPMVERR
118465769YP_880560.1 hypothetical protein MAV_1315 [Mycobacterium avium 104]MYRNRYRRPPGRRNSAQVSGVSTVFALGETGPARGLRDCQS
118465768YP_882996.1 short chain dehydrogenase [Mycobacterium avium 104]MARWLITGCSTGLGREIAGAALQAGHRVVVTARRADAVRGFAEEFGELAL
PVALDVTDRDQIAAAVAAADAAFGGIDVLVNNAGHGYLSAVEEGEDAEVR
KLFDVNYFGAVDMIKAVLPGMRARGCGHIVNISSMTGLVANPPNAYYSST
KFALEAVTEALAAEVRPLGIKVTAIEPGAFRTDWATRSMKESGTPIADYT
DVAARKDLIKQFADHLPGDPRKVAEAVLMVTGLDEPPLRLLLGRDVLKAM
RDKIAAMSASIDEWEAVTKDVNFPGA
118465767YP_883363.1 hypothetical protein MAV_4222 [Mycobacterium avium 104]MRKRRRSAGHAQRRGPRCATVTIGPMSESRGDSRSSGRSGRFSRRSAPRR
LSRRGRDMRGPLLPPTVPGWRSRAERFDMAVLEAYEPIERDWQDRLADLD
VAVDEIPRISAKDPDSVQWPPEVIADGPIPLARLIPAGVDIRGNATRARI
VLFRKPIERRAKDTVELGELLHEILVAQVAIYLDVEPSVIDPTIDDD
118465766YP_881239.1 hypothetical protein MAV_2020 [Mycobacterium avium 104]MSRLPGVSDRDAGLGARIAFFFTRRKLAQMTGLETAGMLEPLRMYAHIPR
LLNAHGRLEQAESRLDILSPRHRALAELKAATTVRCEYCIDLGSQIARRW
GITDEELLAMADYRDAACFSDVDKLILEYATAISRTPVEVSDELFDALRA
HFDTAQLVGLTHVITLGNLRARFNIALGIGSSGFSGNRVCALPDTPRP
118465765YP_882039.1 undecaprenyl pyrophosphate phosphatase [Mycobacterium avium 104]MTAQLSYVEAVVVGAFQGVTELFPVSSLGHAVLVPALVGGRWAQDLSVSA
HRSPYLAFIVGLHVATAAALLVFFWRDWVRILAGFFSSLRHRRIRTPDER
LAWLIVVGTIPVGLAGLALEQLFRTTLGKPVPAAAFLLLNSVALYAGEVL
RRRVAPVADEPAVPDAEQQHGDEASDNRLAQLPLRRGVLIGAAQILALLP
GISRSGITIVAGLWRGLSHEDAARFSFLLATPIILAAGVYKIPELFGPLG
AGIGGQVLAGSIASFVCAYLAVRYLTRYFQTRTLTPFAIYCAVAGGASLV
WLALR
118465764YP_882265.1 LprJ protein [Mycobacterium avium 104]MVTVIFARRVRLTGLIVGVLAGLAALAGTLSAPIRADMLGNAFLSALTNA
GIAYTQPTSTMAMGQSVCPRLFEPGGSFDAVAADMAQRAGMSYETAGRFT
IVAIATYCPAVIAPLLGNRLAS
118465763YP_882937.1 hypothetical protein MAV_3765 [Mycobacterium avium 104]MLSLEEISDRLEIQQLLVDYSTAIDNRRFDDLDDVFTPDAYIDYTALGGI
EGRYPEVKKWLAEVLPNFPVYAHMLGNFSVRIDGDTASSRVICFNPMVLG
GDTDQVLFCGLWYDDEFVRTPGGWRMTRRVETKVFQKVM
118465762YP_881083.1 hypothetical protein MAV_1862 [Mycobacterium avium 104]MTNLIADGLFRIDGDRAVLLGSRRRSTGVVKFPAERPELFDGSPDTQEDI
EPIELSTEGTLYTFTTQEFAPPLPYKGSRDPKIFRPYIVGFIELAEGVLV
ESLIIDAAAAELQIGQRMVSATTTLETEAGESFLTFAFRPA
118465761YP_882176.1 oxidoreductase [Mycobacterium avium 104]MLAQFGMSIPLVAAPMSGGPTTPAMVSAAARAGALGILAAGYKTVQGIEA
EIKAVRAESIPFGVNLFAPNPVPVDPQRYRDYHGIIQREADQFGLTLPPQ
PVEDDDAFDEKIALLLDDPVPLVSFTFGIPPREVIAALRRAETVVAQTVT
TADEAAQAHDAGVDMLVVQATAAGGHSATLSPQRPVPSVPITDLVRQVTA
RVPLQVIATGGLATPAAVAEVIRAGAHAAAVGTVLLRATESGASATHQAA
LADPAYTETVLTRAFTGRPARGLRNAFIDAHEAGAPLGYPAIHHLTSPLR
KAAAAAARPEYVHLWAGSGYRHATAEPAADILRRLTSAL
118465760YP_880132.1 acyl-CoA dehydrogenase domain-containing protein [Mycobacterium avium MDVRLTAEQQQMRDAAAKLADDLGPATVQDLDDQGRISRLDKQIEMSGWR
SLRSDGASGVEVAIVAEEFGRRLVDTPFLGPVLADDLLRHVGADAAATTV
AVDDRAVDARGARRAVSLSGGAVLAVDVQPAPDNVDLTRADATTVGAPET
LGEVGSDVAGQWRALALVTTTADLVGVARGAHALACDYAKIREQYGNPIG
SYQAIAHLLAESLALIEGSISVARHAAWAVDALAPAEAIRAAQIAKVYCA
RAARTVCETAIQVHGGIGNTWECAAHVYLRRALTSTELWPVALKEIDLGL
S
118465759YP_881658.1 LppT protein [Mycobacterium avium 104]MHDRTVRARTATGIVEGFTRDGVHRWRSIPYARPPVGDLRFRAPQPAQPW
SGVRHCHGFANCAPQQRRYTLLGLSGLGGRYQPMSEDCLTLNVVTPEAPA
EGPLPVMVFIHGGGYFLGSSATPLYDGAALARRGCVYVSVNYRLGALGCV
DFSSLSTPEIPLESNLYLRDLVLALQWVRDNIAEFGGDPDNVTIFGESAG
ACITATLLAVPAAKGLFAQAISESPASGLVRSQEVAAEFANRFANLLGVR
RQDAANALMQASAAQLVKTQHRLIDEGMQDRLGAFPIGPVVGDDILPTDP
VEAMRRGEAHRVPLIVGTNAEEGRLFTRFLAMLPTNESMVEELLADAEPA
VRERITAAYPDYPDRSACIQLGGDFAFGSAAWQIAEAHCAHAPTYLYRYD
YAPRTLRWSGFGATHATELLAVFDVYRTRFGALLTAAADRRAALRVSNQV
QRRWRAFSRTGVPGEDWPRYTAADRAVLVFDRKSRVEFDPHPHRRMAWDG
FSLAR
118465758YP_882757.1 RNA methyltransferase [Mycobacterium avium 104]MGELTLTTGSPANGGSCVAHHEGRVVFVRYALPGERVRVRVTADRGSYWH
AEVLDVIEAAYGRIESLCPIAGVDGAGCCDLAFVRPEAARALKAAVVANQ
LERLGGHRWAGEAEPLGNTGPTGWRTRVRLDVGADRRPGFHRYHSEELVT
DLRCAQLPPGMLDGIAETQWPSAAQLHVAVDDDGARHVVRTLRQGRRTAT
KVIEGRYEAVQRVSGRRWRVPVTAFWQAHRDAAATYRALVLDWAQPGAGM
TAWDLYGGAGVFAAALGEAVGESGRVLSVDTSRASTRAARAALADLPQVQ
VVTDSVRRALAAQRTPALQADVAVLDPPRAGAGREVIDSLSAAGVPRIVH
IGCEAASFARDMGIYLGHGYTVEKIRVFDAFPLTHHSECVALLTR
118465757YP_882721.1 hypothetical protein MAV_3543 [Mycobacterium avium 104]MTDLQGKVAVITGGAGGIGRALGRRLGHEGMKVVLADVLADPLQEATRTL
TDEGIEAAGVVTDVTDYSSVEALAKEALRRFGAVDVVCNNAGTGAVSEGY
LWEHDLADWRWGIDVNVLGVIHGLKAFVPILLERGEGHVVNTCSGNGGFA
PIARGAMGGPATAVYPMTKAAVLCVTESLYTHLEMTGTRVRAHVLFPGGF
LNTGIWESWRHRPPRYAPTQQRRTPEQTLDKVVARFEAAGARVEFTPLET
VADLVVDGIAADRFWMMGPPAPSDDVVRRKAASILSRGAPDYLVDVLGRS
AGGNSETQGENQ
118465756YP_883357.1 alkane-1-monooxygenase [Mycobacterium avium 104]MTTVDLQQPSEPAAWRDKKRRLWLMGLIAPTALFVMLPLVWALNRLGWHA
AAQVPLWIGPILLYILLPILDLRFGPDGQNPPDEVMERLENDKYYRYCTY
VYIPFQYLSVILGAYLFTATDLSWLGFHGGLGWAGKLGLALSVGVLGGVG
INTAHEMGHKKDSLERWLSKITLAQTCYGHFYIEHNRGHHVRVATPEDPA
SARFGETFWEFLPRSVFGSLRSALRLEAQRLRRLGKNPWNPLTYPSNDVL
NAWAMSIVLWGVLIAVFGPGLIPFVVIQAVFGFSLLEAVNYLEHYGLLRR
KIDSPSGKARYERCTPEHSWNSDHVVTNLFLYHLQRHSDHHANPTRRYQT
LRSLDGSPNLPSGYASMISLTYFPPLWRKVMDHRVLAHYGGDITRVNVSP
RRRAKLLARYPVVTA
118465754YP_879427.1 glyoxalase [Mycobacterium avium 104]MSEHEAKMIILSTDDLDESIRFYSETLGMPLKFRDGAHFAALDAGPVTLA
LATAVDHPIPGQVVVGIKTADVDGAARAVEASGGGIVKGPYDDAHERRAV
VYDNKGNGLVFYKPLGR
118465753YP_881516.1 1-acylglycerol-3-phosphate O-acyltransferase [Mycobacterium avium 104]MWYWLFKYVLLGPLLSLLGRPKVEGLEHVPSSGPAILASNHLAVMDSFYL
PLVVRRRITFLAKSEYFTGTGLKGWFQRWFFTAVGQVPIDRTDADSAQAA
LTTAQQVLAQGKLLGMYPEGTRSPDGRLYKGKTGLARLALQTGVPVIPVA
MIGTNVVNPPGSNMLRFGRVTVRFGKPMDFSRFEGLAGNRFIERAVTDEV
IYELMGLSGQEYVDIYAASLKKGGAEAPGDEAARIPETAAG
118465752YP_883580.1 hypothetical protein MAV_4445 [Mycobacterium avium 104]MRFSIAIPQFDYDGFDGAGLRSFLTRAEQLGFEGGWALEQIIGPAPPLAP
LELLAYCAACTERLRLGVAVLVTSLHDPLQLASAVTAVDRLSHGRLDIGV
APGGGTRKFAAFGVDKDTFVAYFTEGLKLMKAAWSDDPRVTFHGRFRDVD
DLPIAPKPVQRPHPPIWFGGLAPKALARAVRHGDAFMGAGSSTTEAFAGA
VAVLRRELDEQQRDPAEFTIGKRVYLTVDDDAARARERVLAGLSRIYGRM
PGVADVPVSGTPGDVVRGLREVIDAGAQTLLLNPVGADVAENHEQMERLA
AEVIPQLN
118465751YP_880812.1 AMP-binding enzyme [Mycobacterium avium 104]MPEASTPTIDRLVRSRAAEFGGKPMVIDPGYRITYDQLDTATRELAAVFV
QAGVGKGTRVGLIMPNNTRWVLIAIALTRIGAVLVPLSTLLRAGELVAQL
RVAAVQFLVSVDEFRGHRYLDDVAAVRSELPALQQVWPTEQLDAAAAGAR
AGQIVDAMTQTVTPADPLVIMFTSGSSGTPKGVWHSHGSALGAVQSGLAA
RCIDADSRLYLPMPFFWVGGFGSGILSALLAGATLVTEEIPRPETTLRLL
ESERVTLFRGWPDQAETLARHAGTVGADLSALRPGSLQALLPPEQRARPG
ARATLFGMTEAFGPYSGYPADTDMPVSARGSCGKPFDGMEVRIVDPDTGA
PVGAGTAGIIQIRGPHTLRGMCGRSREELFTVDGFYPTGDLGHLDDAGFL
FYHGRADDMFKVSGATVYPSEVERALRTIDGVDGAVVTNVPGATGDRVGA
AVVCRELTAAQLRAAARNLLSSFKVPSVWLVLRSDDDLPRGVTGKVDVRR
LRELLADADRRQETRVQG
118465750YP_879546.1 hypothetical protein MAV_0257 [Mycobacterium avium 104]MTDPDAENPYVPDEPGTVDLIVRIAQVLAGDWMPDLGTALEADRTSEAH
118465749YP_883501.1 co-chaperonin GroES [Mycobacterium avium 104]MAKVNIKPLEDKILVQANEAETTTASGLVIPDTAKEKPQEGTVVAVGPGR
WDDDGAKRIPLDVSEGDTVIYSKYGGTEIKYNGEEYLILSARDVLAVVSK
118465748YP_883750.1 glutamate-1-semialdehyde aminotransferase [Mycobacterium avium 104]MGSSDQATAHARAQAASARLFDDACAVIPGGVNSPVRAFTAVGGTPPFIT
AARGCRLTDADGNHYVDLVCSWGPMILGHAHPAVVEAVAKAAASGLSFGA
PTPAESELAAEMIARVAPVERIRLVNSGTEATMSAVRLARGFTGRAKIVK
FSGCYHGHVDALLADAGSGVATLGLPSSPGVTGATAADTIVLPYNDIDAV
RQAFAEFGDQIAAVITEASPGNMGVVPPAPGFNAALRALTAEHGALLIVD
EVMTGFRVSRSGWYGIDPVDADLFTFGKVMSGGLPAAAFGGRAEVMERLA
PLGPVYQAGTLSGNPVAVAAGLATLRHADAAAYAALDANADRLARLLSDA
LTNAGVPHQIPRAGNMLSVFFTDTPVTDFASARATQTWRYPPFFHALLDA
GVYPPCSAFETWFVSTALDDDAFDRIAAALPAAARAAAGADEGNS
118465747YP_884369.1 acyl-CoA synthetase [Mycobacterium avium 104]MAEDTIQALLRKRWSDPGVAVKYGDTQWSWAQYLRDAAARAAALLGAADP
GRPMHVGTLLGNTPEMLSQMAAAGLGGYVLCGLNTTRRGKALAADVRRAD
CQFVVTDAEHRPLLDGLDLAGTQILDTSTPDWAGFVDAAGELTPHREVAA
MDPFMMIFTSGTSGNPKAVQVSHLMAVFAGSNLVQRFGLTEHDTCYVSMP
LFHSNAVVAGWAPAVCSGAAIVPAKFSARNFLDDIRRYGATYMNYVGKPL
AYVLATPERADDADNPLRVAFGNEANDKDIEEFGRRFGVQVEDGFGSTEN
AVIVIREPGTPRGSIGRGIDGVAIYNSDTVTECPVARFDADGALINADEA
VGELVNTAGSGFFTGYYNDPDANAERMRHGMYWSGDLAYRDADGWIYLAG
RTADWMRVDGENLAAAPIERILLRHTAINRVAVYAVPDGHVGDQVMAAVV
LNDGETLTPAAFEVFLDAQPDLSPKARPRYVRIAADLPSTATHKVLKRQL
ISQGTAVAAGEVLWEREPRGTAYTVVASPDCGVPGDGSAPSTVAPV
118465746YP_880675.1 ABC transporter permease [Mycobacterium avium 104]MTRFLARRLLNYLVLLALASFLTFCLTSVAFKPLDSLLQRSPRPPQAVID
AKAHSLGLDEPIPIRYAHWASHAVRGDFGKTVTGQPVGASLGRRVGVTLR
LLVIGSLIGTVAGIAAGAWGAIRQYRLSDRVVTMLALLVLSTPTFVIASL
LILAALRVNWALGVQVFDYTGETSPGVTGGAAALLDRLRHLVLPSLTLAL
AAAAGYSRYQRNAMLDVLGQDFIRTARAKGLTRRRALVKHGLRTALIPLA
TLFAYGVAGLVTGAVFVEKIFGWHGMGEWLVQGVATQDTNIVAAITLFSG
AVVLLAGLLSDVFYAALDPRVRVS
118465745YP_880191.1 amidohydrolase [Mycobacterium avium 104]MTLTHMQERVPAAERIAVRCVDSDVHPVPKRGEITPYIPERWRKFFFEHR
VGELIYYDAPDYAHAFAMRTDTFPPDGEFPGSDPDMAFRQLIMEAGSDIA
ILEPAGRTPRIGEAHQAYCSALNDWQANHWLDSRNNWHERWRGSICAAIE
DPEGAVEQIEKWAGHPYMAQILIKAEPRPSWGHPKYDPIWAAATKHDIVV
SCHLSRSNYEMLPTPPVGFPSYNHDFMVTYSLLAANQVMSLIFDGVFDRF
PTLRIVFVEHAFTWILPLMWRMDAIYEARKSRVQIKRKPSEYVKDHIKFT
TQPLDYPEDKTELTRALEWMECDKILLYSSDYPHWTFDDPRWLVKHLPKA
ARDAVMYKNGIATYHLPETVPVLEGQVRVL
118465744YP_879506.1 hypothetical protein MAV_0212 [Mycobacterium avium 104]MPSVSPELQALKARIMGSRPVMRRPGWPVFPYTTMVRSSLWIGVAVVAVL
FAWGGWQRRWIADDGLIVLRTVRNLLAGNGPVFNQGERVEANTSTAWTYL
MYAGSWVGGPLRMEYVALALALTLSVLGVALLMLGAARLYAPSLRGRRAI
MLPAGALVYIALPPSRDFATSGLESGLALAYLGLLWWMMVCWAQPVRNRS
DRREFAGALAFVAGFSVLVRPELALMGGLALIMMLVAARTWRRRALIVAA
GGALPVAYEIFRMGYYGLLVPGTALAKDAAGDKWSQGMTYLSNFDAPYLV
WVPAALLVLLGVLLAAARRRPSFLRPPLAPNYGRVARAVHSPPAVVAWVL
VSGLLQALYWIRQGGDFMHARVLLAPLFCLLAPVAVVPVMVPDGQDYSRE
TGNWVAGAACALWLGIAGWALWAANSPGMGDDATHVTYSGIVDERRFYAQ
ATGHAHPLTAADYLGYPRMAAILTALNNTPEGALLLPSGNYTQWDLVPMA
QPPPGTTPDKFPQKPQHTVFFTNLGMVGMNVGLDVRVIDQIGLANPLAQH
TERLKHGRIGHDKNLFPDWVIADGPWVKVYPGIPGYLDAQWVAEAVSALQ
CPDTRAVLASVRAPMTPHRFLSNVLHSFQFTGYRIDRVPRYELARCGLPV
PEEAPPPPRE
118465743YP_880468.1 fructose 1-6-bisphosphatase II [Mycobacterium avium 104]MTVEGDRSSAATGRAPAQGRPRGEAPDRNLALELVRVTEAGAMAAGRWVG
RGDKEGGDGAAVDAMRELVNTVSMRGVVVIGEGEKDHAPMLYNGEEVGNG
DGPECDFAVDPIDGTTLMSKGMPNAISVLAVADRGAMFDPSAVFYMNKIA
VGPEAAHVLDITAPIAENIKAVAKVKALSVRDMTVCILDRPRHAKLIDEV
RETGARIRLITDGDVAGAISACRPHSGTDMLAGIGGTPEGIIAAAAIRCM
GGAIQAQLAPRDDEERQKAIDAGYDLDQILTTEDLVSGENVFFCATGVTN
GDLLKGVQYYPGGCTTQSIVMRSKSGTVRMIEAYHRLSKLNEYSAIDFTG
DSSAAYPLP
118465742YP_883955.1 hypothetical protein MAV_4831 [Mycobacterium avium 104]MAGHLTMQLEAMASAAHILTNQADGFSSELDSIADDWRNLSSTWQGAAAS
DFRPAWDEWHQGAKAVATLLSEHSQLLLRSLDLMLDHETIAARAFAALSP
TDPES
118465741YP_881776.1 MaoC domain-containing protein [Mycobacterium avium 104]MDDALATIGEELGVSRWVEIDQSRIDAFADVTMDHQWIHVDVEKAKAESP
YGATIAHGFLTLSLIPGVSKDNYRVENAKMGINYGLNKVRFLSAVTAGSR
IRVRSELADATKVADDTVNLTVRHTVEIDGVDKPAAVAELIARFVW
118465740YP_880839.1 hypothetical protein MAV_1605 [Mycobacterium avium 104]MAKALSGLSLARDAARELAMLVPRTVAGLQESTGWAPLSPRGARQFGEVM
LDELVLSAFSLLGGSPAALRPVDACAAAAEELAALGIDGAHAAPNPLRPT
SIRRRSIAGLDYERMAFEHDPALPATLVADGLGGPARAVVHLRRHRDGPR
PWLVWVHGAGQGGTEDLLLSGIGRIHRELGFNIAMPVQPGHGCRRRQWPV
YPDMDPLGNVAGMMRAVSEVRAVVRWARSQASTLVVAGISMGSPVAALVS
HLERQVDAVALYTPILGLNAMIARHLQRWGPARDGFRELLQSPVVTRLTS
VIDPLAVTPAPPPERRLIVGAWHDRMAMREPANALQDRWAGQLYWYDGSH
VGHIFSRRVQRITDRFLRDAVLA
118465739YP_880921.1 ABC transporter permease [Mycobacterium avium 104]MTVAPPAGTASTEAVPQHRTQVWPVLAGVAVLAGCTAAGIGTLSLASALT
ATGLPDPGPVTTLGLPFLRAAGEIAAVLAVGSFLFAAFLVPPQPSGVLDA
DGYRALRLGTVASGVWAVCAALLVPLTLSDVSGHPVADLRPAQMWSLAGL
ITTASAWRWTAILAAAITLASLPVLRWSWAPVLVAASLTTLIPLGLTGHS
SAGGSHDLATNGLLIHLVAAALWSGGLLALLAYALRGGQGGGHLGLATRR
FSAIALWCWVAMALSGLVNAAVRVQPSDLLATGYGRLVLAKAAALCLLGG
VGWRQRRVNVAALQAVSTLARARRALLRLTLIEAALFGLTFGIAVGLGRT
APPPPPARLPSIAEAEIGYDFDGPPTLTRILFDWRFDLIFGTAAIVLAGL
YVAGVVRLRRRGDRWQPGCTSSWLLGCLVLLFVTSSGVGRYMPAMFSMHM
VVHMCLSMLVPILLALGAPVTLALRALPAAGRGDPPGPREWLLAALHSRF
SRLLTNPVVATVLFVAGFYGLYLSNLFDTTASSHAGHLLMNLHFLLSGYL
FYWVVIGVDPTPRPIPPLAKLAVVFASLPLHAFFGVVLMGTRKVLGADYY
RSLGFSWHTDLLGDQRLGGGIAWSAGEFPLVIVMLALLVQWARSDRRTAK
RLDRAADRDDDAELAAYNAMLAQLAGRDKPGEGSATGQA
118465738YP_880873.1 AMP-binding enzyme- putative [Mycobacterium avium 104]MRAPADFGVDRFTVPAVLDRRAEQHPDRVMMSIAGVDVTFAQMRQRSCAA
ANMLSDLGVGRGDRVALFSGTCPEWVYFWLGAARIGAVSAAINAAHKGDF
LLHALRLCRPAVIFTDPEHRSRAERAAAALEGPARIVVQGDSLTATLSRA
ADRAPAEDRGDAGELGCLFYTSGTTGPSKAVATTWHYLFSVAATVAAAWE
FRQGEVLWTAMPLFHLSAAPSVLAPMLVGATTVLAAAFHPREVWDDIRAH
GAVGFAGAGAMVSMLQNLPADPGDARLPLRFISAAPIDARSYRDIEKRYG
CRIVTMYGMTEAFPIAVKALADAGIPGTSGRPNPDFEVRILDAHGNSLPP
DTVGEIACRPRHPHVMSEGYIGDDLAVRPHPEWFRTGDLGRLDRDQNLTY
VDRIKDALRRRGENISSVEVETVVMGHPAVAEAAAVGVPGELGEDDVLVV
VTLRPGATLDCAELLDFCADRMPYFCVPRYVETVPELPKNAIGRIRKDLL
RARGLTTNVWDREKHGYVVRR
118465737YP_879608.1 ABC transporter permease [Mycobacterium avium 104]MNFVQRAIAYLLSADNWTGPVGLAARILEHLEYTGIAVGASALIAVPVGL
LIGHTGRGTLLVVGAVNGLRALPTLGVLLFGTLLFGLGLGPSLVALMLLG
VPALLAGTYAGIANVEPTVVDAARAMGMTESQVLLRVEVPNALPLILGGL
RSATLQVVATATVAAYASLGGLGRYLIDGIKEREFHLALVGALTVAALAL
VLDGLLAVAVWASVPGTGRLRRTYRPLPHRLAGTSYGR
118465736YP_880617.1 hypothetical protein MAV_1373 [Mycobacterium avium 104]MPGLPTPPRGWPVGSYPTYAEAQRAVDYLSDQQFPVQQVTIVGVDLMQVE
RVTGRLTWPKVLGGGVLSGAWLGLFIGLVLGFFSPNPWGALATGLVAGVF
FGLITSAVPYSMARGTRDFSSTMQLVAGRYDVLCDPQNAEKARDLLARLA
I
118465735YP_879454.1 ATPase AAA [Mycobacterium avium 104]MMGDLQTARRHFDRAMAIMSRQGRAAALPEFVAATDADPSMADAWLGRIA
CGDSDLASLRKLYATSEWLHRETTRIGQTLAAEIQLGPYIGITVTDASQV
GLALSSALTIAGEYAEADKLLANRDLLDSWTNYQWHQLARTFLMYRTQRW
PDVLLTAAEELPPQAIIMSAVTASICALAAHAAAHLGQGRVALDWLDRVD
VIGQTQASSRFDADVLTASIGPADIPLLVADLAYVRGMVHRQLGEEDKAQ
IWLSKATINGVLTEAAKEALADPNLHLVITDEQTIDSRTDRWDASSAKSR
DELDDDAAAERRAELLAEGRRLLAKQVGLAAVKQAVAALEDQLEVRMMRL
EHGLPVEGQTNHMLLVGPPGTGKTTTAEALGKIYAGMGIVRHPEIREVRR
SDFCGHFIGESGPKTNELIEKSLGRIIFMDEFYSLIERHQDGTPDMIGME
AVNQLLVALEAHRFDFCFIGAGYEDQVDQFLTVNPGLAGRFNRKLRFESY
SPAEIVEIAHRYATPRASLLDEAARETLLDAATTIRNYTTPGGRHGIDAM
QNGRFARNVVERAEGFRDTRVVAQKRAGQPVTVDDLKIITAADIEAAVRS
VCSDNRDMAAIVW
118465734YP_881879.1 alpha/beta hydrolase [Mycobacterium avium 104]MSCPILFAICENDTVAPAKATQKYAAQAPRGEIKLYDAGHFDIYVGADFE
RNVTDQLNFLSRHVPVS
118465733YP_880236.1 alpha-methylacyl-CoA racemase [Mycobacterium avium 104]MSSGGPLAGVRVIELGGIGPGPHAGMVLADLGADVVRVRRPGVAAMPSED
RDLLHRGKRIVDLDVKARPQALLDLAAKADVLLDCFRPGTCERLGIGPDD
CAAVNPRLIFARITGWGQHGPLAQTAGHDINYLSQTGVLSALGHADRPPL
PPLNLVADFGGGSMLVLLGITAALYERERSGRGQVIDAAMVDGVSLLAQM
MWTMKSTGALRDRRESFLLDGGAPFYGCYETADGKYVAVGAIEPQFFAAL
LDGLGLSPEEVPGQLDRDSYPRMREIFTQRFAGRTRDEWARVFAGTDACV
TPVLTWSEAAASEHLRARSTVITAHGVDQAAPAPRFSHTPARPVGRPPAT
STPLDEINW
118465732YP_883467.1 hypothetical protein MAV_4331 [Mycobacterium avium 104]MTMFSRPAEPAAAEAPGPAPLGGGAVPAKRPPAWSLSNWPVRWKVLAIVL
VPLMLATVFGVLRIHGAMANAAGLRLAAARADVVPAITKYMSALDVALLA
GSAGRDAEGAKKNYEARKNELQTRLGDTDVTDDVRAGVNNLLDTGQMLVN
KVAEGSLGLRERVTFYAPILLTAENVINASVRVDDERIRAQAQGLSRAVG
ARGQMTMQKILVTRGAELPEPQLRTSMATLAGTEPSTLFGMSEVLGAGSP
EAKTLQQQMVSRMAIMSDPASVLVDNPDLLRSIQTTDDIADQVIKNTTAS
VTKSVHAQAAERRNSAILDTALVLAAIVIALAVVLLVARALVRPLRTLRD
GALKVAHTDLEEEIAHVKAGGAEPIPAPLPVYTTEEIGQVAHAVDELHTQ
ALLLAGDEARLRLLVNDMFETMSRRSRSLVDQQLALIDRLERNEDNPERL
DNLFRLDHLAARLRRNSANLLVLAGAKLARDQRDPVPLATVINAAVSEVE
DYRRVEIAGLPECSLLGAAAGGAIHLFAELIDNALRYSPPTTSARVSASR
GGDGGVVVRIADSGLGMNDADRRIANMRLQAGGDANPDPHPENARHLGLF
VVGRIAAWHGMRVGLRGPAANESGSGTTAEVYLPPTVLAGRVVAEPSGPR
HIRAVSSPSAKLASAIAAPAEEGGRHDGTQQPAARGTRNTGDASTPPVTL
LPRRNPGSSGIADVAAVPAPPAEPQPRRQRRELATPWWEASPAPRPAPEP
QQPAPEPQQPAPRPARAASDTSAFFAARPRTETPPETPPEAPPKPAPKPK
PEASIPPAASTGPADDDVIYRRMLSEMLGDPHDLVNSPDLDWQSVWDRGW
TLAAAAEDKPVESHTTDHGLPVRTPGARLVPGGAHGAAAEPDDEPGLNGR
SPAPRRPQHAAVARDPEAVRASFSSHFGGVRTGRSHARESSEGPDQQ
118465731YP_881301.1 ornithine--oxo-acid transaminase [Mycobacterium avium 104]MTILDGQLTATRVDSAIRLAEKRAAHNYSPLPIVAASAQGAWITDVDGRR
YLDCLSAYSAVNFGHRHPEIVATAHAQLDTVTLVSRAVHSDKLGPFCAAL
AYLCDKDMVLPMNSGAEAVESGLKVARKWGAEVKGVPAGQANIIVADNNF
HGRTISIVSFSSDAAARDGFGPFTPGFRSVPFGDAGALAQAIDDNTVAVL
LEPIQGEAGIVVPPDDYLPAVRALCSEHNVLMIADEIQSGLARTGYTFAC
DRWRVVPDVYLLGKALGGGVVPLSAVVADREILGVLHPGEHGSTFGGNPL
AAAIGTTVVSMLARGEYQARATALGAHLQRRLRALVGHGVDEVRGLGLWA
GVDIDPSLGSGRQMSLRLAERGVLVKDTHGATLRFAPPLVVTAQEIDWAV
GQLAAVLREAAS
118465730YP_880352.1 hypothetical protein MAV_1099 [Mycobacterium avium 104]MGESSLNPSVLSRLSVWLRPDWTRTVLARRIAAGTLVVLAAIAALRSDPA
GDYAPVVVAEHDLRPGAALTAADVRLEKRLAATVPEGSPAEIGAVLGSTL
AGPARRGEVLTDVRLLGSRLAEAAVGSKAAAGARIVPLHPADGALIDLVR
PGDVVDVLAAPANTSAETTHAAPKVLATDAVVVLVSAREKIQAAGADRVV
LVALPAGVANTVAGAALGQTVTLTLH
118465729YP_881824.1 hypothetical protein MAV_2633 [Mycobacterium avium 104]MTNVEASPAITLDQEIGRREELADRYTGIHFLEDMGAGIFGKAKGENVLL
IALHYRVGGSVWGVGDTIINNTTFHAAPYDRQKIEDNDFISHRIDPIHRV
DDYTITKETDRVVWQAGDRAIIARPPFWDITGEHLGVDVDVTMERTSEPD
WYIGTWEDLPTEGRGGRDFWAKTSGTITARGKKYELEEHSYSINEHLVFG
ENWVVEARSFPVQYFYHLYRSDELQIFLYARPDSGVVYSRVVFTDGKEIF
YDWDQVTVEEEEYWFDPQTHTRPPVKFRVKLDSPEGRVELALTAYSRSIY
SFQLSEGTRTHYNYFVHSQGQFTSPDGKTIPIKDSENDTCFAEWGLTSPL
GSGAPLLTP
118465728YP_883507.1 alanine racemase [Mycobacterium avium 104]MAVTPISLTPGVLAEALVDLGAIEHNVRLLCEQARGAQVMAVVKADGYGH
GAVQTARAALAAGAAELGVATVDEALALRAAGISAPVLAWLHPPGIDFRP
ALLAGVQIGLSSQRQLDELLTAVRDTGRTATVTVKVDTGLNRNGVPPAQY
PSMLTALRRAVAEQAIVPRGLMSHMVYADQPANPVNDVQAQRFTDMLAQA
REQGVRFEVAHLSNSSATMSRPDLAFDMVRPGIAVYGLSPVPELGDMGLV
PAMTVKCTVALVKSIRAGESVSYGHTWTAQRDTNLALLPVGYADGIFRSL
GGRLQVSINGRRRPGVGRICMDQFVVDLGPGRPDVAEGDEAILFGPGSNG
EPTAQDWADLLGTIHYEVVTSPRGRITRTYREAHTVES
118465727YP_884412.1 thioredoxin [Mycobacterium avium 104]MTDAEKAIATIEVSDASFSTDVLASNKPVLVDFWATWCGPCKMVAPVLEE
IASERGDHLTVAKLDVDANPETAQNFQVVSIPTLILFKDGQPVKRIVGAK
GKAALLRELSDAVPNLG
118465726YP_882546.1 6-7-dimethyl-8-ribityllumazine synthase [Mycobacterium avium 104]MSPAAGVPEMPALDASGVRLGIVASTWHSRICDALLAGARKVAADSGVEN
PTVVRVLGAIEIPVVAQELARNHDAVVALGVVIRGQTPHFEYVCDAVTQG
ITRVSLDASTPVANGVLTTDNEQQALDRAGLPDSAEDKGAQAAGAALSAA
LTLRELRARS
118465725YP_880588.1 major facilitator family protein transporter [Mycobacterium avium 104]MGEPSARATTPGTPMRRIAAACLVGSAIEFYDFLIYGTAAALVFPAVFFP
RLGPTVATIASMATFATAFLSRPLGAAVFGYFGDRLGRKKTLVATLLIMG
ASTVSVGLVPSTASIGIAAPLLLTVLRLLQGFAVGAEWAGSVLLSAEYAP
TDRRGWYGMFTLLGGGTAGILASLTFLAVNLTMGEHSPAFMHWGWRVPFL
ISSGLIGIALYVRLNIDETPIFVEEKARHLVPKAPLTELLRLQRREIILV
AGSFVGGMGFIYLGNTFLVMYAHNHLGYSRSFIWGIGALGGLTSMACVAC
SAWISDRVGRRRVMLWGLVACLPWAFVVIPLIDTGRPVCYVVAVLGMFGT
AAVANGPTAAFVPELFATRYRYSGAAVAMNLAGIVGAAVPPLLAGTLLAT
YGSWAIGLMMASLVLASFVSVYLLPETRGAALDAAAAAEKVAAR
118465724YP_880778.1 hypothetical protein MAV_1542 [Mycobacterium avium 104]MEAGPDGHDYEVRPIAAARAVKTYRCPGCDHEIRSGAAHLVVWPVEPTLG
GAEDRRHWHTGCWAHRATRGPTRKWS
118465723YP_882783.1 soluble pyridine nucleotide transhydrogenase [Mycobacterium avium 104]MSSPQEYDMVVIGSGPGGQKAAIASAKLGKSVAVVERGQMLGGVCVNTGT
IPSKTLREAVLYLTGMSQRELYGASYRVKEKITPADLLARTQHVIGKEID
VVRNQLMRNRIDLLIGHGRFVDPHTIEVEDPSRREKITISGKYVVIATGT
RPARPSGVEFDEDRVLDSDGILDLKSLPTSMVVVGAGVIGIEYASMFAAL
GTKVTVVEKRDDMLDFCDPEVVEALKFHLRDLAVTFRFGEEVTAVDVGSA
GTVTTLASGKQIPAETVMYSAGRQGQTDHLDLHNAELEADNRGRIFVDDN
FQTKVPHIYAVGDVIGFPALAATSMEQGRLAAYHAFGEASDGITELQPIG
IYSIPEVSYVGATEVELTKDAIPYEVGVARYRELARGQIAGDSYGMLKLL
VSTQDLKVLGVHIFGTSATEMVHIGQAVMGCGGTVEYLVDAVFNYPTFSE
AYKVAALDVMNKVRALNQFRR
118465722YP_883186.1 NADH dehydrogenase subunit B [Mycobacterium avium 104]MGLEEQLPGGILLSTVEKVAGYVRKNSLWPATFGLACCAIEMMATAGPRF
DIARFGMERFSATPRQADLMIVAGRVSQKMAPVLRQIYDQMAEPKWVLAM
GVCASSGGMFNNYAIVQGVDHVVPVDIYLPGCPPRPEMLLYAILKLHEKI
QQMPLGVNRETAIAEAEQAALSARPTIEMRGLLR
118465721YP_881139.1 acyl dehydratase [Mycobacterium avium 104]MSTAAAILATTIPGEHVRIAVNKDTEPFWQAAKERRLVAPQCADCQTFRL
PPTPFCPTCQSKAVNWVELSGAATVYSFAVVHGVPGMPDLVLVPAVLDLA
DAPGARLVSNVVDVAPADVFIGMSLRVDFSPIADGWLLPIFRVDQSAKE
118465720YP_879945.1 UDP-forming alpha-alpha-trehalose-phosphate synthase [Mycobacterium avMAPGGGRGSKTASYGNSDFVVVANRLPVDQERLPDGSTAWKRSPGGLVTA
LEPLLRRQRGAWVGWPGIVDEDVDHEDDPIVQDDLELRPVKLSADDVAEY
YEGFSNATLWPLYHDVIVKPIYHREWWDRYVAVNRRFAEATSRAAARGAT
VWVQDYQLQLVPAMLRELRPDLTIGFFLHIPFPPVELFMQLPWRTEIVKG
LLGADLVGFHLTGGAQNFLFLSRRLIGANTSRGAVGVRSRYGEVELESRV
VRVGAFPISIDSTALDQTARHRDIRRRAREIRAELGNPRKVLLGVDRLDY
TKGIDVRLKAFSELLAEGRAKRDDTVLVQLATPSRERVDSYQQLRNDIER
QVGHINGEYGEVGHPVVHYLHRPVPRNELIAFFVAADVMLVTPLRDGMNL
VAKEYVACRSDLGGALVLSEFTGAAAELRQAYLVNPHDLEGVKDTVEAAL
NQSVEEGRRRMRSLRRQVLAHDVDRWARSFLDALAESGPRDG
118465719YP_883624.1 elongation factor G [Mycobacterium avium 104]MAQKDVLTDLTKVRNIGIMAHIDAGKTTTTERILYYTGISYKIGEVHDGA
ATMDWMEQEQERGITITSAATTCFWNDNQINIIDTPGHVDFTVEVERSLR
VLDGAVAVFDGKEGVEPQSEQVWRQADKYDVPRICFVNKMDKIGADFYFS
VRTMEERLGANVIPIQIPVGSEGDFEGVVDLVEMKAKVWSAEAKLGEKYD
VVDIPADLQEKAEEYRTKLLEAVAETDEALLDKYLGGEELTIEEIKGAIR
KLTISSEAYPVLCGSAFKNKGVQPMLDAVIDYLPSPLDVPPAEGHVPGKE
EELITRKPSTDEPFSALAFKVATHPFFGKLTYVRVYSGKVDSGSQVINST
KGKKERLGKLFQMHSNKENPVETASAGHIYAVIGLKDTTTGDTLSDPNHQ
IVLESMTFPDPVIEVAIEPKTKSDQEKLSLSIQKLAEEDPTFKVHLDQET
GQTVIGGMGELHLDILVDRMRREFKVEANVGKPQVAYKETIRRKVENVEY
THKKQTGGSGQFAKVIINLEPFTGEDGATYEFENKVTGGRIPREYIPSVD
AGAQDAMQYGVLAGYPLVNLKVTLLDGAFHEVDSSEMAFKIAGSQVLKKA
AAQAQPVILEPIMAVEVTTPEDYMGDVIGDLNSRRGQIQAMEERSGARVV
KAHVPLSEMFGYVGDLRSKTQGRANYSMVFDSYAEVPANVSKEIIAKATG
Q
118465718YP_879463.1 hypothetical protein MAV_0169 [Mycobacterium avium 104]MRFAFKTSPQNTTWAQMLAVWQAADDIDVYESGWTFDHFYPIFSDSSGPC
LEGWTTLTALAQATKRLRLGTLVTGIHYRHPAVLANMAAAVDIISGGRLE
LGIGAGWNEEESGAYGIELGSIRERFDRFEEACAVLTSLLSQETTDFDGK
FYQLKGARNEPKGPQRPHPPICIGGSGEKRTLRITARYAQHWNFVGGPPD
VFAHKRDVLASHCADIGRDPKEILLSAHLRLEPDLDYGKVIDDAAALAAE
GLDLGIVYLPPPHDPAVLEPLAEAIRDSGLLRS
118465717YP_880570.1 adenylylsulfate kinase [Mycobacterium avium 104]MSNNITWHEHKISRGEREQLNGHKGCVIWFTGLSGSGKSTVANVVEQKLY
ERGIRSYLLDGDNVRYGLNAGPDLLEERHGPEFAQRFGLGFSAQDREENI
RRIGAVAKLFCEAGIIALTAFISPYVRDRDAIRATLDDGDFQEIFIDTPI
EICEKRDPKGLYKKARAGEIKGFTGIDDPYEAPPRPELRLDGAAKDAETL
AEEVIAHLERVGVIATDGLAHTRGRDEVTA
118465716YP_884386.1 hypothetical protein MAV_5274 [Mycobacterium avium 104]MGYSAADESFTHQLPTTFDQVHDADPTWSDRCYFFAAAPDGTMLLASGYG
NNPNTASGLGYVKVSLADGRHWDLLSGRPVTGDDRGELRAGPMRWTCVEP
LKKWRLDVGPNNSGIEWELYYEPTAPMWELLPMKVSGPDGRLLADMYHMK
EPGRWSGWVRIDGQRVSVDGFHGGRDRTFGVRVSDRIDFWLWLDAGFGDH
AIEAWVIESCDGTVLYADGGITYADGTLSKRFVKIEHEVEFDGERKRPAR
AVLVFTDEDGRAHRVVAEAPHPQVNAYYGLPMAHCHYEDLGGGSYFIHFA
WDSSDPEQLSETEDKSMALDQLMRFERDGHTGWGIFELLLGGQGYRRYPN
WRAMDMSAFTQDKTPVDRLPADGDGADR
118465715YP_883466.1 roadblock/LC7 domain-contain protein [Mycobacterium avium 104]MTAPDNSWSAAPDRSLDWLVTKFAREVPGVAHALLVSVDGLPVAASEHLP
RERADQLAAVASGLASLATGAAQLFEGGQVLQSVVEMSNGYLLLMQVGDG
SHLATLAAASCDIGQIGYEMAVLVERVGGVVQSTRRSSVS
118465714YP_882573.1 hypothetical protein MAV_3391 [Mycobacterium avium 104]MNSGTLVGSLIFAAVLVVVIAVVIQLMMRGWVRRARRQAELIGELPGVPD
KVGTATATLQGVYVGCTLSPAWNDRVTAGDLGYRSKAALTRYPEGILLER
IRATPIWIPQQSISAVRTERGMAGKVAARNSILAIRWRLPSGVEIDTGFR
ANNRGEYDGWLQPGREERRS
118465713YP_880790.1 glutamate racemase [Mycobacterium avium 104]MSSALAPVGIFDSGVGGLTVARAIIDQLPDEHIIYVGDTGHGPYGPLSIP
EVRAHALAIGDDLVGRGVKALVIACNTASAACLRDARERYEVPVVEVILP
AVRRAVATTRNGRIGVIGTQATINSHAYQDAFAAARDTEITAVACPRFVD
FVERGVTSGRQVLGLAEGYLEPLQRAQVDTLVLGCTHYPLLSGLIQLAMG
DNVTLVSSAEETAKEVLRVLTERDLLHPHPDDPRAAGPSRVFEATGDPEA
FTRLAARFLGPAVSGVRPVHHVRID
118465712YP_882374.1 quinolinate synthetase [Mycobacterium avium 104]MTVLNRMDTLAEDMVADITDSPTGYTGVDGDAQWAAEVRRLAKLRGATIL
AHNYQLPEIQDVADHVGDSLALSRIAAEAPEDTIVFCGVHFMAETAKILS
PDKTVLIPDQRAGCSLADSITPEDLRAWKDEHPGAVVVSYVNTTAAVKAL
TDICCTSSNAVDVVASIDPDREVLFCPDQFLGAHVRRMTGRENLHVWAGE
CHVHAGINGDELGERARANPDAELFVHPECGCATSALYLAGEGAFPADRV
KILSTGGMLDAANTTSARKVLVATEVGMLYQLRRAAPQVDFQAVNDRASC
RYMKMITPAALLRCLVEGADEVHVDPGIAAAGRRSVQRMIEIGQPGGGE
118465711YP_880542.1 hypothetical protein MAV_1297 [Mycobacterium avium 104]MPNIPQQLISSAANAPQILQNLATALGATPPAPPATPGISFPGVPAAGSP
VSASSPAAVPSIPGLPQAAAPSAPSTATGGIPGMIQGLTGAQPSAAAPAA
PASSSIPGLPAIPGLSAPAAPATPPAPQLPQAQVNMPAMPAGLPVSVPAQ
VTLPKDLPALASGQAPGAPAAPAAPAAPAPAASPAGPVAPLLAALP
118465710YP_883674.1 exodeoxyribonuclease V- beta subunit [Mycobacterium avium 104]MERFDLLGALPAARSTTVLEASAGTGKTFALAGLVTRYLADGAATLDQML
LITFGRAASQELRERVRCQIVDAVAAFADPSRAGDNELVAYLLDGTEDRL
AARRQRLRDGLAGFDAATIATTHQFCQLVLRSLGVAGDTAAGVTLLDSLD
ELVAEIVDDLYLAHFGQDHDDPVLHYREALRLARDVVNNPSAQLRPLHPE
PGSRAAVSLRFANDVLAELDTRKRRLGVLGYDDLLTRLADALATEHSPAR
LRMHQRWPIVMVDEFQDTDPVQWQVIDRAFSGRSTLILIGDPKQAIYAFR
GGDIVTYLRAAETAGQKKTLDTNWRSDSALLQRLQVVLRGAQLGDPAIVV
NDVAAHHRGHRLSGAPRNDPFRLRVVSRNTLGRRGIANLPIDELRQHIGA
DLAADIRALLAAGATFDGKPVRAGDIAVIVERHRDAQACFTALCDAGVPA
VYTGNSDVFTSQAAEDWLCLLEAFDQPHRPGVVRAAAATMFFGETAETLA
AGGDALTDRIAQTLREWAGHARERGVAAIFEAAQLLGMGNRVLGWQGGAR
HMTDLAHLTQLLGEVAHCEHHNLPALRDWLRRQRDERSGAPERNRRLDSD
AAAVQIMTVFVSKGLQYPIVYLPFAFHRNTTDSDVVLFHDEDGTRCLHVG
GKDSPDFKTVERLGRKEDASDDSRLTYVALTRAQAQVVAWWSPAYHEPNG
GLSRLLRGRRPGEPVVPDRCEPAKISDEDALARLREWEAAGGPVIEEAVP
APAPPLPGVPVPARLENRHFHRGIDTGWRRTSYSGLIRQAQPSGVGSEPE
AAGLDDEVGDILLAPATSVGDVASPMADLPAGATFGTLVHAVLQTADPFA
PDLAAELTARIREHSVWWPVAATPEDMAAAMVPMHDTPLGPLAGGLTLRR
IGLSDRLCELDFELPLAGGDRRSAPPEVRLADLAPLLRAHLPADDVLACY
ADRLTDRSLGAESLRGYLTGSIDAVLRIPDGAGHRYLVVDYKTNRLGDAQ
HPLTAADYDRPRMVEAMLHSDYPLQALLYSAVLHRFLRWRLAGYDPDRHL
GGILYLFVRGMCGPDTPVRDGHPSGVFDWRPPSSLIAALSDLLDAQGVAV
118465709YP_879315.1 hypothetical protein MAV_0014 [Mycobacterium avium 104]MFAGMSWRARPKLAITPDGLAVRGWYRTQVLPRPDIKIIRIIEFRRYGRT
VRLLEVESADGDPVVLSRWDLGADPLQVLDALTAAGYAGPRQR
118465708YP_882965.1 hypothetical protein MAV_3793 [Mycobacterium avium 104]MRSADRQTGKSYSRQEFTAWLVESCERQHVAVTITNPAVLADIATLLR
118465707YP_881600.1 ATPase AAA [Mycobacterium avium 104]MTKILTFRGYLTTHINRQSPVALKYPPRQFGVGKERKMGSSERSEAFGTP
RESDMSSGDEAELEELRREAAMLREQLEHAVGSHGGARSARDVHQLEARI
DSLAARNSKLMETLKEARQQLLALREEVDRLGQPPSGYGVLLATHEDDTV
DVFTSGRKMRLTCSPNIDVSLLRKGQTVRLNEALTVVEAGTFESVGEIST
LRELLADGHRALVVGHADEERIVWLAEPLVADNLPDGHPDALNDDTRPRK
LRPGDSLLVDTKAGYAFERIPKAEVEDLVLEEVPDVSYEDIGGLTRQIEQ
IRDAVELPFLHKELYREYALRPPKGVLLYGPPGCGKTLIAKAVANSLAKK
MAEVRGDDAREAKSYFLNIKGPELLNKFVGETERHIRLIFQRAREKASEG
TPVIVFFDEMDSIFRTRGTGVSSDVETTVVPQLLSEIDGVEGLENVIVIG
ASNREDMIDPAILRPGRLDVKIKIERPDAEAAQDIFSKYLTEELPLHADD
LAEFGGDRTACIKAMIEKVVERMYAEIDDNRFLEVTYANGDKEVMYFKDF
NSGAMIQNVVDRAKKNAIKSVLETGQPGLRIQHLLDSIVDEFAENEDLPN
TTNPDDWARISGKKGERIVYIRTLVTGKSSSASRAIDTESNLGQYL
118465706YP_880080.1 hypothetical protein MAV_0807 [Mycobacterium avium 104]MTAPSPTPFLDLAGFTALWDGPPLTVQQRAIVTLLLQVASNWIYNNGPQG
ANLPADDPSAQFVVWDVVSSAVRYQRYSKLASFSRTTGHRMDGGSFSDPM
RALEFTNVHKQLLGIPLEAVPMTSCCPNDFDADDPDQGWPTWWSDQFGNQ
GWDYWDVNNE
118465705YP_883662.1 hypothetical protein MAV_4531 [Mycobacterium avium 104]MRKKVEIEVDLELVDEAIRRFHLADAREAVNLALRTLLHEGDSVASEDEY
DEFSDLSAWQPRRNAESG
118465704YP_879784.1 transposase [Mycobacterium avium 104]MNSRVLKALKDLRREKAPISISSVARRADVTRKSIYHRPTLLALIETHRT
VTVVPDEPAPAAAGPESSIVAALRLRLTAKDAQIAELKAALRERDQTIAV
LHGEIDKLHAGS
118465703YP_881353.1 glycosyl transferase [Mycobacterium avium 104]MRVVQVANFYGPRSGGLRTAVDRLGAEYCAHGHEVFLIVPGQRTERARLY
TGVVRITLPARLIPFTGGYRAVLPGPVKALLEALRPDALEVSDRLTLRSL
GRWGRDHGVTTVMISHERLDRLVGQVLPRRAAQKFADLANARTAADYDTV
VCTTGFAREEFDRIGAGNTVTVPLGVDLQTFHPRHHSQLVRRRWAAPTQL
LLVHCGRLSVEKRVDRSIDALGELCHAGVDARLVVVGEGPLRARLQRQAA
RLAVDFTGFISDRTTVAQLLASADVTLAPGPHETFGLAALESLACGTPAV
VSRTSALTEIVTPDSGASAANDPAAIARAVSAIVSRPERQRRISARRRAE
DFTWHRAAAGMLASLRAPVFDDPGGDSEQTA
118465702YP_881679.1 NtrC protein [Mycobacterium avium 104]MTATVDGATGLLDAALVEDIRAHAAVLDRGQDSARRSFTALGEAGVLGIG
APGNRDGRLPVMAEVIRSISGICMSTGFSLWAHRMTVEYLLTAATPFSAV
AVRPLLRGSVLGVTGMAAAFKEAAGCGSMELTATPVAGGYRVSGPIRWAS
NLYPDSTMVTAVRTEAGERLIVAVPLDTPGVILGEHFDLLALGSTASSYL
NFDGAHIADEQVLSRDFDGFLQAVRPTFLVLQSAMCLGLSRTAVRQAGFG
LGGVNAVFRADVEAITEKLGAAEETLAKLAAAVGGPAAPSKKELLSLRLA
AAELAAASADVEIRTAGGKGYASRTSASRRYREAAFIPVQSPSEAQLRWE
LAGCG
118465701YP_880461.1 serine hydroxymethyltransferase [Mycobacterium avium 104]MTAAPDARPTASDTASLMSAPLADIDPDIAGLLGQELGRQRDTLEMIASE
NFVPRAVLQAQGSVLTNKYAEGLPGRRYYGGCEYVDVVENIARDRAKALF
GADFANVQPHSGAQANAAVLHALMTPGERLLGLDLANGGHLTHGMKLNFS
GKLYDVGFYGVDPTTHLIDMDAVRAKALEFRPKVIIAGWSAYPRVLDFAA
FASIADEVGAKLWVDMAHFAGLVAAGLHPSPVPHADVVSTTVHKTLGGPR
SGLILGKQEYAKSINSAVFPGQQGGPLMHVIAAKAVALKIAGTEEFADRQ
RRTLSGARILAERLSGADVAAAGVSVVSGGTDVHLVLVDLRNSELDGQAA
EDLLHEIGITVNRNAVPNDPRPPMVTSGLRVGTPALATRGFGDAEFSEVA
DVIATALAGGRGADLAALRDRVTRLARDFPLYEGLEDWALVGR
118465700YP_879932.1 acyl-CoA dehydrogenase [Mycobacterium avium 104]MRISYTPEQEDLRRELRSYFTKLMTPERREALSSTQGEYGVGNVYRETVA
QMGKDGWLTLNWPKEYGGQDRSPMDSLIFTDEAAIAGAPVPFLTINSVAP
TIMAFGTDEQKKYFLPKIAAGELHFSIGYSEPGAGTDLANLRTTAVRDGD
DYVINGQKMWTSLIAYADWVWLAVRTNPEAKKHRGISMLVVPTTAEGFSW
TPVHTMAGPDTSATYYSDVRVPVTNLVGEENGGWKLVTNQLNHERVALVS
PAPIYLALREVREWAQNTKDASGARLIDSEWVQINLARVHAKAEVLKLIN
WELASSDGHALGPADASAAKVYGTELATEAYRLLMEVLGTGATVRQDSPG
ALLRGRVERMHRACLILTFGGGTNEVQRDIIGMVALGLPRNR
118465699YP_880399.1 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [Mycobacterium aviumMSDGNTAAAWVPTGSVTVRVPGKVNLYLAVGDRREDGYHELTTIFQAVSL
LDEVTVRNADVLSLDIVGEGADKLPTDERNLAWQAAELMAEHVGRAPDVS
IMIDKSIPVAGGMAGGSADAAAVLVAMNSLWELNVPRRDLRMLAAQLGSD
VPFALHGGTALGTGRGEELATVLSRNTFHWVLAFADGELLTRKVFAELDR
LRRAGDPPRLPGPGPVLAALAAGDADQLAPLLGNEMQAAAVSLNPGLRRT
LRAGVQAGALAGIVSGSGPTCAFLCPSAAAAVDVGTEVSGVGVCRTVRVA
SGPVAGARVVPAPTEV
118465698YP_882051.1 hypothetical protein MAV_2865 [Mycobacterium avium 104]MAIRLGLQIPNFSYGTGAEQLFPTVIAQAREAESAGFDSVFVMDHFYQLP
MLGSPDQPMLEAYTALGALATATERVQLGTLVTGNTYRNPTLLAKIITTL
DVVSQGRAILGIGTGWFQLEHDQLGFEFGTFTDRFNRLDEALEIILPMIR
GERATFEGKWYRASDAFANPRYRDRIPLMIGGSGEKKTIPLAARHFDHLN
VIAGFDELPRKLDAVRRACEQVGRDPATLETSTLTTVMIDDNASLDQIPA
EMTQRMVVGNPDSVADQIKTKVIDAGIDSVIINLPFYTPGIVQAAGEALR
PLVGA
118465697YP_882003.1 antigen 85-B [Mycobacterium avium 104]MTDLSEKVRAWGRRLLVGAAAAVTLPGLIGLAGGAATANAFSRPGLPVEY
LQVPSAGMGRDIKVQFQSGGNGSPAVYLLDGLRAQDDYNGWDINTPAFEW
YYQSGLSVIMPVGGQSSFYADWYQPACGKAGCSTYKWETFLTSELPSYLA
SNKGVKRTGSAAVGISMSGSSAMILAVNHPDQFIYAGSLSALLDPSQGMG
PSLIGLAMGDAGGYKADAMWGPSSDPAWQRNDPSLHIPELVGHNTRLWVY
CGNGTPSELGGANMPAEFLENFVRSSNLKFQDAYNGAGGHNAVFNFNANG
THSWEYWGAQLNAMKPDLQGTLGASPGGGG
118465696YP_881960.1 hypothetical protein MAV_2771 [Mycobacterium avium 104]MRYWSGEMPTRRMKLRRIVSAVPKPHRAAMVTTVSSVSYN
118465695YP_882681.1 hypothetical protein MAV_3499 [Mycobacterium avium 104]MGDPLTKSRKLLAPSAGESAGRRRAVLRLLRASPEPMSIAGIADVLGVHP
NTVRFHLDSLVADGQVEHVELDRKGPGRPPLMFRAVRQMDRGGTRHYRLL
AEILAKAFAAETDPAPKALAAGRAWGQQLDAERRRLPRDAAGAEQAIAQL
VDVLDELGFAPERRVIDGEQQVGLRHCPFLELAENSSNVVCPVHLGLMQG
AMESWGAPVSVDRLDPFVEPDLCLAHLTLQGADR
118465694YP_881765.1 feruloyl-CoA synthetase [Mycobacterium avium 104]MLLEMAASGDPDRVAVVDGDIRLTTVDLSELADGGAGVIAASGASHVAYV
GTGGVLLPLLLFSSARANTAFTPLNYRLSPEGLRELIDRLPSPLVVVDAE
YRDIGAGFGQRVMTSDEFIEAARSTEPVSVFADPDDVAVVLFTSGTTSRP
KAVELTHNNLTSYVTGTVEFGSADPADAALVCVPPYHIAGVGAALSNLYA
GRAIVYLRRFDPHEWVRLVRDERVTTATVVPTMLSRIVAVLEEQSAELPT
LRNFAYGGSKVARPLVRRALDLLPQVGFVNAYGLTETSSTIAVLTPEDHR
LAHEARDDAVARRLTSVGRPVPGIEVQIRAEDGTVLGPGETGELFVRGPQ
VSGRYTEIGSVLDDHGWFATRDVAMLDEDGYLFIGGRSDDTIIRGGENIA
PSEVEDVLIEHPDVREVVVVGLDDAEWGQAIVAVIVPESGTAPAPERLRE
FARSKLRGSRTPDRIVFRDELPTTPTGKVLRREILEDLKPAAAEH
118465693YP_884398.1 hypothetical protein MAV_5287 [Mycobacterium avium 104]MGGPGGIIKNDLPTTTAIVGGPPASIPRPFPVPPGGTSPADAGQGMVGGA
GNANVPKDAADAAAADADRKARAADAAAKFPANEANGSQEMQMLQQMLSS
VTGALGGAMGGVMGPLTQLPQQAMQAGQSALQPLMSAVQGAHGAASLADN
AHLVDSVGGAGSGLGGGAGAGGGGAGLGGGGTVPTSSLGPPPVPTSSPPT
TPAGAKAAMMPPTGGMPAMPGQTGMTGMPMMPPGAMGAGGEGGNKDKPVE
KRVTAPGVPNGQPVKGRLTIPPSAPGSKPGEAKPTVVTNRPNRRIVIMPS
DDEPKE
118465692YP_881798.1 flavin reductase-like domain-containing protein [Mycobacterium avium 1MTLNLAAADKVLAGLRPFPVAVTTIDGGFANGLMSLSAGSASIVPELPRA
TVSLTKYNRTHDMLVNSGIFVMHMLSAGPHEIEKSMEILMTLGGSSGRDG
DKISKLRSKPGVTGAPILLDAHSYVECRITGSLDNDENTIFVGDVVAAEV
FSSEQRLRIGEAWGKLPHEWIEQYEANHEPQLQSARDLRAAAAARV
118465691YP_880957.1 50S ribosomal protein L27 [Mycobacterium avium 104]MAHKKGASSSRNGRDSAAQRLGVKRFGGQIVKAGEIIVRQRGTKFHPGTG
VGRGGDDTLFAKQAGAVEFGIKRGRKTVNIVAAGQAAD
118465690YP_880092.1 gp75 protein [Mycobacterium avium 104]MTSTADLALHLAANVHAIARRPDAGACYTQIKTIVDDIERVINRPPAPRF
CGQCDTMIERKICGLALYAPRDAIEVTCPNPLCRTTHNIERLYNRTLNNA
DNKTFPREVLIGNQRTDADRYTTGIMGELGEFVHWRTFARWVREHQLKPA
IWVRPNGRRVFTRHSSEDTPEYRLADVRKVKRHMDRKTGKAKTAKTTD
118465689YP_883748.1 hypothetical protein MAV_4619 [Mycobacterium avium 104]MSARVLAMAGAVLAGLLTGCSSGHDAVAQGGTFEFVSPGGKTDIYYDPPS
SRGRPGPLSGPDLADPAHTLSLDDPIFAGRVVVINIWGQWCGPCRSEVSQ
LQQVYDATRGAGASFLGIDVRDNNRQAALDFVNDRHVTFPSIYDPAMRTL
IAFGGKYPTTVIPSTLVLDRQHRVAAVFLRELLATDLQPVVQRVAQQ
118465688YP_882583.1 hypothetical protein MAV_3401 [Mycobacterium avium 104]MTLIHNTRVDVPVTIDESLCIEGCTLCVEVCPLDALAIDTDTGKAYMHVD
ECWYCGPCAARCPTGAVTVNMPYLLR
118465687YP_883144.1 hypothetical protein MAV_3988 [Mycobacterium avium 104]MYHTRAGGRDASAARLYEDEAMRMLALLAGFAALAGMAAPAHADPAGTTG
SDASFLAALNQAGITYQNPATAIEVGKRACELMDQGSPQVEVIKNVSSSN
PGFTVDGAAQFTMIAASAYCPQHLGQRVGPG
118465686YP_879337.1 hypothetical protein MAV_0037 [Mycobacterium avium 104]MTTDKTGAQTTVSLQDGKYTIAVEGKPVGLADFKDRGDQRVFYHTEIDPA
YGGRGLATILVEEALNEARNEGKRIVPVCSMIGTVLKKHPEFDDITDPVT
PEITQWVHS
118465685YP_881204.1 transcription elongation factor GreA [Mycobacterium avium 104]MTSDTIASSTSQYHRGLRDELSALRSQRSVEVPDDFMDYRPGRAARPSVR
RNRIRVLEELLAAGPGSGDRAAQAVAAPGMVLTIRYDATGETETFLLGRR
NGGGGRVKVYSMASPLGRSVAGARPGEQRIYAIPNDTGRVVTLLKVVPYA
GGDSKPRSPQDIQRCADAGLADERRQA
118465684YP_880251.1 hypothetical protein MAV_0991 [Mycobacterium avium 104]MTDNTPDIPLGSWLAELSDERLIRLLELRPDLAQPPPGSIAALAARAQAR
QSIKAATDDLDFLRLAVLDALLVLQADVQPVPTAKLLALIGERAAETEIL
DALDDLRQRVLVWGDGALQVAADAGSGMPWHPGQVILEDSSRSAEQIAAL
IDDLDPAQLDVLEKLLDGSPMGRTRDAAPGAPADRPVPQLLAMGLLRRLD
AETVILPRHVGQVLRGEQPGPLQLSAPDPVVSTTTAEDADAAAAGAVIDL
LRELDVLLETLSAAPVSELRSGGLGVREVKRLSKTTGIDEQRLGLILEVA
AAAGLIASGMPDPEPATGEAPYWAPTTAADRFAALSTAERWQLLAGSWLD
LPGRPALIGGRGPDGKPYGALTDALYSTAAPLDRRLLLGMLSELPPGAGV
DATSASAALIWRRPRWAKRLQPEPVADLLREAHALGLVGRGAISTPARAL
LEEDADPQAAIDAMARALPKPVDHFLVQADLTVVVPGPLQRDLAEELATV
ATVESAGAAMVYRVSEQSIRHALDIGKTRDWMHAFFADHSKTPVPQGLTY
LIDDVARRHGQLRIGMAASFVRCEDPALLAHAVAAPATEDVALRILAPTV
AVSPAPIGEVLAALRAAGFAPAAEDSTGAIVDVRPRGARVATPQQRRAYR
PVRRPNTESLHAVVAVLRRVTAAPFGNVRVDPALTMTLLQRAAKEQDTLV
IGYLDAAGVATQRVVSPISVRGGQLVAFDSASGRLRDFAIHRITSVVSAT
GR
118465683YP_882611.1 hypothetical protein MAV_3429 [Mycobacterium avium 104]MVDSARRERAEPEAVGPPRRRSSRMARNRAERGRRRRRFALRAALALLVV
VVLAGVFAGGKLWHTVFGPGDDYSGSGERDLVIQIQAGDSTTMVGETLHN
QHVVKTVRAFVNAAHGNSKIDSIQPGFYRMRTEIPASDAVARLADPNSRV
GRLVIPEGRQLDDTTDMKTNKVNPGIFTLISQATCVDLDGNRRCVPVQQL
RAAATNSTTAALSVPPWALEPVNELGRDHRRIEGLIAPGTFNVDPSASPE
SILAGLISAGAEEYLKSGLVDTAQAMGLSPYDILVVASLVQQESNTPDFA
KVAQVIYNRLHAHHTLEFDSTVNYPLDRREVATSDADRGQKTPWNTYVSQ
GLPATAICSPGIDALHAAEHPAPGDWLYFVTIDAAGTTLFTKDYQQHLAN
IELAKHNGVLDSTPR
118465682YP_880274.1 glyoxalase [Mycobacterium avium 104]MAINIEPALSPHLVVDNAAAAIDFYVKAFGAEELGRLPRPDGKLAHAAVR
INGFMVMLNDDFPEVCGGKSMTPTSLGGTPVTIHLTVPDVDASFQRAVDA
GATVVVPLEDQFWGDRYGMVADPFGHHWSLGQPVREVSPEEMAAAMAAMA
AEQGAGQA
118465681YP_883485.1 beta-phosphoglucomutase hydrolase [Mycobacterium avium 104]MVEWIPPDPNHRKRVPVLGLPEKVHACLFDLDGVLTDTASVHTKAWKAMF
DAYLADRAKRTGETFVPFDPAADYRKYVDGKKREDGVRSFLQSRGIHLPD
GSPDDAGDAETIYGLGNRKNDMFQKVLKQDGVKVFDGSRRYLEAASAAGL
GIAVVSSSANTRDVLEVTGLDRFVQQRVDGITLREEHLAGKPAPDSFLRG
AQLLDVPAGAAAVFEDALSGVAAGRAGNFGFVVGVDRVGQAEDLRRNGAD
VVVSDLAELLAS
118465680YP_879650.1 hypothetical protein MAV_0363 [Mycobacterium avium 104]MQSMVTGVVQAEVVMAVAARTMPRTSLYFKRDITTPFVEKECFARERLSY
VS
118465679YP_881161.1 hypothetical protein MAV_1942 [Mycobacterium avium 104]MRGGPSIKHLDDVPAEEMLRYEFADGRTASIWEKWIELSPRYFAFWNKWD
PGAISAQHGHTGDHSIFILAGEIRCGDVVARAGTHIMLEWGDVFGPWEAG
PQGCELYGFIAGEGQPFSGDPAPYEALLAARGARAVPLPMPKRLPPWILA
KMGGAFTSSVTQWEPRPT
118465678YP_879971.1 hypothetical protein MAV_0692 [Mycobacterium avium 104]MPATLSQIQAWSTEHLIDAAAYWTQTADRWEDAFLTMRNQAQSITWHGAG
GDALRQRTGADVSVVSGKADQLRQAAGIARNGASEISAAQRRVLYGVEDA
QNAGFTVGEDLSVTDTRSTSPAERAARQAQAEAFAADLRLRAEQLEAADT
KAAGQITATAGDVGNATFTPAHNGNGVQLVDFKQDGGPVCDDPDYNDRFF
RKFMGRVGAGAAIGGLAGAPEAGVGAIPGAIIGGAAGGIEAFIEGATESE
PPKCGK
118465677YP_883807.1 cyclopropane-fatty-acyl-phospholipid synthase 1 [Mycobacterium avium 1MQLTPHFGNVQAHYDLSDDFFRLFLDPTQTYSCAYFERDDMTLEEAQIAK
IDLALGKLKLEPGMTLLDIGCGWGATMRRAIEKYDVNVVGLTLSENQAEH
VQKTFDAMDTPRTRRVLLEGWEKFHEPVDRIVSIGAFEHFGRQRYGRFFR
MAYDVLPPGGIMLLHTIVRPSFKDARAKGMKLTHEIVEFSRFILAEIFPG
GWLPTPQTVGEYGVTAGFDLTRVQSLQLHYARTLDLWAQALEANREQAIA
IQSQEVYDRYMKYLTGCAKLFREGYTDVNQFTMEKK
118465676YP_882514.1 hypothetical protein MAV_3332 [Mycobacterium avium 104]MADRTVRGGQERSRIKTLTQAALNADKTVEQVEDVLDGLSSTLKELSSSL
AALNATVERMETGLDHLDGTLASLDDLAKRLIVLVEPVEAIVARVDDLVK
VGETVMSPLSVTEHAVRGLVDRLRNRTAQ
118465675YP_882938.1 D-alanyl-D-alanine carboxypeptidase [Mycobacterium avium 104]MDRKLDFAAMRKLWTAAAALLLVGACGAPTAAADSTQPAGSIPIPDGPAQ
TWIIADLDSGQVLAGRDPNVAHPPASTIKTLLAQVVLDEVSLDATVVADA
ADTQVECNCVGIKPGRSYTARQLLDALLLVSGNDAANTLAHMLGGPEATV
AKMNAKAAALGATNTHASTPSGLDGPNGSGSSTAHDLAVIFRAAMANPVF
AQITAEPSAMFPGDNGLQPITNQDELLQRYPGAIGGKTGFTNAARKTFVG
AAARGGRRLVIAMMYGLIKEGGPSYWDQAATLFDWGFAQSPQASIGSL
118465674YP_882074.1 forkhead-associated protein [Mycobacterium avium 104]MTDMDSGSQDQNGDEVTVETTSVFRADFLNELDAPAQAGTESAVSGVEGL
PAGSALLVVKRGPNAGSRFLLDQATTSAGRHPDSDIFLDDVTVSRRHAEF
RLENNEFSVVDVGSLNGTYVNREPVDSAVLANGDEVQIGKFRLVFLTGPK
QGEDGGSSG
118465673YP_881968.1 hypothetical protein MAV_2780 [Mycobacterium avium 104]MFGGAAMLVLAVGCGGGHKGGPSTTSTTTPTTTPSTSVVPSTTPGGGGTV
PGGPTGGGGPGGGGGSIPGGPTGGGGPGGGGGSIPGGPTGGGGPGGGGGS
IPGVGGGGGGPGGGGGCVGNVCGAYP
118465672YP_883529.1 serine esterase- cutinase [Mycobacterium avium 104]MKTHRIGRLLGLGSSALITAAGLLGAPAAVPVASADDCPDVEVIFARGTN
EPPGMGRVGDAFVESLRQQTSGLNIDTYGVNYAASKLQLHGGDGANDTIN
RIKQAVQKCPNTKIVLGGYSQGASVMDIVAGVPIGGINWGSSITPDLASH
VAAVATFGDVADRAGGTLPSQSALLGSKAIDLCNPNDPICHAGPGNEWSG
HTEGYVPVYTTQAAAFVASKLMGAGQSVPGYGPSVPGAGPQSPGYGQQSP
VYGQTPPGSGPSIHDNAPGPGTAPAPAVPSTPPSQAPLV
118465671YP_881333.1 PknM protein [Mycobacterium avium 104]MRRLAATLAAAGMLVAGCGAGNHGAASSSTATGSTASPKTPLARGALPDL
MLSPNDIDTALGVTGTTSDPPFTALGEDPVRRTDYTFPAECKYTTHAGLA
SEYAGSGSTAVYGYHDLAPTPAGANQLESPEVYQFVVLFPSPEQASAFLS
ASSARWPACANRQDTVPADGTNPELRWKVGPVTNANGMLSSQVTVTVNGN
GVNVTMPCQRALTARNNIVIDVDACRKDVGDLGIDIAKQIAGKVDKQ
118465670YP_880915.1 hypothetical protein MAV_1683 [Mycobacterium avium 104]MTILATTLVHPNPGVAWDDIQKQLKRASGLARKHGAENVTVLVNMVGGQG
TNSIGFLTTAKDWATYGQIQQSLSSDPDYQGLLVDSAQIATWENYVSQTI
EV
118465669YP_881305.1 ABC transporter permease [Mycobacterium avium 104]MASAERRVAPRSTALGYALLAPSLFGVLAFLLLPILVVIWLSLCRWDLLG
PLRFVGLSNWRSVLTDAGFGNSLMVTAVFVAMVVPAQTALGLLAATMLAR
RLPGTGLFRTVYVLPWICAPLAIAVLWRWILAPTDGAVSAVLGHSIEWLS
DPSFALPLVSAVVVWTNVGYVSLSFLAGLLAIPEDIHAAARTDGANAWQR
FWRITMPMLRPTTFFVLVTGIVSSAQVFDTVYALTGGGPAGSTDLVAHRI
YAEAFGSAAIGRASVMAVVLFVILIGVTLVQHLYFRRRISYDLT
118465668YP_884304.1 trypsin [Mycobacterium avium 104]MFTATQEGDGMSKSHHHRSVWWSWLVGVLTVVGLGLGLGSGVGLAPASAA
PSGLALDRFADRPLAPIDPSAMVGQVGPQVVNIDTKFGYNNAVGAGTGIV
IDPNGVVLTNNHVISGATEISAFDVGNGQTYAVDVVGYDRTQDIAVLQLR
GAAGLPTATIGGEATVGEPIVALGNVGGQGGTPNAVAGKVVALNQSVSAT
DTLTGAQENLGGLIQADAPIKPGDSGGPMVNGAGQVIGVDTAATDSYKMS
GGQGFAIPIGRAMAVANQIRSGAGSNTVHIGPTAFLGLGVTDNNGNGARV
QRVVNTGPAAAAGIAPGDVITGVDTVPINGATSMTEVLVPHHPGDTIAVH
FRSVDGGERTANITLAEGPPA
118465667YP_883570.1 methyltransferase- putative- family protein [Mycobacterium avium 104]MTRTDQDSWDLASSVGATATMVAAARALASTGERPIINDPFAAPLVRAVG
LDFFRRLVDGEVAPADPQRGERDLQLETDSIAVRTRFFDDFFTGAARDGI
RQSVILAAGLDARAYRLDWPAGAVVYEVDQPKVVEFKTNTMAALDARPAA
QLRTVSIDLREDWPEALRANGFDVTQATSWSAEGLLMYLPPEAQDRLFDN
ITALSAPGSRLATEYHPDATGTTMAQRAQEFNDRWARVGCDIDLSGLFFD
GERSNVVEYLTGRGWRVSARPRRDLFDDYGLAYPEDDETAQFPNIVAVSA
ELG
118465666YP_884142.1 zinc-binding dehydrogenase [Mycobacterium avium 104]MLQRIGAPRPYARSRPISITDVELAPPGRDEVLVRIEAAGICHSDLSVVD
GNRVRPVPMLLGHEAAGIVERVGPGVADLAVGARVVLVFLPRCGRCAACA
TEGLTPCEPGSAANGAGTLLGGDIRLSRAGRPVYHHLGVSGFATHAVVNR
ASAVEVPPDVPAEVAALLGCAVLTGGGAVLNVGRPAPGQTVAVVGLGGVG
MAALLTALTYDGVPVVAVDQLPEKLAAARRLGAHQAYTPQQAVEARVKAA
VVIEAVGHPAALQTAIDLTAPGGRTITVGLPPPDARITVSPLGFVAEGRS
LIGSYLGSAVPSRDIPRFVELWRAGRLPVESLVSSTIRLEDINEAMDHLA
DGTAVRQLIRFDA
118465665YP_883175.1 homogentisate 1-2-dioxygenase [Mycobacterium avium 104]MESFIHLRKGRTPGRLHADLDGLKDDELGRGGFTGRTANMYRRHDPTAYR
VQGPLRPIDVLTSELKPSDATDATGGPLLMFANPDCRISLSRRSEPMPFY
VRHVDGDLLCFVHGGAGLLHTEFGPMPYRQGDWVYLPKATTWRQLPDAET
TLLMIEATDEFRVPPPGPLGRHFPFDPSQATIPEPQALDDDPARDEYEVR
LVHEGGPTTLLYQHNPLDVEGWRGDNFAFTFNIADYNVVTSDSVHLPPTV
HLFMQATGVYVMNFLPKPAEGVPGTERTPWYHRNVDYDEIAFFHGGSLYG
IPMPPGLISHAPQGVHHGAPEKARERARRKFDEYARVDWQVIAVDTRRRL
TPSAEVLAHDLGQH
118465664YP_880430.1 hypothetical protein MAV_1184 [Mycobacterium avium 104]MPAEPDYPQMAAARGRIEPAPRRVRGYLGDVLVFDTTAARYVWEVPYYPQ
YYIPLADVRTELLRDENHAQRVQFGPSRLYSVVAGGRTCESAARVFDADG
DGPLAGTVRFEWDPLRWFEEDEPIYGHPRNPYARVDALRSHRHVHVERDG
ITLADTRSPVLLFETGLPTRYYIDATDVDFAHLEPSATQTLCPYKGTTSG
YWSVRVGDVVHEDLAWTYHYPLPAVAQIAGLIAFYNEKLDIVVDGTPLPR
PHTQFS
118465663YP_879935.1 hypothetical protein MAV_0655 [Mycobacterium avium 104]MIEQLAVPARAVGGFFEMMIDTGRAAFRRPFQFGEFLDQTWMIARVSLVP
TLLVSIPFTVLVAFTLNILLREIGAADLSGAGTAFGTITQLGPVVTVLVV
AGAGATAICADLGARTIREEIDAMRVLGIDPIHRLVVPRVLASTVVALLL
NGLVCAIGLSGGYVFSVFLQGVNPGAFINGLTVLTGLRELVLAEVKALLF
GVMAGMVGCYRGLTVKGGPKGVGNAVNETVVYAFICLFVINVVMTAIGVR
ISAK
118465662YP_883595.1 phosphate ABC transporter phosphate-binding protein PstS [MycobacteriuMMRTRSAVIAGVLMATTLVVSACGETPASLPYTAGAKVDCGGKQTLSASG
STAQANAMTRFIAAYRTACPGQTLDYTANGSGNGIADFLAGRTDFAGSDT
PLSGDQYAAAKRRCGGADAWNLPVVFGPLAITYNLAAVDSLVLDAPTLAK
IFNGTITRWDDPALALLNASMPAEDIRVVYRSDGSGTTDNFQAYLQSAAG
GVWNKGAGKTFNGGVGTGAVGNTGTAAAVKSTEGAISYNELSFALQQGLF
AAEIKTPASRRSLRPVRIGTDIFGKTIKGARIVGTGNDLVLDLSSFYNPA
QPDVYPIVLATYEIVCSKYPGFDVAKAVKAFLQAAIGPGQVELARTGYIP
LSADFQAKVSGAVDAISSPQAPNPD
118465661YP_883344.1 TrkA domain-containing protein [Mycobacterium avium 104]MDVKEVLLPGVGLRYEFTDHKGDRVGIIARRSGDFDVVVYAREDPDEARP
VLHLSNEEAEAVAQILGAPRIAERFTELAKEVPGLETGQVHILAGSPFVD
HPLGDTRARTRTGASIVAIVRDDEVLASPGPSEMLHARDVLIVIGTEDGI
AGVEKIIDKG
118465660YP_881845.1 hypothetical protein MAV_2654 [Mycobacterium avium 104]MVASERMNKLPAEFFLPPQTNAALQRETVRLVAACVAFIVILGVIVALTQ
GIVITV
118465659YP_880289.1 hypothetical protein MAV_1033 [Mycobacterium avium 104]MAKLSGSIDVPLPPEVAWQHASDLSRYKEWLTIHRVWRSTLPDQIDKGTV
VESIVEVKGMLNRIKWTVVRYKPPEGMTLNGDGVGGVKVKLMAKVQPKAD
GSVVSFDVHLGGPALFGPIGMIVAAALRGDIDQSLENFVTVFARSDPSTN
GHR
118465658YP_880303.1 phosphate ABC transporter permease [Mycobacterium avium 104]MVVTRGTATAQLPAPTTLNARVSRRGDRLFKAIAAAAGFTIVVAIALIAV
FLLLRAVPSLRVNHANFFTSAQFSTSDPHRLAFGIRDLLMVTVLSSLSAL
VLAVPIAVGIAVFLTQYAPRRLARPFGAIVDLLAAVPSIIFGLWGIFVLA
PQLEPVAAFLNRHLGWFFLFKTGNVSLAGGGTIFTAGVVLSVMILPIVTS
VSREVFRQTPHIQMEAAQALGATKWEVVRMTVLPFGRSGVIAASMLGLGR
ALGETVAVLIILRSAARPGHWSLFDGGYTFASKIASAAAEFSSPLPTGAY
ISAGFALFVLTFIVNALARAIAGGKVNG
118465657YP_880659.1 serine/threonine protein kinase [Mycobacterium avium 104]MSDERSSKVGSMFGPYHLKRLLGRGGMGEVYEAEHTVKEWTVAVKLLNES
FSSDPVFRERMKREARTAGRLQEPHVVPVHDYGEIDGQMFLEMRLVEGTD
LDSVLKRFGPLPPPRAVAIITQIASALDAAHAAGVMHRDVKPQNILVTRD
DFAYLVDFGIASATTDEKLTQLGTAVGTWKYMAPERFSDAEVTYRADIYA
LACVLFECLTGSAPYRADSAGVLVSAHVMDPIPAPSARRPGVPKAFDAVI
ARGMAKKPEDRYASAGDLALAAKEALSTPDQDRAATILRRSQEAALPAAG
QRDAGASTVLAPPPAVNTRQPGSAASQAGRGWTPESGPIPAAGQPGPPYY
QGGNANWAAAPAQFAGPPPWGRPPPKRRVWPIVAAVVAVLVVIAGGVGVW
LVIRPKPEPPQAAPLTSDRLGALLLSASEVNAVMGSSTMEPGKPITATDS
SSVTVSVPDCQGALYTTQDPVYAGSGYSAVNGLVSSEPGDNYDHWVNQAV
VLFPSADKAKSFLQTSLQKWKGCAGQTVTVTNKSKTYRWTFAQVQGAPPK
ITLMDTQEGADGWECQRALSVANNVIVDINACGYRITDQGDQIADKIVAK
IDNE
118465656YP_882095.1 PPE family protein [Mycobacterium avium 104]MFYGAFPPEFNSGRMYSGPGAGSFVAAATAWQNLAAELQSAAASYSSVLS
GLTAGPWVGPSSLAMASAAAPYVAWMQQTAAQAAETAAQATAAATAYETA
FAAHVPPAVIAENRALLAQLVATNIFGQNTAAIAANEAQYGEFWAQDATA
MDTYFAASATAANKLTEFGPAPKTTNEAAQPMQAAAVSSAASTPAANVAQ
TAASAASTTLPYSGPFSGPANLAYLYQTFMTNLFNTVPGGASFYTSMYNA
VKVPLGLTTQFNGVGLLVNFPLSQWLKFAPPIGYGALPKDALGAGLGALG
FGRGTLYSAISPVAGMGNAGTLVGKLSIPPSWATATPSIRTVAAALSAAG
AEAVPAAALGEGSLFSSMGLAGMLGSAVGSGGPTMVRGGVRNRMTAIKDL
KDKQSPEQLKRLVAQISEQPESVQHHNVDQENLDTLLEQLAKKPGIHAVH
LKKGDKSKVLPADAQLG
118465655YP_881323.1 hypothetical protein MAV_2113 [Mycobacterium avium 104]MTGAARTARRPTGPARPAGTARSARVIGAGRMVEISGLRPAMAGATRGRG
AMPARRRRCPGSGAGEPGAHSQRGGSERSGDAHPSDKLLQPHDASPIHSV
HSGSLRKGNSSNAPRHHPDTR
118465654YP_881444.1 acyltransferase- ws/dgat/mgat subfamily protein [Mycobacterium avium 1MLRMQRLSGLDASFLYLETSSQPMHVCSIIELDTSTVPGGYTFERLRDAL
VRRIRAVPPFREKLADSPLNLDHPVWVDDEDFDVDRHLHRIAVPAPGGRA
ELSQICGHIAQTPLDRRRPLWEMWVIEGVAGTDCHRDGRLAVMTKVHHAG
VDGVTGANLMSQLCATEPDAAPPEPAAGVGGGAGWRIAAGGLVRFAARPL
RLASVVPDTAASVLATVRRALDGAAMARPFAAPTTVFNARISNRRCIAYA
ELNLDDVKAVKNHFGVKVNDVVMALVSGVLRQYLAERNALPDSSLVASVP
ISVHGKSDRPGRNQVSAMFASLHTEIADPVQRLKAIAHANSLAKEHSSAI
GASLLQDWTQFAAPAVFGIAMRLYARTRFTDSMPVHNLVVSNVPGPQLPL
YLLGCEVKAMYPLGPIFHGSGLNITAMSLRGKLDVGLIGCPDLVPDLWEL
ADEFAVAMEELRAAAR
118465653YP_882015.1 amidohydrolase [Mycobacterium avium 104]MVSDTDALAEHIGAVSLIDQHVHGCWLTTGGRRRFENALNEANTEPITGS
GFDSQLGFAVRAHCAPILGLPRHADPQSYWERRCQLSEHELARLFLPAAG
VCNWLVDTGIGHGVVAGVAEMAELAAAPTAELVRLEEVAEQAAHAPGDYA
AAFDEILAARAAGAVGTKSILAYRGGFDGDLSEPSATEVARAAARWRELG
GTRLRDRVLLRFGLHRALRLGKPLQLHVGFGDRDCDLHKANPLLLLDFLH
HSGDVPIVLLHCYPYEREAGYLAQAFNNVYVDGGLSVNHLGARSPAFLAR
LLELAPFSKILYSSDGFGPAELHFLGAVLWRRGIHRVLREFVEAGDWSRA
DAIRVVDLIARENAARLYGLAP
118465652YP_884288.1 acetyltransferase- gnat family protein [Mycobacterium avium 104]MTPQVRPADRADIRALSATLARAFYDDPVMVWLFPDRRKRIARLSRVFAT
MTRHHHLAGGGVEVACADAGIGAAALWDPPHRWRETPRAQLAMTPTYLRV
FGLRSMRGRAVQELMKSVHPEEPHWYLAVIGSDPGVRGQGFGQALMRSRL
DRCDAEHCPAYLESTKPENVPYYQRFGFTVTREIVLPDGGPSMWAMWRPP
R
118465651YP_881687.1 hypothetical protein MAV_2495 [Mycobacterium avium 104]MSGVVLIVLGHWLAGSVTYHDGQFGRQNPLVDMPWTQWLTWPFQAVPTFF
LVAGYAGAVSWTHRHDEEGVPRRSWLQRRLARVLGPTAVYAVLVSAVVVA
LAACGVAGSVLEYAGWAVAMHLWFLAVYLVVVSLTPIALVAQRRWGLWVP
AALAVTVAVLDAARIGAHLPHLSWVNYVLGWGTLYQLGIAWHEGSLAGRR
PWLLAGVSAVLLAALIWLRVYPVSMIGVPGQTIDNTTPPTVALLAFGGAQ
TGIVMAAAPALNRALRAIRAERGLSIANNNIMALYLWHMIPVVIVAIVGY
PAGLLPQPPEGSVQWWQARLEWVAVLSAVTAVEMVLLWWARRLFAAPLPL
LGVPLPARAAEPVLLAGAALAAYTLSVVAAEGFAPDGRFPWPTALVFTAG
VLLAALRPTARPVERPA
118465650YP_881503.1 cytochrome C oxidase- subunit 3 [Mycobacterium avium 104]MVSVGTIVWLSSELMFFAGLFAMYFTARAQSGGKWPPPPTELNLYQAVPV
TLVLIASSFTCQMGVFAAERGDVFGLRRWYVITFLMGLFFVLGQGYEYYH
LMGHGTTIPGSAYGSVFYLATGFHGLHVTGGLVAFIFLLARTAMSKFTPA
QATASIVVSYYWHFVDIVWIALFTVIYFIR
118465649YP_880527.1 caax amino protease [Mycobacterium avium 104]MSQSTSPYHTSVFAELRRAITNVAVPHNEPPAIVRRRRVVVAITLVLGAA
VLGYSLRRHPGESSFYWLTLGLAAVWTVGALSSGPLHLGGICWRGRNQRP
VITGTTVGLLLGGAFVVGGLIAREIPAVSALITRVLLYAHHGWLPLVVAI
TVINGIAEELFFRGALYTALGRYHPVLISTLLYTAATMAAGNPMLGFAAV
ILGTVCALERRASGGVLAPVLTHCGWGLIMVLALPPVFGL
118465648YP_881617.1 hypothetical protein MAV_2421 [Mycobacterium avium 104]MESERFVLAAPSIDTIEKYLFGKFGMYIRSARNLPRIGVPVSAEDEHSDV
NIETREYEGVERFALVAPDGSAVAVGSADKITGTADLKKLALYLNATIDQ
IEVSVLDPDGKPLFERR
118465647YP_881689.1 RmlD substrate binding domain-containing protein [Mycobacterium avium MTANTVLVTGAFGQVGKRCTQLLLQRGRTVVAMDLRNDNTAAVATELAAG
GYPGTLIPAYTDLLDAEAVRDLVTAHQPDAVVHLAAVVSPLSYRKPDLAR
RVNVGGTENLLAACTALPRPPLFLMASSAAVYGSRNPYRQPERITPDTPV
NPIDQYGQDKVLAEAAIRASGLPYALFRLGGIISPDTHASINGDYLLLMR
SMPSDNRMHAVDARDVALAFANGVDRAATISGKVLLIGGNESYVLTQREL
EDAMMEAVGLGRLGPSASLPGNPADDRGWSFTGWYDTTEAQQLLDFQEHD
WSQTVAWLAESQGRSRLALRLLGPLLRPLLRTILIVQRRLEGRGPYADPW
TLIEKKYGTAALATAD
118465646YP_882204.1 steroid monooxygenase [Mycobacterium avium 104]MTSGSDRRATPDVDVVVVGAGLAGLYALHKLRSNGLRVRVFEAGPDVGGT
WYFNRYPGARCDVESVDYCYSFSDALQREWDWSEKYATQPEILAYINWVA
DRLDLRRDITLNARVNSAVLDEAQLRWTVTTETGERVTARFCVMATGPLS
AAMTPPFPGLDTFAGQVYHTAAWPHEPVDFTGKRVAVIGTGSSGIQSIPI
IAEAASQLYVFQRTPNYSVPAGNRPLSDSDRAEVKAHYAERRRISWRSGG
GSPHVAHPKLTMEATPEERREAFEKRWELGGVLFSKTFADQMIDPVANEE
ARKFYEEKVRAVIDDPVLADLLIPNDHPIGTKRICTDSNYFQTFNRPNVK
LISVRKTPIMSIDATGINTTDAHYDLDAIVLATGFDAMTGALAKIDIVGR
DGRRLSDDWSGGPRTYLGLGVDGFPNLFLVSGPGAPAVLANMVLHAEANV
NWIADCIAYLDAHDYTAVEATTDAVDDWGAECARRADATLFTKADSWYLG
ANVPGKPRVFMLFVGGFGVYLDICAEVANAGYKGFSLVKAR
118465645YP_879433.1 transporter- major facilitator family protein [Mycobacterium avium 104MMSSNVRAARNRPGRTDPQPPTGAPLFVGVLGLLLATGWVANHFVGLMPA
ISDRDHLATTTLDGIFGIYALGLLPGLLVGGRTSDALGRRPVALTGSAAA
LVGTVAMLLSQHSPALFAGRLIVGLGVGLAISAGTAWASDLRGPAGAATA
GAVLTAGFAVGPFAGGVLAWAGPSGVRASFALAAAILALAAFAVVAAPQP
SPVTAPADPDGEETADAAPQGISRALSWAMPLAPWVFASATLGFVTIPGR
LHTALAAPVAAGTATLIVNGVSGAVQVLARALRWGPQAGTAGAVLAALGY
AVAAAAPSTLTPALGVPLFVVLGCASGLCLREGLIDLEAAAPQRLRGGLT
GLFYVVTYIGFGLPLILASVRPGVATAILSGMAVLAVTAAVGRAARLRRD
DHRQN
118465644YP_883262.1 response regulator receiver domain-containing protein [Mycobacterium aMTDDATPTTVMVVDDHPIWRDAVARDLAESGFAVVATADGVATAQRRAGV
VRPDVVVMDMQLPDGDGAQATAAVLAVSPSSRVLVLSASDERDDVLQAVK
AGAAGYLVKSASKAELAQAVTDTAAGRAVFTPSLAGLVLGEYRRIAQSKD
DGPTRPRLTDRETEVLRYVAKGLSAKQIAEKLSLSHRTVENHVQATFRKL
QVANRVELARYAIEHGLDEEP
118465643YP_881325.1 hypothetical protein MAV_2115 [Mycobacterium avium 104]MAEPNVVPDQPRWADGLPYFVRDGNDLVPTEIARGGWGPSLSGHVVGGLL
AWAVEQAAADAGLQPARLTVDLPRPTELEPLRVHTQVRHDRRRLRLVEAV
ISQNDAVVAQASALFLRRGPQPDGRVWSPPVQMPPLPPDQTYSTLFMRTY
GWGSQVQNPDPDWPQTDGPKYTWIHETRPLIDDEPLSAFTRAAMAGDITA
SIANWGSKALQFINADYTLTLSRLPEGDHIGLASLTHHSHDGVASGSAVL
VDTAGPIGTGLSVAIAHSGFRPPSADPSAREFR
118465642YP_881079.1 oxygenase KshA [Mycobacterium avium 104]MAVFDGTARTFQERGFPHAAYPTGWFQVGWSADYPSGRVAAETFFGQDLV
LYRAGKNDRDPHGRIVALDAYCPHMGAHLGYGGSVEGTCLRCPYHGWLWD
ADGRNAEIPYGEAQSINARTRSWPVREAGGVVYLWHAADGSAPSWDPPHM
PEAEDDDFYAPYPWATHREPMRMHPQFAAENFPDLAHMRYVHRWEEIPNI
SLWQEDGPVLRVDYEGVISTPKGSVRVTTENTANGVGLNINRVADGLRST
TLGAFTPINQTHSLGFITVWVAKRDRESSEPDGLARSIASANTEELFGPT
ADRRVWENQRYREHPLTVGYEATYTRAFRRWSRQFYPPTTSVRARSEGPA
HDLGPSVAKNSAGGAAAT
118465641YP_879788.1 hypothetical protein MAV_0507 [Mycobacterium avium 104]MVSDHRQSFATLRYDIERAIPKVGEQWKALFDSPRDIHGQAFCTDVRLMV
LRMRELRGPQPWDTLSSRCGSGLSVQISNGRGMDLRVRRWPSKVLHGERV
RIVAMPDGGGLPLLRASTEPGRQMMLDEGSKAELFPAPKTTAAGKPDILS
LWWPTDDGSGLAEAELAAVIDVDSASRVQILATSPLPPVTESPLLTTPKR
SVEPASDFGDLEPPALGSGTDDPDEPA
118465640YP_882604.1 acyl-CoA dehydrogenase domain-containing protein [Mycobacterium avium MPVAFHRQDTPAGAAAVQPVLAEIAADYRLRLADGGTEPPLRGLKLVRDH
RLGALRLARELGGAGYTAPEFFDYLVALAAADPDLAHILRIHYALVEELQ
VTPRRPGSDRWIAVVAEGGLIGGANAEQSQKSVGGNHRDTRLVTTPDGLR
LRGRKFYSTGAQFSDYLRITAQDDDGAPTAVVIPVDRAGVEHLDDWDGIG
QRQTGSGTTVFNDVAVADDEVFPLGSTIGVNRARGALVQLYLHAVAAGIL
RSLTEDAAALVRGRRRTYTFASADTPTADPQLLQIVGEIDAVAYTAHALV
RNAAAELAPALQAARDTGIDPELEAAASIAAARVKVAIQEPALRAASRVF
DAGGASAVQASALLDRHWRNLRTLFSHNPTVYKARVLGDVVVNGAALPDT
SFF
118465639YP_884361.1 polysaccharide deacetylase [Mycobacterium avium 104]MNRRQFLGSLAASVVAGVGAARLIVDPQPRTFAQTPAAAIPTSGPTAPQA
LLPPPPLSARIPLPGGGALMKIPGEGDLLALTVDDGVNSEVVRAYTQFAK
DTGVRLTYFVNGVYDSWTENLQLLRPLVDSGQIQLGNHTWSHPDLTTLTK
EQVAEQLSRNDAFLKKTYGIGAKPYWRPPYAKRNAAVDAVAADLGYQVPT
LWSGSLSDSTLITEDYILQMADQYFTPQAIVIGHLNHLPVTHVYPQLVDI
IRERNLRTVTLNDVFLKTP
118465638YP_881452.1 hypothetical protein MAV_2248 [Mycobacterium avium 104]MPNGWGSYLNEMPALDRGYHRINRTDLLNGDGLPQTLLAGYVWGTGSSAF
LVGRRARVFRDNDAARIADCLQGVAEELRKGNTVEAYGSMLRGNPNNLKH
LGPSFFTKFLYAADAEGAQPGRALILDQFVAVALKDIDGWDISRTGPWEP
NTYEDWLAHAHRIASDEGVRPDAVEMAYFNHGREIG
118465637YP_882664.1 glutamine amidotransferase subunit PdxT [Mycobacterium avium 104]MSAPRIGVLALQGDTREHLAALREAGAESMPVRRRGELEAVDGLVIPGGE
STTMSHLLKDLDLLEPLRGLLADGLPAYGACAGMILLASEILDAGAGGRE
ALPLRAIDMTVRRNAFGRQVDSFEGDIAFAGLDVPVRAVFIRAPWVERAG
DGVEVLARAAGHVVAVRQGARLATAFHPEMTGDRRIHRLFVDLVTGVV
118465636YP_880890.1 hypothetical protein MAV_1656 [Mycobacterium avium 104]MKTELKWVEPYPGHFHANIDDRSEYRVHAVSTGGFRAERVDDGFVHHDLG
RAASAAEAQGICQDLHTRTLRRAAWEAYMAEHDPPGWE
118465635YP_880267.1 hypothetical protein MAV_1008 [Mycobacterium avium 104]MSTESGPNRTAPPLPAALLRVWPFIALGALGWLAAVGAAFLVPGLHCWRP
VTLAGLGVGVLGTSIFLLQLAAARRGARGAQTGLENFLEHD
118465634YP_880186.1 hypothetical protein MAV_0924 [Mycobacterium avium 104]MRIRLDRTVCDGFGICAKHAPGYFSLDDWGYASLIGDGTVAEADRDAVMR
ALLDCPVHAIAEIGERTAPSHRPPLAEATDPAEHLKTEENEAEWGFTR
118465633YP_879382.1 transport protein MmpL4 [Mycobacterium avium 104]MSDDMSDTDEIPVAHRTHVEHKPRLARTIRVLALPIVLGWLVLAVGVNVF
VPQLEKVAEEVSVPLSPSDAPSVTGMKHIGEKFKEYDSDNLVLVTLVGDK
PLGEDAHRFYDGLVEKLKQDPHVEHALNFWGQRFTSSGVESYDHRSAYVQ
VNLRGDQGGAVGDKSVAAIRKIVADSKPPAGVKAYVAGQGALTADTIVVG
DASLAKMTIITIIIIAIMLMFVYRSIGTVLLTMVILFVGLATGRGVVALL
GETGIMGLSTFAVNLLTALAIAAGTDYAIFMVGRYQEGRERGLDREAAYY
DTFAGVTKVVLGSGLTIVGALACLKFTRLPYFSSLAFPCAVGLLVVVAAG
VTLTPALIALASGFGLFDPKRKFNYTRWRRLATAIVRWPAPILATSVILA
IVGAIGLMGFTPRYNDLYYLPQSASSVQAYNAADRHFTQARLNPDLLMIE
SDHDLRNPRDMLVLDKVAGAIFRVPGIERVQSITRPLGPPIQDGSVPFQL
SVQSAPIRSNLDYLKARVGDIKKITGFLDTQIALLERQYAVTQKLANAAD
DSSKTTGETAAITDQIRDHIADFDDFWRPIRSYFYWEKHCYDIPICWSLR
SLFDALDGFDQLAEKFHALTSDLTDTAKATRELLAIIPENIAVSKSIRDT
TLTIYSSFDSLIAQFDRLTDTNAVMGKSFNDSQVESLFYLPPEIFQNPDF
QLGLSLMVSPDGKAARFIITHATDPATVKGIASVDQERQAAKEALKLTSL
ENADIYLGGTAATFYDIANGAKYDLMIAAVASIVLIFIIMVIVTRALVAA
GVIVGTIVLSLGAAFGFSTLIWQHLADFQLHWVATEFALIVLLAVGSDYN
LMLVSRIEEEIGAGLKTGLIRGMGVTGPVVTAAGVVFAVTMGAMITSDLR
AIGQFGTTIGIGLLFDTFVVRSLITPSIMTAMGRWFWWPKRVRVRPASQM
LRSVGPRPLVRALLHQPRHAVPPPPTT
118465632YP_884393.1 histidine kinase domain-containing protein [Mycobacterium avium 104]MLRAAICHLREQLRRRGELIPVGLTWASLIAVDAALLLGGTIGTLQRPAA
DLPVSLTAFAIALSPTVAFFVFNMKMTPGPLWATWTASTALTLFVTSTPI
RADFAPALLVLMVLVVATLASVVGGLLAAASAAALLLTAAALHRLDAIVL
YLGFIVVAWLLGYLMRTQRLLVAEQIEAQQMLAEHAAADERRRIAREVHD
VIAHSLSITLLHVTGARRALQQDRDVDDAVEALEQAERLGRQAMADIRRT
VGLLDNWPTKAAPTTPEPGLDDVASLVDGFRRAGLAVTLCVEGPADHVSP
AVGLALYRITQESLANIAKHAPESKAGVVLDISPASARLAVTNILPAAVV
AARSPEGRGLRGMRQRVELLGGAIDVGPTRDGWSVCAEIPLQESDGSWRP
WWCGKA
118465631YP_879974.1 hypothetical protein MAV_0697 [Mycobacterium avium 104]MVAKPQGRGVRPADLRSIDLTNWIENVFSECIWHVDDSRQPQPQPGSAIG
RKAIRDAVKPGRQRISRELLELAADIYRKHIDGQPLKAVERELCVPQRTA
ARYIEMCRADEYQILPPTTKGKRKA
118465630YP_882252.1 SpoOJ regulator protein [Mycobacterium avium 104]MTERPDNGVELGLTGRPPRAIPEPQPRTSHGPAKVVAMCNQKGGVGKTTS
TINLGAALAEYGRRVLLVDMDPQGALSAGLGVPHYELEKTIHNVLVEPRV
SIDDVLLQTRVKHMDLVPSNIDLSAAEIQLVNEVGREQTLGRALHPVLDR
YDYVLIDCQPSLGLLTVNGLACSDGVVIPTECEYFSLRGLALLTDTVDKV
RDRLNPKLEISGILLTRYDPRTVNAREVMARVVERFGDLVFDTVITRTVR
FPETSVAGEPITTWAPRSTGAIAYRALAREFIDRFGA
118465629YP_882347.1 cytochrome D ubiquinol oxidase subunit 1 [Mycobacterium avium 104]MNVVDISRWQFGIVTVYHFIFVPLTIGLAPLLAIMQTAWVATGNTAWYRL
TKFFGKLFLINFAIGVATGIVQEFQFGMNWSEYSRFVGDIFGAPLAMEGL
FAFFFESTFIGLWIFGWGRLPKLIHLACIWIVAIGVNASAFFIIAANSFM
QHPVGAHYNPATRRAELDDIFALLSNNTAQAAFSHTVTGALLTAGTFVAA
VSAWWMVRSRAGGSTTPAAETEARTMFRPAAILGCGVVLLATVALFFTGD
RQGKLIFVQQPMKMASAESLCHTQTDPDFSVLTIGTHNNCGSVTEVIKVH
YVLPWLAEGRFSGVTLRGVNELQQQYQQRFGPDDYRPNLFVTYWSFRLMI
GFLAIPVLFALTVLWVTRRGRTPRQRWMSWFALLTIPTPFLANIAGWVFT
EMGRQPWVVVPNPTGDQAVRMTVREGVSNHVPGMVITSLATFTLVYAVLA
VVWFFLLKRYTVEGPLEHDAEPAPPRAPSDDEVAPLSFAY
118465628YP_883418.1 glycerol-3-phosphate dehydrogenase 2 [Mycobacterium avium 104]MSDPIHALGEPGSPASALGPRQRAAAWDRLGAEQFDVVVIGGGVVGSGCA
LDAATRGLKVALVEARDFASGTSSRSSKMFHGGLRYLEQLEFGLVREALY
ERELSLTTLAPHLVKPMPFLFPLTNRLWERPYIAAGIFLYDRLGGAKSVP
AQKHLTRAGALRLCPGLKRSALIGGIRYYDTIVDDARHTLTVARTAAHYG
VVVRNSTQVVALLREGDRVTGVRVRDSEDGSVTEVRGHVVVNATGVWTDE
IQALSKQRGRFQVRASKGVHVVVPRDRIVSDVAIILRTEKSVMFVIPWGS
HWIIGTTDTDWDLDLAHPAATKADIDYILSTVNTVLAIPLTHADIDGVYA
GLRPLLAGESEETSKLSREHAVAVPAPGLVAIAGGKYTTYRVMAADAIDA
AAQFIPARVAPSITEKVSLLGADGYFALINQAEHVAQLRGLHPYRVRHLL
DRYGSLIGDVLALAADRPDLLNPITEAPGYLRVEALYAVTAEGALHLEDI
LARRMRISIEYSHRGVDCAREVADVVAPVLGWTAGDVEREVANYTARVQA
EILSQAQPDDVSADELRASAPEARAEILEPVPLN
118465627YP_881942.1 catalase/peroxidase HPI [Mycobacterium avium 104]MSSDTSASRPPQPDTGTASKSESENPAIPSPHPKSNAPLTNRDWWPNQID
VSRLHPHVAEANPLGEDFDYAEEFAKLDVEALKADVISVMTTSQDWWPAD
YGHYGGLFIRMSWHAAGTYRIHDGRGGGGQGMQRFAPLNSWPDNVSLDKA
RRLLWPVKKKYGNKISWADLIIFAGNCALESMGFKTFGFAFGREDVWEPE
EILWGEEDEWLGTDKRYPGTGERELAQPYGATTMGLIYVNPEGPEGKPDP
IAAAIDIRETFGRMAMNDEETAALIVGGHSFGKTHGAGDADLVGPEPEAA
PIEQQGLGWKSSYGTGVGKDAITSGLEVVWTPTPTKWDNTFLETLYGYEW
ELTKSPAGAWQFTAKDGAGAGTIPDPFGGPGRAPTMLVTDISLRESPIYR
DITRRWLDHPEELADAFAKAWYKLLHRDMGPVSRFLGPWVPEPQLWQDPV
PPVDHPLVDDNDVAALKDKVLASGLSVPQLVKTAWSAAGSYRNTDKRGGA
NGGRLRLQPQRNWEANEPSELDKVLPVLEKIQQDFNASASGGKKISLADL
IVLAGSAAVEKAAKDAGYEISVHFAPGRTDASQESTDVDSFAVLEPRADG
FRNFARPGEKAPLEQLLLERAYLLGVTGPEMTVLVGGLRALGANHGGSKH
GVFTDRPGALTNDFFVNLLDMGTEWKASETAENVYEGHDRATGALKWTAT
ANDLVFGSNSVLRALAEVYAQDDNQGKFVEDFVAAWVKVMNNDRFDLK
118465626YP_879875.1 arylamine N-acetyltransferase [Mycobacterium avium 104]MTLDLGAYFDRIGYGGKAAPNLEVLRALMAAHTGSIPFENLDPLMGVPVD
DLSPAALTDKLVHRRRGGYCYEQNGLLGYALAEIGFRVRRLAGRVVWMQP
PDTPPRAQTHTVLAVTFPGSQGAYLVDVGFGGQTLPSPIRFETGNSQQTT
HEPYRLDDRGEGLVLQALVRDEWQPLYVFGTRTVPQIDLLVGSWYVSTHP
SSMFVTGLMVALTTADARWNLAGRELTVHRAQGSEKIRLDDADAVLDVLG
ERFGIDVDGIGQRGALLARIEQVLDA
118465625YP_880387.1 chain length determinant protein [Mycobacterium avium 104]MDFRTFVRILGAHWKLALTALLACTVGAAFVTALQTKHYQSSATVLISFS
GATDLNEVYSGTETAQERLSSYAQIAGGHIVAERAIRQLQLPMSADDLLS
QTQVKYTPKSVMFTISVKDTDPARAAALAGAMANQFSALLPTIAPNTGPN
TVGAQATAGPRPEVAETTPAPGQPPEAPAAVGPTGKPWPLARATMVEPPR
VPNVPVSPVPLRNMVIGFIAGLLLAIAVALTREAGDRTVRTRAKLEELSG
LPTLAELPGRRGGTPRFGTDTAFDDAVRGMRTRLLRAMGPDARQVLVTGP
FGGEGTTTTAMNLALALAEMGEDALLVEGDSRRHVIAGLLRVESGEGLAS
ALANPAAAAEVVKPTPISRLFILASRSARRESLPPSAYLPEVVDRVVQEL
SSRFDRIVIDGPPVLATADTGLLSGAVPATVLVVRAKRTTADELRDALTA
LRAAGAHVVGTVLTDARQSLHIRAADRAYRSKVSRPA
118465624YP_879859.1 hypothetical protein MAV_0579 [Mycobacterium avium 104]MRLRLGRPDITRYADRFDVPAAGPGGLSVTWLGVASLLIDDGSSALLTDG
YFSRPGLARVVAGKVSPSPPRVDGCLARAKVSRLEAVIPVHTHFDHALDS
ALVADRTGALLVGGESAANVGRGYGLPEDRIVVAADGEPIRLGAFDVTLV
KSHHCPPDRFPGVIAEPLIPPARASAYRCGESWSTLVRHRPTGRRLLICG
SAGFVPGALAGQRAGAAYLSVGQLGLRPRSYLDEYWDQTVRTVGARRVIL
IHWDDFFRPLSKPLRALPYAGDDLDSSIRVLDELAERDGVALHLPSVWRR
EDPWA
118465623YP_883282.1 transposase [Mycobacterium avium 104]MVKRPRITTERNIAMALDQSALLEVLDALRTADAGERITQAAETIYQALI
DAELTAFIGASPHERVTSRGVV
118465622YP_881415.1 hypothetical protein MAV_2207 [Mycobacterium avium 104]MTGTTSADPAAPAAQLVIFDLDGTLTDSAEGIVASFLHALESIGAPVPPG
DLVAQIVGPPMDDTFRSMQLGEDAEAAIAAFRAEYGARGWAMNTLFDGIE
ALLADLRAAGVRLAVATSKLEPTARRILAHFGLDHHFEVIAGASPDGSRK
AKVEVLAHALAQLEPLPERVLMVGDRSHDVHGAAAHGIDTVVVGWGYGHA
DSHPDGVTRAATIDELRRALGV
118465621YP_882082.1 SbmA protein [Mycobacterium avium 104]MGAKPFKPSIDWSAAFVDSLRWLAIAWVISAVCLFGVLLAFRFLTPWGRQ
FWRITRGYFVGAHSVRVWLMLGVLLLSVLLSVRLSVLLSFQSNDLYTALQ
KAFEGIASGNDAVKHSGIHGFWVSLGIFCLLAALWVTRFMADVYLTQRFI
IAWRMWLTANLTDDWLAGRAYYRDLFIDNTIDNPDQRIQQDIDIFTANAG
GTPNVPSNGTGSTLLFGAVNAVASVISFTAILWKLSGDLNLFGLVLPRAM
FWTVLVYVFIATVVAVWLGRPLIWLSFNNEKLNAAFRYALVRLRDAAEAV
GFYRGERVERAQLWQRFTPIIANYRRYVRRTIIFNGWNWSVTQIIVPLPL
AIQAPRLFAGEIAFGDVTQTATAFNNIHDSLSFFRNNYDAFAAFRAAIIR
LHGLVDANSKGRALPAILVKPSEETAVELRGIEVRTPEGDQLVDSLDIQL
DEGDTLVITGRSGAGKTTLLRSLAELWPYASGTLCRPDGDNATMFLSQLP
YVPLGTLRTVVCYPNSPDSIADSQLHEVLTKVALAPLISRLDEDQDWAKV
LSPGEQQRVAFARVLLTRPKAVFLDEATSALDEGLEYALYQLVRAELPGC
VMVSVSHRPTVEQHHDQQLHLLGGGPWQLSPVEKEPARV
118465620YP_880143.1 transcriptional regulator [Mycobacterium avium 104]MTGSGTGSQTLARGLTALQMVADAPAGLTVQQLADQVGVHRTIAYRLLTT
LAEFRLVAKGEDGRYRPAAGLAVLGASFDRNVRQLCLPTLRALADELGTT
VSLLVAEGDQQVAIAVIVPSHVAYQLSFHEGSRYPLDRGAAGIALLACMP
PRPGERELVSRARERGWVTTYGEIEPNTYGLAVGVRRPAPSPPTCINLIS
HREDVVMRGKDAVMRAAEQLSKLLS
118465619YP_884352.1 oxidoreductase- short chain dehydrogenase/reductase [Mycobacterium aviMSFAARYGPWALVAGASDGVGAAFAEGLAERGVNVALLARRQDVLDRVAA
RIRARTSAQTRTLAIDLAHPGAAKAIAAATADVTIGMLVYCAGADPDFKP
FLANRIEAAEAMVQRNCMVPMQLCHHYAPAMVERGAGGIVLFGSGAGLAG
GPNMVAYGASKAFDMVFAEALWAELHDKGVDVLGLILGKTDTPALRALEY
SRGQIASPDQAPSDAAAVSDVIAEAFENLGNGPTLMVGDTMRAAAQLLAS
LSRNQAVELFAQAAAAAMGPDD
118465618YP_882285.1 oxidoreductase- short chain dehydrogenase/reductase [Mycobacterium aviMLGFDRLPEHIVDKRVTELMDLSGKKAVVTGAGGDGLGQAIANRLGGLGA
DIALIGRTLEKVQRRGREVEERWGVKTVAISADMSDWDQVHNAVREAHWQ
LGGLDIMVNNPVMVAGGLFETQTKEQIDFTVLGSLTMMMYGAHAALQFLL
PQGSGKIINIGSVGGRIQQRGLVVYNACKAGVIGFTRNLAHEVALRGVNV
LGVAPGIMLNPQLKQYVLDPQDDQERAGRDAMIEAITQQVQLGRASLPEE
AANMVAFLATEAADYLCGQTIDVAGGQWMG
118465617YP_880258.1 hypothetical protein MAV_0999 [Mycobacterium avium 104]MRLILNVIWLVFGGLWMAVGYLAAALVCFLLIITIPFGFASLRIASYALW
PFGRTIVDKPTAGSGALIGNVIWVVLFGVWLAIGHILSAAAMALTIVGIP
LALANLKLIPVSLMPLGKQIVPVGSPVPHAPPVAA
118465616YP_881018.1 MerR family transcriptional regulator [Mycobacterium avium 104]MLHNVRRAPKRVRRQSREYRQLIEGAVSQLFDAAVRHPHGDPNSGEYRIE
DLARLAGTTTRNIRVYRDRGLLPPPLRVGRIALFNDTHLTRLRLITSMLD
RGYTIAHVREMLSAWEQGKNLGDVLGLETAIVGTWTTEKPETMSLAEAQR
LVGDPRAFERLVALQVIRVDGTRATLTRPKLIEAFNEIRGYGVEFDKLID
LHEQIVPEIDKISDMLVRAGAEHVLDRIKPGEPLPADAEIAELITMLVRF
RTQAVATVTATLASSIEANIESLVSRILADYLESSSSA
118465615YP_881872.1 NADH ubiquinone oxidoreductase- 20 kDa subunit [Mycobacterium avium 10MPTQAAVKAEETLIHVLWINAGLSCDGDSVALTAATQPTIEEIALGALPG
LPKIAVHWPLIDFECGPEGGADDFLSWFFKADRGELEPFVLVVEGSIPNE
NLHDEGYWCGFGNNPGTGQPVTTSEWLDRLAPKATAIVCAGTCSCYGGIH
AMAGNPTGAMGVPDYLGWDWKSKAGIPIVCVPGCPTQGDNLSETLTYLLY
MATGQAPMIPLDDELRPTWLFGNTVHEGCDRAGYYEQGDFATEYGSPKCI
VKLGCWGPVVKCNVPKRGWINGIGGCPNVGGICIGCTMPGFPDKFMPFMD
EPPGGLISSTASGLYGSFIRPLRRITGRTLNKEPRWRHKGKQLTTGARRT
W
118465614YP_881407.1 hypothetical protein MAV_2198 [Mycobacterium avium 104]MVAADHAPSYARKLGIQRDQVVQEWGWDEDTDDEIRAAVEEACGSDLLDE
DTDEVVDVVLLWWRDGDGDLVDTLMDAISPLAEDGVIWVLTPKTGKPGHV
LPAEIAEAAPTAGLMPTSSVNLGDWSASRLVQPKSRAGKR
118465613YP_883472.1 acyltransferase- ws/dgat/mgat subfamily protein [Mycobacterium avium 1MAQTLDTAFLKAHDPDQHASLAIGAVAIVDGTVPDPAQLEHLVAERILPI
ARCTQLLRAHPLNREWVDCPDFDLAWHLRRVAIAGTGDEAELSRVIGQAL
RRPLDPGRPPWECWVIEGLRGNRWAMLMKTHHGLLDGNPAARLITRLCDD
ADADMFANNAAAQPVSSPTGWLDALSRVSSLTGGLLGALRLAGRAEAVAP
VRRYATVRVPIADVDRVCRKFGVSANDVALAAVTEGFRTVLLDRGEQPRA
DSLRTLVPLPVRSAVLSHLPVEHDDPVRRLQTVHARCNPAAGTQPAGIVE
SAIGLVPNMVRGNLIQLLSRLPQRAVVTLATNVPGPRRRLRVMGQTLERL
LPVPPTATQLHTGVAVLSYGDELVFGITAGPGDGFDVTRLAAAVELGMAR
LAALGDDSVLLFADRRRRRAARSPLGRVPPAHPSAPGHARH
118465612YP_881370.1 ISAfe7- transposase OrfA [Mycobacterium avium 104]MPKEQSPGKPTTRRYSAEEKAAAVRMVRTLRAELGTEQGTVQRVARQLGY
GVESVRTWVRQVDIDEGLAPGVTTSESKKVKELEQEIRELKRANEILKRA
ASFFGAELDRQHKK
118465611YP_880986.1 MmpL10 protein [Mycobacterium avium 104]MSPTAPAGDEVEMRRIADFVVRWPWLVIGFWAALAVALPLAFPSLAEMAQ
KHPLAILPGNAPSNVAARQMTEAFHESGSDDLLLVALTDEKGLGPADEAV
YRRLVDALRRDTRDVVMVQDFISAPPLRSAVTSKDRKAWVLPVGIAGELG
TPQSYAAFNRIAGIVKQTLEKHENGPAATSLTVSLTGPAATVADLTVAGE
RDRLPIELAIAVLVLVVLLVVYRSAVTMLLPLVTILLSLVIAQAAVAGYS
QLTGSGVSNQSIVFLSAIMAGAGTDYAVFLISRYHDFLRRGDDFDQAVRK
ALISIGKVITASASTVGITFLLIGFARMGVFKTVGISSAIGIGVAFLAAV
TLLPAIMVLAGPRGWIRPRRELTTGLWRRSGIRIVRRPRAHLVASVLVLI
ILASCAGLVRYNYDDRKALRPSAPSSVGYAALERHFPVNQSIPEYILIRS
PHDLRTPQALADLEQLADRVSQLPNVSVVSGITRPTGNVPEQFRATYQAG
AIGSMLAGGSTMINDQTDDLNRLARGAGTLADNLGDVRGQVNQLAASVRE
LENAFSSTKNQYSGDALVNQVDIAARLVDHVNSLSNAMGWNFTAAKNMFA
WIGPVLAALQGNPVCDADSSCSATRATFEQLVGPRGQADLDAIDDLSHQL
QAYPDKRALKASTDRLRNAFAKLNDVLRAMGMDRPGGLQSNLTTLQNGAD
QFAGGSRQVADAVAQLVDKVKQLGAGLSESAAFLLSLKHDAAHPAMAGFN
IPAQLLRLPQFQEAAKVFISPDGHSVRYLVQSKLSPFSTQAMDQVDAITA
TARGAQPNTALADAEVSMAGYTVGLKDTRDYYQHDIKFIIAVTLLVVLLT
LMALLRAIVAPLYLVATVVISYLSAVGVGVLVFQFLLGQQLHWSVPPLAF
VVLVAVGADYNMLLVSRMRDESPHSMRYGIIRTLSSTGGVITAAGLIFAA
SMSGLLFSSIGTVVQGGVVIGVGILLDTFLVRTVTVPAIAALAGRANWWP
SRIAVRRNPVSGQP
118465610YP_884230.1 hydrogenase-4- C subunit- putative [Mycobacterium avium 104]MNVMSYVAGAAQILAVMAGAPLVIGAMRQVRARLEGRGGGGVLQPWRDLR
KQLGKQQISPQGTTVVFAAAPAIVAGTTLLIVAIAPIVATGSPLDAAADL
FAVVGLLFLGTVALTLAGIDTGTSFGGMGASREITIAALVEPTILLAVFA
LSIPAGSANLGALVTNTIDHPGQVVSLTGLLAFVALVIVIVAETGRLPVD
NPATHLELTMVHEAMVLEYAGPRLALVEWASGMRLTVLLALLANLFLPWG
IAGGHPSAVDVAIGLAAITAKVTVLAVALAGAEVFIAKLRLFRVPELLAG
SFLLALLAVTAANFFTARA
118465609YP_880372.1 hypothetical protein MAV_1120 [Mycobacterium avium 104]MPAPELRDVRTVFLDRDGTVNVKAAEGEYIRSPAELVLLPGAARALAALN
AAGLRTVLVTNQRWLSEPTAAPADFAAVHDRLIRLLADRGARVDAAYHCP
HPANSCDCRKPGPGMLLRAAAEHDVDLAASVMIGDSDVDMVAGRAAGTKT
ILIRPGARQAVAEADFVVDDLAAAVELILNAGKTPPAG
118465608YP_880729.1 hypothetical protein MAV_1488 [Mycobacterium avium 104]MSGLRFSTVVGDSGTVVDTGRAGQLRDRSRDRNRPRRNVFPDKYGVLVCT
VC
118465607YP_882422.1 transposase [Mycobacterium avium 104]MALSTYYDAKARVPSARALRDAVLGPALCQLWKDNYCVYGARKLWKTARR
DGHDVGRDQVARLMRAAGIEGVRRGKRVRTTKADPAAARHPDLVHRNFAA
AAPNQLWVTDLTFVPTWAGVAYVCFIIDAHSRMIVGWRVASHMRTSMVLD
ALEMARWSRGTTLQDLICHSDAGSQFTSIRYGERLAEIGTVPSIGTVGDS
FDNALAETVNGYYKAELIYGPARSRPWKTVEDVELATLSWVHWHNTSRLH
SYLGDIPPTEFEAAFYDAYRTDQPLIGIQ
118465606YP_880434.1 glutamine amidotransferase- class-II [Mycobacterium avium 104]MCRLFGLHAGTRACTATFWLLDAPDSLAEQSRRNPDGTGLAVFDEHARPQ
LHKEPIAAWRDAAFAREAHQLTGTTVIAHVRYATTGSLDVRNTHPFLQDG
RIFAHNGVLEGLDVIDARLREVGVDGLVLGDTDSERVFALITAAIRARDG
DITAGLVDAVRWLAEQVPIYAVNLLLSTATEMWALRYPHTHQLYVLDRSA
DAARQPEFDLHTIRIHARSQQLRTRPSVVFATERMDADPRWRLLEPGELV
HVDAGLRVTRRLVLPDPPRQLLRRDELSTPVRDSQHALPDTRRAG
118465605YP_883003.1 DNA-binding protein HU [Mycobacterium avium 104]MSEGLMNKAELIDVLTQKLNTDRRQATAAVENVVDTIVRAVHKGDSVTIT
GFGVFEQRRRAARVARNPRTGETVKVKPTSVPAFRPGAQFKAVVSGAQRL
PSEGPAVKRGVVGGAAKKTAAKKAPAKKAAAKKAPAKKAAAKKAPAKKAA
VKKAPARKAATKAPVRKAATKAPAKKVAAKKAPAKKAATKAPAKKAASKA
PARKAAAKKTTARRGRK
118465604YP_881269.1 cysteine synthase A [Mycobacterium avium 104]MSIAENVTQLIGNTPLVRLNRVTEGAVADVVAKLEFFNPGNSVKDRIGVA
MIDAAEQAGLIKPDTIILEPTSGNTGIALALVAAARGYRCVLTMPETMSV
ERRMLLRALGAEIVLTPGADGMPGAIAKAEELAKSDDRYFVPQQFENPAN
PAIHRSTTAEEVWRDTDGKVDIFVAGVGTGGTITGVAQVIKERKPSAQFI
AVEPAASPVLSGGQKGPHPIQGLGAGFVPPVLAMDLVDEVIAVGNEESIA
LARRLAAEEGLLVGISSGAALVAALQVARRPENAGKLVVVVLPDFGERYL
STPLFADLAD
118465603YP_883743.1 hypothetical protein MAV_4614 [Mycobacterium avium 104]MVYLLLVLILGTLIYVGWRAARSQAARPKTRVIGPDDDPDFLRRLGHGDN
NPF
118465602YP_882104.1 subtilase [Mycobacterium avium 104]MQRSATAEANVWRGRASAAALAALLLASGALAGLPPAAAISPPTIDPAAV
PPDGPPGPGAPMKQNSYCTEVGVLPGTDFRLQPKYMDMLNLQEAWQFGRG
AGQKVAVIDTGVTPHPRFPHLIPGGDYIMSGDGLSDCDAHGTLVASMIGA
ASADGAGVPPAAPRKPVTIPTTEPPPKAPPPQTVTLSPLPQTVTMVPPPP
SQEQQQPPPGPFGAPPPPPAAGPAPAGPPPGPPQGGQAPAGNHGGGTVTI
PGHAGAARVTNVDNLRGPRPLDPPPPTPPKPGPDAFSGVAPDVDIIAIRQ
SSQAFGLKDAYTGDEDPQTQAKIDNVQTMARAIVHAANMGASVINISDVT
CMSARNIIDQRALGAAVRYAAVDKNAVIVAAAGDTSKKDCKQNPPHDPLQ
PNDPRNWNSVTTVVTPSWFSDYVLTVGAVDTEGHPLSQGNQGQASTSVAG
PWVGIAAPGTDVVGLSPRDDGLINAIDGPDNTLLVPSGTSFSAAIVSGVA
ALVRAKYPQLSAYQVINRLTRTARAPARGVDNQVGHGIVDPVAALTWDVP
DGPVKPPQQLSAPLTIPKPVPRRDMVPIWVAAGGLFGALLIGGAVFGTAM
LMKRSRRQQ
118465601YP_884179.1 hypothetical protein MAV_5061 [Mycobacterium avium 104]MVSHLPADRVDETGARTVAQGIEDGVAAERLGFANVYLSERWNLKEAGVV
LGAIGARTTRVGLGTGLVSPARRHVLHMAALGATIHAAVGPRFLLGLGRG
DHAYLRHEGLKTAGFAAVVDYVKIMRRLWDGEAVTYDGPAGNYRNIKLGD
IYQGPAPQVLYGTFGMPKAAAAVAEAFDGVILPPMMSPSATTASVGRLRR
ACEAIGRDPATLRVVQCVVTAPDLSVDETRALAHARAVTYLQAPEYGAAL
ARVNGWSLAPVERLRAAVAKVKSAGDELVDTAFHRIQLMDLADMVPDEWM
EASCAFGTAAQCARKLQEFKRAGADEIATYGSTPSQNAGVLAAWSDAFAG
DMR
118465600YP_879910.1 short chain dehydrogenase [Mycobacterium avium 104]MLDGKVVVISGVGPGLGTTLAHRCADSGADLVLAARTAERLEKVAKQVND
GGHRALAVRTDITDDDEVAYLVETTMATYGRADVLINNAFRVPSMKPLAG
TSFQHIRDAIELSALGALRLIQAFTPALETAHGSIVNVNSMVLRHSQAKY
GAYKMAKSALLSMSQSLATELGEKGIRVNSVAPGYIWGDTLQAYFEHQAG
KYGTTVEQIYAATAANSDLKRLPTEDEVASAIMFLASDLSSGITGQTLDV
NCGEYHT
118465599YP_882931.1 50S ribosomal protein L19 [Mycobacterium avium 104]MNRLDFVDQASLRDDIPVFGPGDTVNVHVKVIEGAKERIQVFKGVVIRRQ
GGGVRETFTVRKESYGVGVERTFPVHSPNIDHIQVVTRGDVRRAKLYYLR
ELRGKKAKIKEKR
118465598YP_882977.1 dibenzothiophene desulfurization enzyme C [Mycobacterium avium 104]MRRTDSGTTEFHNVAVRPDEVLGKPNAILEAFLASGRGSLFGPIVQLVFS
SVYLGIARGALETAREYTRTQARPWTPAGVTQAVEDPYTIRSYGEFGIQL
QAADAAAREAAQLLQAAWDKGDALTSQERGELMVQISGVKAIATQAALDV
TSRIFEVIGARGTHPKYGFDRFWRNIRTHTLHDPVSYKIAEVGNYVLNQR
YPIPGFTS
118465597YP_880138.1 LAO/AO transport system ATPase [Mycobacterium avium 104]MTIGELIDRARNGSPRAAGRLLSLVEGEQRDEVLTAIGPAPRDTGPVIGI
TGPPGAGKSTTVAALVGAYRRRGCRVAVLAVDPSSPFSGGALLGDRIRMA
AHINDSDVLIRSVATRGHLGGLAAAVPAAIRLLAAIGYDVVLLETVGVGQ
SEIEIAAVADPTVVILNPGAGDAVQAAKAGVLEVADIVAVNKADRDGAEQ
TVRDLRAETSAPIVSLIAARGEGIEDLMAAIEDHRRTDSRARRLARARAQ
ILSLAQTRLRTQPALDRLAEAVVDGTQDPYTAADRLLSPSRTETD
118465596YP_882278.1 glycosyl hydrolase- family protein 15 [Mycobacterium avium 104]MAEQTVDAGTVFAPRVLREYALLADGERGALIGPQGDVAWMCAPRWESDA
VFSNLVGGGGVYAITPTDVRHVWGGYYEPGTLIWRNRWITRDGIVECREA
LAFPGDPERVVLLRRLVACRGTVRVRVLLAPAAEFGKHGPGRPRLDDDGV
WSGRSGRLRWRWLAGCDARPVDSAGHGAGELLGCEITLDEGGRHDLVLEL
SERTLPERLPDAGLAWDATAAAWQRSVPALNCTIAPRDGRHAYAVLRGLT
SCGGGMVAAATLGLPERAHTNQNYDYRYAWIRDQVYAGMAAAAVGTTELL
DRAVGFIGARLLEDGANLKPAYTVTGGAVPGEETLDLPGYPGGTDKVGNW
VNQQFQLDVFGEALQLLAVAGAADRLDAEGWRAAQAAIRAIEKRWREPDY
GVWEIQDERWTQSRLACVAGLRAVAKLAGAGPELTACASLADAILADTAS
ESLHPHGYWQRSPRLPGVDASLLLPPVRGAVPADDPRTRATLDAVRRDLT
DDGFVYRFRHDERDLGEAEGAFLLCGFMMALAEHQLGHTHCAMRWFERNR
AACGPPGLFCEEYDVRQRQLRGNLPQAFAHALMLECTATLAEDAVHHD
118465595YP_880859.1 amidohydrolase [Mycobacterium avium 104]MPSRELSFPVFDADNHMYEPQEALTKFLPDHRKHVIDYVQIRGRTKIVVR
GHISEYIPNPTFEVVARPGAQEEYFRNGSGGKSYREILGEPMKAIPAFRE
PGARLEVMDELGIDYALMFPTLASLVEERMKDDPEMTHDVIHALNQWMYE
QWSFNYKDRIFATPVITLPIVDRALEELEWCLERGARTVLVRPAPVPGYR
GSRSFGFEEFDPFWQACVRAEIPVSMHASDSGYSELLNIWEPGDEFLPFK
PTAFRSLAMGHRPVEDAFGALICHGALSRNPDLRILSIENGADWVPHLFK
GLKGVYKKMPQAFAEDPIETFKRCVYVSPFWEDRFAEIVNMVGTDRVVFG
SDWPHPEGLKDPISFVDELADFSDEDKAKIMGGNLMKLMKVSAPAAKKPV
SA
118465594YP_883238.1 phosphoheptose isomerase [Mycobacterium avium 104]MIEVHFDALREAVRRTSIQAPRLRGWGGRLATVLPAGGRLLACGNGGSAA
EAQHLTAELVGRFREERIPMSAIALHADTSALTAIANDYGDDEVFARGVR
AHGRPGDVLVALSTSGASRNVIAAVKAAHDVGMVTWALTGPAPNELAGMC
DEAICVDAAGTATVQEVHLLLIHGLCMALDDHLLRREAS
118465593YP_880410.1 nucleoside triphosphate pyrophosphohydrolase [Mycobacterium avium 104]MIVILCDPRRPSLVPVEAVEHLTGEVQYTEEMPIAVPWSLPAARPVHSGD
PDDPAPVLLSSDRDHPAVTARLAAGARLISAPDAPRGERLVDAVAMMDKL
RTAGPWESEQTHESLRRFLLEETYELLDAVAGGNAEALRDELGDVLLQVL
FHARIAEDAPQSAFTIDDVAAALIRKLGNRVPGVLAGQTISLEEQLAQWE
ERKAAEKPRKSVMDDVHTGQPALALAQKVIGRAEKAGLPADLIPPQVTSI
AISADVDAESALRTAVLDFVATVRGVERSIAAARRGTSVPDEFDIAPLGE
ISEQEWRQHWPAGDTDPEPAPAEQLTDDAGGDEN
118465592YP_880632.1 NikQ protein [Mycobacterium avium 104]MTGLYYDPWNREIDADPYPIYKMLRNEAPLYYNERHDFWGLSRYDDVDAA
LRDPLRLSSAKGDILDVVKADPVMPPGVFINEDPPLHTIHRALVARAFTP
KKMRTLEDKIRAFCVASLDMVADSDRFDFVEDLGAELPMRTIGMLLGIPD
ADQPSVREHARATLHNDTGGPMPIRKDHYFDGDMFSDYVEWRKQNPSDDL
ITELLSVDFEDQSGTVRRLTTPELLIFLAVIAGAGVETTGRLFGWMGKVL
ADHPDQRKELAEDRSLIPAAVEELLRYEPPGPSVARYVTEDVEFHGQTVP
SGSAMLLMLSSANRDERRFDHPDRFDIHRKPGRHLTFGRGVHFCLGAPLA
RLEGRIGLEEVLNRWPEWEIDMDNARRSRTSTVRGWDSMPAIVT
118465591YP_882277.1 glucose-methanol-choline oxidoreductase [Mycobacterium avium 104]MHSRDLPGERTMRRYADDDEVDLVVVGAGAGGSVLAQRLARAGWRVVILE
AGPFWHPDEDWVSDEAGSHPLYWTQKRIIGGADPIELGKNNSGRGVGGSM
IHYAGYTPRFHPSDFATYTLDGVGADWPIRYEDLRRHYEQVELELPVAGQ
NWPWGDPHRYSFAPHPISGAAAKLWEGALKLGIEMRVGPVGIVNGTFGNR
PHCIYRGYCLQGCKVNAKASPYVTHLPDALAHDVEIRANCMAARVELDGS
GAARGVVYYDEAGGTERLQRAKVVAIAGYSIETPRLLLNSVSDRFPNGLG
NNDDQVGRYVMVQGATQSAGRWSEEVRMYKAPPPEVTSEQFYETDSSRGF
ARGFSIQTVSPMPIGWAEHVLADGHWGRALREYMRDYNHWATIGVLNELL
PQPDNRVTLADEKDAYGIPVARFDYTLCDNDKANMAYSTNVIGDILRAAD
AQDVLTIERFAHLIGGARMGTRPDNSVVDSDHRVWGVPNLFVADGSVCPT
QGSANPALTIMALASRLAERLAAGKVDTAAGRRSKAAARG
118465590YP_882146.1 TetR family transcriptional regulator [Mycobacterium avium 104]MRSHGWAGNTPASDAEAIERILDAADRIIAERGSALRIADVARALGVTRQ
TVYRYFPGTQALLVASAMRSADGFLDRMAAHLDGVTDPVVAITEGMAFAV
EELASDHQVEFVLNQRHRGGQKVSIISDTALAFGRSMLHRYDIDWESYGF
DEAGLEELNEFSLRVLHSFLTDPGRPPRTGADLRRYLTRWIGPAIAYPQL
LRAMDALGAAEPQQRPRRRASKAS
118465589YP_882499.1 FeS assembly protein SufD [Mycobacterium avium 104]MTNLTEAVEGSSLAAANKGELFASFDVDAFEVPHGRDEIWRFTPLRRLRG
LHDGSAPATGKAEVSVGEQPGLRVQTVRRGDERLGQGGIPTDRVAAQAFS
SFNSATLITVQRDTQIAEPIGVTVTGPGEGAVAYGHLQIRVEELAEAVVV
IDHRGSGTLADNVEFVVDDAARLTVVWLADWADDAVHVSMHHARLGKDAV
LRHVAVTLGGEVVRLTANVRYTSTGGDAELLGLYFADDGQHLESRLLVDH
AQPDCKSNVLYKGALQGDPASALPDAHTVWVGDVLIRAEATGTDTFEVNR
NLVLTDGARADSVPNLEIETGEIAGAGHASATGRFDDEQLFYLRSRGIPE
EQARRLVIRGFFAEIISKIAVPEIRERLTAAIEHELAFTESRATAS
118465588YP_883214.1 alpha/beta hydrolase [Mycobacterium avium 104]MRARTDPFPDRLPPSRTVTVRAVDGTRLHAQVFGPPDGYPIVLTHGITCA
IRAWAYQIDDLARDYRVIAYDHRGHGRSGVPKATGYSLKHLAADLDSVLE
ATLAPHERAVLAGHSMGGITIAAWSNRYRHKVSRRADAVALINTTSGELI
RQVQLLSVPPGLSPARVLAGRVLIGAFAGFAVPRAARVPSRHLVALLATG
RDADPAIARLVYELFENTAPAGRAGCARALVSALGSRYLDLAGLTVPTLV
IGSERDRLTPIRQSRRIAEGLPNLIELVELPGGHCSMLEHPREVNRRLRA
LAESATRNLPTHRISS
118465587YP_879414.1 PPE family protein [Mycobacterium avium 104]MTAPVWMALPPEVHSTLLSSGPGPGPLLAAAATWTGLSTQYDSAATELTA
VLTGSMPVWDGPTADRYVAAHMPYLAWLQLAGALSAEAAAQHQGVATAYT
AALAAMPTLPELAANHATHAALVATNFFGVNTIPIAVNEADYARMWTQAA
TTMTTYQATTEAVQMTSVAGSGTGGKAGSGSGSGTGAGTGTGTGTGTGTG
TGTGTGTGAGSGTGGGTGAGGGGGTGSFQLPTPEEIWEMLFGPDGEQIPG
QGQPNWSPSEYLQNLGNFFNGNAQAVAWLQQNLSGLLNPSQFPALINYFI
AWQTYRIINWTIRTLRFILQELPLLLQVGLSLSITSLGGLAGLAGLAGLA
GLAAPASAPAPAAMPQPAGMGAQPPVVSAAPAMAPMAPTSPVAPATSAVS
TPAPVASAIAPPATPPVPPAPVTGAEGFGYMVGSFGLGMDSKAQTRARSA
LAAGRPAASSAGAAAVEQEQGRTRRRPRSVIDPGYRYEFIEGDDEVVAVA
SAAQDRYRPSDSGGSIQGFAGTLPKSGVRASGLNTLAGNESGDGARIPML
PESWDGP
118465586YP_879557.1 hypothetical protein MAV_0268 [Mycobacterium avium 104]MSEVPFTPAEHKAIDAKLADRKPNNSAWAAGLADAFHVLPLERARKRPVN
RGWPTAPALTEAALAWHLDQGGNIGALLGASGERGLIAWDADNAAGAEAI
EAAGYTPFAIPANALNPNHSKGRYGGRHFLWSVPAEWAVPGMELTSPRAT
VTLAGGGTVDVLAGPKFLVLPPSYLCEEGHLNPYNPGAGWTPSPPPLPVQ
FWPDWVRPEGTPDPPAELAALRVDIRKRTAFERAEDRMLSAGSRALTELI
DAVPMATWLAMDDQRYIEVLDTAGSCGCPKGRFSLQSSATGMELHDGCAY
GRGVHVYSGTLAAHLAGNGETRDHMSWPDFIAGLYGRSFRDVVRDAGIEL
RAERQELDHVTAEQLDQAAGEAEARGDTARAEELRVAAAKQRAAVMAYAE
QHGEVFLTEAAVGGVPAAPIPAVGVAPQLTLIAGGAPLQSAPAIGTLGVA
VDGSLALKPEPAPVETVAAEPAAAPVVEPATEPGMAPAATEPAAQPAAEP
VAADDPAGRTQAVKDRAREALHHSVEPELLERLFCTKELQRVRKRAEEGL
APPVLALTADLAGVLSLVPPTTRIPPIVMNRQSGFNAIYSSVAESGGGKS
GTASVSFNPVAGAVGLPKPFVPPCMPLGSGPAMAELFVTMEKDKETKERY
PVVHNDSARVYWPEISRMDATKTQSGSTLSSEMCQAFSSEELGSLTKTNC
AYAMPHTYRLIMAMGSQLATAGAALDPLSALMGLSQRVWWVCGETFDVPV
EGTPEFEAWAERIPDSMKGDDDGLVDLPIPAFPAGNVPVDREVRIEVRKI
RMRLQAAKRDPETALETHTALIRLRWAFAAAVYHGEAPAITKKWWDWTAI
FEEHHRRVRRACQIAQPLLRTGEAVQAGILDDIRSSTREAAQHRDAKQNL
LRWARAQHVAGKQFTAAQGANSGKAGSYRRQHGAQLVQELVEDGLLGVQL
VHVAQVGGELAYHGPTQLGLDVDLDAVQ
118465585YP_882997.1 uracil-DNA glycosylase [Mycobacterium avium 104]MTARPLSELVEPGWARALQPVAEQVARMGQFLRAEIAAGRRYLPAGPNVL
RAFTYPFDEVKVLIVGQDPYPTPGHAVGLSFSVAPDVSPLPRSLANIFQE
YTADLGHPPPSCGDLTPWAQRGVLLLNRVLTVRPSNPASHRGKGWEPVTE
CAIRALTARQQPLVAILWGRDASTLKPILAQGNCVAIESPHPSPLSASRG
FFGSRPFSRANKLLAEMGADEIDWRLP
118465584YP_881834.1 oxidoreductase- NAD-binding Rossmann fold protein [Mycobacterium aviumMTLRVGIIGVGWGARVQVPGFRAAKGFEPVALCARTPDRLERAAAKLGIE
QTSTDWQSFVTRDDLDVISVATPTVLHHEMTIAALAAGKPVLCEKPLAGD
LEAARHMVRAATDSKLPTACCFENRWNPDWLAVADKVRSGFLGSQYLARV
SRSASYWHPSHPLQAHWMYDREQGGGYLAGMLVHDLDFLTSLLGRPVSVC
AEVRTSDPVRELPDGGTLPVTADDTAALLMRMESGVTVILSLSVMGAHAD
HYRLELFGSDGTIIGDGDLRSAAYSLGAATDAGLSPLTVDEREPAHPERL
PGGLAGHASRAMALMLQDWLPAFDGGPSGAATFEDGLLSLAVIDAAHRSA
EGGGWEQVQV
118465583YP_883909.1 cobalt-zinc-cadmium resistance protein [Mycobacterium avium 104]MGAGHNHTPAETGDARLIPRMVMAAAILAAFFVVELVTSLLINSIALLAD
AGHMLTDVVAVFMGLAAVTLARRGSSSPARTYGWHRAEVFTAVANAGLLI
GVSVFILYEAIQRLREAPAVPGVPMIVVALAGLAANFVVALLLRSHSSGS
LAVKGAYLEVIADTVGSLGVLIAGVVTVTTRWPYADVVVAVLVALWVLPR
AISLARDALRILSESSPTHIDVEELRAALGAVDGVTGVHDLHVWTLSPGK
DMCTAHLISTGDSARVLRDARAVLSARGLAHATVQIDCPDDTECSDSF
118465582YP_879808.1 inorganic pyrophosphatase [Mycobacterium avium 104]MEFDVTIEILKGQRNKYEVDHETGRLRLDRYLYTAMAYPTDYGFIEDTLG
EDGDPLDAMVLLPQSVFPGVIVEARPVGMFRMTDEKGGDDKVLCVPAGDH
RWEHIQDIGDVPEFELDVIKHFFVHYKDLEPGKFVKAADWVGRAEAEAEV
QRSIERFKAQGH
118465581YP_884404.1 hypothetical protein MAV_5293 [Mycobacterium avium 104]MDYCLAGDGGAAAIWHGQPDLDLDGDGRFESIGLDFDHDGLRDDALADLD
GDGLVDHAVLDLDNDGTPEAYFTDDGSGTWAVAVDRNGQLRWFGLDGVEH
TGGPMVDFDGHGRPDARLVDTDDNGLADRVLRTDETGVTGYVDTDGDGKW
NVRLTDTDGDGLADGASAL
118465580YP_879347.1 hypothetical protein MAV_0047 [Mycobacterium avium 104]MADSALQQQLDEVRTLLARARELFGPNPVEPPTGIAPDPSAAKPWLR
118465579YP_879834.1 lysyl-tRNA synthetase [Mycobacterium avium 104]MSPAPDADIPEQYRIRRDKRARLLAEGHDPYPVAVERTHTLAQVRAAHPD
LPVDTATDDVVGVAGRVIFARNSGKLCFATLQEGDGTTLQVMVSLDKVGR
EALDAWKADVDLGDIVSVHGTLISSRRGELSVLADSWRMASKSLRPLPVA
HKEMSEEARVRQRYVDLIVRPQARTVARQRIAVIRAIRNALERRGFLEVE
TPMLQTLAGGAAARPFVTHSNALDIDLYLRIAPELFLKRCVVGGFDKVFE
LNRVFRNEGADSTHSPEFSMLETYQAYGTYDDSAVVTRELIQEVADEAIG
TRQLPLPDGSVYDIDGEWASIEMYPSLSAALGEEITPQTTVEKLLGIAER
LGVEIPRDRGYGHGKIVEELWEHTVGDTLTAPTFVRDFPVETTPLTRQHR
SIDGVTEKWDLYVRGVELATGYSELTDPVVQRERFAAQARAAAAGDDEAM
VLDEDFLAALEYGMPPCTGTGMGIDRLLMTLTGLSIRETVLFPIVRPHS
118465578YP_879679.1 aspartate-semialdehyde dehydrogenase [Mycobacterium avium 104]MVAIGVVGATGQVGQVMRRLLDERDFPATSVRFFASSRSQGRKLEFRGAE
IEVEDAATADPTGLDIALFSAGKTMSLVQAPRFAAAGVTVIDNSSAWRKD
PDVPLVVSEVNFERDAHRRPKGIIANPNCTTMAAMPVLKVLHDEAGLQRL
VVSSYQAVSGSGIAGVEELATQARAVIDGAEQLVHDGRAVSFPAPQTYVA
PIAFNVVPLAGSLVDDGSGETDEDQKLRHESRKILGVPDLAVSGTCVRVP
VFTGHSLSINAEFARPLSPERARELLDGAPGVKVVDVPTPLAAAGVDESL
VGRIRRDPGVPDGRGLALFISGDNLRKGAALNTIQIAELLAAQL
118465577YP_884123.1 ABC transporter [Mycobacterium avium 104]MARSHPQHAAPNPNRNIKAVRTVRFWAAPLVITLALMSALCALYLGGILN
PTTNLRHFPIAVVNEDAGPGGAQIVDRLATGLDRNKFDIRVLSRDEAKHQ
LDTGRVYGSLLIPPSFSSKLRDFATSAVSPARPDKPSITVSTNPRAGTLG
ASIAGQTLNSAMGTANGIAAQRVMAEVTAQTGGTPLPGATQAGLSSPIEI
QSVVYNPLPNGTGNGLSAFYYALLLLLAGFTGSIVVSTLVDALLGYVPAE
FGPVYRFAEQVRISRFQTLLLKWAMMVLLGLLTSAVYLAIANGLGMPIDL
SWELWAYGVFAIAAVGITSSSLLSVLGTAGMLVSMLVFVIFGLPSAGATV
PLEATPPLFRWLAEFEPMHQVFLGTRSLLYFGGRGDAGLSQALTMTSAGL
VIGLLLGGIVTHLYDRKGFHRIPGAVGFAIAQDHQAQHQARRGKSTQPPD
SPVEPETPAEPESPDEPESPSAQT
118465576YP_883514.1 hypothetical protein MAV_4379 [Mycobacterium avium 104]MTAIRCDDVVTATRVPAARAARPPRPAPADSGNPLMDMTTRLLAIPLHQL
YAVLWRVGIIEVRA
118465575YP_882796.1 diaminopimelate epimerase [Mycobacterium avium 104]MKFAKGHGTENDFVLLCDTPAELRLTAAGVAALCDRRRGLGADGVLRVTT
AGAAAAAGVLDRLPDGVAGDDWYMDYRNSDGSVAQMCGNGVRVFAHYLRA
SGLETRDEFVVGSLAGPRPVTVHAADATGADVSVDMGKANTLGSGGKAFE
ATVGGRRFAGLAVDVGNPHLACLDPELSVDELAALDVAAPVSFDAAQFPD
GVNVEVLTAPAAGVVHMRVHERGVGETRSCGTGTVAAAVAALTAAGADTG
TLTVRVPGGDVVVTVTDATSYLRGPSVLVAHGEISEEWWQQAQR
118465574YP_882447.1 glycosyl transferase [Mycobacterium avium 104]MKCVLASYGTRGDIEPSVVVARELQRRGHDMIMAVPPDSVSFTEAAGLTA
VPYGLDSQAWLDVYRNFWTSFFRGFWKMGEMRGMWREMWDLSDQCWAQMN
TTLLSLADGADLLFAGQSYQEPAANVAEYYDLPLATLHHVPMRPNGQVVS
VLPAPLARSAMTAFDWFCWRLNKKVEDAQRRELGLPKATGPSPRRIAERG
SLEIQAYDEVCFPGLAEEWAKWDGQRPFVGTLTMELTTEADDEVMSWIRG
GTPPICFGFGSMPVESPADTVDMIGTACAQLGERALLCAGRSDFSGVPAP
DHVKVVGPVNYATIFPACRAVVHHGGSGTTAASLRAGVPTLILSMDANQT
IWGAQLKRLKVGATRRFSATDRDSLVQDLRKILAPDYARRAREIAARMTK
PADSVMKAADVVEDFVQSRSRTGRS
118465573YP_879672.1 hypothetical protein MAV_0387 [Mycobacterium avium 104]MSALLAQAQQMQQKLMEAQQQLANAEVHGQAGGGLVKVVVKGSGEVVAVK
IDPSVVDPSDVETLQDLVVGAMADASKQVTRMAQERLGSLAGGFGAPPGQ
PPAPAPGV
118465572YP_881461.1 hypothetical protein MAV_2257 [Mycobacterium avium 104]MSTRGFNDYPLRSISLNFPQGDPIAVAATERQAQSVQDQAEAFIDQVLDS
LASTTAIARTANAPTEVTQPG
118465571YP_883627.1 hypothetical protein MAV_4493 [Mycobacterium avium 104]MTGRVTPRPGVSHALRTGPGSDASWTREFARHSLPYG
118465570YP_880440.1 hypothetical protein MAV_1193 [Mycobacterium avium 104]MSEPGSATDTDTGDEPSQQQTAPDGTRTGAQTAVAEHPAPKAPAPGTPQP
EKPWWVRHYTFTGTTVGLVFIWFSLTPSLLPRGAIFQGLVSGISGAIGYG
LGVFAVWLYRYLWAKPSSPPPPRWAWKILIPVGAVGMVLMAIWFHVWQDK
VRDLMGVAHLKWYDYPVAGVLSLVVLFTCVEIGQFTRWLVSFLVGRLDRI
APFRLSATIVVALLVVLTITLLNGVVLKFAMRTMNNTFASANNEMSPDTA
PPKTPLRSGGPESLVSWESLGHQGRVFIEGGPRVEQLTAFNGAPATEPIR
AYAGLNSADGITATAELAARELQRTGGLRRAVVAVATTTGTGWINEAEAT
ALEYMYNGNTAIVSMQYSFLPSWLSFLVDKENARHAGQALFEAVDRLVRQ
LPEAQRPKLVVFGESLGSFGGEAPFMSLNNVLARTDGALFSGPTFNNTIW
TDLTSTRDAGSPEWLPIYNDGRNVRFVARAANLARPKDPWDHPRVVYLQH
ASDPIAWWTTDLLFARPDWLKERRGYDVLPETTWIPVVTFLQVSADMAVA
QNVPDGHGHHYVADVADAWAAVLSPPGWTPDKTDRLRPLLHANG
118465569YP_883590.1 50S ribosomal protein L14 [Mycobacterium avium 104]MIQQESRLKVADNTGAKEILCIRVLGGSSRRYAGIGDVIVATVKDAIPGG
NVKRGDVVKAVVVRTVKERRRPDGSYIKFDENAAVIIKPDNDPRGTRIFG
PVGRELREKRFMKIISLAPEVL
118465568YP_883716.1 hypothetical protein MAV_4587 [Mycobacterium avium 104]MLHILIHGRSDPPETTRGRIALRWARIAVLIVTGLVTLQSVLLVAGAWRN
DLAITHNMGVAQAEVLSAGPRRSTIEFVTPERVTYRPELGVLYPSHLATG
MRIYVEYNKNDPNLVRVQHRNAGLAIIPAGSIAVVGWLGAAVLLVLLALA
DKWLDRRGKGAGPADFA
118465567YP_883248.1 NAD dependent epimerase/dehydratase [Mycobacterium avium 104]MVVGASSGLGRCIGVGLAQRGDRVALLARRRQRIEAAAKDAGPGAVAIEC
DVTDQASCASAIGEAVDALGGIDNIVYTPAVGPLVRMVDTDADTWRRIFD
TNVIGASLVTAAAVPHLSASAGKAVYLSSDAGAFGPPWPGLGAYGVSKAA
LERLVEAWRAEHPDIGFTCLIVGECAGGEGDGQTGMNQGWDMDLAMKAVP
LWSSRGCMPGKLMPVEDLIDVVHTILRTNASTSMPLVVARGAPASQAAFA
EANQS
118465566YP_879706.1 formate dehydrogenase- alpha subunit [Mycobacterium avium 104]MANADCIVIQGSNMAECHPVGFQWVEEARARGARVIHVDPRFTRTSAVSD
RHIPIRAGSDVVLLGALINHVLTNDLWFSEYVVAYTNAATVINENFRDTE
DLGGLFSGFDPETGQYDTSSWAYEEEDDGRSGGEIESPGGGHTHGATATH
SAAGDEHGSGGPPLAHARVRRDETLQHPRTVFQILKRHYARYTPEMVKDV
CGISREDFDYLARSIVENSGRERTTCFAYAVGWTQHTLGAQFIRTATILQ
LLMGNVGRPGSGIMALRGHATIQGSTDIPTLFNLLPGYLPMPKAGVHDTL
ADYLDAVGSKKQKGFWANADAYTVSLLKAWWGEAATADNDWAYDYLPRLT
GPHGTYQTVMGMLADEVEGYFLLGQNPAVGSAHGRMQRLGMSHLKWLVVR
DFNLIESATWWKDGPEIASGELKTEEIETEVFFLPAATHVEKAGSFTQTQ
RLVQWRHQAVEPPGQCQSELQFFYELGKRIRQRLAGSTDERDRPLLDLTW
DYPTDEHGDPDGEAVLAEINGYRVGEPADPLASYTELRADGSTAAGCWIY
TGVYANAVNQAARRVPNGGASPSQSEWGWAWPADRRVLYNRASADPDGKP
WSERKRYIWWDPDQRRWVGYDVPDFVVDRAPGARPDPELGGPDALAGDDP
FIMQADGKGWLFAPKGVVDGPLPTHYEPQESPVANALYPQQRNPARITFA
RKDNLSAPSAGEPGSDVYPYVFTTYRLTEHHTAGGMSRWLPYLSELQPEM
FCEVSPELAAERGLQPYGWATIISPRAAIEARVLVTKRVAPLVINGHTVH
QIGLPYHWGVGGDAVVSGDAANDLLGVTLDPNVQIQESKAGSCDIRPGRR
PRGEELLRLIADYQSRSGVTAETGNVRVDDAVWERGS
118465565YP_879759.1 lipid-transfer protein [Mycobacterium avium 104]MISLRNQAAIVGIGHVPFGRRGELAEKGHLRLAVEAITLACEDAGITGKD
VDGYSSYYTEVEPAELVSAFGAQRLRYTAQTWGGGGASMCGAFQNAALGV
TTGQADYVVVHKVATMAGTARYGQAFGQMGQGVNAIGGPFAFSVPYGLQS
PGQMFALAARRHMHLYGTTSEQFAHVAINARTMAANNPAARFREPITVAD
HQASPMIADPLRRLDFCMESDYGCAVVIASADRARDLRQKPAYIAAAAVG
APYRYGNALMSFYNQPDEDFASSGHRTVADELYRHSGLTLQDMHAAMLYD
HFTAMMIMALEDFGFCKKGEGGPYVADGNLALGGPLPVNTHGGNLAEAYT
HGMTHVMEAVRQIRGSAINQIPSATNILVVGGAGPSPTSGMILTGSR
118465564YP_882626.1 hypothetical protein MAV_3444 [Mycobacterium avium 104]MRFDEYTEKHGLAVSPVERFAGLVVEVGVPRGWEPFDSAVGVRVWVCRTD
PCLDVFGANAVLTMHRVQAALDPADVFAMLVEQQLQTAPGCCELNRELGL
AGESVGVQGLLAMQITHELGAIESVSRSRIITAEEETLIAQLTMTVLRDS
PVERANIWLAVHKRAAVAGPASDDHHRNAPATTMRDRH
118465563YP_881700.1 PAS domain-containing protein [Mycobacterium avium 104]MTSPGADRYLSAAFRNKSLPERLRDLEAMVEAITDCAIIQLDANGDVARW
CPGAEAMTGYSAAEALGRPAALLYTSEDRAAGLAERELAAARESGRCEFE
GWRARKNGQRFRAGVALSVFTDDAGSAIGFTTVMRDVTAEHQRAETMFHA
LLESAPDAMVIVGPDGRIVLANAQADQMFGYPREELIGREVEILIPPRHR
GSHERYRTGFFAAPAARRMGAGLELWGMRCDGTVFPVDVSLSPLQTEQGV
MVSAAIRDITEQLAVQAELTETRAQAEVLAERDRIAGDLQDHAIQRVFAV
GLALQGTIPRARSADVQQRLNAAVDDLHAVVQDFRTAIFDLRHTKTDVPG
LRQRFDEVIGRLAEGLAATVQYKGPLSVVEGELADQAEAVVAEAIGNAVR
HTAATKLTIAVEVADEVSIEVIDNGKGLPDDVSEAGLKTLRRRAERVGGT
LTVGAAAGGGTRLRWVAPLP
118465562YP_883873.1 glycine oxidase ThiO [Mycobacterium avium 104]MPSDCGSLAVVGGGVIGLAVARRAAQAGWSVRVHRSGERGASWVAGGMLA
PHSEGWPGEERLLRLGLESLRLWREGGFLDGLPGRLVTARESLVVAVDRA
DVADLRTVADWLSAQGHPVVWESAARDVEPLLAQGIRHGFTAPTELAVDN
RAVLEALDAACERLGVRWAPPLHDLAEADADAVVIANGIDAPALWPGLPV
RPVKGEVLRLRWRKGCMPVPQRVIRARVHGRQVYLVPRADGVVVGATQYE
HGRDTAPVVSGVRDLLDDACAVLPALGEYELAECGAGLRPMTPDNLPLVG
RLDARTLVAAGHGRSGFLLAPWTAEQIVSELAPVGAHR
118465561YP_884063.1 hypothetical protein MAV_4942 [Mycobacterium avium 104]MNRAVMLRFAACGIIGLGAALLIAALLLTTYTTSRITKVPLDVDATLISD
GTGTALDSASLSTDHVVVNQNVPLVSQQQISVESPANADVVTLQVGSSLR
RTDKQKDTGLLLAIVDTVTLNRKTATAVSDDTHTGGAVQKPRTINDENPP
TAIPLRHDGLSYRFPFHTEKKTYPYFDPIAQKPFDVNYDSQEDVNGLTTY
KFTQNVGYNADGKLVAPVAYPSLYADQATDSKFTAPASMWGIQGGDPNEQ
ITMTRFYAAQRTFWVDPVSGTIVKQTEHAHHYFARDPLKPELTLADYKVT
SNEDTVESQVNAARDERDRLALWSRVLPITFTAVGLIALVGGGLLASFSL
RSESALTDPGLDRGDQDFFGRSGLEEPVSGAEAETEKLPTQRPDLRSESG
PDEPTEAGPTEAKPPDRE
118465560YP_882185.1 hypothetical protein MAV_2999 [Mycobacterium avium 104]MRGMSSDREAVSAAFDAIDAALDDLLDCDYAALATREKLALLNRCERLRR
RLPAIEHPLINALARDATPAELGGRLSHAIAEATLISRAEAARRVHTAAD
LGPRVGLTGEPLPPLLAATAAAQREGSLGLEQVAVIRKFCHQLPGWIDQA
TRERAEADLANQGTRYRPEQLAALAGTLADCLNPDGLYRDEDRARRRSLT
LGNQHADGMSELRGLLTPELRATLEAVLAKLAAPGMCNPLDESPCVDGTP
TEQAIEGDTRSAAQRNHDGLLAGLRALLASGNLGQHNGLPASIIVTTTLA
DLETAAGKGLTGGGTLLPMSDVIRLSRHAHHYLAIFDKGKALALYHTKRL
ASPGQRIVLYAKDRGCTAPGCTVPGYYAEVHHCTDYATCHTTDINDLTFA
CGPHHRLLQPGAWTTHKNARGETQWLPPPHLDRNQPRTNTFHHPEKLLRG
EDGGEDDDGDDDEAA
118465559YP_882117.1 P450 heme-thiolate protein [Mycobacterium avium 104]MSEGQYGTFHLPRLDFATLPMSVDRGLGWKTLRDAGPVVFMNGHYYLTRR
EDVLAALRNPKVFSSTVLQPPGHPLPVLPLAFDPPQHTRYRKILQPYFSP
HALGKSRPVLERHAAEMIAALADRGECEVMADFAHLYPFQVFMDLYGLPL
QDRDRLLDWKNAVVGEKPFVTESDVEKSEQLLAYLADAIAQRRQHPGTDM
LSQVMTGEGNFTDIELLGMSHLLILAGLDTVTAAIGFSLFELARRPQLRK
ELRDNPKQTRVFIEEIVRLEPSAPVAPRITTEYVEVGGMTLPPGTSVRLC
MAAVNRDDSDSMSTNELNMDGKVHRHWGFGGGPHRCLGSHLARIELTVVV
AEWLTQIPDFELPDGYEPVINYPSKSFALKELPLHWG
118465558YP_882313.1 esterase [Mycobacterium avium 104]MPMTVQVLAGVVLTLAVGWRSRRWRTVWVPVAALAGAAVAYLTHWYIVDR
GLSDEPAPAALWLWVMLTGTAVAVLVLGWRTARRWRRGAAVLAVPLCLLS
AALVLNLWVGYFPTVQSAWSQLTSGPLPDQTDQATVTAMAASRIRPPHGT
VVPVAIPSDGSHFKHRGELVYLPPEWFATTPPPALPTVMMIGGQFNTPAD
WTRAGNAVKTIDDFAAAHHGQAPVLVFVDSGGAFNNDTECVNGVRGNAAD
HLTKDVVPFMISAFGVSPHRSNWGVAGWSMGGTCAVDLTVMHPELFSAFV
DVAGDFFPNAGNKAQTIARLFGGNADAWAAFDPTTVINRHGPYRDVAGWF
AISSDGPPAPRRDIQLSDSGAIRLAAREAAANPGNQTAAAYSLCALGRAN
GIDCAVVPQPGRHDWPFADRAFAAALPWLAGALGTPGIPRTPLPATSSPA
VGAPLVVPAERSNTGKR
118465557YP_882895.1 hypothetical protein MAV_3719 [Mycobacterium avium 104]MSSMMTTLDGFGVPVVVAGPENGVVVVILGDEDRAPAAYDAVCERLHTAS
LRTVVIGFDPRLTPKSVIGILDALGIGWAVVMGDRAGGELAWELTATRLG
RFVGLVVIDRGHPRAADRDGAIRDGHCPPVEIGTTVLVSSPAARAVAQAS
QQYVYADYRVVHLGRRTVQESTAQLAAEIILRTSTW
118465556YP_882835.1 acyl-CoA dehydrogenase [Mycobacterium avium 104]MPPVIEIAREHNPFPTTGVSRGRDGIPRYDELPATLVDMLADQVDARPDS
EAVVELGGGRLTYRQLWDRAARVAGGLRADGLRRGDRVAVRYPAGIDWVL
AFWGTVLAGGVAVAVNTRSAQPEVDFVLSDSGARLQLAPGDPLPDGKPYV
TEQLGAADTAALFYTSGTTGHPKGVPTTHEAFLTNTENAIRCLQQPRDLG
EDMRTLISVPLFHVTGCNSQLLAAARLGGASVILPALDLDTLLNAVVAER
VSVMVTVPAIYALLLRHKDFAGTNVSRVRWVGYGGAPIAPSLVRTVKDAF
PHATVFNGYGMTETASLMTVLPDREAVEHADSVGYAVPSVDLGLIPFGDN
EPGVGELVTRGGNVTAGYWNRPQATASTFAGGWLHTGDVVRVDDAGRVHI
IDRLKDIINRGGENVSSVEVEAVLLGAPGVADACVLGVPDDVMGEKVGAV
LFGDDDIDVPAVLEHCRGRLADFKVPQYITVVDGPLPRNAGGKLLKARLR
DQVHWGDPLR
118465555YP_882493.1 hypothetical protein MAV_3311 [Mycobacterium avium 104]MRAITAPIAICVRRGFNERAGTDSSPIARFAVVSKYPRRPRFSRRGRQK
118465554YP_881791.1 acyl-CoA dehydrogenase [Mycobacterium avium 104]MKRLVLEPEHEAFRETVRQFIERELVPNAERWEADRIVDRSAFVAAGKYG
LIGFNMPEQYGGGGVDDFRFNAVIDEEIARYGGPSPSLSLQNDVVGPYFS
SLANDEQKERWLPGIVSGELIVAVAMTEPGAGSDLAGIRTSAVRDGDDWI
INGAKTFISSGINCDLVVVVCRTDPEAGHKGFTLLVVEAGMEGFSRGRKL
EKMGLHYQDTAELAFENVRVPSANLLGKEGRGFYHLMHNLPSERLSIAIS
AIAGARETWRQTLQYAKDRKAFGQSIGSFQHNRFLLAEMDTELEIGEQYI
DRCLRAVVDGELTAVEASKAKWWCTETAKKVIDGCVQLHGGYGYMTEYRV
ARDYMDNRIMTIFGGTTEIMKDIIGRDLGL
118465553YP_883995.1 methyltransferase- putative- family protein [Mycobacterium avium 104]MRSEGDTWDITTSVGSTALFVATARALEAQKPDPLAVDPYAEIFCRAVGG
SAADVLDGKDPDHQLKTDDFGVHFVNFQGARTKYFDEYFRRAADAGVRQV
VILAAGLDSRAYRLDWPAATTIFELDQPQVLDFKREVLAGVDAHPRAERR
EIAVDLREDWPQALRDSGFDPDKPSAWIAEGLLIYLPASAQEQLFTGIDA
LAGHGSHVAVEEGAPMTPEDFEAAVAAERAANEQGEQRMFFQLVYNEQCA
PAAEWFGSRGWTAVPTPLADYLRQVGRPVPGPDTEAGPMIARNTLVSAVR
A
118465552YP_879470.1 hypothetical protein MAV_0176 [Mycobacterium avium 104]MADPQDPTNSAADGAGDPPEKKPPAKAAKKTAKAPAKKAPAKKAPAKKAP
AKKAPAKKAPAKNTPTGGGQRADTNGDLTAAAKDAAAQAKSTVEAADNPV
APAVVGPAAGQSPVPLIVAVAVSLLAILLIRQLRRR
118465551YP_883965.1 hypothetical protein MAV_4841 [Mycobacterium avium 104]MLSKLVALAAVIALSPITVIPAVLVLHAPRPRPASLAFLGGWVLGLVGLT
TAFVGGSELLSGLHATPPKWASWVRLVFGVALLALAAYHWFTRHRQRSMP
RWMRSFAALSPVRAGVVGAVLVPLRPEVLILCAAAGLAVGNSSLSAGAQL
VAAAIFVVLAASTVAVPILVYVGAGDRFDDALERLKAWMEANHDAMLAVI
LLLIGLIVLYNGIRALA
118465550YP_882585.1 hypothetical protein MAV_3403 [Mycobacterium avium 104]MSAADGVSSQTWTKVPAITLGFWVIKVLATTLGETGGDTVTMTLDWGYAA
GVALFGVTLVLLVTAQILAARFHPVLYWATIVASTTFGTVLADFADRSLG
IGYTGGSLLLLACLLATLGIWRWSQGTVSVATVHTPKVEAFYWATITFSQ
TLGTALGDWLADTRDFGYRRGALVFAAGLLVVAGLYFWTGVSRVALFWVA
FILTRPLGATVGDFIDKPVAQGGLAWSRPLATAVLAALIAVLLIVIPQRP
GRHPGRPEAGAAQSPTAT
118465549YP_881930.1 serine esterase- cutinase [Mycobacterium avium 104]MGNPVAAADPCSDVSVVFARGTHQEPGLGNIGQAFVDSLTSQLGGRSVDV
YAVNYPANDDYHNSANAGADDASAHVQDTVAACPNSRIVLGGYSQGSTVI
DLATNAMPPSVADHVAAVALFGEPSSGFSTMLWGGQPLPTINPLYGGKTI
SLCAPDDPICSGGGNIMAHVSYIDAGMTAHAATFAANHLNQGSPRT
118465548YP_881661.1 hypothetical protein MAV_2469 [Mycobacterium avium 104]MLRSRGVEEDVMAEAVDRVTRVASDLMDSAAAEGARQSRSAKQQLDHWAR
VGRAVSSQHTASRRRVEAALAGRLSTAELTVEEGVVFNAEISAAIDESLA
RTNYGATLAGQGVTTVALNDDGEIVEHRPDGTAVVLAGRR
118465547YP_880703.1 hypothetical protein MAV_1461 [Mycobacterium avium 104]MGARINSILAAVRALAGLPTDHVGLPDPDPWAWPNLDCNAVQRDGLSVED
LCRASRAAADLDDPEVMENAWR
118465546YP_880346.1 50S ribosomal protein L32 [Mycobacterium avium 104]MAVPKRRMSRANTRSRRAQWKAEKTELVGVTVAGQRHKVPRRLLKAARLD
LIDLDRR
118465545YP_882557.1 primosome assembly protein PriA [Mycobacterium avium 104]MSPGPRTPVEVEPIARVLPMLSVPHLDREFDYLVSAEQSDDAQPGVRVRV
RFHGRLVDGFLLERRHDTDHQGKLGWLDRVVSPEPVLTAEIRRLVDAVAA
RYAGTRPDVLRLAVPARHARVEREARAAAGIPMPAPVDPSGWEGYGRGAQ
FLAALAESRAARAVWQALPGEPWTDRFAEAAAQTVRAGRSVLAIVPDQRD
LDALSHAVTTRIDAAGVVALSAGLGPAARYRRWLAALRGSARVVIGTRSA
VFAPLSDLGLVMVWADADDSLAEPRAPYPHAREVAMLRAHQARCAALIGG
YARTAEAQALVRSGWAHDIVAARPVVRARTPRVIALDDTGYADERDPAAR
TARIPSVALRAARSALQHGAPVLVQVPRRGYVPSLACARCRTIARCRHCT
GPLSLAESPGEGGGGLVCRWCGRVDPTRRCARCGSDAVRAVVVGARRTAE
ELGRAFAGTTVITSSGDAVVPEVADGPALVVATPGAEPRARGDYGAALLL
DTWALLGRQDLRAAEDALWRWMTAAALVRPRGDGGVVMVVAETSLPTVQS
LIRWDPVGHAESELTARAEVGLPPSVHMAAVDGTPAAVNALLDEAGLTGG
QTLHADLLGPVDLPPGARRPAGTPPGAPVTRMLVRVPRRDGLALAAALRR
GVGVLSARQTHEPARVQIDPLHIG
118465544YP_884098.1 peptidase M13 [Mycobacterium avium 104]MTNTAIRSGIDLSHVDDSIRPQDDLFGHVNGRWLAEYEIPADRATDGAFR
QLYDRAEEQVRDLIVEASEQGAAAGGDDAQRIGDLYASFLDEDTVQRRGL
QPLLDELALIDEAADAAALAAVMGALQRTGVGGGVALYVDTDAKNSARYL
VHVTQSGIGLPDESYFRDEQHAEVLAAYPGHIARMLRLVFGGSADDHAET
AARIVALEAKLAAAHWDVVKRRDADLTYNLRTFADLRTEGSGFDWDGWLQ
ALGATPDAVAELVVRQPDYLTAFAALWESLDLDEWKWWARWRVIRARAGW
LTDELVAADFDFYGRLLTGAEQIRDRWKRAVSLVESLMGDAVGKLYVARH
FPPGAKARIDELVSNLRAAYRISISDLDWMTPQTRQRALAKLDKFTAKVG
YPAKWRDYSALVIDRGDLYGNYQRGYAVNHDRELAKLGGPVDRDEWFMTP
QTVNAYYNPGMNEIVFPAAILQPPFFDAEADDAANYGGIGAVIGHEIGHG
FDDQGAKYDGDGNLVDWWTDADRTEFASRTKALIEQYDAYTPRGLPSGYH
VNGAFTVGENIGDLGGLSIALLAYQLSLNGQPAPVIDGLSGVQRVFYGWA
QVWRTKSREAEAIRRLAVDPHSPPEFRCNGVIRNMDAFYDAFDGADEGAL
FLEPDRRVKIWN
118465543YP_884282.1 TetR family transcriptional regulator [Mycobacterium avium 104]MDFGRPRDPRIDAAVLRATVELLAETGYPGLLVSAIAQRAGTSKPAIYRR
WPSKAHLVHEAVFPVGADTAIPDTGSTADDLREMVRRTMVFLTTPAAKAA
LPGLIGEMAADPSLHSALLERFAGAIGGGLADWLAAAAARGEARPDVTAA
ELAETIAGVTLVALLTRPTELDDAWVDRTTRLLLKGISA
118465542YP_881909.1 MerR family transcriptional regulator [Mycobacterium avium 104]MRGDPTPRSARGVYGISVASELSGIPPQTLRHYERRGLLTPARSDGGTRR
YSDDDLARLKRISQLVDQGVNLVGVARILDLESKNDQLKADYSALELLNA
QLKTRQNSERAAAPRQGRGEARREAV
118465541YP_884122.1 YhhW protein [Mycobacterium avium 104]MSAGFEIRRAATRAVTTTPWLTSRHSFSFGDHYDPDNTHFGLLLVNNDDI
VSPGTGFDTHPHRDMEIVTWVLAGALAHQDSTGNRGVVYPGLAQRMSAGR
GILHSERNDSPSLPVHFVQMWVIPDEAGIDPSYQQHEIDDTALGGGLVTI
ASGIRGHDAAISLHNRNAALHGARLPAAAAVDLPAAPYLHVFLARGRADI
EDVGELHPGDAVRFTDTDGRRVTGLEPSELLIWEMHARLGG
118465540YP_883371.1 dTDP-RhA:a-D-GlcNAc-diphosphoryl polyprenol- a-3-L-rhamnosyl transferaMLPVVTVTYSPGPHLERFLASLSLATEREVCVLLADNGSTDGTPQAAVER
YPNVRLFHTGANLGYGTAVNRAVAQLDRGGEWVIVANPDVQWGPGSIDAL
LDAAARWPRAGALGPLVRDPDGSVYPSARHLPSLVRGGMHAVVGPFWKNN
PWSTAYRQERLEPSERPVGWLSGSCLLVRRSAFERVGGFDERYFMYMEDV
DLGDRLGKAGWLSVYVPSAEVLHHKGHSTGADPASHLAAHHRSTYMFLAD
RYSGWMRAPLRWALRASLAVRARLMVRSALRESGRRVEGRH
118465539YP_881564.1 cysteinyl-tRNA synthetase [Mycobacterium avium 104]MAAGAGPGSAATMYVCGITPYDATHLGHAATYLAFDLIYRQWLDLGHDVH
YVQNVTDVDDPLLERAARDGIDWRALAEREVSLFREDMAALRILAPRDYV
GATEAIADVVELVEKMLASGAAYVVDGEFPDIYYRADATLQFGYESGYDR
ETMLRLFAERGGDPQRPGKTDALDALLWRAARPGEPSWPSPFGNGRPGWH
VECAAIALSRIGSGLDIQGGGSDLIFPHHEFTAAHAECVRGERRFARHYV
HAGMIGWDGHKMSKSRGNLVLVSQLRGRGVEPAAIRLGLLAGHFRGDRYW
SDQVLDEATARLRRWRTATALPAGPDATDVIARVRQYLADDLNTPKALAA
LDGWTTDALDYGGHDTAAPRLVATAVDALLGVAL
118465538YP_881572.1 mycocerosic acid synthase [Mycobacterium avium 104]MVPVAVIGMACRLPGAVDSPERLWEALLRGDDFVTEIPPDRWDADEYYDP
EPGVPGRSVSRWGAFIDDVAGFDPEFFGINEREATAMDPQHRLLLETSWE
AMEHAGLTEERVADSRTGVFIGLTHGDYQLLAADTRSVEGAYGFSGSNFS
LASGRIAYALGVHGPALTVDTACSSGLTAIHLACRSLHEGESDLALAGGA
TLALDPRKFSAGSAEGMLSPTGRCHAFDVAADGFVGGEGSVMLLLKRLND
ALRDGDRILAVVRGTAANQDGHTVNIATPSKTAQTAVYRAALAAAGVDAG
TVGMVEAHGPGTPVGDPIEYASLAEVYGIDGPCALASVKTNFGHAQAASG
ALGMMKAILALQHGVVPRNLHFTQLPDDLARIDTKLFVPQQTTPWVSNGG
HPRRAAVSSYGLSGTNVHAILEQAPEPAPETVAPEGISAESPLLFPLSST
SADELRRTAGRLADWVHAHGDLALPDLAYTLARRRVHRPVRTAVLAGDRA
QLIEALREVADGDTPYPAAVGRGDRGPVWVFSGQGSQWAAMGADLLATEP
VFAATVAQAEPLIARESGFSVAEAMSAPQTVTGQDRVQPTLFTMQVALAA
TMKAHGVRPGAVIGHSLGEAAAAVVAGALSLEDGARVICRRSRLMSRVAG
TGATASVELPAQQVLSELTARGISDVVVAVVASPQSTVIAGAAPTVRDLV
TAWQERGVMAREVPTDVAFHSPQVDPIMDDLTDALAEISPRPPEVPYYSA
TLFDPREQPVCDARYWANNMRRMVRFATAVQAALEDGYRVFAELAPHPLL
VRALEQTARSREIPMAALAGMRRGQALPHGLRGFVADLHNAGAAVDFSVL
YPTGRLVDAPLPTWTHRRLWLTDGGLESPTHGGCTVAVHPLLGPHVHLQE
EPERHLWQADVGTAAQPWLADHQIRNVVVLPGAAYCEMALAAARSVLGAT
AEVRDIRFEQALLLDEQTTVDASASVSSPGVLHFTVQSHQGGEQARHASA
VLGAATDEQPAAHDLSALLTAHPHDDDGDEVRRRMDRRGVQYGPAFAGLG
AVHSGDETGTVLAEVALPRQIRSQQAAYGAHPALLDACFQSVEAHPAVRA
LGDGALGLVLGIRRLRAYGAARNAHYCYTRVTKADTSGVEADIDVLDEHG
AVLLAVQGLRVGTSASESGTRDRVLTERLLNIEWRQRELPEPEHADAASW
LLIGTTATADVLASTLADTLKNHGAQCTTMAWPQQADHTAHAEQLRNQWR
GDGFTGVVVLTGPKNGDNDQESALLSRDHVQHLVRIARELTDLPGEPPRL
YVVTRNAQTVLPNDVPNLGQAGLRGLVRVIGMEHPQLGAGQIDVDESTDA
QALARQLLAGSEEDETAWRDGAWYTARLCPAPLLPEERHTAVANHECDGM
RLQIRTPGDLESLELVACDRIPPGPGQIEVAVSASSINFADVLVAFGRYP
AFEGRLPELGTDFAGVVTAVGPDVTDHKVGDHVGGLSANGCWGTFLTCDA
RLAVTLPPGLADDQAAAVTTAHATAYYGLHELARIGAGDRVLIHSATGGV
GQAAIAIARAAGAEIFATAGSEQRRQLLRDMGIEHVYDSRTVEFADLIRH
DTDGYGVDIVLNSVTGAAQRAGIELLAFGGRFVEIGKRDIYGDTRLGLLP
FRRNLTFYALDLALMSFSHPDRLRGLLRTVYRLTADGALPMPESTHYPLA
DAASAIRVMSAAQHTGKLVLDVPHAGRSRVVVPPAQVRAFRSDGAYIVTG
GLGGLGLFLAEKMASPGSRAGCGRIVLCSRALPNPKALATLERIRQMGAD
IVVERGDIAEAGTAQRLLDVATATGLPVRGVLHLAAVIEDATLANITDEL
IERDWAAKVYGAWNLHCALQESGAEQSLDWFCSFSSAAALVGSPGQGAYA
AANSWLDAFTRWRRARGLKATAIAWGAWAQIGRGAALADSADVAITPDEG
AYAFEALLRHDRACTGYAPITGTPWLTAFAQRSPFAEAFRANGQSATGTS
KLRAELEELPPEEWSTRLRRLISDQVSLILRRNVDPDRPLPEYGLDSLGG
LELLTRIQTETGIRVSPADIAAIGTIRGLADLLRDKLTPAGAAQAERV
118465537YP_882564.1 S-adenosylmethionine synthetase [Mycobacterium avium 104]MSEKGRLFTSESVTEGHPDKICDAISDSVLDALLAQDPRSRVAVETLVTT
GQVHVVGEVTTTAKEAFADITNTVRERILDIGYDSSDKGFDGASCGVNIG
IGAQSPDIAQGVDTAHETRVEGAADPLDAQGAGDQGLMFGYAINDTPERM
PLPIALAHRLSRRLTEVRKNGVLPYLRPDGKTQVTIEFEDDVPVRLDTVV
ISTQHAADIDLENTLTPDIREKVLNTVLNDLAHDTLDTSSTRLLVNPTGK
FVVGGPMGDAGLTGRKIIVDTYGGWARHGGGAFSGKDPSKVDRSAAYAMR
WVAKNIVAAGLAERVEVQVAYAIGKAAPVGLFIETFGTATVDPVKIEKIV
PEVFDLRPGAIIRDLDLLRPIYAQTAAYGHFGRTDVELPWEQLNKVDDLK
RAI
118465536YP_880670.1 hypothetical protein MAV_1428 [Mycobacterium avium 104]MKLHRLTLTNYRGIAHREIEFPDHGVVVVCGANEIGKSSMIEALDLLLEA
KDRSTKKEVKQVKPTHSDVGAEVSAEISCGPYRFVYRKRFHKKCETELTV
ITPYREQLTGDEAHERVRAMLAETVDSDLWHAQRVLQAASTAAVDLSGCD
ALSRALDVAAGDSGGLCGTEPLLIERIDAEYARYFTPTGRPTGEWAAAIA
RLADAEAAVAECAAAVAEVDERVSRHAALTEQVADLSQRRIAAGPRVTAA
RQAADRIAELTAQRREAQLVAEAAAATKAAAAQAHSGRLQLLADIDTRAA
AVTQTHAQVQQAAADHAVAQADAQACDTALQHATEALAELERRVQEAQRT
VERSAGREEADRLAARLDKIDAIQRDRERISAELSTIAVTEELLRRIEDA
AAAVDRIGDQLASTSAAVEFTAVADIHLVIGDRQVSLPAGQSWSITAVGP
TAVEVPGVLTARVTPGATTLDVQAKHAAAQQELAAALTAGAVADLGAARS
ADQRRRELQGTRDQLGATLAGLCGDEPLDELRSRLARLRAEHPEQPAAPT
GGAADLAAARTELEALAQARACASAECVTRRQAATAAAARLAETATAATV
LQNRLDTLRAELDAATGRLAAERASVGDEELAASADAALRAEQAAERRVA
ELADALAAASPDSVAAELADATQESESLRERYEEAAGALREVTIELSVFG
SEGRQGKLDAAETEREHAASEHSQVGRRARAAQLLRSVMTRHRDTTRQRY
VEPYRAELQRLGRPVFGPTFEVDIDSDLCIRSRTLNGITVPYESLSGGAK
EQLGILARLAGAALVAKEDAVPVVVDDALGFTDPDRLAKMGQLFDSVGSH
GQVIVLTCSPDRYDGVKGAHRIDLSA
118465535YP_880214.1 hypothetical protein MAV_0954 [Mycobacterium avium 104]MRSVRTLTTATLVAATAFGGLGAAATAGATTKEEVAVNGTFRATSIGDWA
QRNDQYFEEPTVVQTWTISSTCDTFQECHGTVTSDLGWTAPLYMSDGQMW
KVKHEVPNWERCEDGTAFTGQQTFYFYPVNEYGGYQLGSSTFAGKDKTVG
PSGACGQNQWLDIAMPLRLDKLS
118465534YP_883705.1 monooxygenase- flavin-binding family protein [Mycobacterium avium 104]MTVTPQEAADHGAAEADYFDVLIVGAGISGIDAAYRITERNPQLSYAILE
RRARIGGTWDLFRYPGVRSDSSIFTLSFPFEPWTRKEGVADGVHIREYLT
ATAHKYGIDRHIRFNSYVRSADWDSTSDTWTVTVEDGARDGERKLYRARF
LFFGSGYYNYDEGYTPDFPGIEEFTGTVVHPQHWPEDLDYTGKKVVVIGS
GATAVTLLPSLSDRAAKVTMLQRSPTYLISASKYGKVAAVARKVLPRKPA
HLVIRMYSALTEAVFFALSRKAPRLVRWLLRRKAINSLPPGYAVDIHFKP
RYNPWDQRMCLIPDADLYNAITAGRADVVTDHIDHFDATGIALRSGAHLD
ADIIITATGLQLQALGGATISLDGNEIKTNDRFVYKAHMLEDVPNLFWCV
GYTNASWTLRADITARATAKLLEHMTTHGYTHAYPHRGNEPMTEKPSWDI
NAGYVLRSVHALPKSGTKRPWNVRQNYLADAIDYRFDRIEEAMVFGRAAD
RAALAG
118465533YP_881289.1 hypothetical protein MAV_2073 [Mycobacterium avium 104]MAENTAGDQVDWAGLPVNLDFAFSRDQRDKVYAQHLKRRHGTQFGTWRRG
GQVCVCELASESVSSG
118465532YP_882324.1 drug efflux membrane protein [Mycobacterium avium 104]MTDAATITGGWRELLGARYLRTSILLAGGVALYATNEFLTTSLLPNTIAE
IGGSRLYAWVTTLYLVGSVVAATMVNPMLLRVGARASYLLGLAVFGVASL
VCGAAPDMHVLIAGRAMQGVAGGLLAGLGYAVINSALPRWLWTRGSALVS
AMWGVATVVGPATGGLFAQLGIWRWAFVVMAVLTALMALLVPVALARVDP
APAIPRMKVPVWSLLIIGVASLAVSVAQIPHNTAATFGLLAAGIMLVGLF
VIVDWRMHAAILPPSVFSPGPLKWIYLTMGVLMAAAMVNTYVPLFGQRLA
HLTPIAAGFLGAALALGWTVSEIVSASPENPRTVGRVVMVAPLVAASGLA
LGAVARHGDGSAWTAALWAVALLVAGTGIGMAWPHLSARAMASVNDPAEG
GAASAAINTVQLTSAAIGAGLAGVVVNTATGGDEMAAHLLFTVFTALSAA
GVAVSYAATRATRQAQPVGNVG
118465531YP_883056.1 isopentenyl pyrophosphate isomerase [Mycobacterium avium 104]MDAMTHRKRRHIDVCLSDPVEFDGVTTGLDRYRLPYHALTQTSLGDIDVS
TSFFGANLRAPILIGAMTGGAEMSKTINRNLAAAAQQLGIGMMLGSQRIM
LDSALGERAADSFAVRDVAPDVLLFGNIGLSQLAKTAVPHLVKALDRVGA
DALAVHTNPLQEAMQHNGDTDFSGSLSRLREAAAALDYPVLLKEVGHGIG
GAAAAELVGGEGQPPVAGIDVAGAGGTSWSRVEQFVRYGELRYPDLADWG
VPTARAIVEVRRLLPEIPLVASGGIRTGMDAAKAIALGADVVAVARPLLP
AAIESSAAVVDWLRPFIDELRVCLHGCGVADLAGLRAVELIRLA
118465530YP_882724.1 hypothetical protein MAV_3546 [Mycobacterium avium 104]MSWTRYETRALADTSLRGDALHAALEDYIRVQNPQLTDVRLERATATGAS
GGPPGSRWYQVTYLAEDPERGA
118465529YP_883793.1 hypothetical protein MAV_4664 [Mycobacterium avium 104]MRHDDVFRLNEPRRVAVLAVHTSPLAQPGTGDAGGMNVYVLQTALHLARR
GIEVEIFTRATASADPPVQRVVPGVVVRNVVAGPFEGLDKYDLPTQLCAF
AAGVLRAEASHEPGYYDIVHSHYWLSGQVGWLARDRWAVPLVHTAHTLAA
VKNAALAQGDSPEPPLRTVGEQQVVDEADRLIVNTDDEARQLISIHHADP
ARIDVVHPGVDLDVFRPGDRRAARAALGLPLDEDIVAFVGRIQPLKAPDI
VLRAAAKLPGVRIVVAGGPSGTGLASPDGLALLADELGISARVTFLPPQS
RPNLATLFQAANLVAVPSYSESFGLVALEAQACGTPVAAAAVGGLPVAVR
DGVTGTLVAGHDVDHWADALAGLLRAPAPAAAAMSRAAAAHAATFSWDHT
TDALLASYRRAIREYTTERRGVGA
118465528YP_880014.1 cupin domain-containing protein [Mycobacterium avium 104]MATADGFHPDFDDATPHVARNRVYHVKASQLSSDTAQSEGLRRFAALSGN
SVGSEKLWMGETHAFPGSASDNHHHGESETAIYVRTGNPEFVFHDGVHEV
RIATAPGDYVFIPPYLPHREENPDPHTTAEVVIARSTQEAIVVNLPALYP
LTDPD
118465527YP_879902.1 hypothetical protein MAV_0622 [Mycobacterium avium 104]MVAGFSAAALHGSKWVDAMTVVDLIHHNRHRQPGIRVHEERIEEDEIAVL
DGILVTSASRTALDLGCWYPTTAAVAGIDALARETRIKAADVELLAQRYP
GRRGIVRAREAIALFDGGSQSPKESWLRVVLTQAGLPPPQTQIRVVDDLG
DPVAYLDMGWEDLKVAVEYDGDHHRSDRRQYGWDIRRSEMLQRLGWIVVR
VVAGDRPADIIARVREARARRA
118465526YP_880963.1 isochorismatase [Mycobacterium avium 104]MLVVDMMNSYQHPDAENLIPNVEKIIEPLTGLVRRARESAGVDLVYVNDN
YGDFTAQFSDLVRSALDGARPDLVKPIAPVSGEAASLTKVRHSAFYSTAL
AYLLSRLGTKRLIITGQVTEQCILYTALDAYVRHFPVVIPTDAVAHIDPE
LGAAACKMMEQNMSAELTTAADCLG
118465525YP_883900.1 O-succinylhomoserine sulfhydrylase [Mycobacterium avium 104]MSQAGDDSVRTPPALPDGVSQATIGVRGGLLRSGFDETAEALYLTSGYVY
ESAAVAEQSFTGELDHFVYSRYGNPTVTMFEERLRLLEGAPAAFATASGM
AAVFTSLGALLAAGDRLVAARSLFGSCFVVCNEILPRWGVQTVFVDGDDL
AQWEEALSVPTAAVFFETPSNPMQSLVDIAAVTELAHAAGAKVVLDNVFA
TPLLQQGIPLGVDVVVYSGTKHIDGQGRVLGGAILGDRDYIDGPVQKLMR
HTGPAMSAFNAWVLLKGLETMAIRVEHSNSSAHRIAEFLETHPAVRWVRY
PYLPSHPQYDLAKRQMSGGGTVITFALDCPDDKAKQRAFEVLDKLTLIDI
SNNLGDAKSLVTHPATTTHRAMGPEGRAAIGLGDGVVRISVGLEGTDDLI
ADIDRALG
118465524YP_881001.1 hypothetical protein MAV_1777 [Mycobacterium avium 104]MASARKSQWKAFQRFAENLVFDRAPRLVRHVQNSQTVLRELQQAVKITAN
VIAAAAPPPPDTAVLGRPVTRSSLPTAQRARKLVYAPKLDGRADPGEIVW
TWVVYEDDPSRGKDRPVLVVGRDRSTLLGLMVSSQERHAADPEWVGIGSG
SWDYEGRPSWVRLDRVLVVPEEGIRREGAILDREVFDVVAARLRAQYAWS
118465523YP_880220.1 hypothetical protein MAV_0960 [Mycobacterium avium 104]MSDVDGGHARGPRRVDGELILFWTLPVALVLWIASFFLFPGFNPPMSPSL
PADQVAAFYRDPAHLPEIRYSMILFNWFGVCLVPILTLIVLQIRRMAHRT
PIFSYAMLGCAAGGPTLFLVANVCWLLAAFRPERSPELTQLLNDFGWITF
TIVVPFLIGQSVILALAIYFDGQPRPVFPRWVAHFNLLVAAALVPAAFVG
VSLTGPLAWDGLLSFWVKNVAIAVWIVVMGVVLGRAIYRERAENTGRADE
LVSA
118465522YP_882826.1 type I restriction-modification enzyme- R subunit [Mycobacterium aviumMSPGGGIVGAVSTRRLSVAQARRIAVAAYLRSPSTPGNQVPEGEPTLGDR
FRNQANHLARAWSLCVGNETLDTLRPTVKFYEQVRVWMGKFDAQQRQAEG
KPIPDDIKRLLSSLVAESTASGEIVDIYDAAGLPKPSLSELGPDYEAKAK
AAAHPHLAIEALRAVLTKELAAATKNNVVRQRAFSDRISDLMRRYTNQQL
TSAEVIAELIAMAKDVAAESDRGKHFTPPLSNDELAFYDAVAQNESAVEL
QGEDVLAQIARELVGVMQRDTKTDWTVRDDVRAKLRSSIKRLLVKYRYPP
DKQPEAIKLVIEQMEALAPEYAERAGRMAKGEDCE
118465521YP_882135.1 dihydrolipoamide acetyltransferase [Mycobacterium avium 104]MADFIIRIPRVSVAVSEAELTGLLVGAGEHVEAGTPIYVIATEKVEQEIE
AGASGTVRWTGQVGTTYQIGAEIGVITG
118465520YP_883019.1 aspartyl/glutamyl-tRNA amidotransferase subunit B [Mycobacterium aviumMSVAANAELMDYDDVIARFDPVLGLEVHVELSTVTKMFCGCTTAFGAEPN
TQVCPVCLGLPGSLPVLNQAAVESAIRIGLALNCEIVPWCRFARKNYFYP
DMPKNYQISQYDEPIAINGYLEAPLDDGTTWRVDIERAHMEEDTGKLTHI
GSETGRIHGATTSLIDYNRAGVPLIEIVTKPIVGAGERAPQIARAYVTAL
RDLLRALGVSDVRMDQGSMRCDANVSLKPIGTAEFGTRTETKNVNSLKSV
EVAVRYEMQRQAAVLASGGRITQETRHFHEAGYTSPGRVKETAEDYRYFP
EPDLEPVAPSRELVERLRLTIPELPWLSRKRIQQEWGVSDEVMRDLVNAG
AVDLVIETVKHGAPSEQARAWWGNFLVQKANEANIGLDELNISPAQVAAV
IALVDEGKLSNKLARQVVEGVLAGEGEPDQVMNARGLELVRDDSVTQAAV
DEALAANPDVAEKIRGGKIAAAGAIVGAVMKATRGQADAARVRELVLAAC
GQG
118465519YP_884152.1 sulfatase-modifying factor 1 [Mycobacterium avium 104]MLTELIDLPGGAFLMGSNSFYPEESPVHEVTVRPFSIERHPVTNAQFAEF
VDQTGYVTVAEKALDPKDFPGVPAEDLKPGALVFTPTAGPVDLRAWRQWW
TWMPGACWRQPFGPGSSIEDRLDHPVVQVAYPDAAAYASWAGRRLPSEAQ
WEYAARAGTSSAYAWGDDVAPGGEIMANTWQGKFPYRNDGARGWTGTSPV
GTFAPNGFGLVDMIGNVWEWTSTRYSAGHHPGRAAPSCCPTSPTGDPAVL
QTLKGGSHLCAPEYCHRYRPAARSSQSQDSATTHIGFRCIAS
118465518YP_880852.1 acyl-CoA dehydrogenase domain-containing protein [Mycobacterium avium MSTVDSPEKILFTSTTQAFLEKEAPLRRVRELHAAGTAFDPGWWRRAAEL
GWTGLLVPEELGGGSVSESGLADLATVAEQLGKTVAPGPLYPVSIVLSAL
AECSGAETHRDVIEALISGETVASWAVYEPGQGWAPLNPSVTATETDSGY
RIDGVKDRVEAGAQSALLLVVARCGADGQIRQFLVPTDAPGVRIEPQQSV
DLVKQYARVHFDGVVVPRSAAVGTAAETATLIERQSQLAQVLQCAEVVGV
VQTVFDFTTQWALDRHTFGRPLASYQALKHKFADMKLWLEACRATTWAAV
AEVAARSPQAGLSASIAKSYVGEMAGQIVQACVQMHGGIGVTWEHDLHLY
LRRVTLYRGMFGTPEEHNLRVYQFEKAGGAAK
118465517YP_881567.1 TPR repeat-containing protein [Mycobacterium avium 104]MEFRRSLAALNNGEFHGVALVGDGGVGKSTLARMLAKTVESAGRTVRFAL
GTQTGWAVPLGAFSRAVSLGVGHEPAIMLAAAHNTLGQDKNLVVVVDEAQ
LLDPLSATLVNQLAAGRSARLIVTIRSGEPVLDAVTALLKERLLLTVHVD
PFTREQTELLAGAVLGGPVDTRLVDELFERSAGNLLLLRGFLTAGVESGA
LVHTEQGWQLQGPLRGDRELHDALEYRLQSLSSEEREVVEVLATAELLEW
EILRDICDADAMASLERRGLIQLVTDGSHTLVQLNHPMLGEAATRHAGVV
RSRQLNGILAKTLRKHLRAAGRRSQISDPRGRIQLAQFIMRSDLEPDLDV
VIKAAADAMAMSNVVLGEQLATFAVDRGGGLAAALVLAEAVSWQGRGEEA
DSILLGADVDDADEWLIARWGCLRAANLAWGCGDAEGATRVLAEVKQRLA
TEGSLQLIDALDVSIGFFRGDIARTIELGPRLCEPDVVPMATVWAAVATC
GALTAVGRFSEVGRIAAAGVRATAQCRAGAQRFAIGLAEVMAATAAGDYP
AAERIHKRYAALATGLPAAEAMVDAMLGVLQLTRGELQEACATLDRSISQ
LSQGFPLPWQLVVGALQAQAEGARGDSAAAAVALRRVEEAYGPHVAVFLP
ELELARAWERAAAGDTAGAQTQAMQAAQTARKAGMHLVEMRARHAALRFG
DRAQAARVDELASILNSPSAQAVAGHARGLAQHDGDLLDAAAHRFADLGA
LAFAADAAAQAASEHARRGDRRKEVESSTWAHALAGQCGSRTPALDAAAR
PLPFSGRERQIVNLVAAGLSNREIADRLVISVRTVEGHLYRLFTKLGINN
RDQLIQLIRRDAS
118465516YP_881463.1 hypothetical protein MAV_2259 [Mycobacterium avium 104]MTTPEYSIDEVQREIFGTSGAGPERVYVELFAKFMRWPVDKFVLRSVSDT
GRTEHHVTWVKGQAIGVASYVRRQGDIEMTAEVRTLNAVS
118465515YP_882224.1 transposase- Mutator family protein [Mycobacterium avium 104]MSVMDVKRPPRDPSSQPSTESSRSPTMTAPHIVDPAGLLGEALAEASPDL
MRSLLQTVINALLSADADAVVGAEWGQPTPGRRAQRNGYRHRGLDTRVGT
IDVAVPKLRKGTYFPDWLLERRKRAESALITVVADCYLAGVSTRRMDKLV
KTLGIDSLSKSQVSRMATDLDEHVEAFRHRPLDSAGPFTFVAADALTMKV
REGGRVVNGVVLLATGVNGDGHREVLGMRVVTSETGPAWNEFFADLVARG
LAGVRLVTSDAHAGLREAIAANLPGAAWQRCRTHYAANLMSICPKSMWPA
VKAMLHSVYDQPDAPAVAAQFDRLIDYVTDKLPAVADHLATAREDILAFT
AFPKDVWSQIWSNNPAERLNKEIRRRTDAVGIFPNRDAIVRLVGAVLAEQ
NDEWAEGRRYLGLDILTRCRLTTITDDNPDIGANDMPALTA
118465514YP_879735.1 Crp/Fnr family transcriptional regulator protein [Mycobacterium avium MDEILARAGIFQGVEPSAVTALTKQLQPVDFPRGHTVFAEGEPGDRLYII
VSGKVKIGRRSPDGRENLLTIMGPSDMFGELSIFDPGPRTSSATTITEVR
AVSMDRDALRAWIADRPEIAEQLLRVLARRLRRTNNNLADLIFTDVPGRV
AKQLLQLAQRFGTQEGGAMRVTHDLTQEEIAQLVGASRETVNKALADFAH
RGWIRLEGKSVLISDSERLARRAR
118465513YP_882296.1 argininosuccinate synthase [Mycobacterium avium 104]MSERVILAYSGGLDTSVAISWIGKETGREVVAVAIDLGQGGEDMEVIRQR
ALDCGAVEAVVVDARDEFAEGYCLPTIRNNALYMDRYPLVSAISRPLIVK
HLVAAAREHGGSIVAHGCTGKGNDQVRFEVGFASLAPDLEVLAPVRDYAW
TREKAIAFAEENAIPINVTKRSPFSIDQNVWGRAVETGFLEHLWNAPTKD
VYAYTEDPTLNWSTPDEVIVGFERGVPVSIDGKPVSVLGAIEELNARAGA
QGVGRLDVVEDRLVGIKSREIYEAPGAMVLITAHTELEHVTLERELGRFK
RHTDQRWAELVYDGLWYSPLKAALESFVDKTQEHVTGEIRMVLHGGHIAV
NGRRSAESLYDFNLATYDEGDSFDQSAAKGFVYVHGLSSKIASRRDQR
118465512YP_880252.1 hypothetical protein MAV_0992 [Mycobacterium avium 104]MADIAEGKARKNRYVDNGWPTTDPDDHAVSELVTDRTGALSPFGELVFPL
PATELPYLHPVTVVNR
118465511YP_881097.1 acyl-CoA dehydrogenase [Mycobacterium avium 104]MRMSSADWRSQLERLLTEYQCEQAALTIKPDRIEAACAWHAKLVDNGLAA
PGWPKSVGGLELSLEEQLDYYRMTTAAGAPPHPCPLSFIVAPTLIQHGTD
QQKKRFLAPLLRADEFWCQGFSEPGAGSDLASLSTRAVRDGDVYRVTGQK
VWTSMADRADWMFTLVRTGPPGRSTDGITYLLIPMDSPGITVRPLRDISG
AAHFAEVFLDDVEVAVQNRVGAEGQGWSIMRTSLGHERATAFLADEFKYR
RTADKVIDLVVSQQLDSDPQVRQDIARLESGVRTIAANSARALATVLRGE
DPGGVASVNRLVKSEFEQHMHALALRALGPHAALGSRASDAIDKGRWTFG
YLMSRATTIGAGTAEIQRNTIAESVLGLPSHRGEGRRAAAVVPGSPLAVA
QEGERELREVLAQALHERGNVESLLDLKRPHDATDPAAWSALVEFGLPGL
AVDEALGGAGAPRRLLYAAIEEVGKALAPVPLVPTVTALDVAVAVGAKAV
VQRIVAGAPAAFAIPLRESGWLTTGLELPSWDGERLTGVVPIVAGAPAAD
VLLVLARATGGDGEVLVEVDPDADGVDVKTHQPLDLTATVGALTLNGAAG
QVLSDGTDLRHGLRIARCHALRAVAADSVGVGSRALAMSVEWAGERQQFG
RPIGSFQAISHRCADMLVALEGASSLLVAAADADDDRSEYLVELAAAAAI
DAAVAATEGTLQIHGGIGFTWEHPAHLLLRRAKANAVLVGRPEALRDRAA
GAIFGGRQWNTA
118465510YP_884032.1 hypothetical protein MAV_4911 [Mycobacterium avium 104]MEPMRQTASINNIRTAIRQLSVRAQLARKEGRHGDAAELENRIQGFREEL
SHRP
118465509YP_882426.1 linear gramicidin synthetase subunit D [Mycobacterium avium 104]MARDDRAFPLTRGQLDIWLSQEAGFAGTQWQLGLLVKIDGKVHRDALEQA
ITQAVAEAEPGRVSFFEVDGQVVQKPIDYPHVELAFHDLTDHADPVAEAR
EMSSAIQRTPMPLNGQMFKFVLFQTGHDEFYLFGCCHHIAIDGLGMALVC
RRVATIYSAMVAGKPIPDAYFGTVQDLIDLESGYEASPDYAEDKAYWSEH
LPPESGPVDRLPDAEGERDHYSPSASVQLDPSVANRIKELSKKLAIRRFS
VTTAACALLVRGWSGSGSEVALDFPVSRRVRPESKTLPAMLAGVVPLVLS
TAPESTVADFCKHVDKRIRELLAHQRFPVHTLEGDGLRQAPNRVGINFIP
SRLTLDLAGSPATASYTNHGPVGHFGLFFLGAGDQLFLSTAGPGQPFASF
GVADLAGRLQQILAAMTEDPDRPLSSIELLTGDEPALIDRWSNRPALTEP
APAPVSIPQAFAEHVQRTPDAVAVTFGATSLTYAQLDEASNRLGHLLADH
GVGPGDCVAVMFPRCADAIVSMLAVLKTGAAYVPIDPAHASSRMDFVLAD
AAPSAVITTSDLRSRLDDHDLLVIDVHDPAVEAQPGTALPWPAPENTAYI
IYTSGTTGTPKGVAIPHLNVTWLIESLDAGLPPGNVWTQCHSSAFDFSVW
EIFGALLRGRRLLVVPESVASSPEDFHALLVAEQVSVLTQTPSAVAMLSP
EGLESTALVVAGEACPTDVVDRWAAPGRVMLDAYGPTETTVCASISTPLT
AGDPVVPIGSPIAGAAMFVLDKWLQPVPAGVVGELYLAGRGVGHGYVRRP
GLTASRFVPNPFGAPGSRMYRTGDLVCWGPDGQLQYLGRADEQVKIRGFR
IELGEIQSVLAGLDGVEQAAVVAREDRPGDKRLVGYITGTADPAELRAQL
ADRLPPYMVPTAVMVLDALPLTGNGKLDKRALPSPEYAAGEYRAPGDAIE
EILADIYAQVLGVERVGVDDSFFDLGGDSILSMQVVARARAAGVICRPRD
VFVEQTVARLARVSQVAVDGELGAADEGIGPVRPTPIMRWLQDIDGPIDE
FNQTMVLAAPAGVGVDDVAVVLQALLDRHPMLRLRVQDDGAGGWSLEAPE
VGSVRAADCLRAVDSLSDAALVEARSRLNVSDGVLLSAVWASETSQLALV
VHHLAVDGVSWRTLIEDINIAWAQHQGGQEIALPVPGTSFARWSSILAEY
AKSPAVVAAAAAWQQVVATPAVLPAVGPDDTYASAGQLSASLDVETTRLL
LGEVPAAFHAGVQDILLIAFGLACTEFVGGGAPIGIDVEGHGRHEEIASG
VDLSRTVGWFTTKYPVALRMGRRLDWARVVAGEAALGAVIKDAKEQLRAL
PDGLSYGLLRYLNPEIEVQGPDPVIGFNYLGRLGAGADLSEEMWRVSADS
LSSAAVATAVPMPLAHTVELNAGTMDTDAGPQLHANWRWARSVLTDEQLN
RLSRLWFEALTGICAHVQAGGGGLTPSDIAPARLDQQQIDELCQQHQIAD
VLPLSPVQQGLLFHTGFAQELEDLYAVQLGITVSGTLDPHRLRDAVQNAV
NRHPNLVARFFDEFGEPVQIIPAEPEMAWRYLELDGGDIDGQLEQLSADE
RAAVCDLAGQPAFRAALIRIADDRHRLLLTIHHIVIDGWSLPVLLQEVFA
GYYGQRLPAPPSYRSYLMWLSAQDRAAAQDAWREALAGFETPTLVAPPGK
IGRRAVATYTVSADTTKALGELARSSRTTVSTVLQGAWAQLLTWLTGQHD
VAFGTAVSGRPTELPGADAMVGLLINTVPVRADIAAATTVVDLLEQLQRA
HADTLEHEHLALNEIHRVTGHDQLFDTLFLYENYPIDASALLDVHELAVT
EFSSREFNHYPLSVVATPGHELSLRVEYDTEVFDEAGIETLIERLRQVLA
AMTTDPGQRLSAIDLLDAAEHERLDAWGNRAVLTRRPAAQASIPALFAAQ
VARAADAVAITCGERSFTYREVEESANRLAHLLSGQGAGPGQRVAVVIPR
SAEAVVAIFAVLKTGAAYVPIDPGVPAARLQFVLADSAPVAAVTTAEVRD
RLDGFTGQIIDFDDPAVAEQPATGLPVPAADNIAYIIYTSGTTGIPKGVA
IPHRNVTLLLETLDAQLGLGQVWTQCHSLAFDFSVWEIFGALLHGGRLVI
VPDDIVRSPEDLHALLVREQVSVLSQTPSAFYALQSADALAPELGQQLKL
QTVVFGGEALEPHRLATWLHRHPGLPRMINMYGITETTVHASFREIVDAD
VDSSVSPIGVPLANLAFFVLDGWLRPVPVGVVGELYVAGGGLATGYVGRP
GLSATRFVACPFGGPGARMYRTGDLVRWGADGQLQYMGRADAQVKIRGYR
IELGEIQAALAGLDGVEHAAVIAREDRPGDKRLVGYITGTADPAEVRAQL
GERLPGYMVPSAVVVLDALPLTVNGKLDTRALPAPEYSDVDRYRAPVTAI
EEILADIYAQVLGVERVGVDDSFFDLGGDSILSMQVVARARAAGVICRPR
DVFTEQTVARLARVATVATGDDDVVDEGTGRVVATPIMRWLQNMDGPVEQ
FNQTMVLAAPAGVTPDDVAAVLQALLDRHAMLRLRVEDDGAGGWSLEVPE
AGSVQAADCLETVDALSPAALVDARSRLNLADGILVRAVWASETSQLALI
IHHLAVDGVSWRTLIEDLNIAWAQHHSGQPVALPTGGMSFARWSALLEDH
ARRPEVVERAEDWRQVAAVPAVLPGAQPGDTYATAGQLSASLDVETTRLL
LGEVPAAFHAGVQDILLIAFGLAWTQFIGTGAPIGIDVEGHGRSEELGPQ
VDLSRTVGWFTAKYPVALRLGGLSWGQVVGGDEALGAVVKEAKEQLRALP
DGLTYGLLRYLNPQAGLDVSDPAIAFNYLGRLGGGAAELSPELWRLSPDS
FALAGAAGAVELPLPHTVELNAGTMDTEDGPHLQANWTWARSALDDKQIG
RLSELWFDALAGICTHVRAGGGGLTPSDVAAARLTQRDLDELAQRYRVAD
VLPLTPLQQGLLFHAGTAQGSQEPEDLYAVQLDISVTGAVDPDRLREAVR
TVITRHPNVVAHFSEDFGEPVQILSAEPELAWQYVELDAGADLDEQVERL
SSAERVAVGDLAQPPFRGALIRTAEDAYRFVLTNHHIVLDGWSKPLLLQE
IFAAYFGVRLPAPVPYRNFITWLSAQDRAAAQAAWREVLAGFDTPTLVGP
SGRMALGPRGVAEFHVPADTSRLLGELARSCRTTVSTVLQAAWAQLLMWL
TGQHDVVFGTAVSGRPTELAGSESMVGLLINTVPVRATIGAETTIADLLD
QLQRAYTHTLEHQHLALNDIHRVTGHDQIFDTMFVYENYPIDTAALSAVD
ELTITGFTNREYNHYPLSVQAVPGHEIGLRVEFDTDVFGEARIEKLIERF
RRVLEAMTVDLEEQS
118465508YP_882090.1 hypothetical protein MAV_2904 [Mycobacterium avium 104]MLALLGIGAAALGYAAPARAEPQGDDAAFLASLDQSGITYSSSVQVIASA
KAVCGLMGRGETGLQVVTDIKDQNPGMTMDGAAQFAALASNAYCPHHLAP
KGG
118465507YP_881511.1 acyl-CoA dehydrogenase [Mycobacterium avium 104]MREYSVPARFSVGENENIATMVFEHERDDPNFVIYQRQVDGEWTDVTCAE
AAAQIRSAALGLISLGVQAGDRVSIFSATRYEWAILDLAILAVGAVTVPI
YETSSAEQVRWVLQDSEAVLAFAETDEHAAMVTELTAELPALRRVLHIDG
SGPKALDQLAEAAAGVEPAELTARLDGLRAQDPATLIYTSGTTGRPKGCQ
LTHSNLLYETRGAKESLPTLLDQGQRLLIFLPLAHVLARSLTLSAFANKV
TVGFTSDIKNLLPMFAVFKPTVVVSVPRVFEKVYNTAEQNAANDGKGRIF
AMAVQTAVDWSEAADRGRRGPLLRAKHALFDRLVYHKLRAALGGDCHASV
SGGAPLGSRLGHFFRGVGLTIHEGYGLTETSSAITVNQVGNVKIGTVGTL
LPGNSMRIAEDGELLVRGGVVFSGYWRNEQATADAFTDGWFKTGDLGVLD
DDGFLKIVGRKKELIVTAGGKNVAPAVLEDRLRAHPLISQAMVVGDNKPF
IGALITIDPEAFGGWKQRNHKGAGASVADLTTDPDLVAEVDAAIKDANQA
VSHAESIRKFRILPVDFTEDTGELTPTMKVKRNVVAEKFASDIEAIYAKD
118465506YP_879659.1 hypothetical protein MAV_0373 [Mycobacterium avium 104]MLMSAEPQPPTVPAGAAAGHPRRSVIEAAWRAIGPGVEVLSADDGGPLSR
TIKRIIDPLVLRLRSNPAYSAPVVTPETAAAMHELIVGSGPELRAAAAWF
EALKLERRRQRIRTGNAQELYFPVCFELAVTKGAPAPHDNETAAAVLADI
HRDRDRTAIEVLHRYAGNSDVVAALADQLQRSWRDVRAGPVDTGPFLAEL
ATVLGMAGGHRGAAARQRVWSAMITDATPYNLGALAHIDCASLPWSIVEV
GLSSVEPQRVPEVAAASEGQRPLDRSVLDRVRATLRRALDRDALPDIPLL
CEEEVDRACAPWGLLAEDKQATLVAGIEVAVQLAPLDPSACCRDDLAAQI
QARLRKEAYVLHARRYLAANGPIHPRQQQVVDDLAVFAQPYLNRLWARLH
GRDVWQEPCDDVDDVRALLDGVARSVSLDHRQRIKAMLELQVAG
118465505YP_880742.1 gp13 protein [Mycobacterium avium 104]MTTALPDFPVTTHPDMLPVRFEAPPVNPAPGGLYSSVFWTDVGTDEASRH
LTGVEVRGANFPGDQVGVWDTDWCGVPALDGDRKEGERGGVLDPFDPLVV
WAFDSCDATEPSRREVEQRAAQALRLRESVVVARQFAARLLVDAADLDAI
PAVADVVAALAHIEAEFAEANVLGYVHASPAWLPVFVAAQLITRSGAKWT
TPGGHALVFDGGYRAGLAGTIVATSAPLFGWRDVPQVRTALDERHNLYVA
VAERSVLVGYEAVVAAVEVTP
118465504YP_880722.1 TnpC protein [Mycobacterium avium 104]MCVGADSIDDLDLVRAGGMKSLFGGVYAASTVGTLLREFTFGHARQLESV
LRHHLSHLCQRVDLLPGSDKGAFIDIDSLLRPVYGHAKQGASYGHTKIAG
KQILRKGLSPLVTTISTTGAAPAITGMRLRAGKANSGKGAGRMIAQAIGT
ARAAGVRGQILVRGDSAYGTRAVVGACRSHGARFSLVMTRNTAIDRAINS
IDESAWTPVRYPGAVRDPDTGDWISDAEVAEIGYTAFASTKDRFTARLVV
RRVKDARFRDALFPVWRYHPFFTNTDLPTAEADITHRQHAIIETVFADLI
DGPLAHMPSGQFGANSAWVLCAAIAHNLLRAAGVLAGGAHAVARGATLRR
KIVNIPARLACPQRRPILHLPTHWPWADHWITLWCNTIGHSPPTTATI
118465503YP_883739.1 5'-methylthioadenosine phosphorylase [Mycobacterium avium 104]MHHNGRMLGVIGGSGFYIFFGSDADDVTVDTPYGPPSAPVTVGAVGGHRV
AFLPRHGARHEFSAHTVPYRANLWALRKLGVRRVLAPCAVGSLVPELGPG
AVVVPDQLVDRTRGRADTYFDSGAVHVDFADPYCPALREAVTGLPGVVDG
GTMVVIQGPRFSTRAESRWFASAGFSLVNMTGYPEAVLARELEMCYAAIA
LVTDLDAGVSAGEGVKAVEVFAEFEKNIEPFKKLVRDAIGRVAAERSCTQ
CSPHAGVSLPIELP
118465502YP_881840.1 MaoC like domain-containing protein [Mycobacterium avium 104]MSPGDGAGGQTTTTTALRVGVQAPVREFGPLTRQMFVRYAGASGDFNPMH
YDDQLARSAGYPSVFAQGMFSAALLAGFATDWLGAGSVRRFGVRFREQVW
PGDVLTCSGTVTAVSAEPDAERVIVELTATRQTGGVAITGTAEFVNPRNA
ARCGAGDADRP
118465501YP_879535.1 hypothetical protein MAV_0244 [Mycobacterium avium 104]MDSQRFRKLLDAPGPFVSVYFDDSHDTHDAEAQLELKWRAIREDLERRGV
GAPIVAGIEDAVMNLRPPIGRSGRAVIAGADGVLINEHLARPAATTILRV
SELPYLVPILEQSFDHPDYVLVVVDHSGADITTHIGGTLRSETVDGAGYP
VHKAAGAETAGYGDPQLRTEEAARKNVRAAADRVAELADDKAIDVIFVVG
EVRSRSDLLAALPERLHDRAVTLEVGARHSGHDFTEIERAIEAEFVKRQL
RAIDDAAQRFTAEIGRQSGLAAQGLDAVCSALRQGAVETLIIGDIGDATV
VADEGLTTVAPNENVLSEQGAAPARTLRADEALPFSAIKVGANLVRTDER
IAPADGVGAVLRYAPTLHQSVE
118465500YP_880112.1 gp54 protein [Mycobacterium avium 104]MSAVELFRYEGAHLRTVLVESEPWFVAADACRMLSLRDTTSAMKMVHDDD
KRLLHRSDTPQLFEGIAAQVQVITVVNESGMYALIFQSNKDRARDVRRWV
TSEVLPSIRKTGSYGAPVLTEDEIVHRALTITQARVEALTAKVVELAAPA
SAWNELAESTGDYSVADAAKVLSRDPSISIGRDRLFLFMSAERWLFKRDG
RWRAYQAQVDCGRLAEKVGRPFWHEGRGELVAGEPTVRITPKGLAELHKR
LRGTGQLALVSAL
118465499YP_881042.1 esterase [Mycobacterium avium 104]MSTVLRIEPRWTDLDPVGHVTNSVFLVYAEEARARFLHRALPDAWNHVVV
VHSDIDYHHPVLQSDSVEVSSAVESVGTSSFTTLNIIATARHKCATVRTV
QVALREDGSGTRPWTDDERTTLNELITAAKK
118465498YP_883527.1 peptidase [Mycobacterium avium 104]MRLLAVSALTMLPVFETPPAHAVSPPAVDDKWLPKPARPAPPWPTAQREV
CATLTADSGPGRRGPAGGSDLSAVWQLSRGTGQRVAVIDTGVARHRRLPA
VVPGGDYVSTGDGIQDCDAHGTLVAGIIAAAADPKSDEFSGIAPEATLIS
IRQSSAKFGPAGNRSGGGVGDVDTLAKAVRTAADLGASVINISSVACAPV
VSAPDDRALGAALAYAVDVKNAVVVAAAGNTGGPGQCPPQRPDATWQTIT
VAVSPAWYDDYVLTVGSVNADGAPSTFSLAGPWVDVAAPGEAVTSLAPEP
VSGTSYAAPVVSGLAALIRARFPALTARQVMQRIEATAHHPPAGWDPLVG
HGTVDPLAAVSAETGAPPPAPRAAAVPIAAPPPAPARDSRAPDVAVRGAA
FCLVALTLAAAAGAVRARLRRTRDGVAGD
118465497YP_879459.1 hypothetical protein MAV_0165 [Mycobacterium avium 104]MHLTLHLNVLRGRWQRPRRGHTGGCGRTPSALSRWAVRQAEMILLGTSVQ
L
118465496YP_879997.1 adenylosuccinate lyase [Mycobacterium avium 104]MSIPNVLAARYASAEMVAIWSPEAKVVAERRLWLAVLRAQQQLGVAVPAE
AIADYERVLEDVDLASIADRERLLRHDVKARIEEFNALAGHEHVHKGMTS
RDLTENVEQLQIRRSLELVFAHGVAVAARLAERAVAYRDLVMAGRSHNVA
AQATTLGKRFASAAQETLIALARLRELIDRYPLRGIKGPMGTSQDMLDLL
GGDPAKLAELERRVAEFLGFSTVLTSVGQVYPRSLDHDVISALVQLGAGP
SSMAHTIRLMAGHELVTEGFAPGQVGSSAMPHKMNTRSCERVNGLQVVLR
GYASMAAELAGAQWNEGDVFCSVVRRVALPDSFFAIDGQIETFLTVLDEF
GAYPAVIGRELDRYLPFLATTKVLIAAVRAGMGREAAHHVIREHAVATAL
AMREHGAEPDLLERLAADERLPLDRAALDAALADRRAFTGAAADQVDEVA
AQVDALVSRYPDAAKYTPGAIL
118465495YP_883325.1 hypothetical protein MAV_4179 [Mycobacterium avium 104]MDMKRCAKRFAGAGVLALAGLVTIGVGVSTAETIQAEGNYPTREACQDAG
PGVKASTPGNWNNFWCVPDRNVNGNWKLVLSN
118465494YP_883858.1 thiamine biosynthesis protein ThiC [Mycobacterium avium 104]MTAIVEPSVTTGPIAGSSKVYRELDGVPGARVPFRRVHLSTGDHFDLYDT
SGPYTDPDATIDLTAGLPARPGRVRDRGTQLQRARAGEITAEMAFIAARE
GMPAELVRDEVARGRAVIPANHNHPEIEPMIIGKAFATKVNANIGNSAVT
SSIAEEVDKMVWATRWGADTIMDLSTGKNIHETREWILRNSPVPVGTVPI
YQALEKVKGDPTLLTWEIYRDTVIEQCEQGVDYMTVHAGVLLRYVPLTAK
RVTGIVSRGGSIMAAWCLAHHRESFLYTNFDELCEIFARYDVTFSLGDGL
RPGSIADANDAAQFAELRTLGELTKIAKSHGVQVMIEGPGHVPMHKIVEN
VRLEEEWCEEAPFYTLGPLATDIAPAYDHITSAIGAAIIAQAGTAMLCYV
TPKEHLGLPDRKDVKDGVIAYKIAAHAGDLAKGHPHAQERDNALSQARFE
FRWNDQFALSLDPDTAREYHDETLPAEPAKTAHFCSMCGPKFCSMRITQD
VRDYAAKHGLDSEEAIEAAMADKSREFAEHGNRVYLPLAQ
118465493YP_881707.1 amidohydrolase [Mycobacterium avium 104]MLRIDTHHHLIPPDYRKALQQKGIDEAGGRALPDWSPEASLQTMAELDVG
TAILSVSTPGTTFLSEPADAAALARDLNDYTAELAAAQPDRFGFFATVPM
PHVDAAVAETVRALDELSADGVVLLANNAGVYVGQDGQDALFDALNHRSA
VVFIHPAELPGPTVPGVAPFAADFLLDTTRSAYLLVRNGIRNRYPNIRFL
LSHAGGFVPYASHRMAMAIMADTGRSFADVLDDFSSFYFDTALSSSAAAL
PSLLAFARPGHITFGSDWPFAPVAVGKLFAAGLETYPALDTSTRGAIEHT
NALALFPRLGTPPHPIPQSPAQRIRHSLSRGAMRVVARMTSTS
118465492YP_879701.1 GatB/Yqey domain-containing protein [Mycobacterium avium 104]MAELKSRLRADLTAAMKAQDKLRTATLRMLLAAIQTEEVSGKQAKDLTDD
EVIKVLAKESRKRAESAEIYTQNGRGDLAANEHAEARIIDEYLPTPLTEA
EVADVVDTAIAQVAEEIGERPSMKQMGMVMKAATAIAAGKADGARLSAAV
KERL
118465491YP_879848.1 DNA repair protein RadA [Mycobacterium avium 104]MTAKWVGRCLECGTWGTVDEVPALSAVAGRRPRLTAASQAVPITSIKPDA
SRHRSTGVDELDRVLGGGVVPGSVTLLAGDPGVGKSTLLLEVAHRWAQSG
RRALYISGEESAGQIRLRADRIGCGGDQVYLAAESDLHTVLEHVATVKPA
LVIVDSVQTMSTTEADGVAGGVTQVRAVTAALTAAAKANGVALILVGHVT
KDGAIAGPRSLEHLVDVVLHFEGDRNGSLRMVRGIKNRFGAADEVGCFLL
HDNGIAGVTDPSNLFLDQRSAPVPGTAITVTLDGKRPLIGEVQALLASPS
GGSPRRAVSGIDHSRAAMITAVLEKHGKLPVAVNDIYLSTVGGMRLTDPS
SDLAVAIALASALSELPLPTTAVMIGEVGLAGDLRRVSGMARRLSEAARQ
GFSIALIPDGDDPRREIVPSGMRALRAPTIGAALQHMVDIAEPRKGWTHR
ALGPQNDTL
118465490YP_880624.1 malate dehydrogenase [Mycobacterium avium 104]MSASPLKVAVTGAAGQIGYSLLFRLASGSLLGPDRPIELRLLEIEPALKA
LEGVVMELDDCAFPLLSGVEIGADPNKIFDGANLALLVGARPRGPGMERS
DLLEANGAIFTAQGKALNEVAADDIRVGVTGNPANTNALIAMSNAPDIPR
ERFSALTRLDHNRAISQLAKKTGAKVTDITKMTIWGNHSATQYPDIFHAE
VKGKNAAEVVGDQNWIENDFIPTVAKRGAAIIDARGASSAASAASATTDA
ARDWLLGTPAGDWVSMAVISDGSYGVPEGLISSFPVTTKDGDWTIVQGLE
IDEFSRSRIDKTTAELADERNAVTQLGLI
118465489YP_882445.1 ISAfe7- transposase OrfA [Mycobacterium avium 104]MPKEQSPGKPTTRRYSAEEKAAAVRMVRTLRAELGTEQGTVQRVARQLGY
GVESVRTWVRQVDIDEGLAPGVTTSESKKVKELEQEIRELKRANEILKRA
ASFFGAELDRQHKK
118465488YP_882044.1 integral membrane protein [Mycobacterium avium 104]MTAQQTAGLCQRLRGDPHGRHCCHRIPARSTTLTSVGIIGYIIIGGLAGA
LASKIVRGSGAGILMDIVIGIVGALIGGFILSFFVNTAGGGLIFTFFTAL
LGSVILLWIVGMVRRT
118465487YP_883827.1 hypothetical protein MAV_4699 [Mycobacterium avium 104]MRFAGVVLGWLIATLALAVAVPAGWVQLHVVDADGYAALARRAAADPALQ
SAMAAELTTRAMALIAEHGGGRYPVDGTQVHDAAAAFTAGPAFPPLFAQA
NRAAHAWLFDGSGAGGDQWAVDVAPMLDDPSIRPLLRRHNVAVPAKLTVP
LTVSVPRQGRLSGLTRWGPWLSLGSAALCGVGALLTLAAARRRGKALSSL
GVAALLVGAAGWAGLEAAGRYVNDALNHTTGNVRRIAEVMVAHAESGVHQ
WLNATLLAGAALAGLGVLVAVLGGLAGAASRR
118465486YP_884297.1 MarR family transcriptional regulator [Mycobacterium avium 104]MVGRFRRQLRRSAGRAFDPARLSESQSELLWLVGRRPGISVSAAAAELGL
VPNTASTLVTKLVSGGFLLRAAADTDRRVCQLRLTESAQQIVDESRAARR
ALLSEVVDELNDDQIEALTRGLEVLDMMTQKLRERRP
118465485YP_882521.1 triosephosphate isomerase [Mycobacterium avium 104]MSRKPLIAGNWKMNLNHFEAIALVQKIAFALPDKYYDKVDVTVLPPFTDL
RSVQTLVDGDKLRLSYGAQDLSQHDSGAYTGDISGAFLAKLGCTFVVVGH
SERRTYHNEDDALVAAKAAAALKHELTPIICIGEHLEVREAGNHVIHCEE
QLRGSLAGLSAEQIGKVVIAYEPVWAIGTGRVASASDAQEVCAAIRKELA
SLASAQIADSVRVLYGGSVNAKNVGELIAQDDIDGGLVGGASLDGEQFAT
LAAIAAGGPLP
118465484YP_882316.1 GGDEF domain-containing protein [Mycobacterium avium 104]MSGTLDHLVTAAAAELMAATAADAAQISERVLADLVSHFGVNFGFLRHND
HSIRATVLVAEWPPRNVDPDPLGVIYFADADSVFARVETMKEPDVLRPEP
ANADYQRNIEDGTGIPEVSLAAVPLLSGDVTTGTLGFVKFGDREWLSEEL
NALQAIAALFAQLQARVVAEEQIHYLAEHDELTGLLNRRALIAHLDKRLA
PGQPGPVPVVFLAIDRFKVINGRLGQDAGDRFIDAFAALLREATEIPSVI
ARFGGDEFGVVPAAPMDVEAAESFAHSLHERLHHPIAIDDEMLSRTVSIG
VAAGIPGDESTSDLLRRVDQATRSAKAAGGNNVATFRPEMSTIDTIRNDI
ELYLEGMIDGGSGALVLHYLPEFDMRTGEILGTEALTRWQHPTLGLLMPD
SFIQVAESINLGAKLGRLVMRSACAQFGQWRSRGVGQGTVLRINVSPVQL
VTAGIVDTVAATLDEFGLDPSTVCLEITESVVVQDIDATRQTLFGLKDIG
VQIAIDDFGTGYSVLTYLKSLPVDSLKIDKGFVQSLDTNPGDLAIVRSTL
ALADAFGLDVVAEGVETVAAAETLLSLGCHRAQGFLLSRPLDSAGMEALL
IKGAIPMRFSDGGAPENQHVV
118465483YP_881724.1 virulence factor Mce [Mycobacterium avium 104]MTLTADRSGLIMEPGAKVKLRGVQVGRVTSIHSGDPVTLRLELYPEQLQY
IPANVTAQITATTAFGGKYVDLQIPESPSPRRLAAGAVVRSRNVTTEVNT
VFQNLVAVLNQVDTPKLNAVLTALGDGLRGKGEALGEATTDLNEVLGAIN
PRSETIRADSRALEGFSDTYSAAAHDIVTVLDAGSTTSATVSNNAQALDS
LLLNVIGLSHSGIGLIGPNKDNLVHGVNLLESTTRLLMKYNPELTCTLLG
SKYDAEFFGDVAGGHNGYSVTLDVALLLGDEAYRYPDNLPINGAKGGPGG
QPGCGSLPDVSKNFPLRYLVTNTGWGRGLDMRPNPGIGFPGYVDYLPVTR
GTPQPPSLRHPGGTAPGPMPYPGAPPYGAPQYAPDGTPLYPGLPPAPPPG
RPRDAGPPPAGSEPFTPPVPGAIQPTCGVLNQVCEPLPPPPNVPGP
118465482YP_881696.1 hypothetical protein MAV_2504 [Mycobacterium avium 104]MFARVLGPFLVVFTATTVARASDMRKLLSDFDSNSALPLVTGGFLLLASL
VILGLHQCWRGAPAVTVSVVGWVFAVRALLLMAFPHAFMAAADAAVRMTA
LWVSGDVVVGVVGLYLAYVGWKPVTSPSTPATTSTPDVPRAA
118465481YP_883431.1 hypothetical protein MAV_4293 [Mycobacterium avium 104]MTTANQADGTPSVPRSRKILCIVYAAIAFAALIATWSNGGPYVHSAADFL
GTFWRDAKATSASRFVAADALMLAISVVILMVIEATKHSVRFVWVYVVGS
FFVAISVMFPLFLIARELRMGTSETPRLRMTDTTLLAVVGVMTAALTVWI
DMG
118465480YP_883812.1 DNA-binding protein [Mycobacterium avium 104]MSKTFVGSRVRQLRHERGFSQAALAQMLEISPSYLNQIEHDVRPLTVAVL
LRITEVFGVDATFFSSQDDTRLVAELREVTMDRDLDIDVDPTEVAEMVSA
HPGLARAVVNLHRRYRITTAQLAAATEERFFDGSGTGSITMPHEEVRDYF
YQRQNYLHELDTAAEDLTIKMRLHHGDLARELTRRLTEVHGVHINRRIDL
GDTVLHRYDPETKTLEISNHLSWGQQVFKMAAELAYLEFGDLIDSLVAQG
KFTSEESHKLARLGLANYFAAAAVLPYRQFHDVAENFRYDVERLSSFYSV
SYETIAHRLSTLQRPSMRGVPFSFIRVDRAGNMSKRQSATGFHFSSSGGT
CPLWNVYETFANPGKILVQIAQMPDGRNYMWVARTVERRAARYGQPGKTF
AIGLGCELRHAHRLVYSEGLDVSGGPGTVATPIGAGCRVCERDNCPQRAF
PALGRALDLDEHRSTVSPYLVKQP
118465479YP_882408.1 ketoacyl reductase [Mycobacterium avium 104]MSLPKPDIATTVVITGASSGIGAELARGLARRGFPLLLVARRRERLDDLA
NEVGGQYSVGVEVLPLDLGDSKARARLAGRLRSESIAGLCNSAGFGTSGV
FHELPMERESEEVTLNALALMELTHATLPGMVSRGAGAVLNIASIAGFQP
VPYMAVYSATKAFVQTFSEAVHEELHGSGVSVTCLCPGPVPTEWAEIANA
ERFSIPIAQVSPRDVAEAAIGGMLTGRRTVVPGVVPKVVSTGGRFAPRSL
LLPGIRIGNRFRGGPKR
118465478YP_879800.1 adenylate cyclase- family protein 3 [Mycobacterium avium 104]MTTAAALPGRISAFARWVVRTPWPLFWLSMMQADIIGALFVLGFLRYALP
PEDRIQLQDLPVVNLAVFATSLVVLFLAASVVNLTLLMPVFRWQRRDNLL
AESDPAATELARIRALRMPFYRTVTSMVIWCIGGVVFIIASWSVARFAAP
VVAVATGLGAAATAIIGYLQCERVLRPVAVAALRSGVPENVKAPGVILRQ
ILTWMLSTAVPVLAIVLAVVADKTSLLHATPEKLFTPILLLAVAALGIGL
VSTLLVAMSIADPLRQLRWALSEVQRGNYNAHMQIYDASELGLLQAGFND
MVRDLSERQRLRDLFGRYVGEDVARRALERGTELGGQERDVAVLFVDLVG
STQLAATRPPAEVVHLLNEFFRVVVETVGKHGGFVNKFQGDAALAIFGAP
IEHPDSPGGALAAARELHDALLPVIGSAEFGIGVSAGRAIAGHIGAQARF
EYTVIGDPVNEAARLTELAKLEPGHVLASAIAVSGALDSEALCWDVGEVV
ELRGRTAPTQLARPVKLATPEEVAPQEVSSEVSG
118465477YP_880159.1 short chain dehydrogenase [Mycobacterium avium 104]MDGFLSGFDGRAAVVTGGASGIGLATATEFARRGARLVLSDVDQPALEQA
VNGLRGQGFDAHGVVCDVRHLDEMVRLADEAFRLLGGVDVVFSNAGIVVA
GPLAQMNHDDWRWVIDIDLWGSIHAVEAFLPRLLEQGTGGHIAFTASFAG
LVPNAGLGTYGVAKYGVVGLAETLAREVKPNGIGVSVLCPMVVETKLVSN
SERIRGADYGMSATPEGAFGPLPTQDESVSADDVARLTADAILANRLYIL
PHAAARESIRRRFERIDRTFDEQAAEGWTH
118465476YP_882047.1 molybdate ABC transporter permease [Mycobacterium avium 104]MYLPAAAGTMFVVLPLLAIAVKVDWPHFWSLITSPSSRTALLLSLRTAAA
STALCVALGVPMALVLARGGTRLVRSLRPLILLPLVLPPVVGGIALLYAF
GRLGLLGHYLEAAGISVAFSTTAVVLAQTFVSLPFLVISLEGAARTAGAD
FEVVAATLGARPTTVWWRVTLPLLLPGVVSGAVLAFARSLGEFGATLTFA
GSRQGVTRTLPLEIYLQRVTDADAAVALSILLVAVAAVVVLGLGARRLTG
TDAR
118465475YP_881714.1 hypothetical protein MAV_2522 [Mycobacterium avium 104]MVAAAGRKVTTSAEAAALLGLPRAMESVPRNDCGFEIGCGTIDKRELVNE
LRIW
118465474YP_882326.1 hypothetical protein MAV_3142 [Mycobacterium avium 104]MCQSTEITDARDEFAAEVLRKLLRRIHFENQVANPPQGNHAYLVSHAWTK
GPMMYLVYTSPPSDITWGLARDTRESIIDQGPWPDADEAATYYFLLDLEE
GCATSNYPREPGEILWCGYPLEDDLPARPSDIPDTYRITPSQRTSSAKRP
RDENRPVVNEPRLYADPP
118465473YP_883379.1 serine/threonine protein kinase [Mycobacterium avium 104]MSDNGPAAQVGSWFGPYRLVRLLRQGGMGEVYEAEDTRKHRLVALKLISQ
QFSGNPEFSARLQREADIAGRLTEPHVVPIHDYGEIDGRFFVEMRLVDGI
DLGSLLHREGPLAPPRAIAIIRQVAAALDAAHAAGVTHRDVTPGNILVTP
SDFAYLADFGIARAASDPGLTQVGTAIGTYYYMAPERFTDDEVTNSVDIY
SLACVLTECLTGVPPYRADTVERLVAAHLTKTAPPLSQLRPGGFPPALDR
VIAKGMAKRPEDRYRTAGEFAAAAHEALTTSEQRKAATILRDGQIAALGA
GAAEQRSTHWPDSFAPSPSAETVVGPSPARAGAPSSGLIRAAPTGSGRVY
APGPDFGRPVAPTDNKRKQWIIVGAVALVALVAFVVAVVGYLSTASSGPA
KQAGGQSVLPFNGIDFRLSPGGVTLDGAGNVYVTSEGMYGRVVKLAAGSG
ATTVLPFNGLYQPQGLAVDGAGTVYVADFNNRVLSMAAGSNSQKELPFSG
LNYPEGVAVDSQGGVYVADRGNSRVLKLAAGSQNQTVLPFTGLNNPDGVA
VDPAGNVYVADTDNNRVVKLDAASNTQSELPFHDLSVPWGIAVDNGGTVY
VTEHDKNDVVKYPPGATSGTVLPFTALNTPLAVAVDRDQSVYVADRGDDR
VVKLAQ
118465472YP_884165.1 hypothetical protein MAV_5046 [Mycobacterium avium 104]MPAVDTEHRTDDKTAAADDGRTIEAIDTDTKDTQLDDHEQKDTKAEKFER
RVSKAPRQLSISLRAAAFGSVVCILAATAGVFAWLYWGAHDELAAQHRAT
NDRNHAEEIATDYAVNAAEMDFQDFNGWKLKLINGTSPELKDKLTKAADS
MQQILGPLQWKSTARPLAAIVRSDNGGVYVVDSFVSVLTKTVQAPEGLQS
TATYSITLDSKHNWQITDVGGIDAALRK
118465471YP_880678.1 sulfate adenylyltransferase subunit 2 [Mycobacterium avium 104]MPKEAMTADLQTAPAAGQYELSHLRSLEAEAIHIIREVAAEFERPVLLFS
GGKDSIVMLHLALRAFRPGRLPFPVMHVDTGHNFDEVIATRDELVKQHGL
RLVVASVQDDIDAGRVVEPKQGRNPIQTVTLLRAIRENKFDAAFGGARRD
EEKARAKERVFSFRDEFGQWDPKAQRPELWNLYNGRHHKGEHIRVFPLSN
WTEFDIWSYIGAENIALPSIYYAHRRKVFRRDGMLLAVDRNMQPNPDEPV
FEATVRFRTVGDVTCTGCVESQAATVDEVIAETAVSRLTERGATRADDRI
SEAGMEDRKRQGYF
118465470YP_884289.1 F420-dependent glucose-6-phosphate dehydrogenase [Mycobacterium avium MTGISRRTLGRLAVGAGVLASAVQACAKPGAGHGRSGAPPAPAGKGVGFV
LSHEQFRTDRLVAHAQAAERAGFTHGWASDHIQPWQDNEGHSMFPWLTLA
LVGSSTSHVSFGTGVTCPTYRYHPATVAQAFASLAILNPGRVFLGVGTGE
RLNEQATTNGYGNYTERHDRLAEAIALIRQLWSGSRISFSGRYFQTNSLK
LYDVPATPPPIFVAAGGPKSAKLAGQFGDGWITQSGDVTNPKLLAAFGAG
AQAAGRDVATLGKRAEMFAVVGDDAVAARAATLWRFTAGAVDQPDPVDIQ
RAAESNPTDKVLGGWTGRHRRGSARRGRAAGPRRGRRSLPALSAGRPDGR
HRLLPGQCLTEIALNPLRATPVSPLPATNSRRIGQNRDVMDAVDPDSRHQ
LAVRMAELVRGMAAPRRLDQVLAEVTAAAVEVIPGADIAGVLLVRKGGEF
ETLADTDSLAARLDVLQHDFGEGPCAQAALQETIVRSDDLRREPRWPCYA
PAAVQLGVLSSLSFKLYTADRTAGALNLFSHRPDAWDTEAETIGSVFAAH
AAAAILAGSRAEQLYSAVSTRDRIGQAKGIIMERFGVDDVRAFDLLRRLS
QESQVKLVEIAQQIIDTRGQGA
118465469YP_884154.1 ISAfe7- transposase OrfA [Mycobacterium avium 104]MPKEQSPGKPTTRRYSAEEKAAAVRMVRTLRAELGTEQGTVQRVARQLGY
GVESVRTWVRQADIDEGLAPGVTTAESKRVQELEQENRELKRANEILKRA
ASFFGAELDRQHKK
118465468YP_883690.1 alpha-1-2-mannosidase [Mycobacterium avium 104]MRSRTAPIALVATLAVLMTVIAPAPPRGYDGPPLFVANPVDHVVTLIGTG
TGGETVGEINNFPGATVPFGMVQYSPDTAGNYAGYNYDNPRATGFSMTHA
SVGCAAFGDISMLPVTGGLGVQPWNATERIAHDDTERGVPGYYTVRLPGA
GVTAELTATAHTGVGRFSYPGDGRPALLQVRSGSSLAGNSRATIQLGEDN
TTITGWATSGGFCDKPNAYTVYFAMKFNRPFISYGSWDGSTVYPGARSAN
APYSGGYVEFPAGSVLEVRTAISYVGIEGARANLAAEGNAGFDDVRAAAA
RQWNAALSRVTVAGRNSDDLTTFYTALYRTLLHPNMFNDADGRYVGFDGG
IHRVADGHVQYANFSDWDTYRCLAALQALLFPDRAADMAQSLVTDAQQSG
ALPRWAFANAATGEMSGDSVVPLIVNLNTFGANDFDTAAALRYMVDGATK
GGVGLAGYVERRGIATYLRLGYAPFTLEFGRNGWIADASITLEWSIDDFA
ISRFADSLGDAATAAEFANRAQYWQNLFNPSTRSVVPRSWSGFFRPGPAV
VVSPANFGQVGYDEGNAEQYVWSVPHNVAGLVTALGGRAAVADRLDRFTK
KLNVGPNQPYLWAGNEPSFGVPWLYNYIGQPWKTQHTVDRVRGLFGPTAD
GEPGNDDLGALAGWYVWAALGLYPATPGTPILTVAAPLFDRIEIALPAGK
SIRIAAPGASGPHHPAYISGLKVDGRPTGHTWLPESIIRTGGTLAFSLAA
YPDKHWGTAESDAPPSFGAGSSAVAVNVPQPVVSIAPGHRGSVTLDAQRM
IDGAGGYTVSGAASDAGVAVTPTSGQFDADGAASVSVPITVAPTVPQDYY
LVSLTTTVGQSTRTTTVLVDTQAEPESR
118465466YP_880831.1 L-carnitine dehydratase/bile acid-inducible protein F [Mycobacterium aMQGFRVLEVAQFTFVPAAGAILADWGADVIKVEHPVRGDTQRGFVNMGGI
QVDPERHPLMEHPNRGKRSVGVDVSTPGGQEVIYELAKTSDVFLTNYMPA
QRRKHKFDVEHIRAVNPNIVYARGSAYGDKGAERDVGGYDGTAFWTRSGI
GYALTPEELGGALGQGIPAFGDSIGGMFIAGGISAALLHRERTGEAVELD
VSLLSTAWWAAGASVTQGMETGEVMRTPMPGAGAPSVNPFMGNYETSDGG
TINLCIISPTGLIRDTFEHLGIPEAADDPRFCDVLPLIQNADAAAELIAK
AFAAKPFDYWRQHLKTMKGQWAPFQSLLDLIDDEQAIANDMIAEVELAGG
GKPFRVVRGPVQFNHEPLATTRAPQASEHTELVLMELGMDWDRIEELKNA
GAIA
118465465YP_883446.1 multidrug resistance protein- SMR family protein [Mycobacterium avium MAWLILIASGVLEAVWATALSRSEGFSRLGPSLVFFVALAFSMTGLAVAM
RSLPVGTSYAVWVGVGAALTVTYAALVGDEPASPVKLVLIAGIVACVAGL
KLLG
118465464YP_880035.1 transcriptional regulator [Mycobacterium avium 104]MELLLLTPELHPDPVLPSLSLLAHTVRTAPPEPSSLLEAGTADAVIVDAR
TDLSSARGLCRLLSTAGRSVPVLAVVSEGGLVAVNSDWGLDEILLPTTGP
AEVDARLRLVVGRRGGLADQESAGKVTLGELVIDEGTYTARLRGRPLDLT
YKEFELLKYLAQHAGRVFTRAQLLHEVWGYDFFGGTRTVDVHVRRLRAKL
GPEYEALIGTVRNVGYKAVRPARGRPPVAEADDAESESDSASESDAEDVH
DPLVDPLHTQ
118465463YP_881901.1 AraC family transcriptional regulator [Mycobacterium avium 104]MVGYRTLDVPEGVHRGMPSSMLTFIVSLDDGVEAADTATALPAARPTPLI
LGGLHLRASHVRQRRGQAGVQLAVHPLASRALFGLPSAELPVAEYDATAV
LGRDIVDLHHRVAEAHRWPDVFALVAQYLIDARRRRDGATVRPEVLHAWH
LLQRSRGLMPVTALADAVGVTTRHLATLFRREVGHSPKTVAMLMRFQHAT
GRIAESARRHGRVDLARVAADTGYSDQAHLSREFVRFAGVPPQRWLAEEF
RNIQDGGHLLGSQWEHDCFESDRLVDTASP
118465462YP_882713.1 transposase- Mutator family protein [Mycobacterium avium 104]MSVMDVKRPPRDPSSQPSTESSRSPTMTAPHIVDPAGLLGEALAEASPDL
MRSLLQTVINALLSADADAVVGAEWGQPTPGRRAQRNGYRHRGLDTRVGT
IDVAVPKLRKGTYFPDWLLERRKRAESALITVVADCYLAGVSTRRMDKLV
KTLGIDSLSKSQVSRMATDLDEHVEAFRHRPLDSAGPFTFVAADALTMKV
REGGRVVNGVVLLATGVNGDGHREVLGMRVVTSETGPAWNEFFADLVARG
LAGVRLVTSDAHAGLREAIAANLPGAAWQRCRTHYAANLMSICPKSMWPA
VKAMLHSVYDQPDAPAVAAQFDRLIDYVTDKLPAVADHLATAREDILAFT
AFPKDVWSQIWSNNPAERLNKEIRRRTDAVGIFPNRDAIVRLVGAVLAEQ
NDEWAEGRRYLGLDILTRCRLTTITDDNPDIGANDMPALTA
118465461YP_881910.1 18 kDa antigen 2 [Mycobacterium avium 104]MVLMRTDPFRDLDRWTQQVLGTAARPAVMPMDAWRDGDQFVVEFDLPGVN
ADSLDLDVERNVLTVRAERPDLDQNREMVSAERPRGVFSRQLFLGDNLDT
DKIEANYHDGVLRLTIPVAEKAKPRRIEINHNHRTAINA
118465460YP_879783.1 hypothetical protein MAV_0502 [Mycobacterium avium 104]MLDAVSCNVGWRLAAGLAAVALVLAPAAAADPECSSCVQGKEAIDDQVLR
RHVQLTANDDLHQYCESLLRNVLKSGRVARVDSPPDFVASCEDEGRVLIA
GQ
118465459YP_879786.1 transposase [Mycobacterium avium 104]MVARSQRVSFGEGPDTYTVVGDDGLPIGPAAEYLRFLRDGGASPHTVRAY
AAGIADWFTVLSHTGHVWDDFPTTLFGQYLQFLRTGDLPGSARIGPPQQR
LAASSLQPRAAAVLSMYRYHADAHHVDTPYRRLFTSRGSWRRYRRYVGFL
DGVGPQRRGDHPIYRMRTQNRCTTPVLTPPQVNTILDACSVQHDGTWSGG
PAAVRNRLLFAVLAETGMRLGEALSLRHHDFHIGAGATPFIEIVDRQDHP
HGVRVKTGSRRVYVGDDLEALYSEYVWQLVAMAADVEVPDLASHFVFVNL
AHGPRFAAMRVETVYDKVRGIKRAQPSLPAGWTPHWLRHTHATALLLAGV
PEHVVMRRLGHADVQTTLSTYGWVTQDAEMRSLASWKNYVAGWKGLHDGP
P
118465458YP_881524.1 integral membrane protein [Mycobacterium avium 104]MATGTDTPAADPPAAKPSRGQWFSRLKAFAGSADSGPAKLGMLGSVLITL
GGLGAGSTRQHDPLLESIHMSWLRFGHGLVLSSIVLWTGVGLMLIAWLSL
GRRVLAGEATEFVMKATTGFWLAPLLVSVPVFSRDTYSYLAQGALLRDGL
DPYAVGPVANPNSLLDNVSPIWSITTAPYGPVFILVAKIITILVGNNVVA
GTALLRLCMLPGLVLLIWATPRLARHLGADEPTALWICVLNPLVLIHLMG
GVHNEMLMVGLMAAGIALTFGGRPVAGVTLITVAIAVKATAGIALPFLVW
VWARQLRDQRGYRPVPAFFAATAASLLIFAVVFAALSAVAGVGLGWLTAL
AGSVKIINWLTVPTAAANLIHAIGSGFFPVSFYPILRVTRLVGIAIIAIS
LPLLWWRFRRDDRDALTGIAISMLIVVLFVPAALPWYYSWPLAVLAPLAQ
SRRAVAIIGGLSTWVMVIFKPDGSHGMYSWLHFSLATAVALVAWYSLYRV
PQPAQ
118465457YP_882441.1 dehydrogenase DhgA [Mycobacterium avium 104]MALAMITGASSGIGLELAELFAQRGYDLVVAAENDGIYPASDSLSRWGVD
VRPVQVDLRTPDGVEKLYREATEGGRGLDAAALNAGVGGGGSFVEGELAH
DLSIIDLNVRSTVHLAKLVLRNMTRRNTGKVLFTSSLASMAPGPFEAVYH
ASKSFVQSFAAALRDELRDTGITVTSLMPGTIETNFFSRAGMDQTRAGQK
PKDDPAEVARQGFEAMMRGHRKVVGGSLTTKTVGVALRFLPDSWKAAASR
VNSTPAGRR
118465456YP_881971.1 ArsR family transcriptional regulator [Mycobacterium avium 104]MVVVTGVDRVFLALANPVRRELLQLLARHPLSAGELSERFELSRPAVAEH
LKVLREAALVADERRGRQRIYHLTAEPLAELGEWLHPFEKFWRTRLRRLA
EVAEELE
118465455YP_882855.1 bifunctional riboflavin kinase/FMN adenylyltransferase [Mycobacterium MLTIGVFDGVHRGHAELIAHAVKAGRARNVPTVLMTFDPHPMEVVYPGSH
PAQLTTLTRRAELVEELGIDVFLVMPFTTDFMKLTPDRYVHELLVENLHV
VEVVVGENFTFGKKATGNVETLRRAGERFGFAVEAMSLLSEHHSNQTVTF
SSTYIRSCVDAGDVVAAMEALGRPHRVEGVVVRGEGRGIQLGFPTANVAP
PMYSAIPADGVYAAWFTVLGHGPVTGTVIPGERYQAAVSVGTNPTFSGRT
RTVEAFVLDTQADLYGQHVALDFVARIRGQHKFDSVDDLVVAMGQDTERA
RQLLSAG
118465454YP_880754.1 50S ribosomal protein L31 [Mycobacterium avium 104]MKADIHPTYAETTVLCGCGNTFQTRSTKDGGRIVVEVCSQCHPFYTGKQK
ILDSGGRVARFEKRYGKRKAGAEKAESADK
118465453YP_883846.1 hypothetical protein MAV_4719 [Mycobacterium avium 104]MKVQLQVDGSPVRAAASAAEIAATGADGLFTFEGQHDVFFPLLIAAEATG
CELMTNVAIAPPRSPMHLAYAAYDLQLYSGGRFRLGLGSQIKVHVEKRYG
SKWEPPAARMAEAISAIKAIFAAWEGRARLDFRGEFYTHTIMAPTFDPGP
NPYGPPPVLLGALGPMMTRTAAEVADGLLVMPFNSARHFAERTLPAIGEG
LRRSGRTLTEFPIIAQAMVAVGRDEADLATAIDGVASLIAFYGSTPAYLP
VLQVEGWDGIQPELNALSKQGRFAQMRGLITDELVARIGIVGTPEQCAEQ
IAARFGEHADEVCCYFPGYTPRPADVADLIGALHRVPALP
118465452YP_879513.1 propionyl-CoA carboxylase beta chain [Mycobacterium avium 104]MTEMAPAPIQHTTAEKLAELYRRLELAKEPGGEKAAAKRDKKGIPSARAR
IHALVDPGTFLETGALAKTPNDPNALYGDGCVTGHAMIDGRPVGLFSHDQ
TVFQGTVGEMFGRKVARLMEWCAMVGCPIIGIQDSGGARIQDAVTSLAWY
AELGRRHEALSGLVPQISLIFGKCAGGAVYSPIQDDLLVSVRDQGYFFVT
GPDVIREVTGEEVTLDELGGSDAQARYGNIHHVVNTEAEAFQYVREYLSF
LPSNCFDQPPIVNPGLEPEITPTDLELDSIVPDSDNMSYDMHEILLRIFD
DGDFLEVAAQHGPAIITGYARVDGHPVGVIANQPMHLSGSIDNEASDKAA
RFIRFCDAFNIPLVFVVDTPGFLPGAEEEKRGIIKRGGRFLYSVVEADVP
KVTITVRKSYGGAYAVMGSRQLTADFNFAWPTARIAVIGAEGAAQLLMKR
FPDPTTPEAQQIKKDFIEGYNLNMAIPWTAAERGFIDAVIDPHETRLLLR
KSLKLLRDKQLWFRVARKHGLIPV
118465451YP_883877.1 extracellular solute-binding protein- family protein 3 [Mycobacterium MAEAERVPMTAGLPLLRRACTALAAVLVAAGCGHTESLRVASVPTLPPPT
PVGMEQLPPQPPLPPDGPDQNCDLTASLRPFPTKAEADAAVADIRARGRL
IVGLDIGSNLFSFRDPITGEITGFDVDIAGEIARDIFGAPSHVEYRILSS
DERVTALQRGEVDVVVKTMTITCDRRKQVNFSTVYLDANQRILAPRDSPI
TKVSDLSGKRVCVAKGTTSLHRIRQIDPPPIVVSVVNWADCLVAMQQREI
DAVSTDDSILAGLVEEDPYLHIVGPNMATQPYGIGINLNNTGLVRFVNGT
LERIRRDGTWNTLYRKWLTVLGPAPAPPTPRYLD
118465450YP_879525.1 oxidoreductase- FAD-binding [Mycobacterium avium 104]MSSTDPLITPARLTGFGRTAPSVAQVLRTRDPEVIAKAVARVADSGHSKS
RGVIARGLGRSYGDNAQNGGGLVIDMTGLNRIHSISADTRLVDVDAGVSL
DQLMKAALPFGLWVPVLPGTRQVTVGGAIACDIHGKNHHSAGSFGNHVRS
MELLMADGTVRTITPDGPDASDAELFWATVGGNGLTGIVLRATIAMTPTE
TAYFIADGMATKDLDETVAVHLDGSEADYTYSSAWFDLISPPPKLGRAAV
SRGSLARLDQLPKKLAKNPLKFDAPQLLTVPDVFPVSAMNKLSFMAIGEV
YYRLGGTYTGKIMNLSQFYHMLDLVSGWNNAYGPRGFAQHQFLVPPDAMD
EFKAIIRWIQTRGHYSALNVFKLFGPGNRAPLSFPMAGWNVAMDFPNKPG
VNEFLNELDRRVLQFGGRVYTAKDSRTNAETFHAMYPRIDEWIAVRRKVD
PTGVFASDMARRLELL
118465449YP_882126.1 hypothetical protein MAV_2940 [Mycobacterium avium 104]MSNHDYVTYEEFGRRFFEVAVTPERVAAAFADIAGSEFAMEPIAQGPGKI
AKVSANVKIHEPRVTRRLGDTITFVIHIPLSIDLLVDLWLDKQRFVVSGD
IALRATARAAEPLLLIVDVAKPRPSDITVNVSSKSIRGEVLRILAGVDGE
IRRFIAQYVADEIDAPHSQAAQVIDVAQQLEQAWPG
118465448YP_882712.1 hypothetical protein MAV_3534 [Mycobacterium avium 104]MALSPSPPRPSAPGKDTTSPQRSGDFYLATSGDFLLATDGDFLMAMDISV
VKRPRITTERKLSPA
118465447YP_882671.1 diadenosine tetraphosphate [Mycobacterium avium 104]MSDPEQAEQDAERTILDRGVGEQDHLQRLWTPYRMTYLAEAPMKRGPNSS
GKSEQPFTDIPQLTDEDGLVVARGELVYAVLNLYPYNPGHLMVVPYRRVS
ELEDLTDAESAELMSFIQKAIRVIKNVSRPHGFNVGLNLGTSAGGSLAEH
LHVHVVPRWGGDANFITIIGGSKVIPQLLRETRQLLATEWAKQS
118465446YP_881742.1 carveol dehydrogenase [Mycobacterium avium 104]MGSLDGRVVFITGAARGQGRSHAVMCAEQGADIIGVDICENLDIVPYALG
TEDDLEETARLVEKTGRKMLTRKADVRDKTALQEAFDAGVTEFGHVDTVL
ANAGVVLTNADERDASEALRLGLDIMLIGVWNAFQVAIPHMKERGEGGNL
IATSSMIALLDLTDGRGGSDAYLMSKVAVVGLVRAYAAMLAPDRIRVNAV
APTNCATPMITDNPALFKVIEDNPRMVNAVQTALPDLPLIEPRDVSNTIL
FLISDAGRSFTGSMLKVDAGMDVRRG
118465445YP_881193.1 transposase- Mutator family protein [Mycobacterium avium 104]MVKRPRITTERNIAMALDQSALLEVLDALRTADAGERITQAAETIYQALI
DAELTAFIGASPHERTETRSNQRNGSRPRTLSTVAGDLELRIPKLRTGSF
FPALLERRRRVDQCLFAVVMEAYLHGTSTRKVDDLVKALGTDTGISKSEV
SRICKDLDTEVAAFRDRPLGDQRFPYVFLDATYCKARVNHRVVSQAVVIA
TGVAADGRREVLGFEVGDSEDGAFWTAFLRSLKSRGLAGVQLVISDAHAG
LRSAIDAVLIGAAWQRCRVHFLRNVLAQVPKGSAEMVAAAIRTVFAQPDA
EHVREQLDTIAGMLGRQFPKVETMLREAAADITAFADFPVAHWKKIWSTN
PLERLNKEIKRRTDVVGVFPNPAALLRLAGSVLVEAHDEWQVADKRYLSE
TSLALLDVSDQSAETIAPTAALTA
118465444YP_880148.1 3-alpha-hydroxysteroid dehydrogenase [Mycobacterium avium 104]MAEIDALWRYDGRRAVVTGCASGIGEQVVRQLGQLGADVIGLDQRRPGCA
LGEFHEVDLADPESIDRAAAGIDGPVDALFNIAGVSSGIGNPPLVVTVNF
LGTRQLTEALIPKMVAGSSIVSVSSLAAAGYREHLRQVAPLLDTATMREG
IDWCTSHPEELGTGYQLSKEALILYTMRSVTPLGARGIRINCTGPGVTET
PILDQLRTAYGQGFLDDIPKPLGRVSRPAEQAAVLLFLNSDAASYISGQV
VWVDGGNVGAAIARELEEGRTPWPV
118465443YP_880484.1 hypothetical protein MAV_1239 [Mycobacterium avium 104]MRTTVTIDDALLAEAAELTGVTESVALLRQGLQTLVRVESARRLAALGGT
DRKASVGPRRRTPADDSR
118465442YP_883840.1 phosphatidylserine decarboxylase [Mycobacterium avium 104]MARRPRTIGPSASDPGFSPQHALELVRSAIPPVHPAGRPFVGAGLALALA
GRRHRWLRRAGLLAAGACAGFFRHPPRVPPTRPGAIVAPADGEICVIDVA
TPPAELSMGDVALPRVSIFLSLLDAHVQRAPVSGEVIDVQHRPGRFGSAD
LAAASTENERTSLRIRTPGGAEVVAVQVAGLLARRIICDAHVGDKLSIGD
TYGLIRFGSRLDTYLPAGAQPLVTVGQRAIAGETVLAELP
118465441YP_883268.1 oxidoreductase [Mycobacterium avium 104]MTMAQAIWESIPADLYGRRKRDRMYTALYGVGALFGGLASASRWTPARVV
PVRRTTTAVVTQREELAPDVVAFTLADPHGGLLPSWTPGAHIDVRLPSGR
RRQYSLCGPPGRRTDYRIAVRRIEDGGGGSIEMHDTFRVGDALEFEGPRN
AFYLVTDERDVLFVIGGIGVTPILPMIQTAQQHGINWRAVYAGRSRDYMP
LLDEVVAVAPERVSVWADDERGRIPTAADLLAEAGPATAVYVCGPTAMLE
AVRTARDEHADAPLHYERFGPPPVVDGVPFELELARSRRVLTVPGNRSAL
DVMLDRDPATPYSCQQGFCGTCKVKVLAGQVDRRGRTVEGDDEMLVCVSR
AKNDRLVIDA
118465440YP_881002.1 GTP-binding protein LepA [Mycobacterium avium 104]MPQSGRADTLDTLANRRLAGPDQEIPISSFADKTFTAPAQIRNFCIIAHI
DHGKSTLADRMLQLTGVVDERSMRAQYLDRMDIERERGITIKAQNVRLPW
QVSGGEDAGKEFVLHLIDTPGHVDFTYEVSRALEACEGAVLLVDAAQGIE
AQTLANLYLALDRDLTIIPVLNKIDLPAADPDRYAGELAHIIGCEPDDVL
RVSGKTGEGVARLLDEVVRQVPPPQGQADAPLRAMIFDSVYDIYRGVVTY
VRVVDGKITPRERIAMMSTGATHELLEVGIVSPEPKASDGLGVGEVGYLI
TGVKDVRQSKVGDTVTSARHGAQEALTGYREPKPMVYSGLYPVDGSDYPD
LRDALDRLRLNDAALTYEPETSVALGFGFRCGFLGLLHMEITRERLEREF
DLDLISTSPNVVYRVIKEDGTEIVVTNPSDWPEGKVRTVYEPVVKTTIIA
PSEFIGTIMELCQSRRGELGGMDYLSPERVELRYTMPLGEIIFDFFDSLK
SRTRGYASLDYEEAGEQEAQLVKVDILLQGEAVDAFSAIVHKDAAFAYGN
KMTTKLKELIPRQQFEVPVQAAIGSKIIARENIRAIRKDVLSKCYGGDIT
RKRKLLEKQKEGKKRMKTIGRVDVPQEAFVAALSADAAGDKSKK
118465439YP_882100.1 PPE family protein [Mycobacterium avium 104]MIDFAALPPEINSARIYAGPGSAPMMSAAAAWNTMAAEMRSAAASYGAVI
SELTSADWFGPSSMSMLAAVTPYLTWLTDTATRAEEAAAQANSAATAYEA
AFAMTVPPAVVAANRAQLATLVATNVFGQNTPAIAATEAEYGQMWAQDAA
AMNGYAVASTAATRLTPMTAPRSNTSPEGVAAQATSVTNAAQAPAGTVQS
TVSSSGLAGLLSGSDNSAFGTFTNGNFFSTAVVNGSLAGGPFNPQFIISS
VQGVLAAQHATTLGGLGDFAADAEGAATADLAASTGGSAPVAAGMGRAQL
VGSLSVPQGWANAATINPGQAAVPATGVTGLTDAASAAGGPGGVAGPVGG
TGRRLRRAIPKYGFRPVVMPRPPAAG
118465438YP_880897.1 ATP-binding protein [Mycobacterium avium 104]MSTDSAATPATRIADGYAVAGQALELGTVVIDGAADPSAQIRIPLATVNR
HGLVAGATGTGKTKTLQLIAEQLSAAGVPVLMADVKGDLSGLSRPGQGDD
RTAARAKDTGDDWQATAFPVEFLSLGTNGIGVPIRATVESFGPVLLSKVL
GLNATQESTLGLIFHWAKERNWPLVTTDNLRGAISHLTSDEGKEDLKSLG
GVSATTAGVILRALVNLDAEGGDTFFGEPKLDPNDLLRTNDQGQGVISLL
EFTGQSVRPVIFSTFLMWLLADLYTQLPEVGDIDKPKLVFFFDEAHLLFA
DASKAFLEQVEQTVKLIRSKGVGVFFCTQLPTDIPNDVLSQLGARIQHAL
RAFTPDDQKALSKTVRTYPKTDVYDLESALTSLGIGEAVVTVLSEKGAPT
PVAWTRMRVPRSLMASIGTEEITKAAKRSELQAKYGQTVQQPAQPPPGPQ
APTGSRSPQAQSDYPPVPPNGPVPPMPEPAEPKGPGLLERLWHDRDVQSA
VNTGIREIIRLKFGGGGRRRK
118465437YP_881476.1 hypothetical protein MAV_2272 [Mycobacterium avium 104]MARAGQKAVIAIAGSSGLIGSALAAALRADDHRVLRIVRRAPANGDELSW
NPESGDLDPDALRGVDAVVNLCGVNIGKRRWSGAFKQSLRDSRITPTEVL
AHAVADAGVATLVNASAVGFYGNTKDRVVDENDRAGTGFLAQLCQDWEAA
TLPAQYGGARVVLARTGLVFSPAGGALGRLRPLFRTGLGARLGSGRQYMS
WITLEDEVRALLFAIFEPALSGPVNMTGPAPVTNAEFTTAFGRAVNRPTP
LMLPGFAVRAALGEFADEGLLTGQRAIPAALERTGFVFHHNTIGEALGYA
TARPAHD
118465436YP_880519.1 cytochrome P450 superfamily protein [Mycobacterium avium 104]MEQLFDDLEDFGAFDDAVSGDVRDPYTELARLRREEPIQRLDTSGMPHEE
SKPVFIVYRHEDAQQMLRDNETFSSAAVIAAFGPVLGERVMLGMDEPVHG
RLRSLVSKAFSQKALARWEDELVGRVGNSLIDRFAGNGKADLVKEFTFDY
PSRIIAGLLGLPEQDYPQFQRWSISLLSWILNPQRGLAASAALCDYFAPI
LAARRTEPKDDLISGLAQAEIDGEKLEDEEIYSFLRLLLPAGVETTYRAL
GSLLLALLSDPEQLDAIRGDRSLLPQAIEEGVRWEPPLLTITRVATRDTE
LGGVPIPAGSTVMPMLGAANRQEDRYPDPDRFDIFRAPKSHLGWGHGVHV
CLGMHLARLEMRTAVNLLLDRLPNLRLDPDADDPHIRGQVFRSPTSVPVL
FDPQ
118465435YP_880202.1 hypothetical protein MAV_0941 [Mycobacterium avium 104]MKVWVDSQRCQGHTLCSMIAPDSFQLSDIDGSSSAIDEVVPADREDQVRE
AAQSCPEQAIMITDDA
118465434YP_883027.1 MmpS4 protein [Mycobacterium avium 104]MKGFSIASLVKRGWMVLVVVVVVGVAGFCVYRLHGIFGSHNNTSAAGGIS
DQTEPFSPKHITLEVFGNPGAVATINYVDINVQPRQVLNAALPWSLTMVT
TQPGAFSNLVAQGNSDSLGCRITVDGDVKDERIVNQVNAYTFCLVKSA
118465433YP_881384.1 P450 heme-thiolate protein [Mycobacterium avium 104]MSLKTRPKKGLATRINGAPPPRVPLADIHLESLDFWGYDDDFRDGAFATL
RREAPISFWPAIEMDGFVAGNGYWALTKHEDVHFASRHPEIFSSVPNITI
NDQTPELAEYFGSMIVLDDPRHQRLRSIVSRAFTPKVVARIEASVRERAR
RLVSSLVANHPNGEAELVSELAGPLPLQVICDMMGIPEEDHQRVFHWTNV
ILGFGDPDLATDFEEFLQVSMDIGAYATALAEDRRVNHHDDLTTSLVEAE
VDGERLTSSEIASFFILLVVAGNETTRNAISHGVLALSRYPDERDKWFSD
FDRLTPTAVEEVVRWASPVVYMRRTLTRDVKLRGTKMKAGDKVALWYNSA
NRDESTFDNPWLFDVARTPNPHLGFGGGGAHFCLGANLARREIRVVFDEL
RHEIPDIVATEEPARLLSQFIHGIKRLPVAWTPPR
118465432YP_879881.1 acyl-CoA dehydrogenase [Mycobacterium avium 104]MQDVEEFRAEVRSWLADNLVGEFAALKGLGGPGREHEAFEERRAWNQHLA
KAGLTCLGWPVEHGGRGLSTAHRVAFYEEYARADAPDKVNHFGEELLGPT
LIAFGTPEQQQRFLPRILDVTELWCQGYSEPGAGSDLANVSTTAELDGDQ
WVINGQKVWTSLAHLSQWCFVVARTEKGSKRHAGLSYLLVPLDQPGVQIR
PIVQITGTAEFNEVFFDDARTDASMVVGQPGDGWRVAMGTLTFERGVSTL
GQQIRYARELSNLAELARRNGAADDPFIRERLTRAWTGLRAMRSYALATM
DVEQPGQDNVSKLLWANWHRALGELAMDVIGKPGMTMPDGEFDEWQRLFL
FTRADTIYGGSNEIQRNIIAERVLGLPREVKG
118465431YP_882802.1 hypothetical protein MAV_3625 [Mycobacterium avium 104]MRTYQVRTYGCQMNVHDSERLAGLLEAAGYRRAAEGAEVADVVVFNTCAV
RENADNKLYGNLSHLAPRKRSNPQMQIAVGGCLAQKDREAVLRRAPWVDV
VFGTHNIGSLPTLLERARHNKAAQVEIAEALQQFPSSLPSARESAYAAWV
SISVGCNNSCTFCIVPSLRGKEVDRSPDDILAEVRSLVADGVLEVTLLGQ
NVNAYGVSFADPALPRDRGAFARLLRACGEIDGLERVRFTSPHPAEFTDD
VIEAMAQTPNVCPALHMPLQSGSDRVLRAMRRSYRAERYLGIIDRVRAAM
PHAAITTDLIVGFPGETEEDFAATLDVVRRARFAAAFTFQYSKRPGTPAA
ELDGQIPKAVVQERYERLVELQESISLQGNQALVGQTVELLVATGEGRKD
SATARMSGRARDGRLVHFAADDRVRPGDLVTTVITGAAPHHLIADAGILS
HRRTRAGDAHAPAGARAASVSACPPSGRRRPGPTRWMCLMNDDRNHDDPR
LGALRTEIEAAERRVAGGIDPGARGFVVSILVFVLLGSFILPHTGDVRGW
DVLFGTHDAGAAAVALPSRVFGWLALVFGVGFSTLALVTRRWALAWIALA
GTAIAGAAGMLAIWSRQTVPAGHPGPGWGLIVAWITVLVLIYQWARVVWS
RTIVQLAAEEQRRRVAAQQQSTTLLDDLPKPEDPAAGT
118465430YP_880650.1 hypothetical protein MAV_1408 [Mycobacterium avium 104]MSDVLVSGASVAGTAAAFWLGRHGHSVTVVERHRGPRPGGQAIDVRGPAL
GVLERMGLLAAAAKRRTQIRGSSVVDRDGNELSRDTEAAISGPTGGPIEG
PDIELLRDDLVELLYGASQWTAEYLFDDTITALDDRGAAVRVSFERAAPR
DFDLVIGADGLHSNVRRLVFGPEDEFIERLGTHAAIFTVPNFLGLDYWQM
WHYGDSTMAGVYSARDNAEARAMLGFMDAELRLDYRDTEAQFAELERRMA
GEGWVRPQLLEYMRTAPDFYFDEMSQIKMDRWSRGRVALVGDAGYCCSPL
SGQGTSVALLGAYILAGELKAAGEDHEAGFANYHREFADYVQRNQWLVVD
NIPGGAPIPQEVFERIVASITLKDY
118465429YP_881508.1 NLP/P60 family protein [Mycobacterium avium 104]MAKLNELSRQAEQTTEAMHSAQLDLNEKLAAQRAAEKKHDDDQAAVDAAK
AHLASYQNAVNNLAAATYMGGRVDGMEAILTAGSPQGLIDKLAVQRLMAT
QMASQMKSYRIAGEQAAKAERESAKSAADAKSAAEQAAAVRASLQSKQSQ
LQVQIAVVKSQYMSLTADQRTALANPGPAVPAAATAPGAPAPEAAPPGTP
PGGPGPGEAPPPGGAPGMAPGGGGVGGGDRATVVQAALTQVGSPYVWGGA
APGGFDCSGLVMWAFQQAGISLPHSSQALAHGGQPVSLSDLQPGDVLTFY
SDASHAGIYIGDGMMIHSSTYGVPVRVVPMNSSGPIYDARRY
118465428YP_879865.1 TetR family transcriptional regulator [Mycobacterium avium 104]MAVLAESELGSEAQRERRKRILDATMAIASKGGYEAVQMRAVADRADVAV
GTLYRYFPSKVHLLVSALGREFSRIDAKTDRAALTGGTPFQRLNFMVGKL
NRAMQRNPLLTEAMTRAYVFADASAASEVDQVEKLIDSMFARAMADGEPT
EDQYHIARVISDVWLSNLLAWLTRRASATDVSKRLDLAVRLLLGEHG
118465427YP_883986.1 hypothetical protein MAV_4863 [Mycobacterium avium 104]MTSGTVMPIVRVAILADSRLTEMALPAELPLREILPAVQRLVVPAAANGD
SEDGAPSRGAAEVGGAVQLSLAPIGGAPFSLDASLDTVGVVDGDLLALQP
VPAGPAAPGIVEDIADAAMIFSTSRLRPWGTTHIQRFALATVIAVALLAT
GLSVSYRVATGALAGLVAVSAVAALTAIVGLLATARSPRNGMALSIAALV
PIGAALALAVPGRFGPAQVMLAAAGVTAWSLIALMAPSAERERLAGFFTA
TAVLGAAVLLAAGAELLWHITPVALGCGLIVAALLVTVEAAPLSALWARF
PLPVIPAPGDPTPSAPPLPVLEDLPRRVRIGDAHQSGFIAAAVLLSALGS
VAIALRPETLSAAGWYVVGATAATSVLRARVWDSAACKAWLLAQPYLAAG
VLLVLYTATGRYAGALGAVLVLLALVAVWIVVALNPGIAAPESYSLPVRR
LVGFVATGLDASLIPVMAFVVGLFGWVLDR
118465426YP_884279.1 molybdenum-binding protein [Mycobacterium avium 104]MRLSTRNQLRGTITEVELGTVMAVVKVTLDGGDQVVTSSVTRDAATDLGL
EVGKPATVFIKSTEVTIGVD
118465425YP_884357.1 hypothetical protein MAV_5243 [Mycobacterium avium 104]MTVTVVDRGPRQVSRRVDVAAPAAQLYALVADPRRHHELDGSGTVRDNIS
VPAKLVEGSKFSTHMRMFGLPYRITSTITELKPNEVVEWRHPLGHRWRWE
FESLSPTRTRVTETFDYRDAGALKNRLKYYERMGFAKANASGIEATLAKL
RDRYPG
118465424YP_884408.1 virulence factor mvin family protein [Mycobacterium avium 104]MNPAYRQAAPHHRRLPEPPRRPRMPGSPPTGPLPPVPAGIDRRRPELSDS
ALVSRSWAMAFATLVSRLTGFARVVLLAAILGAALSSAFSVANQLPNLVA
ALVLEATFTAIFVPVLARAEQSDPDGGAAFVRRLVTLTTALLIVATALSV
AAAPLLVRLMLGRTPQVNEPLTVAFAYLLLPQVLAYGLTSVFMAILNTRN
VFGPTAWAPVVNNVVALATLAVYALVPGELSVDPVRMGNAKLLVLAVGTT
LGVFAQTGVLLVALRRQHVDLRPLWGIDQRLKRFGTLAAAMVLYVLISQL
GLVVGNQIASTAAASGPAIYNYTWLVLMLPFGMIGVTVLTVVMPRLSRNA
AADDTRAVLADLSLATRLTLITLIPIVAFMTVGGPAMGSALFAYGHFGDV
DAGYLGAAIALSAFTLIPYGLVLLQLRVFYAREQPWTPIVIILVITAVKI
LGSVLAPHLTGDPKLVAGFLGLANGVGFLAGAVIGYVLLRRTLLPGGGHL
IGVGEVRTILVTLTAAMLAGLVAHVADRLLGLSALTAHGGGAGSLLRLLV
LALIMVPITAAVMLRAQVPEARAALDAVRFRITGRGPRPRKPAAPDRSSH
RRPVTYPEQRNSSPPGVNAVQEPIRRRPPERANRARLVKGPEVTDRPMES
AASSAGPGTGSGAPRPVADDFQPDIPADQPDRPRKADPRPADQKNGDAGT
RRGPFDVPRERAADSSADDVHLVPGARIAGGRYRLLVFHGGAPPLQFWQA
LDTALDRQVALTFVDPDRALPDEVLQEILSRTLRLSRIDKPGIARVLDVV
HTGSGGLVVSEWIRGGSLQEVADTAPSPVGAVRAMQSLAAAADAAHRAGV
ALSIDHPSRVRVSIEGDVVLAYPATMPDANPQDDIRGIGAALYALLVNRW
PLAESGVRSGLAPAERDSSGNPVEPMAIDRDIPFQISAVAVRAVQDDGGI
RSASTLLNLLQQATAVADRTEVLGPIDDSPSPSTALISPGNDPATFARRR
RNVLIGVGAGLAVLVAALLVLASIVSKIFGNVGGGLNKDELGLNGPSSST
SAPQTTTSAAAGSVVKPTRASVFSLDGDADNPGTAGQAIDGDPSTAWATE
VYTDAVPFPSFKQGEGLILQLPSPTVVGQVSIDTPSTGTKVEIRAASSPT
PAGLNDTTVLAPAFTLKPGHNVIPVRAGSPTSNLLVWISTLGTTNGKSQA
GFSEITVQAAS
118465423YP_881841.1 transcriptional regulator [Mycobacterium avium 104]MSEASIVRRASYGPSSPAVGARGANTRGRIAEVSLELFGRVGYFDTSVDA
IAKAAGVSRATLYQYFKGKDEIFLELLNECGSALFRVARRIGPLGPDEVG
FDNLNWWLGEWSWVFDKYSTMFVQWTAIASSDTKVRPEITRFVRGYNHRL
AERLAGSGLNGLDPEVAAMAMTALVHRINLFVHTDRAYGRSAKDAVDTLS
VFLQLMLFPDTPRSVLRSLSLHASTDPAADIDALKAPPAPDIAGLSISER
TTSLSKRAVTTVNALADAGAAQFRARGYRSTSVDDIVEAANVARGTFYKY
FSDKQDLLAAVAAEIYGAGTAFAHRIADVDPVAKKSTLRHWLRTYVEFYD
RYSGCIEAWVEGATDDPTIVSIGENGQVQMDIGAARMLIRGPGRYPFDPV
VSALILRALVTRVPQAALDLPEPIDADELVDVLMTCINRGFFGRAK
118465422YP_884331.1 hypothetical protein MAV_5215 [Mycobacterium avium 104]MSQPDALPMSWWVVGSEHTLSQQVPAPPAAVRDFYVDLDNLRLVHPLIVA
VQTLFRGQTPDGYLHRYRVTDRIPLGPLALRINYRAQVLVRADGVVLTEA
DQSPGVRLRGTVSFAPAAAGTRITERIRIAAPRPLAPMTVRQAVKAHTAM
LAGIRSHFANPVER
118465421YP_883009.1 sugar transporter family protein [Mycobacterium avium 104]MAGRRPQAPMTGNGTRPTPKYPGGMQAWGMQTDPVATPDVGAGTRWSIMV
VSLLATASSFLFINGVAFLIPSLQGARGIRLDEAGLLASMPSWGMVVTLV
AWGYVLDRVGERVVMTTGSALTALAAYAASSAHSMVLIAVYLFLGGMAAA
SCNTAGGRLVSAWFPPHQRGLAMGIRQTAQPLGIALGAMVIPELAEHGPQ
AGLRFTALACVFGAVASVIGIVDPPRKPRASASDQELASPYRGSLTLWRI
HAVAGLMMMPQTVTVTFMLVWLIRNLHWSVAAAGALVTLSQLLGALGRVA
VGRWSDRLGSRMRPVRYIAAAAVLVLLLLAWADYLNSRWQAGLMVAISVI
AVLDNGLEATAITEFAGPYWSGRALGIQNTTQRMMAAAGPPLFGALISAA
KYPPAWLLCALFPLAAMPLVPTRLLPPGLETRARRQSVRRLRWWRAVRSH
ALPDIVRRPGQPG
118465420YP_882678.1 oxidoreductase- 2-nitropropane dioxygenase [Mycobacterium avium 104]MLSTPWSAGFGLRVPIVNAPMGGVAGGRLAAAVTAAGGLGMVGMGSVATR
RLLAEQLQYVDGRFGIGLVDWVMRNEAGLLEDALAARPALLSVSFGTDWS
WVAKAHDAGIPTVTQVYDSLGARQAVDAGVDILVARGSEGGGHGEVKLGL
LPLLDAVLDAVSVPVLAGGGVASARSLAAVLAAGASGAWVGTRLSACPEA
LTADGNRRALVEAAETDTAVTRAFDVAKGLPWPARFPSRVLANDFVERWT
GREETLDAGACEELAAAIAAGDCRVAPVDAGQGVGMIRNDATVAEVIDEM
CSGAEQLLSRWGS
118465419YP_883053.1 methylesterase [Mycobacterium avium 104]MNIRAQLRHLRPSVRAKDWPLQVIPRTPWADQRPTFREAQPAVIDAALQR
CRRQPTGNWYAFAASTHVERGRPLGARVAGVDLVAWRDARGALCVGPRSC
PHLGADLATGTVCGGTLICRWHGLPLDGRAREFGWAPVPSHDDGTLAWVR
LDAVGGETPSPRPVIPPRPAGHTLASVAHLVGVCEPADIIANRLDPWHGA
WFHPYSFTRLEVLATPTEEADRFLVAVTFRMGRLGVPVVAEFDCPEARTI
VMRIVDGEGTGSVVETHATPIGSGPDGRPRTAVLEAVIAHSDRPGFARAL
WAAPLLTPVMRYAAGRLWRDDLAYAERRYEVRSQNH
118465418YP_879618.1 hypothetical protein MAV_0331 [Mycobacterium avium 104]MQLTNLSEAELIASAGGDPWAINQSLQAGSPFQISQLAQAFHTAGRCTAE
ADHAFEDARKRFDAAWNHQNGDHPINDSDEVQRVTKSLGAQSLQLPKIGA
DLEGIAASLAEAQKAGAQEIAELERELRGLDNITGAINHDLTLDLSASER
SELESLKKAVHADAVDDVRDALKQMNSIRNGYSETLRKSMDSLHTEGYDP
PTTVDTWMESPLKPGEVRDLGPVAGTGGVPGIPGIGAADLGEVVEIPGQP
GKYLAIFGDSFSGNKMGEGEHYRSVAVPVTFDAEGHPHFGAPLTGPEGSG
HELFPIPSDAKGVTDTLPSGTITLGDKTYMMVTGTKDDLKPVASWLVEVN
GDPGKGWTMVPGSFRGAGDAPTQVSGYKGSDGKVYIAADSFDRSRGITMY
RADPANVFERDKWQPWTGKDWGNPRDQAVQVTNDRYGELSFREIGGRPVL
SGFNVDAHKGSVEVRVGTSPTDMFGADVPTTLVVQNGDPGAPKFMPQPYG
GYILPGSTLDDLKLLGSQWNTAKDGNGVPIGTPYNTREFQLNPFH
118465417YP_879998.1 P450 monooxygenase [Mycobacterium avium 104]MTLAGTLSQIDFTDLDNFANGFPHHLFAVHRREAPVYWHEPTDNTPDGEG
FWSVASYAETLEVLKDPATYSSVTGGERPYGGTLLQDLAIAGQVLNMMDD
PRHSQIRRLVSSGLTPRMIRLVEDDLRARARRLLDAVVPGEPFDFLVDIA
AELPMQMICILLGVPESERHWLFQAIEPQFDFGGSRKAALSQLSEAEAGS
RMYEYGQQLIAAKRAEPTDDMLSVVANATLDDAAAPALSDLELYLFFSLL
FSAGAETTRNAVAGGLLALAEHPEQLRWLRDDLGALPRAVEEMVRWTSPS
PSKRRTATRDATLGGQSIKAGQKVQIWEGSANRDASVFDRADEFDVTRKP
NPHLGFGQGVHYCLGANLARLELRVLFEELLSRFGAVRVVRPVEWARSNR
HTGIRHLVVELREEQ
118465416YP_882322.1 hypothetical protein MAV_3138 [Mycobacterium avium 104]MLDPWAIAVLATALSAAWACRPSLWFDEGATISAAASRTLPELWRLLGHI
DAVHGAYYLLMHGWFALFPPTEFFSRLPSALAVGAAAAGVTVFTRQFAPR
RTAVCAGAVFALLPRMTWAGMEARPYAFVAAAAVWLTVLFVAAVRRGAPR
GWVGYALALMLAILLNLNMVLMVPVYGVMLPLLTARGARRSAALWWAGSS
AVAVGAMTPFLLFAHNQVWQVNWIYPVSWHYAFDIILRQYFDHSVALAVL
SAVLIVAAAVARLAGVPAPPGDLRRLLILCAAWMVIPTALVVVYSAVAEP
IYYPRYLIFTAPAMAIVLAVCIVTLARRPWPIAGAVLLCAVAALPNYLFV
QRWPYAKEGWDYSQVADLIGSHAAPGDCLLVDNTVPWRPGPIRALLATRP
AAFRSLIDVERGAYGPKVGTLWDGHVAIWLTTAKINKCSTIWTITNKDNS
LPDHQSGQSLPPGSAFGQAPAYRFPGYLGFHIVERWQFHYSQVVKSTR
118465415YP_880498.1 6-phosphogluconate dehydrogenase [Mycobacterium avium 104]MQLGMIGLGRMGANIVRRVVKGGHECVVYDHNPDAVKAMAGEEKTTAVSS
LQELAAKLSAPRVVWVMVPAGTITTGVIEELATTLEPGDIVIDGGNSYYR
DDIRHSKTLSEKGIRLLDCGTSGGVWGRERGYCLMIGGDEEAFAHAEPIF
ATVAPGVDAAPRTPGRDGEVTRSEQGYLHCGPSGAGHFVKMVHNGIEYGM
MASLAEGLNVLRNADIGKHVQEGDAETAPLSNPEFYQYDFDIPEVAEVWR
RGSVIGSWLLDLTAIALHESPELKEFSGRVSDSGEGRWTSIAAIDEGVPT
PVLTTALQSRFASRHLDDFANKTLSAMRKQFGGHAEKPAN
118465414YP_882594.1 peptidase- M24 family protein [Mycobacterium avium 104]MTHSQRRDRLRARLEADGLDALLVTDLINVRYLSGFTGSNGALLVFADDR
PPVLATDGRYRTQAAEQAPDLDVAIERALGRYLAGRAAEAGARTLGFESN
VVTVDGFDALTGELDGRKAATELVKAAGTVEALREVKDAGEVALLRLACE
AADAALTALVDGGGLRPGRTEREVSRELEALMLDHGADGISFETIVATGA
NSAIPHHRPTDAVLADGDFVKIDFGALVGGYHSDMTRTFVLTKAADWQLE
IYRLVADAQRAGREALRAGADLREVDAAARRVIADAGYGEQFSHSLGHGV
GLEIHEAPGIGATSTGTLRAESVVTVEPGVYLPGRGGVRIEDTLVVPPET
AGKPPELLTRFPKELAVLA
118465413YP_880804.1 carveol dehydrogenase [Mycobacterium avium 104]MAGKLEGRVAFITGAARGQGRAHAVRMAAEGADIIAVDIAGKLPSCVPYD
PASPEDLSETVRLVEAANRRIVAAVVDTRDFDGLRKVVDDGVAALGRLDI
IVANAGVAAPQAWDDITPEDFRDVMDINVTGTWNTVMAGAPRIIEGGRGG
SIILISSAAGMKMQPFMIHYTASKHAVTGLARAFAAELGKHSIRVNSVHP
GPVNTPMGSGDMVTAVGQAMETNPQLSHVLTPFLPDWVAEPEDIADTVCW
LASDESRKVTAAQIPVDQGSTQY
118465412YP_883523.1 hypothetical protein MAV_4388 [Mycobacterium avium 104]MSTDFDLMRSVAGTTDARNEEIRAMLQAFIGRMSGVPPAAWGGLAAARFK
EVIDRWNAESVRLYHALHAIAETIRHNAGTLQEAGQNHADHIAAAGGSL
118465411YP_881299.1 AsnC family transcriptional regulator [Mycobacterium avium 104]MDRLDDTDERILAELTEQARVTFAEIGDKVNLSAPAVKRRVDRMLDSGVI
KGFTTVVDRNALGWNTEAYVQVFCHGRIAPDELRTAWVDIPEVFSAATVT
GTPDAILHVLARDMRHLEVALERIRSSADVERSESIVVLSNLIDRMRP
118465410YP_879915.1 hypothetical protein MAV_0635 [Mycobacterium avium 104]MHPAHEAGRRSREAVTARDKDAWLAVFADDAVVEDPIGPSVFDPEGKGHR
GRAAISAFWDKAIAPTTKIEFVFRDTYQCGNEEANVGHILITTGDYQTTA
EGVFTYKADDEGKLVALRAYWEMDRAAANTKKISG
118465409YP_884009.1 acyl-CoA dehydrogenase [Mycobacterium avium 104]MIRGELRTVPAAAQASLLVLPVAIDSGEAWVMLRAEQLEIEPVKSIDPLR
PIADVRANAVEVGDDVVLAKLSMATAHALMTTLLSAEAIGVARWATDTAS
QYAKIREQFGRPIGQFQAIKHKCAEMIADTERATAAVWDAARALDEAREK
DWDTAGSHVEFAAAVAATLAPAAAQRCAQDCIQVHGGIGFTWEHDTNVYY
RRALMLAASFGRSSDYPQQVVDTATSTGMRAVDIDLDPDTEKLRAEIRAE
VAAFKAMDREQRKVALAEGGWVLPYLPKPWGRGAGPVEQIIIAQEFAAGR
VKRPQTGIATWIIPSIVAYGTDEQKQRFLPPTLRGEMIWCQLFSEPGAGS
DLAGLSTKATRTDGGWRITGQKIWTTAAQFAQWGALLARTDPNAPKHNGI
TYFLLDMSSDGVDVKPLRELTGNAMFNTVYIDDVFVPDECVLGEVNRGWE
VSRNTLTAERVSIGSSEANFLATLAQFVEFVRDGQFDQVARHRAGQLIAE
GHAAKVLNLRSTLLTLAGGDAMPSAAISKLLSMRTGQGYAEFAVSSFGTD
AAIGDTDQLPGKWGEYLLASRATTIYGGTSEVQLNIIAERLLGLPRDP
118465408YP_880794.1 hypothetical protein MAV_1559 [Mycobacterium avium 104]MTTPETPGAPVPAVPVDKIRTALLGYRIMAWTTGLWLIALCYEIVSHLVM
HHEIRWIEVVHGWVYFVYVLTAFNLAVKVRWPIGKTIGVLLSGTIPLLGI
IVEHFQTRDVKARFGV
118465407YP_882287.1 hypothetical protein MAV_3103 [Mycobacterium avium 104]MTVNSNDETVPCAEPLGSDVVEGDGDLSAVERVLGLGEPQRVGRFRFFLD
GHRWEWSDAVARMHGYRPGQVQPSTELLLQHKHPDDRERVAAVLDQVMRG
KPFSSRHRIVDTAGRTHWVVVAGDRMLDDSGALAGTSGFYVDVTDSLHSD
ITNVLSAVADSRARIEQAKGVLMAAYGISAERAFDILVWRSQETNLKLRD
VAGRFLDAVASKASPGMQRQVDHALLTLE
118465406YP_882882.1 cob(I)yrinic acid a-c-diamide adenosyltransferase [Mycobacterium aviumMPQGVPLQVPDDGLTTRARRHTPVLAVHTGAGKGKSTAAFGMALRAWNAG
LSVAVFQFVKSAKWKVGEEAAFAALGRLHEEQRIGAPVEWHKMGAGWSWT
RKAGSDDDHAAAAADGWAEIARRLAAARHDFYVLDEFTYPLKWGWVDVDE
VVSVLAGRPGHQHVVITGRDAPQRLIDAADLVTEMANVKHPMDAGRKGQK
GIEW
118465405YP_883157.1 hypothetical protein MAV_4004 [Mycobacterium avium 104]MKFTLNILEKRGNDDDTEAEHRWPQYVFGGRMRTSTFVLIVAFLLVWWVY
DTYRPEPAPKPPAQQVVPPGFVPDPNYTWVPRSRLQQPPATVTYTPTPTS
TPPPPPPPPPVTTTTTTTTTPPFQLPKLPCILPAPFCPPSTTPSTPAPEQ
PQPGPGPTPTSPPPAS
118465404YP_879665.1 hypothetical protein MAV_0378 [Mycobacterium avium 104]MGRKVAIPWHASFSIAAGVLYFFFVLPRWPELMGDTTHSLGTALRIVAGV
LAALAALPVVFTLLRTRKPELGTPQLALSLRVASIVAHVLAGLLIIGTAV
SEIWLSLDAAGRWLFGIYGAAAAIALLGIFAFYLSFVAELPPPPPKPIKA
KKPKKRRLRRKKAGEEVETAETAEAEEAEAEEADETEAAQTVTAETEAAE
AAGETEAAEDTAEAEKPAANEPEAETLVAEDSDESRAKLRNRRPTGKGTH
RMRRRRTRAGVAVDQTAEQSGDDADED
118465403YP_879691.1 glycerol kinase [Mycobacterium avium 104]MAEFAEFIAAIDQGTTSTRCMIFDHQGAEVARHQLEHEQILPRAGWVEHD
PIEIWERTSSVLTSVLNRANLSAENLAALGITNQRETTLVWNRKTGRPYY
NAIVWQDTRTDRIASALDRDGRGQVIRRKAGLPPATYFSGAKLQWILDNV
DGVREAAERGDALFGTADSWVLWQLTGGPRGGVHATDVTNASRTMLMDLE
TLDWDDELLSFFTIPRAMLPEIGPSSSPRPFGVTSDTGPAGGRIPITAVL
GDQHAAMVGQVCLAEGEAKNTYGTGNFLLLNTGESIVRSEHGLLTTVCYQ
FGDAKPVYALEGSIAVTGAAVQWLRDQLGIISGAAQSESLARQVDDNGGV
YFVPAFSGLFAPYWRSDARGAIVGLSRFDTNAHLARATLEAICYQSRDVV
DAMAADSGVRLEVLKVDGGITGNDLCMQIQADVLGVDVVRPVVAETTALG
AAYAAGLAVGFWADPGELRANWREDKRWTPAWSDEQRAAGYAGWRKAVQR
TLDWADVT
118465402YP_879814.1 PE family protein [Mycobacterium avium 104]MSFLMVRPEILDAAARELHGINAAVLQSNSAAVTPTTALAPAAADVVSLV
TAARFSRHGLAFQEVSAQAAQLRDQFATTLGISAGSYAAAEIANTAAVG
118465401YP_880546.1 hydrolase- NUDIX family protein [Mycobacterium avium 104]MRADGIPSLAMPTQIVVAGALIRGSRLLVAQRARPPELAGRWELPGGKVA
PGETERDALARELAEELGLRVGDIAVGDRLGGDIAVDGGMTLRAYRVRLL
RGRPDARDHRALRWITAAQLHDLDWVPADRGWLGDLARVL
118465400YP_880494.1 hypothetical protein MAV_1249 [Mycobacterium avium 104]MLTLNQALEETRTGDLWLFRGGSGPDRAIQTLTNSPVNHVGMTVAIDDLP
PLIWHAELGDKLVDLWTGTNHRGVQLNDLHQSVLQWTQRYRQRCWLRQLT
PPATREQENRLLRVIARMDGTAFPTTMRLTGRWLRGRLPTAYDWARGIPV
VDKKIRETTRRRKERQRLGLEAAYCAETVAITYEEMGLLTTEKYSNWFDP
GSFWSGDKLPLTPGYALGDEIEIAVDR
118465399YP_883852.1 peptide deformylase [Mycobacterium avium 104]MPVGDDGSLPADLVKLIADMYDTMDAAHGVGLAANQIGVGLRVFVYDCAD
DRGLTERRRGVVVNPVLETSEIPETMPDPDTDDEGCLSVPGESFPTGRAS
WARVTGLDADGSPVSIEGHGLFARMLQHETGHLDGFLYLDRLIGRYARSA
KRAVKSHNWGVPGLSWMPGEGPDPFGH
118465398YP_883973.1 hypothetical protein MAV_4850 [Mycobacterium avium 104]MAQSPYARLSRSELAVLVPELLLIGQMMDRSGMAWCISSFGRDEMVQIAI
EEWAGASPIYTRRMQRALGYEGDDVITIFKGLQLDIGAPPQFMDFRYTVH
DRWHGEFQLDHCGALLDVEPMGPDYVFGMCHTIEDPTFDATAVATNPRAQ
VRPIHRPPREPADRHPHCAWTVIIDESYPEAQPIPALHIVRQTRAAGWEL
DPIDASDEGMADYSGPLLSDLDFGAFSHSALVRIADEVCLQMHLLYLSFS
IAVRKRAADDAEAVSVCTRGLTGVAGLAAERIQRAVGSGGGIDAVLRVLE
LHPLLNPAGYVVSEIAGNRLLVHRSPAHDDAAWISLCSPGSVQPLQAIAT
AVNPRIGMRVSGTDTDWTAEFVETDTDADELPEVSVTKVSGGSTFQFEPR
RSLPLTVV
118465397YP_882768.1 hypothetical protein MAV_3591 [Mycobacterium avium 104]MPTDYDAPRRTETDDVSEDSLEELKARRNEAASSVVDVDESESAESFELP
GADLSGEELSVRVIPKQADEFTCSSCFLVQHRSRLASEKNGVMICTDCAA
118465396YP_879769.1 dienelactone hydrolase [Mycobacterium avium 104]MTDIDLTDLAAAHAGSQPLRGYLATPSGTGPWPGVVLIHEVFGIDDVMRR
HTDRLAGLGYLTLAVDLFSAGGAARCLISTMTAMIRGRGRAFADIAAARD
YLAGSADCTGKVGVIGFCMGGGFALLTANTGYDAAAVNYGQLPRHLDTAL
AGACPIVGSYGGRDPSLRGATRKLNEALTKAGIEHDVKEYPAASHAFLND
DEAGPRILRPLLRVAGIGPEPDSAQDAWNRIAAFFATHLH
118465395YP_882844.1 hypothetical protein MAV_3667 [Mycobacterium avium 104]MAPPVGAPAGDPGPAGLPGHSSILSAGTYPPAEFHRGYFDLAAGRPNIRT
RGRAAQMGGHDG
118465394YP_883502.1 DNA-binding/iron metalloprotein/AP endonuclease [Mycobacterium avium 1MTTILAIETSCDETGVGIARLDADGAVTLLADEVASSVDEHVRFGGVVPE
IASRAHLEALGPTMRRALSAAGVTKPDVVAATIGPGLAGALLVGVAAAKA
YSAAWGVPFYAVNHLGGHLAADVYQHGPLPECVALLVSGGHTHLLQVRSL
GDPIVELGSTVDDAAGEAYDKVARLLGLGYPGGRVLDELARTGDREAIVF
PRGMTGPRDAPYAFSFSGLKTAVARYLESHPDAVNADVAAGFQEAVADVL
TRKAVRAATDLGVTTLLIAGGVAANSRLRELAEQRCAAAGLTLRIPRPGL
CTDNGAMIASFAAHLVAAGAPPSPLDVPTDPGLPVVKAQVS
118465393YP_880393.1 polysaccharide deacetylase [Mycobacterium avium 104]MRAIATRATVKNAAAGLLCAAGLDALARRRHRDALAILMFHGVEDRPPSP
PCWHVSGAALFRRQLRYVRAHFNVLALEDALDRLAGGTLPPRALAITFDD
GTRNLATHAMPVLRELELPAAVFLATGPIGTDRTLWPDRLWLAIARSPAR
EIDLTPWGLGTRPLKSNIERGAAYAVVVEKLKNLPDPQRIAALDEILCAL
GHHDDSDGGPFRMLSWEQARQLAAEPLVTLYPHTVTHPILARCDDAKLHR
EITESCAVIERETGSPPTVFAYPNGRLQDFDERAKDVLRARGVRWALSTA
PGFADRSCDPLALPRLAVGGDASLNYFKLLVSGGLPRR
118465392YP_881783.1 hypothetical protein MAV_2592 [Mycobacterium avium 104]MKVRLEQSKCVGHAQCYAVDPDLFPIDDSGYSILGEREVRPEDEQLTRDG
VAACPELALILEDG
118465391YP_882540.1 hypothetical protein MAV_3358 [Mycobacterium avium 104]MSEPINRGIVALGGGHGLYATLSAARRLTPYVTAVVTVADDGGSSGRLRS
ELGVVPPGDLRMALAALASDSPHGRLWATILQHRFGGSGALAGHPIGNLM
LAGLSEVLADPVAALDELGRILGVKGRVLPMCPIALQIEADVSGLEADPR
MFRVIRGQVAIATTPGKVRRVRLLPDNPPATRQAVDAIMAADLVVLGPGS
WFTSVIPHVMVPGLAAALRATTARRALVLNLVAEPGETAGFSVERHLHVL
AQHAPGFTVHDIIIDAGRVPSEREREQLRRTATLLSAEVHFADVARPGTP
LHDPGKLAAALDGVRAARKAPGASPVTATADIRVDGASPPAGGNGPAGSG
PRGDDAWR
118465390YP_880837.1 Rieske (2Fe-2S) domain-containing protein [Mycobacterium avium 104]MKVPFTWKVTGWFMVGWSPEFPIGEVRPLHYFGEDLVAYRDESGELHILE
AHCKHLGAHLGHGGTVVGDCVQCPFHGWRWGPDGTNRYIPYQPDRPNRGL
RLKVYPVREQYDCVFVWHQPHGKEPQWEMPDIFGKFPQFETDPAAYYRAY
PEFSRRAEREPVHPQIVAENAPDSAHFEYVHHATVTPRVLDWKIVEQEWQ
FVAGWPDANSDDPEALALRFHSHLFGLGGAISVFEGAQNHRLIFTCTPVD
DECSDLFYSIWWPRLPGDTADVPEGKLREVIEKQFLSTVFDDLQIWRYQK
YVEHPPLSKVDAKGYMALRKWATQFYELPPAGTSSPA
118465389YP_884209.1 TetR family protein transcriptional regulator- putative [MycobacteriumMRRHVQEMLDKTPVGTAPMDRIMVAVDAHLRHELELSDYATASIRNSGQI
PERLRARQLKEEAAYGRIWHKLLTDAVADGVINPELDVRLARLLVLGSLN
WAAEWWNPRRGSIDAVVANAQLLIRQGLSAPKAPSPRKRVAKSTTRTK
118465388YP_882865.1 hypothetical protein MAV_3688 [Mycobacterium avium 104]MCRNITELRGLQPAATAEEIAAAARQYVRKVSGITGPSAANADVFEAAVA
EVTEATTRLLAALPPRRQPPKTVPPLRRPEVIARLAGAK
118465387YP_881986.1 MFS transporter- sialate:H+ symporter (SHS) family protein [MycobacterMSGELTPAPRPAERVAPTARVGHDADVTKPSPGRKLTADQRNSFIAALLG
WTMDAFDYFIVVLVYADIAKTFHHSKAEVAFVTTATLIMRPVGALVFGLW
ADRVGRRLPLMVDVMFYSVVGFLCAFAPNFTVLVILRLLYGIGMGGEWGL
GAALAMEKVPVERRGFFSGLLQEGYAFGYLLASVASLVVMDWLELSWRWL
FGLSIVPALISLIIRYRVEESEVWEAAQDQLRLTSTRIRDVLRNGAIIRR
FVYLVLLMTAFNWMSHGTQDVYPTFLGAHANHGAGLSSTTVKWIVVVYNV
GAIIGGLVFGTLSQRFSRRYTVVFCAMLALPIVPLFAYSRTAAMLCLGSF
LMQLFVQGAWGVIPAHLTEMSPDAIRGLYPGVTYQLGNLLAAFNLPIQER
LAETHGYPFALAATIVPVLITVAVLTLIGKDATGIRFATSESAFLPTEMT
118465386YP_883988.1 low molecular weight protein antigen 7 Cfp7 [Mycobacterium avium 104]MMSQIMYNYPAMLSHAADMSGYAGTMQGLGADIASEQATLSNAWQGDTGM
TYQVWQAQWNEAMESLVRAYQSMASTHEANTMSMLARDQAEAAKWGG
118465385YP_882472.1 secreted protein [Mycobacterium avium 104]MQGAVAGLVLLAVLVIFAIVVVAKSVALIPQAEAAVIERLGRYSRTVSGQ
LTLLVPFIDRIRARVDLRERVVSFPPQPVITEDNLTLNIDTVVYFQVTVP
QAAVYEISNYIVGVEQLTTTTLRNVVGGMTLEQTLTSRDQINGQLRGVLD
EATGRWGLRVARVELRSIDPPPSIQASMEKQMKADREKRAMILTAEGMRE
SAIKEAEGQKQAQILAAEGAKQAAILAAEADRQSRMLRAQGERAAAYLQA
QGQAKAIEKTFAAIKAGRPTPEMLAYQYLQTLPEMARGDANKVWVVPSDF
SAALQGFTKLLGTPGQDGVFRFQPSPVEDVPKHSAEDDADVADWFSTETD
PAIAQAVAKAEAIARQPADGPTGELTQ
118465384YP_881827.1 carveol dehydrogenase [Mycobacterium avium 104]MRMAEEGADIIAVDLAGPLPDSVRYPSATADDFAETVEMVKATGGRIMAT
AADIRDLDALRTAVDEGVEAYGRLDVIVANAGICVPAPWNEITPESFRDI
IDVNVTGTWNTVMAGAQRIIDGGRGGSIILISSYAGVKVQPYMVHYTASK
HAVTGMARAFAAELGKHDIRVNSVHPGPVNTPMGGGDMIAALFAAIETNP
TLNNMGTPFLPQWACEPEDVAAAVCWLASDESRYVTATRLSVDQGMAQF
118465383YP_883726.1 short chain dehydrogenase [Mycobacterium avium 104]MSKSPLRRFADQLVLATMRPPMAPQVLVNRPLIKPVELAGKRVLLTGASS
GIGEAAAEQFAREGARVVVVARRKDLLDALAEGITRAGGEAIAMPCDISD
LDAADALVADVQQQLGGVDILINNAGRSIRRPLAESLERWHDVERTMVLN
YYAPLRLIRGIAPGMIERGDGHIINVSTWGVLSEASPLFAVYNASKAALS
TVSRVVETEWGDKGVHSTTLYYPLVATPMIAPTKAYQGVPALTPEEAGRW
MITAARTRPVRIAPRMAIAAKALDTFGPRWVNAVMQRQTVQPNREAGA
118465382YP_883638.1 ABC transporter ATP-binding protein [Mycobacterium avium 104]MGVAIEVNGLTKSFGSSRIWEDVTLEIPAGEVSVLLGPSGTGKSVFLKSL
IGLLRPERGSVVIDGTDILQCSAKELYEIRTLFGVMFQDGALFGSMNLFD
NAAFPLREHTKKKESEIRDIVMEKLELVGLGGDEKKFPGEISGGMRKRAS
LARALVMDPQIILCDEPDSGLDPVRTAYLSQLILDINAQIDATVLIVTHN
INIARTVPDNMGMLFRRKLVMFGPREVLLTSDEPVVKQFLNGRRIGPIGM
SEEKDEATMAEEQAALEAGQHAGGVEEIEGVPPQIVASPGMPERKAVARR
QARVREILHTLPQKAQAAILDDLEGTHKYRAHEVGD
118465381YP_883402.1 hypothetical protein MAV_4261 [Mycobacterium avium 104]MHAAIRFAVLCAAGAVGFLLIAAVWVSTCPTGGVDTVACGPPQRTLLAFG
GPLIALAGGIWAFVRTYRVWKARGTWWGWHGAGWFLLTVMALMVAMGVAP
IAGPVLAL
118465380YP_884265.1 cell envelope-related function transcriptional attenuator [MycobacteriMGSAGTGHPRRWVLLKGRLVASVASAFVMAVTGVGWTGYHTALGRIIISH
ALPNGAMSLGDNQNILLMGLDSRLDQNGRPLPPEIYDALHAGDESSGGYN
ANVLIVVHLSDGDGPVTAVSIPRDDYAELPGCPGSVCAGKIKQAYGLAYQ
QSLNAQAAGNSGAGATDLAAREQTAREAGRKAEIGAVTDFLGISVDHFVE
VTLGAFFQIAKAVEPITVCLAGDTRDSYSGADFHQGVQRIDAAEAMAFVR
QRRDENDGSFTDFDRTRRQQAFLVSLVEAARSGGALSSVSGLRKLLQVAR
DNVAVDAGLDLMQFAARASQLAGRPLSLYTLPISGFGKDPNGSDINLVDL
PAIRRIVNERFMSDAPAALDAAVPGSQPPAAPAEPAVLDVVNATTHDGLA
AAVEEALAGRGFTRGSATTAPTQAEDSSIEYGPGAEAAARLLADQLHLPA
TAQSAVAPGTVRLTVGAAFPAADYLAHPGASGSGQVSTVSATGTGDHAPA
PTDLSQMTATSVPCVK
118465379YP_883874.1 thiamine-phosphate pyrophosphorylase [Mycobacterium avium 104]MHQRLATLAAARLYLCTDARRERGDLAEFADAALAGGVDVIQLRDKGSPG
EQRFGPLEARDELAACEILADAARRHGALFAVNDRADIARAAGADVLHLG
QGDLPLDVARAFVGPDVLLGLSSHDRDQMTAAAAGPADYFCVGPCWPTPT
KPGRAAPGLALVRAAAELRTGKPWFAIGGIDAQRLPEVLDAGARRVVVVR
AITAADDPAAAARRLSSALAAAR
118465378YP_883114.1 ABC transporter [Mycobacterium avium 104]MTAPGAARPQKRAGSLRPGELAQASVMGALCAAIAIIAVVLPHGGGLGLL
GSVPTGLLAYRYRIRVLITATVAAGVIGFLVVGLSGLAAIALCAYTGGLA
GIVKRHRRGTPTVLAVSLVAAGVVGAGMVIALTVLTRLRQLVFHAIGAAV
DGAASVVARVPPLHAAAVRLAEFFAAALQHWQWLVLGYALVAIVGASLVG
WWALSRVLERLRGIPDVHKLDAPARNGPTRPVPVRLDRVRLRYPHADRDA
LRAVSLDVQAGEHVAVTGANGAGKTTLMLVLAGREPTSGTIERPGSVGLG
ELGGTAVVMQHPESQVLGTRVADDVVWGLPPGTTTDVGRLLGEVGLAGLA
DRDTGSLSGGELQRLAVAAALAREPALLIADEVTSMVDRQGREQLLTVLS
GLTERHRTALVHITHYNDEAEYADRTINLGDTQGDTALIRTATAPAPTFP
AGRGAGRRCSNSPASGTNMPAARRGPEPRCTTSASPCTRATGC
118465377YP_881098.1 acyl-CoA dehydrogenase [Mycobacterium avium 104]MEYGMRPELAEFRAEVRAFVAEHAPAIPPRAGVRSAENDAEFKALQEWTG
RLFEAGYVGADWPVEFGGRGDFTPEHSIIVGEELARAQAPSAQSGSVLAS
HALIHYGTDEQRRRHLPEIRGGRELWCQLFSEPGAGSDLASLRTRAVRHG
DTYTIDGQKVWTTDGHWARYGYLLARTDPDAPKHKGISAFILDMSAPGVS
VRPLRELTGTSDFNEVFFDGVEVPADAMIGAPGQGWAIANATLAHERTNV
GGIVVKLRLAIDALIDLARRVTIDGGPAIDSDRVRDRIGQFSAEVEALSA
LTYANLTRWLRGRERMHDAAMGKLMFSEINLEMAAFAVELAGEAGVLVEG
DDNVLDGGRWQDEWLYARAYTIAGGSSEIMRNLIAERGLGLPRD
118465376YP_880172.1 TetR family transcriptional regulator [Mycobacterium avium 104]MPVARRYDTLLAKGEDRKQRILDVAQRLLTRNGWRNTTLAQIAGEAGVTP
AGLLHHFESKEQLLHAVLDARDLDDDTHADRTGDLFDQIAAVADRFYRAP
ELVGTFTVLLVENILPEAPLHDRMLARHRAATDIVADLIRRGQADGRYRA
DIDPAVKAVEILAFVHGMETTWLLDPSIPLPEVFKQYAETLARDFAPPKR
AETT
118465375YP_883796.1 ErfK/YbiS/YcfS/YnhG family protein [Mycobacterium avium 104]MTPSSAPRPFNRRVALATLGIGALAPGVLAACGGGTAKEAEKKEQPALRL
KYQPADAAQNVVPTAPVSVEVSDGWFQHVTLSNSSGKAVAGTFNSDRTVY
TTTEPLGYDQTYTWSGSAVGHDGKTVAVAGKFSTVSPSKKISGAFQLADG
QTVGIAAPIILQFDAPISDKAAVEKALTVTTNPPVEGSWAWLPDEAQGAR
AHWRTREYYPAGTTVNVQAKLYGLPFGDGAYGAEDISLNINIGRRQIVKA
EVSSHRIQVIRDEGVIMDFPCSYGEADKARNVTRNGIHVVSEKYADFYMS
NPAAGYSHVHERWAVRISNNGEFIHANPASAGAQGNTNVTNGCINLSTSD
AEQYYQSAIYGDPVEVTGSSIQLSYADGDIWDWAVDWDTWVAMSALPPPT
AHPPSTQIPVTAPVTPSNAPTLSGTPTTSTTTPASTGPATPGG
118465374YP_881934.1 hypothetical protein MAV_2745 [Mycobacterium avium 104]MLAACIGLAGAPLVAGCGAAPPATTAATASVTTSATKAVAAQDNPSSTTA
TPGRYGNPAAAARYWAAQSLEDNCGLVSVADVVGEITGTAPSERQMLDLA
ESTPSGTNPGPIYAPRNDPSHSGPNAGIELADLVVLLDHFGIKSEMVSAT
EPDRTGLPALEQYLAKNRKIIAFVNSSVILNADDQRTKADHFLVVTGIDT
DTQIVHLNDPGIDHADEQVGVATFMTAWETSDQSIVVTAAPI
118465373YP_882020.1 bacterioferritin [Mycobacterium avium 104]MQGDPEVLRLLNEQLTSELTAINQYFLHSKMQDNWGFTELAEHTRAESFD
EMRHAEAITDRILLLDGLPNYQRLFSLRIGQTLREQFEADLAIEYEVMDR
LKPAIILCREKQDSTTATLFEQIVADEEKHIDYLETQLELMDKLGVELYS
AQCVSRPPS
118465372YP_880845.1 TetR family transcriptional regulator [Mycobacterium avium 104]MLLGMSPVKPLRSRPTRGEVRDRILDAAAKVFAAEGFAGATIDAIGQAAG
FTKGAVYSNFESKDELFLALLDREFELRGQQIAIALDRSAGDTTAAAREV
SRSVLDSVRDHSDYYVLLVEYWLRAQRDPQLRERLIERRRAAADQALHIV
ESTDTVPGDRRLTDIAQLVVTLNLGVAMEEVLRPGTINPDLLAQLITALL
ESIPV
118465371YP_880401.1 peptidyl-tRNA hydrolase [Mycobacterium avium 104]MAEPLLVVGLGNPGDNYARTRHNVGFMVADLLAARMGSKFKAHKRSGAEI
VSGRLAGRSVVVAKPRCYMNESGRQVGPLAKFYSVPPGDIIVIHDDLDLD
FGRIRLKIGGGEGGHNGLRSVSNALGSKDFQRVRIGIGRPPGRKDPAAFV
LENFTSTERADVPTICEQAADATELLIELGLEPAQNRVHAW
118465370YP_879436.1 sulfonate binding protein [Mycobacterium avium 104]MRPRHLTALAVVAAVTAVSGCGSSSGTTTTKDLHLDYAYYNPLSLVIRDQ
QLLEKKGYHVTWVLSQGSNKANEGLRSKALDFGSTGGSPALLARANGTPI
KTVDVYARGEWTALVVAKNSPINAVADLKGKKVAVTKGTDPYFFLLQSLA
TAGLSPADIEIVNLQHADGKTALERGDVDAWSGLDPFMAETIQQQGSRII
YRNPDFNSGGVLNAREDFITAHPDSVQLVVDTYEEARKWAKTHPAELAAL
LASQAKVSQSVAQEELGRTALDIDPVPGDWLRAVLTRIEPLAVADGDIKS
DDAGRNALNTLIEPKYARQAR
118465369YP_879398.1 mce related protein [Mycobacterium avium 104]MANSLDFDGRGPTDHQLLALGATVLLIAGLITGGLLLKSTGRLNDYIRVV
AELTNVGDGLPARSDVKYHGLLVGAVDNVIPAAYGKPNYVHINLKPEYAQ
DIPSAVTARVVPSNVFAVSSVQLVDGAPGPSIRNGARIPEDLQLSTVIFQ
TTISKLRDILAATGRGREDHSVGILAAVAAATNNRRGPLLTAGAQLTRVL
DELNAIVATDPGPSTVSALLDATRGLQSTAPDLVDVLHDAVRPMQTLVEK
REQFRSLVTGSYHTFSVNRQAFDNHTDQLIEMTQNLTPVLGVFAMNSDKF
VPIFTRLNRLSDKFFQEVWDPELDTGNMRVNLALTPTYTYTRADCPRYGQ
LQGPSCFTAPTIAVRPDLPEVLLPQNYHPPTDLAPPPGTQIGPDGNLVAT
GPPLYNPDPSLADPNPPLPWWPWQIGPAPRVPGTADPDDAPPPPPPSPPP
SPAPPGPVAPAAYGGNVGPVGSQRERDQLGLITGQGRPASVATQLLLGPV
ARGSAVSLQPRPAPGGPK
118465368YP_879567.1 hypothetical protein MAV_0278 [Mycobacterium avium 104]MAPSGEHRPENLGQAAVHAAAVATGNSATTLRQQVKNLNAHASGKTITEQ
CELLTKQAGIAEKVSADLGIVAAALKIREDAARAWNRDAPKDSEIAAAKK
AVADAKKALMDASAASGDTSAASPKLEAAQKKLGELIRRRRDADKAYDAA
EKRADAKLKEISGQYAPHGGGRGHTADGTPETPAPSPGSPSPGAGSPSPG
TGKPSAGAPGKTASGTAKPSATPAATPSSTKPTETETKSGDDLSGLLTQL
ASQQQQQPQSAQQAQPTAQATPAAATPQQQPEKDKDTAQGKASPLDRILG
ADGILDTGDLATLGVGAPLTLGGGSSHATPAAAVTPSAPASAAPSSTGLS
ASATANAQPVTSGTSAQGLHTSTDVTGRSGEPRSAFSVGPETKTSGASGA
TGTSAAPAHAAGTRPMGAGGMPMMPMGGMGGPAGGAGSSKDKESTTLASG
SAESDLLHGRHTAAEAVPGGTIAQKDHPRRRGEDAA
118465367YP_881146.1 transposase- Mutator family protein [Mycobacterium avium 104]MLTVVHDQDSSNEDACGSRSLLDEIVRDGARQMLAAALAAEVAAYIDAHA
GEVDENGHRLVVRNGYHREREVLTAAGAVTVIAPRVNDKRIDADTAERRR
FSSAILPAWARKSPQMTEVLPLLYLHGLSTSDFGPALEQFLGSGAGLSAT
TITRLTAQWQDEAKAFGERDLSGTDYVYLWVDGIHLKVRLEQEKLCLLVM
IGVRSDGRKELVGLADGYRESTESWADLLRSCRRRGMTAPVLAVGDGALG
FWKAMREVFPATREQRCWFHKQANVLSCLPKSAHPGALAAMREIYNAEDI
DHAQVAIKAFEVDYGAKYPKAVAKIVDDADVLLEFYRYPAEHWIHLRTTN
PIESTFATVRLRTKVTKGPGSRAAGIAMAYKLIDAAQARWRAVNAPHLVA
LVRAGAVFHKGKLLERPVDITPPEPAESAETEVA
118465366YP_882175.1 arylsulfatase [Mycobacterium avium 104]MKRPNFLVIVADDLGFSDLGAFGGEIETPNLDRLAYAGIRLTDFHSAPAC
SPTRAMLLTGTDHHIAGIGTMLEVAAPQFHGAPGYEGYLNDRVVALPELL
RDAGYLTLMSGKWHLGATIETSPWARGFERSFALLPAGASHYGGSGARGF
SPVPTLYTEDDRFVSVGDDFYSSDSYTDTLLRYLDERAPDDDRPFFAYLP
FQAPHWPLQAPDESIAKYRGRYDEGPDVLRAERLAALKRLGLCPPDVTPH
PVVADGAPEWADMTDEERARSARTMEVYAGMVDRMDYNVGRVIDYLSRSG
ELDNTVVIFLSDNGAEGAIVEAMPLRGPQIAAQIEKHCDNSLDNLGRPTS
FIWYGPRWAQAATAPSRLHKAFTTQGGIRVPGFITWPGFARQGQIGTAFS
TVMDIAPTLLELAGTSHPGTAYRGREVAPMRGRSLVGYLSGAADTVHDAD
TETGWELFGRRAIRQGNWKALHLPAPYGPGSWQLYDLASDPGEVDDLAAA
RPDKLAELLALWDRYVEETGVILDPISVFDAEL
118465365YP_884240.1 cytochrome P450 [Mycobacterium avium 104]MDFAYDPFDAEVMANPLPYYRILRDHHPVYYMPQWDTFALSRFDDIWRVL
EVNNGTFVASEGTLPPASVLAQHNDGPVDDPPLHPLPFHAMFDADLYGEI
RRTHSRPFRPRAVTDLEGRIRTLANERLDELLARGSFDLTQEYGGVVVAT
IVCELLGIPTDLAPQVLAAVNAGSLAEPGVGVDTGQARPNYFEFLLPAVQ
RRRADPSGPPLEVVDGLLGYQLPDGSALDDLEVATQMLCIFIGGTETVPK
IVAQGLWELSRHPDQLAAVRADPQHNIPVAREEMIRYCAPAQWFARTVRK
PFDIHGQTLNPGQRVITLLASANRDEREYPDPDDFVWDRPIRRSLAFGRG
QHFCIGYHLARLEVAVLLQEWLRRVPDYAIRADAATRLPSSFQWGWNKIP
VEV
118465364YP_881037.1 acyl-CoA dehydrogenase [Mycobacterium avium 104]MSSFDALIAREPELAELRSAIRDFLRADRAEFGWMPAVDAWLGQWDEGFS
ARLGAAGFLGLTVPKRYGGHGLGHLHRYVVTEELIASGAPVAAHWTADRQ
VAPGLLSYGSEEQCERLLPKIVAGKLYSSIGMSEHGAGSDLAAVSTKAVR
AEGGWVLSGTKVWTSGAHRAHQVVVLARTSPPDPHNRHNGFSQFLVPCDA
KGVRVEPILLMSGAHHFNEVILDSVFVADGDVLGEVGNGWQQVTSELSFE
RSGPERILSTGPLLLAAIRALSNGPAPDERTATVVGDLLARLISLRQLSL
SVARTLTEGGDAANLAALVKDLGTRFEAESVEVVADLLEWSTPNPDLTAM
LTTAWLHKPMFTLRGGTNEVLRGVIARGMGLR
118465363YP_880212.1 virulence factor Mce [Mycobacterium avium 104]MSPRVPRNRLAALAAVVLVGLILAGTAVLVRNTFFGQKTITAYFTTATAI
YPNDEVRVSGVKVGNIKSIEPQGTQAKMTLKVDHDVPIPADAKAVIVASN
LVSARYVQLSPAYRDSGPVMPDGAVIPVERTAVPVEWDEVKTQLMRLATD
LGPKSGVSGTSVGRFIDSAANALDGNGDKLRQTLAQLSGVGRILANGSGN
IVDIIKNLQTFVGALRDSNVQIVQFNDRLATLTSVVNDSKSDLDAALTDL
STAVGEVQRFIAGTRNQTSEQIARLADVTQILVDHHMDLENILHVAPNAL
GNFFNDYNADTGTIVGGFGIMNFANPTFSGLMVPLPVPGCTAVGAIENIT
AVESGKLCSLFLGPGLRVLNFNNLPIPINIFLQKSVDPSKILYSEPRLAP
GGEGPKPGPPEIPPAVSAYTGLPGDPVGPPGAEPPARIPGAAMPLPPPPS
TPMPPPPPPEPGVSGMLLPAQGPQQ
118465362YP_882305.1 hypothetical protein MAV_3121 [Mycobacterium avium 104]MSRLARVQFTVGYAALLLAISCAILVLGPQAHDVIVQRASTNLHNLSHGH
LGTLLGSALVVDAGPLYFWLPFLTCLLALAELHLRTIRLVVAFLVGHIGA
TLLVAAALAASVEFGWLPVSITRASDVGMSYGALAVLGAMTAVIPARWRA
AWVGWWVAAGIASAIVGGDFTDAGHTVAVILGVLVSARFRQPIHWTPARY
LMLAASSGFGFLMLAHHWGTMAATPVFGLLGAAVAYAAAKAYTGRGLAVT
PLDGDDPLTGPQPAVAG
118465361YP_882239.1 GNAT family acetyltransferase [Mycobacterium avium 104]MTMTDPAEDHPSEAITLGLHDASPPEMVDAMAKDVELELGWGRLIFGQTF
ANSQELVEALRREGPGRRDICIYARESHVVVAEAPTELFIDPSHTYRLRF
TGKEKSLAPTPLGVTVRTLNDPIDADAMNRVYVRCGMVPAGVDVIWENHQ
HVPAVKYLLAVRDEDGAVVGTVTGVDHELLFNDPEHGSSLWTLAVDPAAG
LPGVGGALTRALAEHFRSAGRAYMDLSVAHDNAAAISLYEKLGFRRVPVL
AIKRKNAINEPLFSPPPETVDDLNPYARIIADEALRRGIWVEVLDAETGE
MRLTHGGRSVITRESLSEYTSAVAMCRCDDKRLTRRLVSEAGITVPRARL
ATFDEGDFAFLKEVGEVVVKPTRGEQGKGITVGVTAENGPDDLSAALARA
RAQYPDVLIEQRVPGDDLRLVVIDGRVVAAALRLPPEVIGTGEHSVRDLI
AAESRRRSAATGGESRIPLDELTEATVAEAGWKLDDVLPQGTRLRVRRTA
NLHQGGTIHDVTAQVNSELCRVAVTAAEAIGIPVTGIDLLVPDVTGADYA
FIEANERPGLANHEPQPTAAAFIDFLFPGHPGQPQAWTPEESRFARG
118465360YP_880631.1 ATPase [Mycobacterium avium 104]MFVTGDSIVYSASDLAAAARCEFALLRDFDAKLGRGPAVTVEDDLLIRTA
TLGAEHERRELARLRERFGDAVAVIGRPAYTPAALTAASEATRRAVADRA
PVIYQAAMFDGRFLGFADFLVRDGERYQVVDTKLARSEKVTALLQLAAYA
DALAAAGVPVAPEAELRLGDGTAVRHRVCDLVPVYRSARARLQRLLDEHR
AGGAAVRWDDENVTACFRCAVCVEQLRATDDVLLVAGMRVSQRDKLFDAG
ISTVAELAAHRGPVPELAAGVVAKLTAQAKLQVRERETGVPQVEIVDPQP
LALLPEPDPGDLFFDFEGDPLWTADGREWGLEYLFGVLEAGPSGRFRPLW
AHNRSEERKALTDFLALVANRRRRRPNMHIYHYAPYEKTALLRLAGRYGV
GEDQVDELLRSGTLVDLYPLVRRSIRVGADSFSLKALEPLYMGSRLRAGE
VTTAAGSITSYARYCELQADGRADEAVAVLKEIEDYNHYDCRSTQELRNW
LMLRAYESGVLPVGAQPVGDGNTVDDRDELVATLSAFTGAAGIDERTPQQ
TAVALLAAARGYHRREDKPFWWAHFDRLNFPIDEWADNTDVFVAEQASVC
VDWQTPARARKPQRRVRLRGELARGELRTEVFALYDPPAPPGMTDNPDRR
GAGRATVVEADDPALPTEVVVLERVTSDGKPFHQLPFALTPGPPIPTTAL
RDSIEATVAAVAAGLPRLPDSAVVDVLLRRAPRTRSGAALPRSADTVADI
ASALTDLDSSYLAVHGPPGTGKTHTAARVIVRLVAEHRWRVGVVAQSHAT
VENLLDCVIDAGLDPRRIAKKRYDRQAPRWQEIDGNAYAAFLADTPGCVI
GGTAWDFANANRIPPGSLDLLVIDEAGQFCLANTIAVAPAAANLLLLGDP
QQLPQVSQGTHPEPVDTSALDWLVDGQRTLPDERGYFLDRSYRMHPAVCA
AVSALSYEGRLHSDACTAARRLDGCPPGVRLLSVDHQGNSTESPEEADAI
AAAVTGLLGASWTDEHGTRALTASDVLVLAPYNAQVALLRRRLGSAGLDG
VRVGTVDKFQGGQAPVVFISMTASSVDVVPRGISFLLNRNRLNVAVSRAQ
YAAVIVRSPTLTEYLPGTPAGLIELGAFLALTQPDLR
118465359YP_883075.1 ribonucleotide-diphosphate reductase subunit beta [Mycobacterium aviumMSENMKLIDRLSAINWNRLQDDKDAEVWDRLTGNFWLPEKVPVSNDLQSW
ATLTAHEKQMTMRVFTGLTLLDTIQGTVGAVSLIPDALTPHEEAVYTNIA
FMESVHARSYSNIFSTLCSTAEIDDAFRWSEENPNLQRKAEIVMQYYKGD
EPLKRKVASTLLESFLFYSGFYLPMYWSSRAKLTNTADMIRLIIRDEAVH
GYYIGYKYQRGLALVDDAKRQELKDYTYELLFELYDNEVEYTQDLYDEVG
LTEDVKKFLRYNANKALMNLGYEALFPRDETDVNPAILSALSPNADENHD
FFSGSGSSYVIGKAVVTEDEDWDF
118465358YP_881860.1 short chain dehydrogenase [Mycobacterium avium 104]MLARSTIQAITTTLPNGTYIAPRGLMHQWGKPKPTTLRHKARDADSARRL
WDISAELTGCEWQDSHP
118465357YP_883508.1 glutamate decarboxylase [Mycobacterium avium 104]MPQHPSLPAHAIAPAYTGRLFTAPVPALRMPDESMDPDAAYRFIHDELML
DGSSRLNLATFVTTWMDPEAGRLMAETFDKNMIDKDEYPATAAIEQRCVC
MVADLFHAEGLNDADPYSACGVSTIGSSEAVMLGGLAMKWRWRAKTKDWK
KRTPNLVMGSNVQVVWEKFCRYFDVEPRYLPMEEGRYVITPEQVVDAVDE
DTIGVVAILGTTYTGELEPVADICGALDKLAARGGVDVPVHVDAASGGFV
VPFLHPELKWDFRLPRVVSINVSGHKYGLTYPGVGFVVWRSKEYLPDELV
FRVNYLGGDMPTFTLNFSRPGNQVVGQYYNFLRLGREGYTKVMQTLSGTA
RWLGEQLRVSEHCELISDGSAIPVVAFRLAKDRGYTEFDVSHELRTYGWQ
VPAYTMPDNATDVSVLRIVVREGLSADLARALHDDAVSALTSLDKVKPGG
HYDAQHFAH
118465356YP_880467.1 fumarate hydratase [Mycobacterium avium 104]MATDDGDTDYRIERDTMGEVRVPAKALWRAQTQRAVENFPISGRGLERTQ
IRALGLLKGACAQVNKDLGLLAPEKADAIIAAAAEIADGRHDDQFPIDVF
QTGSGTSSNMNTNEVIASIAAANGVTVHPNDDVNMSQSSNDTFPTATHIA
ATEAAVRHLIPALQVLHDALASKAREWHTVVKSGRTHLMDAVPVTLGQEF
SGYARQIEAGIERVRATLPRLGELAIGGTAVGTGLNAPDGFGAKVVETLI
ASTGLSELRTATNSFEAQAARDGLVEASGALRTIAVSLTKIANDIRWMGS
GPLTGLAEIALPDLQPGSSIMPGKVNPVIPEAVTQVAAQVIGNDAAVAVG
GLSGAFELNVYIPMMARNILESFKLLTNVSRLFAERCISGLSANVEHLRE
LAESSPSIVTPLNSAIGYEEAAAVAKQALKERKTIRQTVIDRGLIGDKLS
LEELDRRLDVLAMAKVKPQD
118465355YP_882735.1 hypothetical protein MAV_3557 [Mycobacterium avium