Antigen browsing page


The page has been created to visualized all the protein sequence their gene ID and protein ID from NCBI from selected strain. The strain can be selected from the option given in the form and then click submit to display all the proteins and their corresponding information available in our database. The output will be presented in a tabular format where Gene ID is linked to display an antigen card. If you click on gene ID of a proteins, the number of epitopes mapped and/or predicted will be displayed in result page.

Please select a strain:

Selected strain is M_avium_K-10
Gene IDProtein IDProtein DetailsSequence
161611210NP_959246.2 2-isopropylmalate synthase [Mycobacterium avium subsp. paratuberculosiMPVNRYRPFAEEVEPIRLPDRTWPDKVIDRAPLWCAVDLRDGNQALIDPM
SPARKRRMFDLLVRMGYKEIEVGFPSASQTDFDFVREIITEGAIPDDVTI
QVLTQCRPELIERTFAACQGAPQAIVHFYNSTSILQRRVVFRADRAAVQE
IAVAGARKCVEEAAKYPETQWRFEYSPESYTGTELEYAKQVCDAVGEIIR
PTTENPIIFNLPATVEMATPNVYADSIEWMSRNLARRDSVILSLHPHNDR
GTAVAAAELGYAAGADRIEGCLFGNGERTGNVCLVTLGLNLFSRGVDPQI
DFSNIDEIRRTVEYCNQLPVHERHPYGGDLVYTAFSGSHQDAINKGLDQM
KIDADAADTDVEDMLWQVPYLPIDPKDVGRTYEAVIRVNSQSGKGGVAYI
MKADHGLALPRRLQIEFSQVIQKISEGEGGEVSPKEMWDAFFEEYLAPVW
PLERVKQRVDASDEDSGVTSISATVKINGEQTEINGTGNGPLAAFVHALA
GVGFDVAVLDYSEHAMSSGDDAQAAAYVEASVNGRTVWGVGIAPSITTAS
LRAVVSAVNRAARA
161611209NP_959464.2 3-ketosteroid-delta-1-dehydrogenase [Mycobacterium avium subsp. paratuMSAQEYDVVVVGSGGAGMVAALTAAHRGLSTIVIEKAPHFGGSTARSGGG
VWIPNNEVLKRDGVKDTPEAARTYLHGIIGDVVEPERIDTYLERGPEMLS
FVLKHTPLKMCWVPRYSDYYPESPGGRAEGRSIEPKPFNARKLGPDEAGL
EPAYGKVPLNVVVMQQDYVRLNQLKRHPRGVLRSLKVGARTMWAKATGKN
LVGMGRALIGPLRIGLQRAGVPVVLNTALTDLYLEDGVVRGVYVRDSQAA
ESAEPRLIRARRGVILASGGFEHNEQMRVKYQRAPITTEWTVGAKANTGD
GILAAEKLGAALELMEDAWWGPTVPLVGAPWFALSERNSPGSIIVNMSGK
RFMNESMPYVEACHHMYGGEFGQGPGPGENIPAWLVFDQQYRDRYIFAGL
QPGQRIPRKWLESGVIIQADTLEELASRAGLPVDEFLATVQRFNGFARTG
IDEDYHRGESAYDRYYGDPTNKPNPNLGEISHPPYYAAKMVPGDLGTKGG
IRTDIHGRALRDDGSIIEGLYAAGNVSAPVMGHTYPGPGGTIGPAMTFGY
LAALHIAGEN
161611208NP_959761.2 citrate synthase 2 [Mycobacterium avium subsp. paratuberculosis K-10]MTVVPENFVPGLEGVVAFTTEIAEPDKDGGALRYRGVDIEDLVSQQVTFG
DVWALLVDGKFGHGLPPAEPFPLPIHTGDVRVDVQAGLAMLAPIWGYKPL
LDTDDATARDQLARASVMALSYVAQSARGIYQPAVPQRVIDECETVTARF
MTRWQGEPDPRHIEAIDAYWVSAAEHGMNASTFTARVIASTGADVAAALS
GAIGAMSGPLHGGAPARVLPMIEEVERTGDARGLVKKILDSGDKLMGFGH
RVYRAEDPRARVLRATAERLGAPRHEVAVALEQAALAELRERRPDRAIET
NVEFWAAVILDFARVPANMMPAMFTCGRTAGWCAHILEQKRLGKLVRPSA
IYVGPGPRSPESVEGWDRSLTNA
161611207NP_959996.2 2-dehydropantoate 2-reductase [Mycobacterium avium subsp. paratuberculMVVCGRTPRERIELRPDDADPIVVPGPVHTDPGRVSGPVDVVLLAVKATQ
NAGAAGWLARLCGEHTVVVVLQNGVEQVEQVRPLCPVSPVTPGIVWYSAT
TQPQGWVRLRTEPALVLPSGPSAQAVAALLRDAGCRVDCDPDIITAAWHK
LLTNALAGFMALSRRRSGMFRRDDVAALSRRYVAECLAVARAEGARLSDD
VVDELVDLFRRAPEDMGTSILSDAEAHRPMEWDVRNGVIARKGRAHGLPT
PISDVLVPLLAAASDGPG
161611206NP_960135.2 aconitate hydratase [Mycobacterium avium subsp. paratuberculosis K-10]MTDSVNSFGARNTLKVGDKSYQIYRLDAVPNTEKLPYSLKVLAENLLRNE
DGSNITKDHIEAIANWDPKAEPSIEIQYTPARVVMQDFTGVPCIVDLATM
REAIADLGGNPEKVNPLAPADLVIDHSVIADLFGTADTFERNVEIEYQRN
GERYQFLRWGQGAFSDFKVVPPGTGIVHQVNIEYLARVVMERDGVAYPDT
CVGTDSHTTMVNGLGVLGWGVGGIEAEAAMLGQPVSMLIPRVVGFKLTGE
IQPGVTATDVVLTVTEMLRKHGVVGKFVEFYGEGVAEVPLANRATLGNMS
PEFGSTAAIFPIDEETIDYLKFTGRNAEQVALVETYAKEQGLWHDPAHEP
AFSEYLELDLSQVVPSIAGPKRPQDRIALSQAKSVFREQIPSYVGDGDGQ
QGYSKLDEVVDETFPASDPGAPSNGHADDLPAVQSAAAHANGRPSNPVTV
RSDELGEFVLDHGAVVIAAVTSCTNTSNPEVMLGAALLARNAVEKGLASK
PWVKTTMAPGSQVVHDYYDKAGLWPYLEKLGFYLVGYGCTTCIGNSGPLP
EEISKAINDNDLSVTAVLSGNRNFEGRINPDVKMNYLASPPLVVAYALAG
TMDFDFEKQPLGKDKDGNDVYLKDIWPSQKDVSDTIASAINSEMFTKNYA
DVFKGDERWRNLPTPSGNTFEWSPDSTYVRKPPYFEGMPAEPEPVADISG
ARVLALLGDSVTTDHISPAGSIKPGTPAAQYLDEHGVDRKDYNSFGSRRG
NHEVMIRGTFANIRLRNLLLDDVAGGYTRDFTQDGGPQAFIYDAAQNYAA
QNIPLVVLGGKEYGSGSSRDWAAKGTRLLGVRAVIAESFERIHRSNLIGM
GVIPLQFPDGKSAKDLGLDGTEVFDITGIEELNKGKTPKTVHVKASKNGS
DAVEFDAVVRIDTPGEADYYRNGGILQYVLRNMLKSG
161611205NP_960509.2 UDP pyrophosphate phosphatase [Mycobacterium avium subsp. paratuberculMTAHLSYVEAVVVGAFQGVTELFPVSSLGHAVLVPALVGGRWAQDLSVSA
HRSPYLAFIVGLHVATAAALLVFFWRDWVRILAGFFSSLRHRRIRTPDER
LAWLIVVGTIPVGLAGLALEQLFRTTLGKPVPAAAFLLLNGVALYAGEVL
RRRVAPVADEPAVPDAEQQHGDEASDNRLAQLPLRRGVLIGAAQILALLP
GISRSGITIVAGLWRGLSHEDAARFSFLLATPIILAAGVYKIPELFGPLG
AGIGGQVLAGSIASFVCAYLAVRYLTRYFQTRTLTPFAIYCAVAGGASLV
WLALR
161611204NP_960736.2 FxsA [Mycobacterium avium subsp. paratuberculosis K-10]MVARLLLLYAVVELAVTFALVSTIGWGWTLLVLLATFLLGWGVVAPMAGS
QLLRRIGQLRSGLTEPRAAAGDGALISLATALVLIPGLLSTALGLMLFIP
PVRGAAAPRLTALTLRTLQRHAPPYPTAFRAATDPRGPYEHRDYIDGEGI
DVHEVPAPARNQPFDSRRATG
161611203NP_960839.2 S-adenosyl-methyltransferase MraW [Mycobacterium avium subsp. paratubeMVDDSPDFGHVPVLLERCVELLTPALTRRHPDGSGAVLLDATLGAGGHAE
RFLADLPGLRLIALDRDPSALEIARERLARFADRITLVHMRYDGIAAALT
ESGYAATESVDGILFDLGVSSMQLDRPERGFAYAQDAPLDMRMDPGSPLT
AADILNTYDEAELADILHRYGEERFARRIAAQIVRRRAKEPFTSTADLVS
LLYQAIPAPARRTGGHPAKRTFQALRIAVNDELDTLRRALPAALDALAVD
GRIVVLAYQSLEDRIVKRLFAQAVASRTPVDLPVELPGHEPRFRALTHGA
GRADAAEIERNPRSAAVRLRALQRTQAPQATGKGD
161611202NP_961781.2 recombination regulator RecX [Mycobacterium avium subsp. paratuberculoMTASCPPPSTSEPSREEQARALCLRLLTARARTRAELHGRLAKRGYPDDV
STAVLDRLAAVGLIDDADFAQQWVQSRRAHAGKSKRALAAELHTKGVDND
VITSVLAGIDAGAERDRAEQLVRSKLRRETLAEDDARVTRRLVGMLARRG
YSQNLACEVVLAELAAERERRRV
161611201NP_962989.2 ubiquinone/menaquinone biosynthesis methyltransferase [Mycobacterium aMSRAELDKNPRDVASMFDGVARRYDLTNTVLSLGQDRYWRKATRSALGIG
PGQKVLDLAAGTAVSTVELNKSGAWCVAADFSVGMLAAGAARRVPKVAGD
ATRLPFADDVFDAVTISFGLRNVVDTQAALREMARVTRPGGRLVVCEFST
PSNALFATVYKEYLMRALPRVARAVSSNPDAYVYLAESIRAWPDQAALAD
QIAGAGWAGVRWRNLTGGIVALHAAHRPPR
161611200NP_963032.2 cyanate hydratase [Mycobacterium avium subsp. paratuberculosis K-10]MTRNQLTEQIVVARLAKGLTWQELADAIGRPLLWTTSALLGQHPIPAELG
RILVDKLGLDESAVPVLAAPPMRGGLPTAVPTDPTIYRFYEALQVYGGAL
KEVIAEQFGDGIMSAINFSVDLQKKPHPSGDRVVVTFDGKFLPYQWVSSE
Q
41410448NP_963284.1 50S ribosomal protein L34 [Mycobacterium avium subsp. paratuberculosis MAKGKRTFQPNNRRRARVHGFRLRMRTRAGRAIVSGRRRKGRRALSA
41410447NP_963283.1 ribonuclease P [Mycobacterium avium subsp. paratuberculosis K-10]MLPARNRMTRSTEFDATVKHGTRMAQPDIVVHLRRGSEPDDESAGPRVGL
VVGKAVGTAVQRHRVARRLRHVARPLLGELQPSDRLVIRALPGSRTVSSA
RLAQELQRCLRRMPAGSGR
41410446NP_963282.1 hypothetical protein MAP4348c [Mycobacterium avium subsp. paratuberculoMTGPARSGAAIRGAGRTVARGLIFLIQLYRHMVSPLRPATCRFVPTCSQY
AVDALDEYGLIRGSWLAAARLAKCGPWHQGGWDPIPERPGCRVNCQDASD
AWAVRATRGESGSLV
41410445NP_963281.1 inner membrane protein translocase component YidC [Mycobacterium avium MDLLFDFFSLDFVYYPVSWIMWVWYKLFAAMLGPSNFFAWALSVMFLVFT
LRALLYKPFVRQIRTTRQMQELQPQIKALQKKYGKDRQRMALEMQKLQRE
HGFNPILGCLPMLAQIPVFLGLYHVLRSFNRTTGGFGQPHLSVVQNRLTG
NYVFTPTDVGHFLDANLFGAPIGAFMTQRTGLDAFTYFSRPAVIAVGLPV
MILAGVATYFNSRASVARQSPEAAANPQTAMMNKLALYVFPLGVVVGGPF
LPLAIILYWFANNIWTFGQQHYVFGMIEKEDEAKKQEAIQRRAANAPAPG
AKPKRNLKAGAGNGVDADAAQPDAGATEGQAGGGSDAPSRTPRPGARPKK
RKR
41410444NP_963280.1 hypothetical protein MAP4346c [Mycobacterium avium subsp. paratuberculoMGCGPWMREIKTWQTPTPPNASSTPQRPPSRNRPTATRPTTWRSGLVAEG
EIAGDYLEELLDLLDFDGDIDLDVEGSRAVVSIDGSDDLNKLVGRGGEVL
DALQELTRLAVHQKTGVRSRLMLDIASWRRRRREELAALGDKVARRVLES
GQREELAPMTPFERKIVHDAVAAVPGVHSESEGVEPSRRVVVLHD
41410443NP_963279.1 glucose-inhibited division protein B [Mycobacterium avium subsp. paratuMFHVKHVGPVEPAAGDPEVPPVAELGAAPESAAALFGPRLATAQRYAEVL
GTAGVERGLLGPREVDRIWDRHILNSAAVAELLGRGDRIIDIGSGAGLPG
IPLAIARPDLEVVLLEPLLRRSEFLTEVVDELGLAVEVVRGRAEERPVRD
RFGERDAAVSRAVAALDKLTKWSMPLLRHDGRMLAIKGERAAEEVDRYRR
VMTASGAADVRVVTCGANYLRPPATVVSARRAKPPHPKSARTGKAGTR
41410442NP_963278.1 hypothetical protein MAP4344c [Mycobacterium avium subsp. paratuberculoMTSSGDWPVASSEAREGAATPAPDAPSATHTPAAPIGPGAPSGTRGASAV
GSPAPPPTAATAPPSSAAASTSPPANVSRETADEFDTPIGAAAERAMRIL
HTTYPPLRRPKHRRVFTVANQKGGVGKTTTAVNLAAALALQGLKTLVIDL
DPQGNASTALGITDRQSGTPSSYEVLLGEVSVHDALRQSPHNERLFCIPA
TIDLAGAEIELVSMVARENRLRTALADLDNLDFDCVFIDCPPSLGLLTIN
ALVAAPEVMIPIQCEYYALEGVSQLMRNIEMVKAHLNPQLEVSTVVLTMY
DGRTKLADQVAEEVRRYFGSKVLRTVIPRSVKVSEAPGYSMTIIDYDPGS
RGAMSYLDASRELAERD
41410441NP_963277.1 hypothetical protein MAP4343c [Mycobacterium avium subsp. paratuberculoMTQPLRKKGGLGRGLASLIPTGPAEGDAGPATLGPRMGDAAADVLIGGPA
PQEASPVGAVYREISPADIERNPRQPRQVFDEEALAELVHSIREFGLLQP
IVVRAIKESASGARYQIVMGERRWRAAQEAGLATIPAIVRETGDDNLLRD
ALLENIHRVQLNPLEEAAAYQQLLDEFGVTHDELAARIGRSRPLITNMIR
LLKLPIAVQRRVAAGVLSAGHARALLSLEAGPEAQEELATRIVAEGLSVR
ATEEAVTLANRAGTTTPTPPRRKPIQMPGLQDVADRLSTAFDTRVTVSLG
KRKGKIVVEFGSVDDLQRIIDVMAPPKP
41410440NP_963276.1 hypothetical protein MAP4342c [Mycobacterium avium subsp. paratuberculoMSARITPLRLEAFEQLPKHARRCVFWEVDPAVLGNHDHLADAEFEKEAWL
SMVMLEWGCCGQVATAIPDERSQAEPPCLGYVFYAPPRAVPRAQRFPTGP
VSADAVLLTSMGIEPGPAADDLPHALLARVIDELVRRGVRALEAFGRTPA
ASELQDPRLVGPDLRPVLEAVGDCSVDHCVMDAEFLKDAGFVVVAPHTYF
PRLRLELDKGLGWKAEVEAALERLLESARLEQPVGAASTPANALKTAPPD
41410439NP_963275.1 CwlM [Mycobacterium avium subsp. paratuberculosis K-10]MSSPRREYGDALRCGDRSAAVTEIRATLASLGLLASADEDLSTGRHVALE
LFDAELDQAVRAFQQHRGLLVDGIVGEATYRALKEASYRLGARTLYHQFG
APLYGDDVATLQARLQDLGFYTGLVDGYFGLQTHNALMSYQREYGLSADG
ICGPETLRSLYFLSSRVTGGSPHALREEELVRRSGPKLSGKRIIIDPGRG
GADHGMIMQGPSGPISEADVLWDLASRLEGRMTAIGMETFLSRPVNRSPL
DAERAATANNVGADLMISLRCEAQKSPAANGVASFHFGNSHGSVSTIGRN
LADFIQREVVARTGLRDCRTHGRTWDLLRLTRMPTVQVDVGYVTNPHDRA
MLVSTQTRDAIAEGILAAVKRLYLLGKNDRPTGTFTFAELLAHELSVERT
SQMGGS
41410438NP_963274.1 TrxC [Mycobacterium avium subsp. paratuberculosis K-10]MTDAEKASATIEVSDASFSTDVLASNKPVLVDFWATWCGPCKMVAPVLEE
IASERGDHLTVAKLDVDANPETAQNFQVVSIPTLILFKDGQPVKRIVGAK
GKAALLRELSDAVPNLG
41410437NP_963273.1 hypothetical protein MAP4339 [Mycobacterium avium subsp. paratuberculosMTADTVHDVIIIGSGPAGYTAALYTARAQLAPVVFEGTSFGGALMTTTEV
ENYPGFRDGITGPELMDQMREQALRFGADLRMEDVESVSLAGPVKSVTTA
EGETVRARAVILAMGAAARYLGVPGEQDLLGRGVSSCATCDGFFFKDQDI
AVIGGGDSAMEEATFLTRFARSVTLVHRREEFRASRIMLERARANDKITI
VTNKAVEAVEGSETVTGLRLRDTVTGETSTLAVTGVFVAIGHDPRSELVR
DVLDTDPDGYVLVQGRTTATSIPGVFAAGDLVDRTYRQAVTAAGSGCAAA
IDAERWLAEHAESSAAAQGDATEFPGSTDTLIGAPQ
41410436NP_963272.1 hypothetical protein MAP4338 [Mycobacterium avium subsp. paratuberculosMATAGNDAADHRNAESDPPLTAELLADLQAGVLDALNRVRREVAALGADP
ASPPDPPPQVTARVAAALRSAEPVGATPRAAHSARPPLRTARAIAAVAGL
GAALAAIGVGTVALLRTPAPAPSTPTDIEHITVSTPPMQIPLSRAEILGL
LDRSPDFGPLSDPARRASCLTGLGYPASTPVLGARPVAINARPGVVLVIP
GDSPHVLTVYAVSANCSAADTGLLANTEVPRP
41410435NP_963271.1 RNA polymerase sigma factor SigM [Mycobacterium avium subsp. paratubercMGFGRNGNGDRSDAELLAAHVAGDRYAFGELFVRHQRHLHRLARLTTRSP
EDAEDALQDAMLSAHRGAGAFRHDAAVGSWLHRIVVNACLDRLRRTKAHP
TVPLEDIYPVADRTAQVETTLAVQRALMRLPVEQRAAIVAVDMQGYSVAD
TARLLGVAEGTVKSRCARARVRLAELLGYLDAGAHAAAEGAAGQA
41410434NP_963270.1 hypothetical protein MAP4336 [Mycobacterium avium subsp. paratuberculosMPGSPPTGPLPPVPAGIDRRRPELSDSALVSRSWAMAFATLVSRLTGFAR
VVLLAAILGAALSSAFSVANQLPNLVAALVLEATFTAIFVPVLARAEQSD
PDGGAAFVRRLVTLTTALLIVATALSVAAAPLLVRLMLGRTPQVNEPLTV
AFAYLLLPQVLAYGLTSVFMAILNTRNVFGPTAWAPVVNNVVALATLAVY
ALVPGELSVDPVRMGNAKLLVLAVGTTLGVFAQTGVLLVALRRQHVDLRP
LWGIDQRLKRFGTMAAAMVLYVLISQLGLVVGNQIASTAAASGPAIYNYT
WLVLMLPFGMIGVTVLTVVMPRLSRNAAADDTRAVLADLSLATRLTLITL
IPIVAFMTVGGPAMGSALFAYGHFGDVDAGYLGAAIALSAFTLIPYGLVL
LQLRVFYAREQPWTPIVIILVITAVKILGSMLAPHLTGDPKLVAGFLGLA
NGVGFLAGAVIGYVLLRRTLLPGGGHLIGVGEVRTILVTLTAAMLAGLVA
HVADRLLGLGALTAHGGGAGSLLRLLVLALIMVPITAAVMLRAQVPEARA
ALDAVRFRITGRGPRPRKPAAPDRSSHRRPVTYPEQRNSSPPGVNAVQEP
IRRRPPERANRARLVKGPEVTDRPMESAASSAGPGTGSGAPRPVADDFQP
DIPADQPDRPRKADPRPADQKNGDVGTRRGPLDVPRERTADSSTDDVHLV
PGARIAGGRYRLLVFHGGAPPLQFWQALDTALDRQVALTFVDPDRALPDE
VLQEILSRTLRLSRIDKPGIARVLDVVHTGSGGLVVSEWIRGGSLQEVAD
TAPSPVGAVRAMQSLAAAADAAHRAGVALSIDHPSRVRVSIEGDVVLAYP
ATMPDANPQDDIRGIGAALYALLVNRWPLAESGVRSGLAPAERDSSGNPV
EPMAIDRDIPFQISAVAVRAVQDDGGIRSASTLLNLLQQATAVADRTEVL
GPIDDSPSPSTALISPGNDPATFARRRRNVLIGVGAGLAVLVAALLVLAS
IVSKIFGNVGGGLNKDELGLNGPSSSTSAPQTTTSTAAGSVVKPTRASVF
SPDGDADNPGTAGQAIDGDPSTAWATEVYTDAVPFPSFKQGEGLILQLPS
PTVVGQVSIDTPSTGTKVEIRAASSPTPAGLNDTTVLAPAFTLKPGHNVI
PVRAGSPTSNLLVWISTLGTTNGKSQAGFSEITVQAAS
41410433NP_963269.1 hypothetical protein MAP4335 [Mycobacterium avium subsp. paratuberculosMTAPRLCWAGGLRIAAVLGVLAGLAVLTGPVTPRAVAGEPGVTPFVRVRI
DQVTPDVVTTTSPPVVTVSGMVTNIGDRPVRDVMVRLEHAGPVTASAGLR
TSLDGDTDQYQAAADFLTVAPELQRGQEVGFTLSAPLRALTKQSLGVEKP
GIYPVLVNVNGTPDYGAPARLDNARFLLPVVGVPPDRADDLGSAVAPDTS
KPVGITMLWPLADRPRLAPGVPGGTIPVRLVDDDLATSLASGGRLDILLA
AAEVATSHDVDPDGAVGRALCLAVDPDLLVTVNAMTAGYVVSDSPDGPAQ
LPGTPTHPGTGQATATEWLNRLRALAHRTCVAPLPYAQADLDALQRVNDP
GLSNTALTSVNSIVDKILDVPSTRGATLMPDGRLTGRAVKLLGANQTTVA
VTAADLSAGDAQGSSETSVDTAPRRVSPQVVAAPFDPAVGAALAGAGVNP
EVPTYLDSSLTVRLAHDSVTARRQDALGSMFWHALRHDDTPRTQLLVPPA
TWNLQADDAQVILTALTTSIRSGLAVPRPLPAVIGEATQAAQTGAPPSDQ
VSADGSARGQFNDDVTGAITGQVGRLWGLTSALMTDDRTGLTGVQYTAPL
REDMLRALSQSEPPDSRNGLAQQRLAVVGKTINDLFGAVTIVNPGGSYTL
ATEHSPLPLALHNGLAVPIRVRVHVDAPPGMNVTDVGVIELPPGYLPLRI
PIEVNFTQRVAVDVTLRTADGMRLGEPVRLSVHSNAYGKVLFAITLSAAA
VLVLLAGRRLWHRFRGQPDRADLDRPDPPDARHADPHDLADPRVEQEHRV
41410432NP_963268.1 hypothetical protein MAP4334 [Mycobacterium avium subsp. paratuberculosMSDGEQGKPRRRRGRRRGRGAATSSEKQTNGQLTGDSTATKPRRSRAARR
APDRLRTVHETSAGGLVIDGLDGPRESQVAALIGRIDRRGRMLWSLPKGH
IELGETAEQTAIREVAEETGIRGSVLAALGRIDYWFVTDGRRVHKTVHHY
LMRFSGGELSDEDLEVAEVAWVPMRELPSRLAYADERRLARVADELIDKL
QSDGPAALPPLPPSSPRRRPQTHSRTRHSETRHSDKPATGRKNGHGPGP
41410431NP_963267.1 hypothetical protein MAP4333 [Mycobacterium avium subsp. paratuberculosMHLRYISKAALIMFAGGDPWKINATLQSGRPAQISNLAKAFHDAGRSTGE
AEAAFNLARGRFEQAWTHENDENPINGSAEVQRTTTSLRVQAAQLPKIGA
DLEKVAAALAEAQRSGRGEISTLEGALQDLDNQVGEAVELEKNPQLTASE
RQLLDHYIDGLEKHAIDDTKASVANLTRIRDQYSQQLHTSMDNLREQDSY
DPPIQAFDGNVPESPSQDQRRHNQIEAFKQVFGREPSSAADWETAAALDS
QTYDSKFNGAKSEIRVVRIRPVPGQGVVRVSQWIEQRDVTSSLTGNRDLG
NNRGADQHFDPEDTKVTTYIDYENGLVILRQNPSVEETPTGAPGTVKVGT
PKGSVTQLADGSVRIKYDAGNPFAPSITADTNGPFAGHTITVNGDLAFTP
GPEGVHVNGTRTDYPSLEAYQDFPGGSTRTLLIDPAQSTSSVGPMFNLPF
HHDVGPLGGRAFAPFDSGGWNLKYDVPAPLPATEFGPVTRAPSIPLLPSG
VEVRPDRLLTGKLLRCLRSPAQHHSTPAPGAQQPGRHPLSSN
41410430NP_963266.1 PcnA [Mycobacterium avium subsp. paratuberculosis K-10]MPDAAQDAELLTAAAVALNKHAPMLRELGSAFDAAGHQLYLVGGSVRDAL
LGRLSPDLDFTTDARPEQVQQILRRWADNLWDTGIEFGTVGVGKGDRRLE
ITTFRADTYDQVSRNPQVRFGNRLEDDLVRRDFTANAMAVRITPDGPGEF
LDPLGGLAALRQRVLDTPATPEESFGDDPLRMLRAARFVSQLGFTVAPRV
REAIERMAPQLARISAERVAAELDKLVLGDDPVAGIDLLVHSGMGEVVLP
EIGGMQMAIDEHHQHKDVYQHSLTVLRQAIALEDDGPDLVLRWAALLHDI
GKPATRRHEPNGGVSFHHHEVVGAKMVRKRLRALKYSKQMIDDVSQLVYL
HLRFHGYGDGKWTDSAVRRYVTDAGPLLPRLHKLVRADCTTRNKRRAARL
HASYDRLEARIAELAAQEDLARVRPDLDGNQIMEILGIPAGPQVGEAWRF
LKELRLERGPLDPDEATAELLSWWRSRGNG
41410429NP_963265.1 hypothetical protein MAP4331c [Mycobacterium avium subsp. paratuberculoMDYCLAGDGGAAAIWHGQPDLDLDGDGRFESIGLDFDHDGLRDDALADLD
GDGLVDHAVLDLDNDGTPEAYFTDDGSGTWAVAVDRNGQLRWFGLDGVEH
TGGPMVDFDGHGRPDARLVDTDGNGLADRVLRTDETGVTGYVDTDGDGKW
NVRLTDTDGDGLADGASAL
41410428NP_963264.1 hypothetical protein MAP4330c [Mycobacterium avium subsp. paratuberculoMQLRHLSIPFLVAEAGGDPWSIDSGLQAGRPAQIASLARAFHDAGISTAE
ADVAFTAARGRFEASWNHRNGAVPINDSAEVQRVTRALAVESRQLPRIAT
DLETIAAVLAESQRTSTWYIEALEYDLAAIDDEIGQALEEADHCAAEELR
YSAVTETKAITLVLKQVRESYSRLLHSALARLQADGVDPADVRGVDELSI
PPADTGPEQVKWWWDSLSDAQQRLLIDQHPQELGNLNGIPAEARDSVNRA
TMTDDLSKVEAVARVRGVSVEALRDNVLRNRDIDIFSNPASYGLCATDIV
RYQNAVKTNDCLNKACDPGLPLMLWAYDPLAFAGKGRAGIAIGNPDKARN
TAVVVPGTNSSVRGGWMSDGADDAINLYTQARRADPHHATAVLAWMGYDA
PEFDDSHWEQAVTDPAKLEQVGTPWRARQAGVLLAGDVNGLAATHDAGSR
AHVTVIGHSYGSTTVADAFANSGMRANDAVLTGCPGTDLAHSAADFHLDG
GRLYVGAASTDAISWIGESGSGLPNGLNETLGGPLGPLAGLGTDPAHAGF
GAVRFRAEVAGSHSVMPWFTDHSHYYDVGSEALHNMTEIVTGRGDQLAAE
GMLAPDRDAARVSILGRVHTPLGTLSLPRVEIRMPVVVDPEWERPARSVT
NEHGF
41410427NP_963263.1 hypothetical protein MAP4329c [Mycobacterium avium subsp. paratuberculoMFVDTDLLHSGGNQSHRAGGHARDGADQLAGGTVASGMFGDFAAADAFHS
AVVVAHEQHVQNLQAHSETLTGVGTKAHHAANGFTNMDQQNATEMRALRP
SSSPSPSNA
41410426NP_963262.1 hypothetical protein MAP4328c [Mycobacterium avium subsp. paratuberculoMVGDLPPGPGQGPMTGPPNPTQWAPAFPPQPPRSRTWPAVALAAVAVLLG
GAALVVALTRPTGGSSTASSTTSTTPSYTAEQTAAAHQKLCDTYRLAARA
VQIETNGKNSDRANLATVNGAVMLEEAVNANPAIAPGDRAAALALAESYS
NVAATSSVATGSDDPAWQSALDNANNKNAAMKTVCGGS
41410425NP_963261.1 hypothetical protein MAP4327c [Mycobacterium avium subsp. paratuberculoMVGDLPAGVGEGPSVHPPVGSRPPSYPWQPARRPRPWLAIALAVTAAVAA
GALAIALIRPATRLPAATTLPKYTLSETAAAQKHLCDTYRLVAQAVATDT
NANDRALARIADTNGALLLNMPADNLALDADRRDAAKALAAAYGTVTANN
NSAVASDANYQAALDDVIAKDIAMKKVCGGA
41410424NP_963260.1 hypothetical protein MAP4326c [Mycobacterium avium subsp. paratuberculoMGLDLPPGTWTAALIGPWWPAPSTALRAGAQHWSESCVEQQIYSQTLRTQ
WTLFAAHNQGHTADDLIDRFQQGEKFHLDLAEKYQAKASAFNSAADATDY
LRSRLSEIASTGNREINEILASKKLPPEKLAEIQAVQMRCNADAANASRD
AVDKMMAATQKILDADGVGGDARSWARANGFNTQEAPAPQQITAEDLHLG
QGKSSTGPGVGGGMPSEPHSSGSDQALSNGSPGVGAAGFPGRPHTDAGVV
PPSAGGPGVGGAGLPGPTAPASPVPAGAPSFSAASGTVPSGVPGVHGAPA
AMAPSGLGLGQGGQPNLAQSFASGLATGQATGPGGQAFPANALQAMETGA
PQTPAGTPPVAPTVPSAGAFIAATPPVDAPPAAAPAPSTAGGAAPVAPAV
MTGGSWSSAATGGPSVPSGSLPAYGSDLRPPVVAAPSVPSAPTGPVSGAP
VAPSPASSPSAGGTLVSPVERSAASAAAGQAGAGSSTLANASAVSATAGA
TAGAASSRAAEQQRLQRLVDAVARQEPRLSWAAGLRDDGTTTLVTDLASG
WIPPHLRLPAHVTLLEPAARRHDANVVDLLGAVTVAAAHHANTYVAEPGS
DEPTLSGDRPARSAAPQIDELGPTLVDAVRRRDGLPRIAQAVAAPAVRKT
GVLESEIRMLRECTAEIQHAVLTAYPHHDPAAVGDWMLLAAIQALIDGHE
YLAHYHLAWFQAINHRAGS
41410423NP_963259.1 hypothetical protein MAP4325c [Mycobacterium avium subsp. paratuberculoMGGPGGIIKNDLPTTTAIVGGPPASIPRPFPVPPGGTSPADAGQGMVGGA
GNANVPKDAADAAAADADRKARAADAAAKFPANEANGSQEMQMLQQMLSS
VTGALGGAMGGVMGPLTQLPQQAMQAGQSALQPLMSAVQGAHGAASLADN
AHLVDSVGGAGSGLGGGAGAGGGGAGLGGGGTVPTSSLGPPPVPTSSPPT
TPAGAKAAMMPPTGGMPAMPGQTGMTGMPMMPPGAMGAGGEGGNKDKPVE
KRVTAPGVPNGQPVKGRLTIPPSAPGSKPGEAKPTVVTNRPNRRIVIMPS
DDEPKE
41410422NP_963258.1 hypothetical protein MAP4324c [Mycobacterium avium subsp. paratuberculoMGKPVTDPLRMQAVAALSRGHELFAGAPTRDRLGAPTARPRTTSPSTLPA
AVVARSGALAQRLAQSDDADRVLRTVLAAARADHAHGRAATGTVLDAALA
DAAPAADTPLGRREAMARMAARLRTQHRHISRSRRRARLLALRLRRLHYR
RRRPAAGPTNQPGGRPAVLAAIRKALDIKGIHDPAARARWERGMDLVARR
ESNYNAGAVNDWDANAARGTPSKGAWQFIEPTFAAYHQRGTSRDIHNLVA
QACAFINYAMGRYGVAADASNLADRIQQADPRRSPKGY
41410421NP_963257.1 hypothetical protein MAP4323c [Mycobacterium avium subsp. paratuberculoMPLSLSNRDQNSGHLFYNRRLRAATTRFSVRMKHDDRKQTAALVLSMVLV
AIASGWMMLLNVLKPTGIVGDSTIIGDRDSGALYAKIDGRLYPALNLTSA
RLATGTANQPTWVKPAEIAKYPTGPLVGIPGAPAAMPVHRGAISAWAVCD
TAGRPRSPEKPVVTSIAGPLEGFDRATPLRDDAGLLVTFEGNTYVIWGGK
RSQIDPVNRAVTLSLGLDPGVTLPVEISRALFDALPATEPLGVPPVPLAG
TPSTWVSGSQVGAVLQAQTASGGTQFYVLLPDGVQKVTSFVADLLRSANS
YGSTAPRVVTPDVLVNIPEVTSLAVDYYPTKRLNFIDTAANPTTCVGWEK
GSTDPQARVVVYNGRGLPTPS
41410420NP_963256.1 hypothetical protein MAP4322c [Mycobacterium avium subsp. paratuberculoMHLVRDDRDPASLVANQVLVLPGAANFVTSTSGVVTSDSRESLFWVSDYG
VRFGIANDESTLRALGLDPGSAVQAPWPLLRTFAAGPALSREAALLARDT
VPALGKVAVVTTSAKPGG
41410419NP_963255.1 hypothetical protein MAP4321c [Mycobacterium avium subsp. paratuberculoMSKKAFPINRVKIEPPKPVRVAPAAPIALPEREPRNIWVMIGVPALIVAL
IGTIVMLYVSGVRSLSTGFFPLMGIGAFSMLAFSGRFGRARKITWGEMEK
GRRRYLRDLDSNRDEIQSAVCAQREWQNSVHSDPRGLGAIIGGPRMWERG
RGDEDFLEVRLGTGVQHAPDSVLSVTWPDVASDEELEPVTGQALRDFILE
QRKIRDIAKVVNLRSAPGFSFVGEDLDRLRSLMRSVLCSLAVFHNPRDVK
LLVVTRNPEVWSWIVWLPHNLHDELFDACGWRRLVFATPEELEATLGAEL
HMKGKRGPWTPLAAASPTAMGSALETATDTVDLGPHLVIVDDNTGSPDAW
ESVVGQVGKAGITLLRIASRVGTGVGFAKDQVFELSERHSTPNGSTNGEI
ALRRNGSDADGEDGRPAPLLRVRNKFFAHADQLSIHRAYRYARAMARWSP
TSRSEIDDSVSGATELLRALGISDPRELDVDRLWAERRGRGDERWCEVPV
GAKPNGELQNIIIRAKDFGGFGFHSVVIGTSGSGKSEFFLSLVYGIALTH
SPETFNVIFVDMKFESAAQDILGIPHVVAALSNLGKDERHLAERMRRVID
GEIKQRYELFTSVGARDANDYEEIRLAGRDLPPVPVLLVIVDEYLELFAN
HEKWINLIIHIGQEGRGANVFFMLGGQRLDLSSLQKVKSNIAFRIALRAE
SGDDSREVIGSDAAYHLPSKENGFGLLKVGPRDLEPFRCFYLSAPFVVPK
TKEVAATVDMTLTKPRLYNWQYQPLDAADATALEQAAAVDAEPDEFLYYE
DGFKRKKIVDVLRESLQNVPHRSPGRPWLEPLEDPEPIDVLVAGYRGKPW
HVDYGQNPGLMFPVGVMDIPEESKQVVHAVDALRSNVIVVGAKQRGKTTT
LMTLMCSAATMYSPARVTFFCIGGATLAQAASLPHVTDIVSPKDAEGIER
ILSSMDALIDARENSFRQLKIDLDGFRERRFGPGSDGLGGTDANDPFGDV
FVVVDDYDDLYSKDTVLGDRIISLSSRGPEYGVHVMCSAGGWIHGQRQSL
LQNATARIQLRLADPSESQMGHSSLESRDAARRTLNRPGFGLTDSLHELR
VGVPALTDPATGQMVSIVDVGARIADVAGVTKHATLQRLPQRVELKTILE
YQAAHPSGDDLSIAFAIGERHELGPVPINLRESPGLMILGRQGCGKTLSL
VAIGEAIMSRFSPEEAQLTLIDPKTAPHGLRDLHGPGYVRAYAYDQDEID
EVITALAQQILLPRLPPKGLSQEELRALKPWEGPRHFVLIDDIGDLRPDQ
SYPPKPPVGAALWKLMERARQIGLHVFTTRNSANWATLQMDPWIRFQNSA
KVAQLYMDNDPQNRINRNVRAQALPPGRGLLLSADGDVEGVLVGLPSTVI
TPQ
41410418NP_963254.1 hypothetical protein MAP4320 [Mycobacterium avium subsp. paratuberculosMPDRPGILGRLTGRYALLVVGLWVLAAAVANVAVPQLERVVDSHARSFMP
PSAPSAVAAARAAQLFDQTPSNNFVYVVLERNQRLGAGDRQFYDALTAAL
GSDHRHVYAVTDLWSQPATAAGAQSTDGQAVSVMVRLAGMLGTAQARDSV
NAVRATAQKLGPPAGLQVHVTGPGATIVDKFSAIDRQMLGITAATIGLIL
LLLLVVYRSPVAAAIPLISVGLAFALARAVVAALGQANVIEVSLFSVALM
AAMTLGAGTDYAIFLVGRYHEARRGGVAPAQALTVAYRSIAPVVIGSALT
VSVALACLVFAHVGSFRSAGLPCAIGILATMVAALTLTPALMSLAVRRGY
LEPRPSRTARRWRRVGTTVARWPGPILVAALGLTLLVALPLAGMRIGFNE
PAATPSSTDSNRGYASAGRHFPENALLPDVIAIRADHDLRNPAGLIAIER
ITRHIMAVPGVRAVQSASRPDGKVPEQATLSYQAGVLGRQFGDTVDSLTQ
RLARVSELDGALAQTQHAVDGLGNGLRGGSAGLADMSGAADDMRAGMDGL
QRNVTTVSGYLDPLRDFVGRTPDCAANPICSTVDRVLAPVDSLVQTSAQL
GSGAAKLTTGSNTAATAMAGLPQNVDAMKSALVQARSATRDLLGLSDTLG
PQMHQLTDYLNEISTQFQGSAAADFYLPQRALTDPRYTAVLNHLISQNGR
AAYLLVYGDGAEWGADGAGRAEQVRAAIKEATKEGTLTPVEVDLAGVGPV
TADLQRFVADDTRLLVGAALVLIFLIVTAMLRSPVAGLVVVGTVVTSYAS
AIGASVLIWQHLLHQELHWAVAPIAFIALIAIGADYNLLLALRIKQEAAA
GLRTGIIRAFGGTGGVVTVAGIIFGLTMLALLTSSVLSIAQIGTTIAVDL
LLDTLVVRAFIVPSIVALLGRWFWWPSPLPRRGVARVVKTVEPQPLSVAT
AV
41410417NP_963253.1 hypothetical protein MAP4319 [Mycobacterium avium subsp. paratuberculosMTWALLHDRMAFMAEVIKTAETDPSAALALIDNSPRVPELFGDAEGLMLS
LGQRWITTLVAKLDQAAHEGTSAEQVRADLEAASPGLHALVTIGARRSLR
MRSMARGEHVAVSLFGGPSGDRQTVA
41410416NP_963252.1 hypothetical protein MAP4318c [Mycobacterium avium subsp. paratuberculoMLRAAICHLREQLRRRGELIPVGLTWASLIAVDAALLLGGTIGTLQRPAA
DLPVSLTAFAIALSPTVAFFVFNMKMTPGPLWATWTASTALTLFGTSTPI
RADFAPALLVLMVLVVATLASVVGGLLAAASAAALLLTAAALHRLDAIVL
YLGFIVAAWLLGYLMRTQRLLVAEQIEAQQMLAEHAAADERRRIAREVHD
VIAHSLSITLLHVTGARRALRQDRDVDDAVEALEQAERLGRQAMADIRRT
VGLLDNWPTKAAPTTPEPGLDDVASLVDGFRRAGLAVTLCVEGPTDHVSP
AVGLALYRITQESLANIAKHAPESKAGVVLDISPASARLAVTNILPAAVV
AARSPEGRGVRGMRQRVELLGGAIDVGPTRDGWSVCAEIPLQESDGSWRP
WWCGKA
41410415NP_963251.1 hypothetical protein MAP4317c [Mycobacterium avium subsp. paratuberculoMTDPAPEIAVLLVDDQDLVRSGLRRILRRKDGFVIVAECADGDEVPAAIA
AHRPDVVVMDLRMRRVDGIEATRRLGGRPPVLALTTFNEDELLSGALRAG
AAGFVLKDSSAEELIRAVRAVARGEGYLDPAVTSRVLTTYRKAAPGPRGA
AIAELTTRERDVLTLIGKGLSNSEIADELCISGVTVKSHIGRIFGKLDLR
DRAAAIVYAYDNGIVAPR
41410414NP_963250.1 hypothetical protein MAP4316 [Mycobacterium avium subsp. paratuberculosMMTPSYPWGDDRGQLAQQLRLRYHTLRRRRARRLCHSFERVGVRTAPERL
REMLAGAPLAAHEVINVNFALIAIQLNREARVARYRRLRQRGARSLMFAG
LIMVVINFLMCMAYLLLNLAEPAAPL
41410413NP_963249.1 hypothetical protein MAP4315 [Mycobacterium avium subsp. paratuberculosMAAAAGNPARTRDEDAIGTPPPGPTLVPAERYYSPAFAALEVERMWPRVW
QLACMVDHVAAPGDYFEYRCGPYGVLIVRGDDGALRAFQNVCRHRGNSLC
SGSGSGLRELKCGYHGWTWDLAGALKRVPDRKGFGTLRLSDYPLIPARVD
TWAGLVFVNLDPDAMPLPEYLEAIPEDTAWCRLDEFRCYATLTVEVDANW
KTVADGYSETYHIQTLHPELLRCVDDIHAPQQIWGHTGKSDQPYGVPSPR
FEGALSDEEVWDAYVSTQGALMGAAEGTPFPAADHRPGQTVADLIADRTR
AFAASRGVDLGWADTDRITRLHQYNVFPNMTFLTNADHLTVMCSRPAPDP
AAAPDKGELVMFLTTRMPPGAPRTKPTDVRMSAGEAEPGLVLTQDIAVLA
GLQRGMHQPGFTHLVLSSEERRVINMHRNLERYLDLPAAQRMSGGAGT
41410412NP_963248.1 hypothetical protein MAP4314 [Mycobacterium avium subsp. paratuberculosMFDLKITGGTVVDGTGAQRYRADVGIRDGKIVDVVRADGSEAGGLATAEA
AETIDATGKIVAPGFVDIHTHYDGQVSWDSLLEPSSGHGVTTVVTGNCGV
GFAPVRPGTEQWLIELMEGVEDIPGTALTEGITWGWETYPEYLDAIGKQK
FAIDVGSQVAHGAIRAYAMGERGARNEPATPDDIEAMGRLVREAIEAGAL
GFSTSRTMGHRAMDGEPVPGTFAAEEELFGLGRAMAAGGQAVFELAPQGA
AGEDIIGPKKELDWMRRLSGEINRPVSFALIQVDADPNLWREMLDLSADA
HAAGARLYPQIAARPFGMMIGFQGHHGFSHRPTYRRLAAECSREELAQRL
ADPAVKAAILAEDDLPVDPTLLFDGMFALVQHSLHRLYALGDPPDYEPTP
DRTVAAIAEARGEDPLATLYDLMLEADATNMLMLPLFNYADGNCDAIREM
LLHPAGVLGLSDGGAHCGMICDASYPTFLLTHWARDRSRGDKLALEYVIR
KQSRDTAHLFGLTDRGTIEPGKKADINVIDMDALRLHPAAMAFDLPAGGN
RILQGASGYAATIVSGTVTRRNDVDTGARPGRLVRGAR
41410411NP_963247.1 hypothetical protein MAP4313 [Mycobacterium avium subsp. paratuberculosMGHAFSFLGLAAHLGRGAGRVSVDAVLGGRFGLPRTVDEIDPAVLSRVMG
TTVRTVRVLSRDAGTSSRARLVLTGKDVPDSVFVKVAAQTAATRLMGELG
RLGCTEVRFYRQLAPQVVGVPYCYGAAFDAWTGRYLLVLEDLPAEACEFP
DTLHPLSADQAGLVVELLADLHATFWNRLPRDGRGPLGWLYTPSGDVTSL
LTGSLMHSSIKRLAERTSIPVRDGVFIADNYRAVAALIDAAPHTVMHGDA
HPGNMYFHGGKAGLLDWQAVRRGHPSRELAYTLITSLTPEDRRATQRDLL
DDYRRALAAAGGPQLDRDELWLRFRQAALYAYAAPLITAGMGGMQVEDIA
MEGLRRGVAALEDLETVAALKSSL
41410410NP_963246.1 hypothetical protein MAP4312 [Mycobacterium avium subsp. paratuberculosMEPSRRWGDDRAILDDEEARRRILEAAGRCIVRRGNTQFRMGEVADEAGV
SRSTVYRYFPGRDDVLLGLMLRRVDHALAESVRSLPAPEDPVRSVPRMVL
ARVESVDGNPLNEALFAAESTAMASALQKGSEPLVELLLRHYGPLLERWK
AAGLLYPDVDFRSVVQWLHTATLFLLAPSWRYRPHADKRRFVEQFVVRAL
VPQIRQ
41410409NP_963245.1 hypothetical protein MAP4311c [Mycobacterium avium subsp. paratuberculoMPRNHIASQKGRLMGYSAADESFTHQLPTTFDQVHDADPTWSDRCYFFAA
APDGTMLLASGYGNNPNTASGLGYVKVSLADGRHWDLLSGRPVTGDDRGE
LRAGPMRWTCVEPLKKWRLDVGPNNSGIEWELYYEPTAPMWELLPMKVSG
PDGRLLADMYHMKEPGRWSGWVRIDGQRVSVDGFNGGRDRTFGVRVSDRI
DFWLWLDAGFGDHAVEAWVIESCDGTVLYVDGGITYADGTLSKRFVKIQH
EVEFDGERKRPVRAVLVFTDEDGRAHRVVAEAPHPQVNAYYGLPMAHCHY
EDLGGGAYFIHFAWDSSDPEQLSETEDKSMALDQLMRFERDGHTGWGIFE
LLLGGQGYRRYPNWRAMDMSAFTQDKTPVDRLPADGDGADR
41410408NP_963244.1 hypothetical protein MAP4310c [Mycobacterium avium subsp. paratuberculoMTLGTERERRLTGWLRGRLPDADDVRVEGIDRVSFGHSAEMMTMSVIAAR
RGRDERRDVVLRLRPSPPALLEPYDLARQFGILRALADTDVRAPRALWLE
PTGDVLGRPFFVMERVAGEVYEMQPPADASDDTVARMCESLAEQLAAIHA
VDLTRTGLATLDDGAGHLDRELGHWAAEMNRVKRGPLPALERLHRALLAG
KPAPCPRITLVHGDAKPGNFAFTGGEVSAVFDWEMTTVGDPLTDIGWLEM
LWMQPVGINSHPAALPIDALLAHYQSASGIEPVNRPWYRAFNAYKMAVIC
LIGAMLVEDGHSDDQKLVLAAYGTGLLTKAGLAELGIDEPLDDGPVLPRQ
ERIQQVLARAQ
41410407NP_963243.1 hypothetical protein MAP4309 [Mycobacterium avium subsp. paratuberculosMGKHQVDQAVVLTVSGEVDMLSSPMLAEAIQTALAAKPAALIVDLSKVGF
LASAGMTVLVTTQAELQPPTKFAVVADGSATSRPIKLMGIDSVLSLYPSL
NDALSALSGA
41410406NP_963242.1 fructose-1-6-bisphosphate aldolase [Mycobacterium avium subsp. paratubeMPVRAMRKWESSMSNQQQAERMTSGKGFIAALDQSGGSTPKALRLYGIED
SAYSSEKEMFDLIHQMRSRIITSPAFTGDRVLAAILFEQTMDRDIEGKPS
TTYLWETKGVVPILKIDKGLAEASDDVQLMKPIPGLDELLQRAVSKGVFG
TKERSVIGGANPVGIAAVVAQQFELAHQVLSHGLVPIIEPEVTISIADKA
KAEGILRDEITKQLDSVPDGQRVMLKLSLPTEANFYRPLIEHPKVMRVVA
LSGGYSREEANELLAKNAGLIASFSRALTEGLTVDQSDEQFNATLDKAIQ
SIYDASVAG
41410405NP_963241.1 hypothetical protein MAP4307 [Mycobacterium avium subsp. paratuberculosMDDDCLKLTTYLAERRRAGNRFVSDVLLDLYARHRVECAVLLRGIGGFGT
GHRLRSDESLTLSEDPPVAIVATDTRTKIEALLDEVLAVKQRGLVTLERA
RLLHADVGAARPPEGDAVKLTVYLGRKQRVNGTPAYIGVCDLLHRRGLAG
ATVLLGVDGVVHGERRRASFFGRNVDVPMMIVVVGSGAHIGRVLPEIAAL
LRRPLFTLERVRVCKRDGQLLEPPHALPGVDERGLPLFQQLTVYTSESAR
HGGVPIHRAIVARLRQATAADGATVLRGVWGFHGDHPPHGDGLFALTRRV
PVVTIVIDTPAHIAESFAVIDELTGAEGLVTSEMVPALVSDDGGPGAGRM
ARHRY
41410404NP_963240.1 hypothetical protein MAP4306 [Mycobacterium avium subsp. paratuberculosMSLQDRFAPERLIAAACEEAGSDDFGAEGWRPGLHRLTDGLINDARLSDI
GVEIAHLDIMRALKNRLNVIAWRKAHPEVAEQKISAPIFIVGQPRTGTTI
LYDLLAQDPALRAPLTWEVDEPCPVPRPETYHDDPRIARTQAGIDLSEQI
MPGFLAFHPMGALVGQECVRITAAEFVSMIFSVQYRLPNYYRWLLYEADH
AGAYRFHRIFLQHLQSGVPGQWLLKSPAHLWQLDALLAEYPDALIVQTHR
DPLNVISSIAALTHHLRGMCSDESSITECAAQSYEEIVVGLDREMALRDR
GAVPPGRVIDVQYADFMKDPWTTIKDIYERLDRELRPDAEQRMREFLASH
PSDGGRSRYTWSDTGLDAGAVRERVRTYQDRYGVPTEALR
41410403NP_963239.1 hypothetical protein MAP4305 [Mycobacterium avium subsp. paratuberculosMTVEADPERPSFFDMCSDNRMVGGPNPDGNYYLAMIRGDRRYRITGTRGT
SAYLGFQILAGTGLTPRRMAGYLSDADLASEAGQFALLLSADEPSDPAGA
QWVKIPPDASSVVVREYIGDRAAEQLAALRIEALDPGPLTPLTDEQLADQ
FTAMAWSLMKLATLHLTIKPELLQSPNTLLTAQAADLGEADTTPDNLYMM
GTFRLDPGQALVLDIAPPDTRYWNVTLESIWHECLEPRRRHSSVTNRGVR
PDADGRVRIAISARDFGFGHWLDTGGRHRGFVVLRWLDNPSPPEVAVSVR
EARERP
41410402NP_963238.1 hypothetical protein MAP4304 [Mycobacterium avium subsp. paratuberculosMADYRGGSGYVKRARSPASGRRLRIRRSEDHQMPTDPNGPAAPRRRSEKS
RTAIVTATRELLLERGFDGLTIEAVAARAGVGKQTIYRWWPTRPALVADV
MLEDADRLLASVEHSGDLAADLVGWVGKLVTSLTTPRGSAMLRTLTVACM
EHEDTAVKLRAGFSAPLHDSVRARLLAEGVDAATAESAADAIVGGVVYPI
LSGAQRYSRRRAEHTTRLIVAALTAG
41410401NP_963237.1 hypothetical protein MAP4303c [Mycobacterium avium subsp. paratuberculoMTLGLSPEQQELGDAVGQFAARNAPIAATRDSFAELAAGRLPRWWDGLVA
NGFHAVHLPEELGGQGGRLMDAACVLESAGKSLLPGPLLPTVAAGAVALL
ADPAPAARSVLRDLAAGIPAAVVLPGDGDLHAGAGDGHWLLSGASEVTAG
VCAARIVLVGARTRDGELVWAAVDTEKPTATVEPISGTDLVADAGVLRLD
NHRVLDSEVLTGIDPERARCVVLGLVAATTAGVIQWCVQAVTAHLRIREQ
FGKVIGTFQALQHSAAMLLVSSELATAAAWDAVRAGDESLEQHRMAAAGA
AVMAISPAPDLVLDALTMFGAIGFTWEHDLHLYWRRAISLAASIGPANRW
ARRLGELTCTRQRDMAVNLGDAESELRAKVAETLDAALELRNDQPGRQGD
YSEFETGPQRTLISDAGLIAPHWPKPWGLDAGPLRQLIIDDEFAKRPALV
RPSLGIAEWILPSVIRAAPKDLQEKLIPPTLRGEIAWCQLFSEPGAGSDL
AALSTRATKVDGGWTINGHKIWTSAAHRADYGALLARTDPQAGKHRGIGY
FVVDMRSAGIEVQPIKTATGDAHFNEVFLTDVFVPDDMLLGEPTGGWNLA
IATMAEERSAISGYVKFDRAAALRRLAAQPGPDRDDALRELGRLDAYTTR
SRRWECARPSGCSTARRPGRRPASPRWR
41410400NP_963236.1 hypothetical protein MAP4302c [Mycobacterium avium subsp. paratuberculoMGLRGEAAIVGYVELPPERLSKASPAPFVLEQWAEPGAAALQDAGLPGEV
VNGIVASHLAESEIFVPSTIAEYLGVGARFAEHVVLGGASAAAMVWRAAA
AIELGICDAVLCALPARYITPSSKKKPRPMVDAMFFGSSSNQYGSPQAEF
EIPYGNLGQNGPYGQVAQRYAAVYGYDERAMAKIVVDQRVNANHTDGAIW
RDTPLTVEDVLASPVIADPLHMLEIVMPCVGGAAVVVANADLAKRARHRP
VWVKGFGEHVPFKTPTYAEDLLRTPIAAAADTAFAMTGLSRAQMDMVSIY
DCYTITVLLSLEDAGFCEKGRGMEFVADHDLTFRGDFPLNTAGGQLGFGQ
AGLAGGMHHVCDATRQIMGRAGAAQVPDCNRAFVSGNGGILSEQTTLILE
GD
41410399NP_963235.1 hypothetical protein MAP4301c [Mycobacterium avium subsp. paratuberculoMTTFERPMPVKTPTTAPFWDALAQHRIVIQYSPSLQSYVFYPRVRAPRTL
ADDLEWREISGMGSLYSYTVAHRPVSPHFADAVPQLLAIVEWDEGPRFST
EMVNVDPAQLRVGMRVQPVFCDYPEHDVTLLRYQPAD
41410398NP_963234.1 hypothetical protein MAP4300 [Mycobacterium avium subsp. paratuberculosMTGPQGNGNSSSNKAARPTTADVARLAGVSTATVSYVLNNARGRRISPDT
RDAVYRAAKLLGYRPNLAARNLARGKSGVVLYVVPHVAVGEMPMQAGSRM
TTALAREGLLQVQVFETDDDQHVVDAIANLDPVAVTSLFPLSAAARRAVT
EAGIPHIEIGTLPALNDPHLSVGEMRIAHLVERGHRRIAFAYTGIARWRP
LGDYWFEGVSRAARLRGLPPVRADEVTLDTAASVVSAWVRDGVTAVCAQS
DEIACLVLYGIHRAGLRCPGDLAVMGVDASPMGMVSTPPLTTVQFDPCAV
ADAALAAVFERLGHAAPPSPELTDIARLVVRSST
41410397NP_963233.1 hypothetical protein MAP4299c [Mycobacterium avium subsp. paratuberculoMNKDDLILISVDDHIAEPADMFDAHVPAKYKDRAPRVVVEPDGIQQWYYG
DIHGRNMGLNAVAGKPREMYNIDASRYDEMRPGCFNVDERVRDMNAGGQL
AGLNFPNFTGFSGQVLNQAPDREVNLVMIKAYNDWHIDEWCAAYPGRFIP
CGILPLFDVAEAAKEVNRLAAKGCHAVTFSENPEALQMPSIHTRYWYPLF
EAVCENKTVLCTHVGSASRSPQVSTDAPPSVQMTASSMMSMFTFTELIWA
QFWADFPELKFSLTEGDVGWIPYFLWRAEHVYNRHSGWTLATFPPGYSGP
TDVFKRHFYTCFISDKVGVRNMDWFNEDMLCWESDFPHSDSNWPFAPEDV
IDTMGHLDDAVINKITHENAMAAYSFDPFRHIPKEQARAGHLRAQATDVD
VVTHVGHRASQRDRDAWARMTQFALQAQASAQAPVTVEAAGIAGRATTLG
N
41410396NP_963232.1 hypothetical protein MAP4298c [Mycobacterium avium subsp. paratuberculoMGPAPFAHWRVLEFSNGLAVSYCGKMFADAGADVVKVESPQGDSMRRWSA
GGPPGALFGYLAAGKRSVVGRGRAEVAALLAGADLVLTDLTDGWTLDELT
GRTGPSAVVVAITPFGTTGPYVDQQVVANEFILQALCGSIAGRGWPGDEP
VQAGGRLGEWLAGTFAAAAAAATARHAARTGRGEVIDVSTYEAMVIAMGG
LSAMSASVLGADSLLHERSLELPSIVPTADGMVGFCTITAQQFQDFLVMI
DRADLVDDAELASFAGRVARRDEFLDMVTGWTRTRTTQEIVDLAVAFRIP
VAPIANPETLAKLDHFVQRVVFVESPAGVLAPRVPYRSDAITTRPPSEPP
ALGADNGRVHWPPRPEPARGEDAGTLPLSGIRVTDLTAFWAGPVATQLLG
ALGADVIKIEGVRRPDGMRFSAGRPPDWDQWWEWGPVFLCSNNNKRGISV
DLGTEAGRSIALGLIAAGDLVVENFSPRVMANFGLEWDAVRAANPRAVMI
RMPAFGLDGPWRDRVGFAQTMEQATGMAWMTGHPEGPPVIPRGVCDPIAG
LHAAFAAVAALTVRDREGTGMQVEATMVEAALNVAAEMLVEYSRNGIALR
RNRNRGPGASPQGVYRCRGDDAWVALAALDDTARASLARLLGRAEPGDTG
WDEHADDVDKLISDWAAGRTVADAVDALRAAGVAAAPVTPAAALLADPQL
HARGFWETVDHPVAGTFLCTGMPFAFLGKPRRWLRRVPPRYGEHTAEVLT
ELLGHSDADLAELRASGTISDRPAGL
41410395NP_963231.1 hypothetical protein MAP4297c [Mycobacterium avium subsp. paratuberculoMKTRPAKRTAAIVGVHNTRQGRRLDGETSRSLALKAIRGALDDAGLCLDD
VDGISAGPLSTALIYDLRLGPAWQGLGFGVGMITEAATAIEHGMAEVVVL
VASQAGEYRDHEATAPWTRPENEFVAPWGMFTTAEFALIARRHMHVYGTT
REQLSTVAATIRNNGSRNPEAVYYRRGPFTPDDITASRPIADPFHLLDCA
TTSEGGCALVLANLEKVDTASQPIYVLGSGADFHGPSYQHPPAFDLAGRR
GGDVNGVVGRRAADCAFAHAGLRRDDVDVLELYDPFSFEIIRQLEAFGFC
EDGEGGPFVADGHIALDGSHPVTTDGGTMSFSHAGSNPQMMQRAIRAVQQ
LRGQAGELQVPDAHIALCSNGGAGALFTTVLILGDEPR
41410394NP_963230.1 hypothetical protein MAP4296c [Mycobacterium avium subsp. paratuberculoMTAEPLRPQTGPVPHASSPLSVPFWEGCRSRQLRYQRCRACDLANFPPTE
HCRQCLSDDIGWQQSGGRGEIYSWTVVHRPVTAEFIPPNAPAIITLDEGY
QMLTNVVGVPPGDLRVGLRVRVQFHTVAADVTLPYFTDETDGS
41410393NP_963229.1 hypothetical protein MAP4295c [Mycobacterium avium subsp. paratuberculoMSPRTSNGLPVTAYLVLGVLAANDERLTAGEIKMRAELSVGHFYWSPSVS
HVRRELTRLLARGMVAQTGSQSGKRAITLYETTDAGRDALRRWVQHFPGQ
DQVVIKHPVILKTWLARGEDPERIVDTLERHLDATRARLDEALWSRRRSQ
ELGITADPEQRFSFAVLDYAIRGLYAEISNISQLRDEIAGGTSRDPVKRV
RRSKGQIRRRAPRSPG
41410392NP_963228.1 acyl-CoA synthetase [Mycobacterium avium subsp. paratuberculosis K-10]MAEDTIQALLRKRWSDPGVAVKYGDTQWSWAQYLRDAAARAAALLGAADP
GRPMHVGTLLGNTPEMLSQMAAAGLGGYVLCGLNTTRRGEALAADVRRAD
CQFVVTDAEHRPLLDGLDLVGTQILDTSTPDWAGFVDAAGELTPHRDVAA
MDPFMMIFTSGTSGNPKAVQVSHLMAVFAGSNLVQRFGLTEHDTCYVSMP
LFHSNAVVAGWAPAVCSGAAIVPAKFSARNFLDDIRRYGATYMNYVGKPL
AYVLATPERADDADNPLRVAFGNEANDKDIEEFGRWFGVQVEDGFGSTEN
AVIVIREPGTPRGSIGRGIDGVAIYNSDTVTECPVARFDADGALINADEA
VGELVNTAGSGFFTGYYNDPDANAERMRHDMYWSGDLAYRDADGWIYLAG
RTADWMRVDGENLAAAPIERILLRHSAINRVAVYAVPDGHVGDQVMAAVV
LNDGETLTPAAFEAFLDAQPDLSPKARPRYVRIAADLPSTATHKVLKRQL
ISQGTAVAAGEVLWEREPRGTAYTVVASPDCGVPGDGSAPSTVAPV
41410391NP_963227.1 hypothetical protein MAP4293 [Mycobacterium avium subsp. paratuberculosMTDELRGRRILVTGAATGIGAAAVSVLTDAGADVVATYHTTPPPPDLTAH
WLQCDARDADAVSALVHRAAEHLGGLDVLVHAAGLWQPGIPGCIGADDIS
FLLDTNVKATILTNQAAHAAMKAQDPKGGRIINFGSSEAVMGSPISAVYA
ATKGAVQAWTRSAAKAWAADHVTVNALAPAVQTPGADRLRAFLGPDAAAL
IDQQMQMMIPLGGALGEPARDLGPMLVFLAGSGSGFITGQLLAVDGGLMM
VGA
41410390NP_963226.1 hypothetical protein MAP4292 [Mycobacterium avium subsp. paratuberculosMSTIDISAGTIHYEATGPADGRPVVFVHGYLMGGQLWRQVGDRLAGRGLR
CIAPTWPMGAHPEPLRRGADRTITGVAAMVAELLSALDLEDVVLVGNDTG
GVVSQLVAVHHRERLGALVLTSCDAFEHFPPPVLRPVILAAKSKATFRAV
AQAMRAPAVRKRAFDGLAHSNIDALTELWVRPALSLPAVAEDLRRFTLSL
RTEVTTAAATRLYDFDKPTLIAWSADDVFFAQEDGARLAATIPNARHEVI
AGARTFSMVDQPDRLADLLSTVAVRT
41410389NP_963225.1 hypothetical protein MAP4291c [Mycobacterium avium subsp. paratuberculoMESKRRTQEERSAATRDALIAAARKLWGLRGYTEVGTPEIAAAAGVTRGA
MYHQFADKAALFRAVVEAVEQDVMARMAVVVAESGASTPTDAIRAAVDAW
LEVSADPEVRQLILLDAPSVLGWAEFRDVAQRYSLGMTEQLLTEAIRAGE
LAEQPVRPLAHVLIGALDEAAMVIATADDPDRARRETRQVLQRLVDGMFD
AR
41410388NP_963224.1 hypothetical protein MAP4290 [Mycobacterium avium subsp. paratuberculosMLGGNGLHGVSHPKVDDRAGVPAGTTSFYFRTRKALVHAMAGRLAELDVA
DFSMMAELAEDHATEFAGTAGLARIVMYVNSEPWLTRAKARYELALLAGR
DPELAAALSESADRLYALARNVVTQWHPAGSAPDPALVDDQATATLAFIN
GIMLTFVAGQPAVDDAGQLDRLIQGVIAGVAHVRGA
41410387NP_963223.1 hypothetical protein MAP4289 [Mycobacterium avium subsp. paratuberculosMRDCYRSVMRRVAGVFAALVLMAGTLTGPAIARADGDEPQYADFYTPPDP
LPPGRPGDLIRTEPSRLVLEPSGQLGAIMATGTRIMYRSTDTRGNPIAVT
GTYFEPYNDWPYGGPRPLMSYAPGTQGQGNQCAPSRMFNQGIHYSGGWDI
MFNYEELFVATMVARGFAIVMTDYQGLGTPSMHTYVGRVAEGQAVLDAAR
TAMRLPGTSLDPHGPVAFWGYSQGGGATASAAELAAQYAPDLHIVGTYAG
APPADLKELLPYADGSALVGVVGYALNSVMAAYPEFADAIRSKMTPRGLA
MLESVSRQCVGQTLLDFMFRHIQPYFTEDINQLVNEEPFNSLFEAQRIGR
YKPNAPVLINSNRYDPLVPWTAANQLGRDWCAQGADVEFRTNEEPPFLNK
LVINHALPMLVDGEPAMQWIAARFRGEPTAPNCGQF
41410386NP_963222.1 LpqP [Mycobacterium avium subsp. paratuberculosis K-10]MPAGCHHGPMRFGCARAVNLGLLPVLVVVLAGCLAGGHALGTPDSQSIPV
GPSTHTLQSGGTPRSYHLYRPQGLSEAAPLVVMLHGGFGNGEQAERAYHW
DAEADAGHFLVAYPDGLGRAWNAGTCCGEPAHAGTDDVGFVNAVVGAIAA
QIPVDRARVYVTGMSNGAMMALRLGCQSDTLAAIAPVAGTLLTDCSAARP
ASVLQIHGTADDRVPYAGGPGKAFALNGSPRVDGPSVESVNATWRAIDAC
GPPSSTTAGDVTTQTAGCADGRTVELISVAGCGHQWPGGAPSPLAEKVAG
IPAPSTALDATDTIWQFFARNHR
41410385NP_963221.1 hypothetical protein MAP4287c [Mycobacterium avium subsp. paratuberculoMREGARGGWEPTVPALVNLVAAAGAPRLRAAFAEAGLDGIRPAQSLALVP
LAAGGLHASDLADRLRVSRQAVAQAVAALERHGYVTRTPDPADARARIIE
LTPRGRQALQVMRANAIAMEKRWRKVLGERRLTELRETLTVLLAAEREPG
G
41410384NP_963220.1 hypothetical protein MAP4286 [Mycobacterium avium subsp. paratuberculosMALPPDDRRPACPAMNRRQFLGSLAASVVAGVGAARLIVDPQPRTFAQTP
AAAIPTSGPTAPQALLPPPPLSARIPLPGGGALMKIPGEGDLLALTVDDG
VNSEVVRAYTQFAKDTGVRLTYFVNGVYDSWTENLQLLRPLVDSGQIQLG
NHTWSHPDLTTLTKEQVAEQLSRNDAFLKKTYGIGAKPYWRPPYAKRNAA
VDAVAADLGYQVPTLWSGSLSDSTLITEDYILQMADQYFTPQAIVIGHLN
HLPVTHVYPQLVDIIRERNLRTVTLNDVFLKTP
41410383NP_963219.1 hypothetical protein MAP4285 [Mycobacterium avium subsp. paratuberculosMVGPPLSVIPADRSTATSPSRSARSSKRSRPLEQFFGQLSLLHGWLPPTV
QGLALLMLVAAIHWRARGWLKRVLPAALVAAVAVTVLARWYITSLGVAGD
PAPTALWFWIALSGLAAAVFLVGWRGVRWWRRGLAVLSIPLCVLCAGLAL
NGWVGYFPTVLAAWNQLTQAPLPDQIDRLRVTEMQIAGTRPSKGVVVPVD
IDGNGPSGSHFAHRRELVYLPPAWFNSNPPPRLPAVMMISSAFNTPADWL
GPGGAFTAIDNFAAAHHGFAPVLVFVDPTGSFDNDTECVNGSRGNAADHL
TKDIQPFMVSNFGVSADRANWGVAGWSMGGTCAVDLAVMHPEMFRAFVDI
AGDRGPNVGPKDQSVARLFGGDQAAWAAFDPVTVMTRHGRYADLSGWFEV
PGADVARTAQQGNADPAPALVASSSDPAANPEGQDAAAHSLCAVGAANGI
ACAVVTQPGKHDWPFAAQAFATALPWLAWTIGTPNTEPVQLPQRAAAPPR
41410382NP_963218.1 CtpA [Mycobacterium avium subsp. paratuberculosis K-10]MSTPPRHVDEGTFPDHTASTARIELEITGMTCASCAARIEKKLNKLDGVT
ATVNYATEKAAVSAPASYDPQTLITEIENAGYAAAVAKPSPPRDDPELAS
LRRRLVTATALAGPVIAVAMIPALQFQHWHWAALALTAPVVGWCGRPFHA
AAWANLKHGVATMDTLISIGTLAAFLWSLYALVLGAADRPGMRHDFELTV
GHGAHVSHVAAPCHVYFEVAAGVTLFVLAGRYFERRSKRTAGAALRALLA
LGAKDVAVLRAGAETRIPIERLAVGDEFVVRPGERIATDGIVVAGSSAVD
AAMLTGESVPVEVGVGDGVTGGTVNAGGRLVVRATGIGDDTQLARMAQLV
ERAQSGKADAQRLADRVSGVFVPVVLLLAVATLAGWLTAGGTLATALTAA
VAVLIIACPCALGLATPTALLVGTGRAAQLGVLIKGPEVLETTRAVDTVV
LDKTGTVTTGAMTVLDVVAADGTDRATLLRYAGALEAASEHPIAHAIARD
AKAELGPLPTPTGFRAVGGGGVHGRVDGHAVAVGRPRWLAERGLRPDAAL
AAAAARAEHDGKTVVAVGWDGRARGILALADTVKPCSAAAVRQFTRLGLT
PILLTGDNHTVARRIAGELGIGEVISGALPADKVEAVKRLQSAGRVVAMG
TGTDVAIEAADVTVVRGDLRAAVDAIRLSRRTLATIKTNLVWAFGYNLAA
IPLAALGMLNPMLAGAAMALSSVLVVGNSLRLRSFASIIPGA
41410381NP_963217.1 hypothetical protein MAP4283 [Mycobacterium avium subsp. paratuberculosMPTSEYQVSGMSCGHCEAAVHSEVARIPGVDGVSVSADTGRLVVTSAVPI
DTDAVLGAVDEAGFQAVLVA
41410380NP_963216.1 hypothetical protein MAP4282 [Mycobacterium avium subsp. paratuberculosMSQSLTDKVALITGAARGQGRAHAARLAAEGADIIAVDLAGPLPPSVPYD
SSTPEDLAETAELVRAAGRRVVTAQTDVRDLDALTSSVDTAVGELGRLDV
IVANAGICSPAPWNRITAQAFRDTIDTNVVGTWNTVMAGAQHIIDGGRGG
SIILIGSAAGINMQSFMVHYTASKHAVVGMARAFAAELGRYNIRVNSLNP
GAVATPMGTGRMRDALRAAADDYPHLRGLHKPLLPEGIAQPEDIADAVAW
LASDQSRLVTASQVSVDLGVGYV
41410379NP_963215.1 hypothetical protein MAP4281 [Mycobacterium avium subsp. paratuberculosMTVTEVVVAQPVWAGVDAGKADHYCMVINDDAQRLLSQRVANDEAALLEL
IAAVTTLADGGEVTWAIDLNAGGAALLIALLIAAGQRLLYIPGRTVHHAA
GSYRGEGKTDAKDAAIIADQARMRHDLQPLRAGDDIAVELRILTSRRSDL
VADRTRAINRMRAQLLEYFPALERAFDYNKSRAALILLTGYQTPDALRSA
GGARVAAFLRKRKARNADTVAATALQAANAQHSIVPGQQLAATVVARLAK
EVMALDTEIGDTDAMIEERFRRHRHAEIILSMPGFGVILGAEFLAATGGD
MAAFASADRLAGVAGLAPVPRDSGRISGNLKRPRRYDRRLLRACYLSALV
SIRTDPSSRTYYDRKRTEGKRHTQAVLALARRRLNVLWAMLRDHAVYHPA
TTTAAA
41410378NP_963214.1 ChoD [Mycobacterium avium subsp. paratuberculosis K-10]MKPDYDVLIIGSGFGGSVSALRLTEKGYRVGVLEAGRRFADEDFAETSWD
LHKFLWAPKLGCYGIQRIHPLKNVLILAFMWLLCWMAEGDWPPGVPRRLD
R
41410377NP_963213.1 inositol-5-monophosphate dehydrogenase [Mycobacterium avium subsp. paraMVEIGMGRTARRSYELSEVSIVASRRTRSSQDVSTAWQLDAYRFEIPVLA
HPTDALVSPEFAIELGRLGGLGVLNGEGLIGRHADVEAKIAQLVEAASKE
PEPSAAIRLLQELHAAPLNPDLLGSAVARIREAGVTTAVRVSPQNAQALT
PVLLQAGIDLLVIQGTIVSAERVASDGEPLNLKTFISELDVPVVAGGVQD
HRTALHLMRTGAAGVIVGYGATRGVTTSDEVLGISVPMATAIADAAAARR
EYLDETGGRYVHVLADGDIHTSGELAKAIACGADAVVLGTPLAEAAEALG
EGWFWPAAAAHPSLPRGALLQVAIGERPPLRQVLNGPSDDPFGSLNLVGG
LRRSMAKAGYCDLKEFQKVGLTVGS
41410376NP_963212.1 inositol-5-monophosphate dehydrogenase [Mycobacterium avium subsp. paraMTRGTSHLEDSSDLVGSAYVRVGGLVDDPVPTGGDNPHKIAMLGLTFDDV
LLLPAASDVVPATADTSSQLTKKIRLKVPLVSSAMDTVTESRMAIAMARA
GGMGVLHRNLPVAEQAGQVEMVKRSEAGMVTDPVTCRPDNTLAQVDALCA
RFRISGLPVVDDSGALVGIITNRDMRFEVDQTKKVAEVMTKAPLITAQEG
VSADAALGLLRRNKIEKLPIVDGHGRLTGLITVKDFVKTEQHPLATKDSD
GRLLVGAAVGVGGDAWVRAMMLVDAGVDVLVVDTAHAHNRLVLDMVGKLK
AEVGERVEVIGGNVATRAAAAALVAAGADAVKVGVGPGSICTTRVVAGVG
APQITAILEAVAACGPAGVPVIADGGLQYSGDIAKALAAGASTAMLGSLL
AGTAEAPGELIFVNGKQFKSYRGMGSLGAMAGRGSGAGKSYSKDRYFADD
ALSEDKLVPEGIEGRVPFRGPLSSVIHQLTGGLRAAMGYTGSPTIEALQQ
AQFVRITAAGLRESHPHDVAMTVEAPNYYAR
41410375NP_963211.1 hypothetical protein MAP4277c [Mycobacterium avium subsp. paratuberculoMRDHLPPGLPPDPFADDPCDPSAALDAVEPGQPLDQQERMAVEADLADLA
VYEALLAHKGIRGLVVCCDECQQDHYHDWDMLRANLLQLLIDGTVRPHEP
AYDPEPDAYVTWDYCRGYADASLNEATSDADGFHRRH
41410374NP_963210.1 hypothetical protein MAP4276 [Mycobacterium avium subsp. paratuberculosMTVPESLDEFARTDLLLDALAQRRPVPRGQVEDPDDPDFQMLTTLLEDWR
DNLRWPPASALVTPEEAVNALRAGLAERRRGHRGLAVVGSVAATLMLLSG
FGAMVVEARPGSTLYGLHAMFFDQPRVNEKDQVMLAAKADLAKVAESIDK
GQWDQARTQLTEVSSLVASIDDPATKQDLMTQLNLLNAKVDSRNPNATLP
AAAPSMAPSVAVPAAPPPAASIAPTPAAPPAPLSPAPASTPSPSPSVGKH
HHHGQPPAVAPVNPNQ
41410373NP_963209.1 RNA polymerase sigma factor SigD [Mycobacterium avium subsp. paratubercMEISPSMTIPAGERLDAVVAKAVTGDHNALREVLETIRPIVVRYCRARVG
TVERGGLSADDVAQEVCLATITALPRYRDRGRPFLAFLYGIAAHKVADAH
RAAGRDLAYPTESIPDRWSNDAGPEQLAIEADSVSRMSELLEILPAKQRE
ILILRVVVGLSAEETAAAVGSTTGAVRVAQHRALSRLKSEMIAAGDCA
41410372NP_963208.1 hypothetical protein MAP4274 [Mycobacterium avium subsp. paratuberculosMQADVAGSVDRLLAEAAFGDRPDRWPLPAAGTPAQLWLRAVAAGGQGRYG
AALHDLARLRRTATAGRLASLAHSTQGSFLRQLGWHALARGWDGRALALA
GDDPEAGADALIGLAADALGVGRFAAAAALLARVEPLLDSENIVPQRISV
RRGWVAAELAMARGDGELAVRRAGEAVEAAAATAAGAAGAAARHRVKSEV
VLAAALCSAGDIERARAVADTALHTTARLRLVPLRWALACLLIDIGSVEF
SSRQLHEIREVCAGQVRRAGGTWRSA
41410371NP_963207.1 WhiB3 [Mycobacterium avium subsp. paratuberculosis K-10]MPQPEQLPGPNADIWNWQLHGLCRGVDSSMFFHPDGERGRARMQREQRAK
EMCRQCPVIQECRSHALEVGEPYGVWGGLSESERDLLLKGEIGRGRGIRR
SA
41410370NP_963206.1 hypothetical protein MAP4272c [Mycobacterium avium subsp. paratuberculoMHKGATFAVAAVTAAIAPLAACANQQSSQPNTAPLTSSVPGSERLTTQLK
TAEGIPVANASFEFANGYATVTVEAGPNQVLSPGFHGLQIHAVGKCEANS
TAPTGGSTGDFESAGAVYQAPDHTGYPASGDLTALQVRSDGSAKLVTTSN
AFTAADLRTSSGSALILHQNANNLANTPAADSGKRLACGVIAASSATSTT
TTPTTSVTTSTTTVAVPPPSTSTSTSTVTVTGTPTATSTPTTTVTTPPSL
PPGR
41410369NP_963205.1 hypothetical protein MAP4271 [Mycobacterium avium subsp. paratuberculosMIRTQVCVAGGGPAGMVHALLLARAGIPVVVLEKHNDFLRDFRGDTVHPT
TLRIMDELGLIDEFLRLPHTKIDTVAFDTDGSIRTFGNFKVLKRLGFNQP
YIAMMPQWDFLDFIAEKASAYPEFTLIRNAEVTDLILEGDRVAGVRTPHD
EVRADLVIAADGRKSAVRAAAGLRTAQAHSPMDVLWFRLKWRPGDPRELF
GVFRKGLMMAMIYRGDYWQVAYLMPKGASPKGGSLEEFKERIVTAQPRLR
EHVNDLTSWDDTSELDVRVDRLETWWRTGLLCIGDAAHAMSPAGGVGINL
AVADAVAAANILCAPLQQGLVTDRDLAKVQRRRELPTRIVQAVQVLMQDN
AIAPNLNGDLSPIHVPKIVGFGPLQAIPPLVVGRGFRPEHVRTPDVHAR
41410368NP_963204.1 hypothetical protein MAP4270 [Mycobacterium avium subsp. paratuberculosMTQPTAGWYPDPSNPSRQRYFDGTAWTESYAPFPAPPPGVGQPVKPSRQK
KSDKKWILGAGAVVVVLIAIASGGNDGDKKTVAESNTAASVPSRASAPTK
PKHVGPAVAPAGSPVRDGKFEFQVLGVDRSATKEGVFSLQQAKGEFFVVK
LRVTNIGDKSQSFSASNQKLIIDGKKFDATTSLSDNTWMEDINPGLGMDG
SVSFDIPPGAVPEAIEFHDSMFSGGARVAL
41410367NP_963203.1 hypothetical protein MAP4269c [Mycobacterium avium subsp. paratuberculoMRKWEVDLTLIEAWMDALDDEEYDNLIAALEQLEEHGPITRRPFVDTLEG
SRHPNMKELRPRPTKAGAHIRVLFAFDTRSRAIMLIAGDKAGNWSKWYAK
HIPIADELFDAHQKRLHKAAAKATNRKPRKGKKR
41410366NP_963202.1 hypothetical protein MAP4268c [Mycobacterium avium subsp. paratuberculoMTNLDDMRRRRPGNRTRIDAIKAEMDREVAQYRLRELREAAGYTQTTLAA
AIGVGQNRVSQMEHGDLGTSRVDTLRKYVEATGGELEVSVKRPDGSRVLL
SL
41410365NP_963201.1 hypothetical protein MAP4267 [Mycobacterium avium subsp. paratuberculosMVLRRGVLVVFGGRQRSRDSPTGDSSRARRVIVLHRSRSWRRPRIRLPDL
CRDRVEADVRRDLLYCFGSPSILYRWPRHSTASERRGHPRITSRSRYLDT
VLEAFALGLGRRALQAEENP
41410364NP_963200.1 hypothetical protein MAP4266 [Mycobacterium avium subsp. paratuberculosMDRIWQWVWDRHGAKYPWVIWAFGFTSMFVTYALWSLVITCYERSSHYLE
AVVVTGVGVVLQSLVVLPVRRRFRLMRPVSASDQVDRFQALNETYVWSRT
ARIRQLWFVPIWAATFFAIVSVLAGAHGMRVVEYVIVGGAMGIVTTLISL
HTFMEGSLRPVRAALAGDSGIGDALPRSRPTFAWWLEVSMLSALCNFTTA
GMMVGALLGRVSDSPLLPLLIACVATAALAAPVTVGAIVSPALHPIRDLA
EGTERVAAGDYTRRVPVVQDDDLGALTASFNRMQAGLTERQRLQAAFGTY
VDPALAARLLEQGDDVFTGERREVTVMFVDVRDFTPFAEANSAEDTVARL
NALFEIVVPAVVDGGGHVNKFLGDGALAVFGAPNDLADHADAAVSAALLI
HRLVAKRFGGVLRIGIGINTGVVIAGTIGGGGKLEFTLIGDAVNVAARVE
QLTKTTGDAILVTQQTVDALVSRPPGLSDRGTHALKGKSAPTAVFGLDPA
VTPSHRLG
41410363NP_963199.1 molecular chaperone GroEL [Mycobacterium avium subsp. paratuberculosis MSKIIEYDETARRAIEAGVNTLADAVRVTLGPRGRHVVLAKAFGGPAVTN
DGVTVAREIDLEDPFENLGAQLVKSVATKTNDVAGDGTTTATVLAQALVK
GGLRLVAAGANPIELGAGISKAADAVSEALLASATPVSGKDAIAQVATVS
SRDQVLGELVGEAMTKVGVDGVVSVEESSTLNTELEFTEGVGFDKGFLSA
YFVTDFDAQQAVLDDPVILLHQEKISSLPDLLPMLEKVAESGKPLLIIAE
DIEGEALATLVVNSIRKTLKAVAVKAPFFGDRRKAFLEDLAIVTGGQVIN
PDTGLLLREVGTEVLGSARRVVVSKDDTIIVDGGGAKDAVANRIKQLRAE
IEKTDSDWDREKLQERLAKLAGGVAVIKVGAATETALKERKESVEDAVAA
AKAAVEEGIVAGGGSALLQARKALDELRGSLSGDQALGVDVFAEALGAPL
YWIASNAGLDGAVAVHKVAELPAGHGLNAEKLSYGDLIADGVIDPVKVTR
SAVLNSASVARMVLTTETAVVDKPAEEADDHGHGHHHH
41410362NP_963198.1 molecular chaperone GroES [Mycobacterium avium subsp. paratuberculosis MAKVNIKPLEDKILVQANEAETTTASGLVIPDTAKEKPQEGTVVAVGPGR
WDDDGAKRIPLDVSEGDTVIYSKYGGTEIKYNGEEYLILSARDVLAVVSK
41410361NP_963197.1 O-sialoglycoprotein endopeptidase [Mycobacterium avium subsp. paratuberMTTILAIETSCDETGVGIARLDADGAVTLLADEVASSVDEHVRFGGVVPE
IASRAHLEALGPTMRRALSAAGVTKPDVVAATIGPGLAGALLVGVAAAKA
YSAAWGVPFYAVNHLGGHLAADVYQHGPLPECVALLVSGGHTHLLQVRSL
GDPIVELGSTVDDAAGEAYDKVARLLGLGYPGGRVLDELARTGDREAIVF
PRGMTGPRDAPYAFSFSGLKTAVARYLESHPDAVNADVAAGFQEAVADVL
TRKAVRAATDLGVTTLLIAGGVAANSRLRELAEQRCAAAGLTLRIPRPGL
CTDNGAMIASFAAHLVAAGAPPSPLDVPTDPGLPVVKAQVS
41410360NP_963196.1 hypothetical protein MAP4262 [Mycobacterium avium subsp. paratuberculosMTAGGEPVTVGALTRADARRCAELEAQLFDGDDPWPAAAFHRELASAHNH
YVGARVGDTLVGYAGISRLGRVPPYEYEIHTIGVDPAYQGRGIGRLMLDR
LLEFADGGVVYLEVRTDNEPAIGLYRSVGFEQIGLRRRYYRISGADAYTM
RRKARQ
41410359NP_963195.1 hypothetical protein MAP4261 [Mycobacterium avium subsp. paratuberculosMSPLVLALDTSTPAVTAGIVRRDDLSVLAQRITVDARAHAERLTPNVLAA
LHDSGLNMTDLVAVVVGCGPGPFTGLRAGMATAAAYGHALGIPVHGVCSL
DAIGGQTTGDTLVVTDARRREVYWARYRDGVRTDGPAVAAPADVDPGGAE
AVAGSPEHARLFGLPVTGPAHPTPAGLVAAVGDWSVRPQPLVPLYLRRPD
ATPRAARP
41410358NP_963194.1 hypothetical protein MAP4260 [Mycobacterium avium subsp. paratuberculosMAESGTATLPTAQDTAALGARLAEQLRAGDVVVLSGPLGAGKTVLAKGIA
AAMDVDGPVTSPSYVLARVHPPRRPGAPTMIHVDLYRLLDHTGNQGADLL
GELDSLDLDSDLDDAVVVAEWGEGLVERLAPRHLDIRLERVSGSDVRIAT
WRWAGGEPS
41410357NP_963193.1 hypothetical protein MAP4259 [Mycobacterium avium subsp. paratuberculosMTQRATIEDPYADEDFNTFDGDRALVVTTPDGVPLAVREAGPPDAPLTMV
FVHGFCLQMGAFHFQRTRLPEQLGPDVRMVFYDQRGHGRSGEAAPESYTL
TQLGRDLQTVLQVVAPRGLVVLVGHSMGGMTVLSHARQFPEQYGRRIVGA
ALISSAAEGVSRSPLGEILKNPALEAVRVAARSAPKLMHRGRNVSRSLIG
PVLRAASFSDLQVSRSLDAFSQRMMNSTPIPTMVGFLDALEHHDETAGLW
TLLRVPTLIACGDHDLLTSDEYSRKMAASLPQSELVIVAGASHLALLDKP
EAINGGLVRLVRRATPSRAALALRRIGERLWRRG
41410356NP_963192.1 alanine racemase [Mycobacterium avium subsp. paratuberculosis K-10]MAAVAVTPISLTPGVLAEALVDLGAIEHNVRLLCEQARGAQVMAVVKADG
YGHGAVQTARAALAAGAAELGVATVDEALALRAAGISAPVLAWLHPPGID
FRPALLAGVQIGLSSQRQLDELLTAVRDTGRTATVTVKVDTRLNRNGVPP
AQYPSMLTALRRAVAEEAIVPRGLMSHMVYADQPANPVNDVQAQRFTDML
AQAREQGVRFEVAHLSNSSATMSRPDLAFDMVRPGIAVYGLSPVPELGDM
GLVPAMTVKCTVALVKSIRAGESVSYGHTWTAQRDTNLALLPVGYADGIF
RSLGGRLQVSINGRRRPGVGRICMDQFVVDLGPGRPDVAEGDEAILFGPG
SNGEPTAQDWADLLGTIHYEVVTSPRGRITRTYREAHTVES
41410355NP_963191.1 GadB [Mycobacterium avium subsp. paratuberculosis K-10]MPQHPSLPAHAIAPAYTGRLFTAPVPALRMPDESMDPDAAYRFIHDELML
DGSSRLNLATFVTTWMDPEAGRLMAETFDKNMIDKDEYPATAAIEQRCVC
MVADLFHAEGLNDADPYSACGVSTIGSSEAVMLGGLAMKWRWRAKTKDWK
KRTPNLVMGSNVQVVWEKFCRYFDVEPRYLPMEEGRYVITPEQVVDAVDE
DTIGVVAILGTTYTGELEPVADICGALDKLALKPASAGGVDVPVHVDAAS
GGFVVPFLHPELKWDFRLPRVVSINVSGHKYGLTYPGVGFVVWRSKEYLP
DELVFRVNYLGGDMPTFTLNFSRPGNQVVGQYYNFLRLGREGYTKVMQTL
SGTARWLGEQLRVSEHCELISDGSAIPVVAFRLAKNRGYTEFDVSHELRT
YGWQVPAYTMPDNATDVSVLRIVVREGLSADLARALHDDAVSALTSLDKV
KPGGHYDAQHFAH
41410354NP_963190.1 hypothetical protein MAP4256 [Mycobacterium avium subsp. paratuberculosMRHYYSVDAIRAAEAPLLASLPDGALMRRAAFGLATEIAAELTARTGGVA
GRRVCAVVGSGDNGGDALWAATFLRRRGAAADAILLNPERAHRKGLAAFG
KAGGRIVESVSPTTDLVIDGVVGISGSGALRPAAAEVFAAVDDAGIPVVA
VDIPSGIDAATGATSGPAVHAVLTVTFGGLKPVHALGDCGRVKLIDIGLD
LPQTDVLGFEAADVAARWPVPGPHDDKYTQGVTGVMAGSATYPGAAVLCT
GAAVAATSGMVRYAGSAHREVLAHWPEVIASPTPASAGRVQSWVVGPGLG
TDDAGAAALWFALETDLPVIVDADGLTMLAAHPELVANRAAPTVLTPHAG
EFARLAGSPPGDDRVGATRKLADTLGVTVLLKGNVTVIADPGGPVYLNPA
GQSWAATAGSGDVLSGMIGALLASGLPAGEAAAAAAFVHARAAALSAADP
GPGEAPTSSSRMVPHIRAALAAL
41410353NP_963189.1 hypothetical protein MAP4255 [Mycobacterium avium subsp. paratuberculosMGQASVRGRVRGMTRAVWHFVISAPLTYGWLLVLMITTIIQNQLTGRQLH
SVLLHRSTNIHELGRDPLDVLFSSLLWIDGKNFEPYLLLFTLFLAPAEHW
LGQLRWLTVGLSSHILATYISEGILYFAIEKHDASERLVHARDIGVSYFL
VGVMAVLTFHIARPWRWGYLGVLFLIFGFPLLTMDRVELNFTAIGHFTSI
LIGLCFYPMTRAKGGRQLSPARLRAMLRRRVAPPARPDVDSGR
41410352NP_963188.1 hypothetical protein MAP4254 [Mycobacterium avium subsp. paratuberculosMRSAGMRYGVVGLVVLVLAAYIGSVVLYAQSGTGRRIDEANPTMDGDRPS
ATINVEDIQSNNSVLAVNLAFNPGSALLDPKTHHLKEDLSLRVRSSAMPS
RHTWTKGMLPGLMAVPLTIAGQIERWPFDQYHSGPLEVEIFYGPDTDRDP
DHVPVTFVDHLSGWQLTATRPQADGPYRLHVRRSMSTAAFAIVILGVLIA
IASLALFVAIQTTRDRRPFQPPMTTWYAAMLFAVVPLRNALPGSPPFGSW
VDITVVIWVLVALAISMVLYIGCWWRHLNPPPAAAPAQPAQPAPATTGG
41410351NP_963187.1 D-fructose-6-phosphate amidotransferase [Mycobacterium avium subsp. parMCGIVGYVGQQPACAVVMAALRRMEYRGYDSSGVALVNGDGTLTVSRRAG
RLANLEEAVAQLPPSALTGTTGLGHTRWATHGRPTDRNAHPHRDAAGKIA
VVHNGIIENYAGLRHELEADGVEFASDTDTEVAVHLVAQAYRHGPTAGDF
AASVLAVLRRLDGHFTLVFANADEPGTIVAARRSTPLVIGIGDGEMFVGS
DVAAFIPHTRNAIELGQDQAVVLTADGYRITDFDGNDDLGPGAYREFHID
WDLAAAEKGGYEYFMLKEIAEQPAAVADTLLGHFVDGRIVLDEQRLSDQE
LREVDKVFVVACGTAYHSGLLAKYAIEHWTRLPVEVELASEFRYRDPVLD
RSTLVVAISQSGETADTLEAVRHAKEQKAKVLAICNTNGSQIPRECDAVL
YTRAGPEIGVASTKTFLAQITANYLVGLALAQARGTKYPDEVEREYHELE
AMPDLVARVLATIKPVAALAQRFAQSPTVLFLGRHVGYPVALEGALKLKE
LAYMHAEGFAAGELKHGPIALIEDDLPVIVIMPSPKGSAVLHAKLLSNIR
EIQARGAITIVIAEEGDDTVRPYADHLIEIPSVSTLLQPLLSTIPLQVFA
ASVAQARGYDVDKPRNLAKSVTVE
41410350NP_963186.1 hypothetical protein MAP4252c [Mycobacterium avium subsp. paratuberculoMPSHQFSRRRIDFLRPAAGRHEEAIMTAIRCDDVVTATRVPAARQARPPR
PAPADSGSPLMDMTTRLLAIPLHQLYALLWRVGIIEVRA
41410349NP_963185.1 hypothetical protein MAP4251c [Mycobacterium avium subsp. paratuberculoMARIRKLVAALHRRGPHRVLRGDLAFAGLPGVVYTPEEGLNLPGVAFGHD
WLTGAARYANLLEHLASWGIVAAAPDTQRGLAPSVLNFAFDLGTALEIVS
GVRLGPGKISVHPAKLGVAGHGFGASAAVFAAAGMPAKPAAVAAVFPSVT
SPPAEQPAATLRVPGVILTAPGDAKTLNSNALALAEVWDAATVRVISKAE
PGGLVEGRRLTKVVGLAGAHRRTQRSVRALLTGYLLYTLGGDKKYRDFAD
PHVQLPGTAAPDPEAGAVPLEEKIVALLK
41410348NP_963184.1 hypothetical protein MAP4250c [Mycobacterium avium subsp. paratuberculoMMRIGIALNYSGGFHEAVDRVVELEKAGIEVAVVAEAYSFDAISQLGYLA
AKTRTVELASGVLPLYIRTPSLLAMTAAGLDYVSDGRFRLGIGTSGPQVI
EGFHGVPFDAPIGRTREIVEICRMVWRRERVQYAGRHYQLPLPPDRGTGL
GKPLHLINHPVRERIPISIAALGPKNVELTAEIAEGWQPVFYLPDKAGSI
WGEALAAGAAKRDPALGPLDVMVHASLAIGDDVDQRLAWVKPQLALYIGG
MGAKGRNFYHNLATRYGFGEVADRIQELYLSGRKQQAIDLVPDELVRRMS
LVGPRGYVAERMAAFAESGVTTLLLSPLAADRDEALGFVEHALQLRP
41410347NP_963183.1 hypothetical protein MAP4249 [Mycobacterium avium subsp. paratuberculosMPCAGLPTSRPDGASRAGPRMVCGRGRSRPARALDRDCAELRAAGVVAAE
ALRLQRAQVAELAVAWTGAGGEAAVQLLQRHCDTAEALATELRAAAQRCE
SLRDNLWYLIDAKAATAIAVDDRTRAQRPEWLAAAAAVTAGQPDRDDAHN
LIRQQVIPYVDNDIRNEWLPAMRSATDGVQTSYAMVVDRMAAAPAARFEF
PGDLGSGLVPVPATRPLVAAPMPPLDAAPTLPDAAPTLPAAVSEPAAAAT
LPAAVPSPAAAPAADWGAALGDAAGMPAGDLGGLAGSGMGSGLGSGLGGG
GGLLGLAGKIVDAMGGLLGSVGDGLDGADPFGDQDPLDDNAFHGDPFHAD
DPADAKDAGDDADETAADEPAAPDRPAPAGEAEPNGEPAPSGEAPPTGEP
AQPVAATPPAAPPPGAPPPGAPPPAEPPADPGPAPGAAQPAPEPGSTPCQ
IAADQLPQAGQ
41410346NP_963182.1 hypothetical protein MAP4248 [Mycobacterium avium subsp. paratuberculosMKSLGATRPGAVARTQIDVAAAQRVANQFAVAAEFLDRAVTDHLARLAFG
GAVAGRAHTERGDALHVELQRLAGQVSQWSRASGEIAAALRSSAERYADA
ELYAAARIA
41410345NP_963181.1 MrsA [Mycobacterium avium subsp. paratuberculosis K-10]MGRLFGTDGVRGVANRELTAELALALGAAAARQLASGSAPGRRVAVIGRD
PRASGEMLEAAVIAGLTSQGVDALRVGVLPTPAVAYLTGAYDADFGVMIS
ASHNPMPDNGIKIFGPGGHKLDDGTEDRIEALVGDAGPRPVGAGIGRVID
AEDAADRYLRHLSKASTLRLDGLTVVVDCAHGAASAVAPRAYRAAGARVI
AINADPNGLNINDNCGSTHLDSLRAAVVAHRADLGLAHDGDADRCLAVDA
DGNLVDGDHIMVVLALAMREAGELASDTLVTTVMSNLGLHLAMRSAGITV
RTTGVGDRYVVEELRAGDFSLGGEQSGHIVMPALGSTGDGIVTGLRLMTR
MAQTGSPLSDLASAMQTLPQVLINVTVADKATAATAPSVQTAVGQAAAEL
GDTGRILLRPSGTEPMIRVMVEAPEKDIAQRLATRVAEAVSAAR
41410344NP_963180.1 30S ribosomal protein S9 [Mycobacterium avium subsp. paratuberculosis KMTETTEALENPDNPEAETAAAEVTEAPVEAVPAESYVFERPIQTVGRRKE
AVVRVRLVPGTGKFNLNGRTLEGYFPNKVHQQLVKAPLVTVDRVDGFDIY
AHLHGGGPSGQAGALRLGIARALILASPDDRPALKKAGFLTRDPRATERK
KYGLKKARKAPQYSKR
41410343NP_963179.1 50S ribosomal protein L13 [Mycobacterium avium subsp. paratuberculosis MPTYAPKAGDTTRSWYVIDATDVVLGRLAVAAANLLRGKHKPTFAPNVDG
GDFVIVVNADKVAFSGQKLDKKLAYRHSGYPGGLRSRTIGELMQKHPDRV
VADAIVGMLPKNKLSRQIQRKLRVYAGPEHPHTAQQPIPYEIKQVAQ
41410342NP_963178.1 hypothetical protein MAP4244 [Mycobacterium avium subsp. paratuberculosMDPTLSYNFGEIEHSVRQEIHTTSARFNAALDELRARIAPLQQLWTSEAA
TAYQAEQLKWHRSATALNEILVQLGDAVRDGAEEVADADRRAAGVWAR
41410341NP_963177.1 hypothetical protein MAP4243 [Mycobacterium avium subsp. paratuberculosMATSNTVSTDFDLMRSVAGTTDARNEEIRAMLQAFIGRMSGVPPAAWGGL
AAARFKEMIDRWNAESVRLYHALHAIADTIRHNAATLQDAGQNHADHIAA
AGGSL
41410340NP_963176.1 hypothetical protein MAP4242 [Mycobacterium avium subsp. paratuberculosMSPHRAVVETGPATIRRLCCGTRMPADREVIEAALDAIDDPVALVGERPV
AVEALWKTALRSACCACDGAVVVYPSWWPPARVRTVSAAAATLAGEARAR
PRSWLLARASRAAPEGTVVVEVAERVVAICGPAPASVTAVPRTAPPRSVA
DGVARAVASLAPAVVLIDLPDPIAGAAELGPLIADALRGRIRAEMVHIND
IRLARLACSASDGDDAPAGPDRSAAAPARSRPRILSGLGAAAVIAAAAAP
LAITAAPDRARPMPGTSLVEGRVALSVPNDWPTQRLVGGPGSARVQVTSP
TDPEVALHITQSPVVGETLGDTARRLKQAIDAAPAGVFVDFDPTATSVGR
PAVTYREIRPAHQVRWTVLLDGPVRISIGCQSRPGAEQAVREACELAVGS
AHAIG
41410339NP_963175.1 hypothetical protein MAP4241 [Mycobacterium avium subsp. paratuberculosMPPIPVLPTVVGREGMRDDPGRHRCRGSAGTAGPESAGLPARLLPVALSV
AGMGVMTVVFASGGAAARQPAFLAFPATMLVSTVAAALIGRSRRGGGGLD
ADRGRYLEYLNQLARSVSEIAAAQCASALRDHPDPDTLWTLIGGPRMWRR
RPTDPDFCVVRVGMGVLPLARRVVAPPVPAEEVRDPVTATALRRFLHTHA
TVPGPVTVDLGAGSPVTIDGDGGAARAVLRAVVCQLAVLHAPDRLGIAAV
VGDGDRAHWDWLKWLPHNRHPTHYDALGPMRMVYSTAAQAQQALAGLPVA
RLVLVAERAVAPIAGATVIAIGAGDDGAPVTIRTAAGTVSPSRPDRMTAA
DALTCARRLAGQRVTAGDDDGGWPGLVGLADVSGFDPATLWGRQTGRDRL
RAPLGVAADGTPVELDIKEPAEHGMGPHGLCVGATGSGKSELLRTIALGM
MARNSPDVLNLLLVDFKGGATFLDYANARHVAAVITNLADDAPLVDRMRA
ALAGEMNRRQEALRTAGCDSVAAYQHARRSAAALPALPALFVIVDEFSEL
LSQQPDFADTFVAIGRLGRSLGIHLLLASQRLDEGRLRGLDAHLSYRLCL
KTLSEAESRAVLGDLDAYHLPADPGAGYLRVGAGEPIRFQAALVSGPLRP
DTAPRPPAMVRVFGTRVVGPVSRPVEAAHPSGRSISAAVLDRLAGHGPAA
HRVWLPPLGRPPELCTLLGGAADLTVPVGLVDRPFEQCRTPLIVDLSGAA
GNVAVVGAPRSGKSTALRTSITALAATHDPARVQFYCLDFGGGALSSLHT
LPHVGAVAGRAEPRRVGRIVAECEAVVRRREAFFGEHAIASIADYRQRRP
GSDPFGDVFLVIDGWAVLRRDFETLEASIIALAGQGLSFGVHLVLSASRW
ADIRPALRDQIGTRIELRLGDPADSEIDRRAAAHVPRDSPGRGLSHDGLH
MVIASPVADVAAGESVAPPIPLLPARVDLDAVRRGSGDEFAGRPLLGLQE
RQLQPVAIDFARESHLLILGANGCGKTAALRTLCRELVRTNTAAQAQLVI
VDFRRALLGIVESEQLHGYAMSPAALTALLPGLLDLLSGRMPPPDASQAQ
LRAGSWWSGPDVYVVVDDYDLVASPSGNLLAPLVGFLPYASELGLHLIIA
RRSGGAERAMFEPLLAGLRDLGCMSLTMSEAAPFAAAPPLPPGRGVLTTR
AGADELVQVAWSPP
41410338NP_963174.1 hypothetical protein MAP4240c [Mycobacterium avium subsp. paratuberculoMAVSTTGLCRVSVHWETQAVDVSLPAEIAVAELIPSLVDMLGAGDGGAGR
YRLSAAGAAALDPSTTLAHNHIGDGAILVLSRIDVPLPAPRYRDIADTVS
AALDATARPGVAVRRVAGAAAAASFVTAGGLLLVRNTFSAGVVRDSGGTV
AVLVSTTLLTLGAAAVAHRGYRDRGAALALGAIATVFAGLAGFVAVPGAP
SLSHVLLAAAAAGLAAVSAIGLSGCCGAGLLALACWCLILATAALAGVLS
GAPLPTVASAAGLVSLCLLGMAARASLALAGLSPRPATATAGGPEPGEAW
VSARARRADRWLTGLLAGLSSSATVAAAVTVLAGAPRLCCLAFGTGTGAL
LLLRSRGGDGTRALVFAAGAIVTTATTFGVAAWSAPLPGPWVAATTATLV
AAALYLGCAARTCSPVLSRAADLLEWLALAALVPLTCWIAGLYGTVRGLT
LG
41410337NP_963173.1 hypothetical protein MAP4239c [Mycobacterium avium subsp. paratuberculoMRVVRLLAVSALTMLPVFETPPAHAVSPPAVEDKWLPKPARPAPPWPTAQ
REVCATLTADSGPGPRGPAGGSDLSAVWQLSRGAGQRIAVIDTGVARHRR
LPGVVPGGDYVSTGDGIQDCDAHGTLVAGIIAAAADPKSDEFSGIAPEAT
LISIRQSSAKFGPAGNRSGGGVGDVDTLAQAVRTAADLGASVINISSVAC
APVASAPDDRALGAALAYAVDVKNAVVVAAAGNTGGAGQCPPQQPDATWQ
TITVAVSPAWYDDYVLTVGSVNADGAPSAFSLAGPWVDVAAPGEAVTSLA
PEPVSGTSYAAPVVSGLAALIRARFPALTARQVMQRIEATAHHPPAGWDP
LVGHGTVDPLAAVSAETGAPPPAPRAAPVPIAAPPPAPARDSRARDVAVR
GAAFCLVALTLAAAAGAVRARLRRTHDGVAGD
41410336NP_963172.1 hypothetical protein MAP4238 [Mycobacterium avium subsp. paratuberculosMDNRFGGAARRPSVCATDSRGRGAVPRRPTTWLQVSAYRYLSRRLECALL
GQDPAAAGMRARGQPAALLAGAVLTAAALAAATLLGLLRPHVALDGARVV
LARDSGALFVRVGDTWHPVLNLASARLIAASAVDPLTIRQADLDGSKRGP
LLGIPGAPAFLGRPLAAAESLCDSDGAGATTILLGRTDAASMRVLGGGQA
MLVAAAAGSPAYLLHDGHRARVDLADAAVVRTLRLEGRAPRLVSQSLLDA
VPEAAPIAVPRIPGLGGAAPGLPGFAIGTVLRIIRADGDEYYAVLAGGVQ
RIGRVAADLLRLSNPQGSADAVTVAPDALRTAPVVAALPVAGFPDRAPTV
SEPAATICAGWGDARSVAFLTGAAVPVPPGRAPVTLAQADGRGPALDAVY
LPPGRSAYVRAGANAGTRYLITDTGVRFAVPDDDAAADLGLGQPSPAPWP
LLTLLPAGPELSRPNASVARDTVVGAP
41410335NP_963171.1 hypothetical protein MAP4237c [Mycobacterium avium subsp. paratuberculoMKTHRIGRLLGLGSSALITAAGLLGAPAAVPVASADDCPDVEVIFARGTN
EPPGMGRVGDAFVESLRQQTSGLNIDTYGVNYAASKLQLHGGDGANDTIN
RIKQAVQKCPNTKIVLGGYSQGASVMDIVAGVPIGGINWGSSITPDLASH
VAAVATFGDVADRAGGTLPSQSALLGSKAIDLCNPNDPICHAGPGNEWSG
HTEGYVPVYTTQAAAFVASKLMGAGQSVPGYGPSVPGVGPQSPGYGQQSP
VYGQTPPGSGPSIHDNAPGPGTAPAPAVPSTPPSQAPLV
41410334NP_963170.1 hypothetical protein MAP4236c [Mycobacterium avium subsp. paratuberculoMRLIPVGLGVGLLAGAAVLIAPQLIPLASASCPGVEVVFARGTDEPPGVG
KVGGAFVSSLREQTRKSVGAYGVNYPANKDFLAAADGANDASNHIQQMAG
NCPNTKLVLGGYSQGAAVIDIVTAAPVPGLGFRNPLPPQAADHVAAVALF
GNPSGRAGRLMSALTPDFSGKTIDLCNPGDPICSGGYQWASHLSYVPGLT
NQAARFVATRV
41410333NP_963169.1 tRNA pseudouridine synthase A [Mycobacterium avium subsp. paratuberculoMAGVLDEALTTVFRTPVRLRAAGRTDAGVHATGQVAHLDVPGTALPNAYP
RAPHVGEAEFGPLLRRLGRFLPTDVRVVDITRAPAGFDARFSALRRHYVY
RLSTAPWGVLPQQARYVTAWPRPLDVEAMAAASRDLLGLHDFAAFCRHRE
NATTIRDLQRLDWTRDGDLITARVSADAFCWSMVRSLVGALLAVGENRRP
VSWCRELLSATNRSSDYATAPAHGLTLVGVDYPPDDQLAARNLITRDVRS
R
41410332NP_963168.1 50S ribosomal protein L17 [Mycobacterium avium subsp. paratuberculosis MPKPTKGPRLGGSSSHQKALLANLATSLFEHGRIKTTEPKARALRPYAEK
LITHAKKGALHNRREVLKKIRDKDVVHVLFEEIGPFFADRNGGYTRIIKV
EPRKGDNSPMAVIELVREKTVTSEADRARRVKASKKAPEAAAAAPQAAVE
PEAAEAAPAPDAPEAAPEAEAAAPRPADEAEGSSED
41410331NP_963167.1 DNA-directed RNA polymerase subunit alpha [Mycobacterium avium subsp. pMLISQRPTLSEEVLTDNRSQFVIEPLEPGFGYTLGNSLRRTLLSSIPGAA
VTSIRIDGVLHEFTTVPGVKEDVTAIILNLKSLVVSSEEDEPVTMYLRKQ
GPGEVTAGDIVPPAGVTVHNPELHIATLNDKGKLEVELVVERGRGYVPAV
QNRASGAEIGRIPVDSIYSPVLKVTYKVDATRVEQRTDFDKLILDVETKS
SITPRDALASAGKTLVELFGLARELNVEAEGIEIGPSPAEADHIASFALP
IDDLDLTVRSYNCLKREGVHTVGELVSRTESDLLDIRNFGQKSIDEVKVK
LHQLGLSLKDSPPSFDPSQVAGYDVATGTWSTEAAYDDQDYAETEQL
41410330NP_963166.1 30S ribosomal protein S4 [Mycobacterium avium subsp. paratuberculosis KMARYTGPVTRKSRRLRTDLVGGDQAFEKRPYPPGQHGRARIKESEYLLQL
QEKQKARFTYGVMEKQFRRYYEEAVRQPGKTGEELLRILESRLDNVVYRA
GLARTRRMARQLVTHGHFTVNGVRVDVPSYRVSQYDIIDVREQSLNSVPF
QIARETAGDRPVPSWLQVVGERQRILIHQLPERAQIDVPLTEQLIVEFYS
K
41410329NP_963165.1 30S ribosomal protein S11 [Mycobacterium avium subsp. paratuberculosis MPPAKKAAAAPKKGQKTRRREKKNVPHGAAHIKSTFNNTIVTITDPQGNV
IAWASSGHVGFKGSRKSTPFAAQLAAENAARKAQEHGVRKVDVFVKGPGS
GRETAIRSLQAAGLEVGAISDVTPQPHNGVRPPKRRRV
41410328NP_963164.1 30S ribosomal protein S13 [Mycobacterium avium subsp. paratuberculosis MARLVGVDLPRDKRMEIALTYIYGVGRTRSNEILAATGIDRDLRTRDLTD
DQLTHLRDYIEANLKVEGDLRREVQADIRRKIEIGCYQGLRHRRGLPVRG
QRTKTNARTRKGPKRTIAGKKKAR
41410327NP_963163.1 50S ribosomal protein L36 [Mycobacterium avium subsp. paratuberculosis MKVNPSVKPICDKCRVIRRHGRVMVICSDPRHKQRQG
41410326NP_963162.1 translation initiation factor IF-1 [Mycobacterium avium subsp. paratubeMAKKDGAIEVEGRVVEPLPNAMFRIELENGHKVLAHISGKMRQHYIRILP
EDRVVVELSPYDLSRGRIVYRYK
41410325NP_963161.1 hypothetical protein MAP4227c [Mycobacterium avium subsp. paratuberculoMTQAAGKPDLGRFGSFGRGVTPQQAKDIEALGYGAVWVGGSPPAELAWVE
PLLEATTTLQVATGIVNIWTAPAGPVAESFHRIEAAYPGRFLLGIGVGHP
EAHTEYRKPYDALADYLTRLDEYGVPGGRRVVAALGPRVLKLSAERSAGA
HPYLTTPEHTARARELIGPSAFLAPEHKVVLTTDAEHARAVGRKALDIYF
NLANYRNNWKRLGFTDDEITRPGSDRLVDALVAYGSVDRIAARLREHLDA
GADHVPVQVLTKDENLVSALAELAGPLGLKPS
41410324NP_963160.1 hypothetical protein MAP4226c [Mycobacterium avium subsp. paratuberculoMTEGVSLKPDLGPFGVWLSTRSITAELAARIKSLGYGAAWIGGSPDAELS
WVDPALAGTTSLHLATGIVNIWSAPAAAVAESFHRIESGHPGRFLLGIGA
GHREHTREYVKPYDAVVSYLDELDAAVIPTSRRVLAALGPRMLRLAAQRS
AGAHPFLTTPEHTAKARELVGGSVFLAPAHKVVLTTDRDRARAAGRQAIE
HNLGLSNYVHNWLRLGFTEADVRPPGSDRLIDAVISYGTPQAVAARLREH
LDAGADHVAIQVLGGDSEETLLPALTELADALGLTRTN
41410323NP_963159.1 RmlB [Mycobacterium avium subsp. paratuberculosis K-10]MRLLVTGGAGFIGANFVHSTVREHPEDSVTVLDALTYAGRRESLAGVEDS
IRLVVGDITDAELVSRLVAESDAVVHFAAESHVDNALAGPEPFLHTNVVG
TFTILEAVRRHGVRLHHISTDEVYGDLELDDPNRFTESTPYNPSSPYSAT
KAAADMLVRAWVRSYGVRATISNCSNNYGPYQHVEKFIPRQITNVLTGRR
PKLYGTGANVRDWIHVDDHNSAVRRILESGEIGRTYLISSEGERDNLTVL
RTLLQMMGRDPDDFDHVTDRVGHDLRYAIDPSTLYDELCWAPKHTDFEEG
LRETIDWYRANESWWRPLKDASEARYEERGQ
41410322NP_963158.1 RmlC [Mycobacterium avium subsp. paratuberculosis K-10]MSARELKVPGAWEITPTVHGDARGHFFEWLTDKGFRSFAGHRLDVRQANC
SVSAAGVLRGLHFAQVPLSQAKYVTCVRGSVFDVVVDIRVGSPTFGQWDS
VLLDDAEHRTIYISEGLGHGFLALQDNSTVMYLCSAEYNPGREHTICATD
PALGIDWPLVAGAAPTLSERDAAAPSLEEVRASGLLPTWAETQAFIEGLP
R
41410321NP_963157.1 AtfA_2 [Mycobacterium avium subsp. paratuberculosis K-10]MKLGQVFDPRSNALNAWRLALAAEVIFWHTFPIRGHLPSVRAVLQLLLCV
GVDGFFAISGFLITASWLSNPQLRAYLAARALRILPGFYVCMIVTAFVFA
PLSVAIQGGSPARLLFSYAPFEYVLKNIAVLWLKPDVGGTPHDIPNAGIW
NASLWSLFWEVMCYLVVAAIGVAGLANRRWVSPVILVAAAIGASFLPPVT
FPEVFHHPEGNVATALVFLACRAAIMFSAGALLYQWRDVIPARWSLVAVC
VVIVLVAGQLPDYRVVAALPLAYAVVVSGSLLHNRRLWFRTDLSYGMYIY
AYPVQQLLAVLGLLSLNPVVFCLAVAAATVPLAAASWFLVEKPARALKTR
LKRKAAATPEQAAMVLPPEVPGVA
41410320NP_963156.1 AtfA_1 [Mycobacterium avium subsp. paratuberculosis K-10]MKLGQVFDPRRNALNALRLVLAAEVMLFHSWPITGHMPPKSILQLFFSVG
VDGFFAISGFLITRSWLSDPRLRDYLTARALRILPGFYICLIVTAFVFAP
LSVVIQGGSPAKLLGSAAPLEYILKNSAIVYLQPSIDGTLHGVPGGNAWN
GSMWSLIWELLCYLVVAAIGVVGLGNRRWISPLILVLATLGALVVPPLTF
PGVWTIPQLAVRSAIMFSAGAVMYQWRDVIPARWSLVAVALAIVAAAGFL
PDYRVVGALPLAYAVIVTGSLLKSERLVLRTDLSYGVYIYAFPTQQLLAV
CGLATRLHPALFFLASVAATLPLAAASWFLIEKPSMALKRRLKRKWTGPR
AAESDPRVSQAEPAPADVLADRPAPEAPGHF
41410319NP_963155.1 hypothetical protein MAP4221c [Mycobacterium avium subsp. paratuberculoMTLGPVFDPRRNALNAWRLLLAAEVMLWHCWPITNRLPPAATLQLLFSVG
VDGFFAISGFLITRSWLDDPRLRDFLAARALRILPGYYVCLIVTAFAVAP
LSVAIQGGSVGALLSSGAPLEYLAKNSAVAYVHLNIGATPGGVPHPGVWN
GSLWSLVWEVACYLAVAAIGVAGLADRRWMSVAVLALAVVGAALVPPLTY
PGQWTVAQLAVRSAIMFAAGAVVYQWKDVIPARWSLVAVCVVVVAAASRL
PDYRVVAALPLAYAIIVSGALLRNRRLRLATDLSYGVYIYAFPVQQLLAV
CGLAPAAGGGVLPDRPGRHPAAGRGQLVVDRKAVDGAQTPAAPEVVCGHH
RRTRTSGNHSSTVSTSAATLIAAYGAGSQPRSAKPNSPTVRDAANAASEP
PATAAPAQLSQPGPPAQISSATANDTLACTRNATPMPGMCW
41410318NP_963154.1 hypothetical protein MAP4220 [Mycobacterium avium subsp. paratuberculosMNPNMSRRQLIRHTAWFGAAVGFALTGGEVISHVAGRAAAQHTRAQPTLR
FAQISDSHLGFTGAPNPDVAGTFGRAIDQVNNLGYTPDFVIHTGDLTHLS
TPEQFDQAKQMMSALKTPHVFTVPGEHDSVDDAGQKYRSVFGAGSAGDGW
YSLDVAGVHLIALVNTLNLRKLGHLGADQLEFVKKDVAGLSSDTPIIVFS
HIPLFAMYPQWGWGTDDAAQALSYLRRFASVTCLNGHVHQLFSKTEDNVT
FHSGTTTAYPLPHPGDRPAPKPVTLPAGRLRDALGVREVAYSRGDTVLAL
KERTLQ
41410317NP_963153.1 hypothetical protein MAP4219 [Mycobacterium avium subsp. paratuberculosMGMTLAKSLTAALAVAVAVAACSAPRPAAGGGTPSTQTPVTAPPAAAGPN
QVVIDGFAFAPATLTVPAGTTVTWINRDEEPHTVAASDGSFHSPGMGTGA
VFTHTFSAAGTFDYVCSIHPMMRGTVVVTG
41410316NP_963152.1 hypothetical protein MAP4218 [Mycobacterium avium subsp. paratuberculosMNARGLRRYVDDLLRGRRPRPFLPDDFEAAQLRTAIELRAARPDSEVADA
PRPEFLADLHRRLAEQMSGAPTRPRPGRGSTRRQVIVGTSAAATAAVAAV
SIDRTVIAGQSGPDRAPQIASGTLAPNQGSWQRVAASSEVPDGVLRAFDL
GAVSGFVRRVDGKVQAISGVCTHQGCKLWFDAPDDTLRCPCHTTSFSPSG
KVLTHQLPIEPKPLPALMVREADGIIEVFAPVRRI
41410315NP_963151.1 hypothetical protein MAP4217 [Mycobacterium avium subsp. paratuberculosMAAHNEPVGPRPLRAVPEGGYPDWEAVYADNAAWVYRTLFARVGNRADAE
DLTAEVFLAALRPLRLTASAAEVRAYLRATARTVLAAHWRETLGREITSI
EDIEQPPEHPDAISTAPQRVARVLDSLPDRYRRILESRFLQGNSIKEAAA
ELGISVANAKVLQHRALRLAAQVNEGGRP
41410314NP_963150.1 hypothetical protein MAP4216 [Mycobacterium avium subsp. paratuberculosMHTIEADYLVVGAGAMGMAFIDTLVTETAASQARVVVVDRHHAPGGHWTM
AYPFVRLHQPSAFYGVNSLRLGGDSIDQIGWNRGLYELATADEICAYYDR
VMRTRLLPTGRVRYFPDSEYRGDGRFRTSAGADHTVEVTRRIVDATYMHV
SVPAMRPPPYTVGDGVDCVPPNELPRRPGYQRYVVVGAGKTGIDTCLWLL
GRGVEPDRLTWIMPRDSWLLDRATMQPGALFAEQIKHSFTAQLRAINDAG
SVAELFSRLEDAGLLLRIDPAVRPTMYRCATVTRLELEQLRRITDVVRLG
HVRSIEPGAMVLDGGAVAVDGRALYLDCTADGAEKRPATPIFTPGRITLQ
SVRGCQQIFSAALIAHVEAGYGDDARRNELCVPLPHPDTDVDWLRLALAD
YTNQLRWFDDPELMTWLSGARLDLSGHLIGHLLPSASAKPRVRARILGIA
KSVFAATAARLGELLAADAALAAS
41410313NP_963149.1 MmsA [Mycobacterium avium subsp. paratuberculosis K-10]MTTQIPHFIDGQRTAGQSTRTADVFDPSTGAVQAQVPMAGRADIDAAVAS
AIEAQKGWAATNPQRRARVLMRFIELVNQHNDELAELLSREHGKTLADAK
GDIQRGIEVIEFCVGIPHLLKGEYSEGAGPGIDVYSLRQPLGVVAGITPF
NFPAMIPLWKAGPALACGNAFVLKPSERDPSVPVRLAELFVEAGLPPGVF
QVVHGDKEAVDAILNHPDIQAVGFVGSSDIAQYIYAGAAATGKRSQCFGG
AKNHMIVMPDADLDQAVDALIGAGYGSAGERCMAISVAVPVGDKTADRLR
ARLVERINNLRVGHSLDPKADYGPLVTGAAVARVRDYIDQGVAAGAEIVV
DGRERRSDDLTFGDANLEGGFFIGPTLFDHVTPDMSIYTDEIFGPVLCIV
RAQNYEEALRLPSEHEYGNGVAVFTRDGDAARDFVSRVQVGMVGVNVPIP
VPVAYHTFGGWKRSGFGDLNQHGPASIQFYTKVKTVTSRWPSGIKDGAEF
VIPTMD
41410312NP_963148.1 FadE9 [Mycobacterium avium subsp. paratuberculosis K-10]MFTLDDDERVIAETAAAFAAKRLAPHALEWDAAEHFPVDVLRESAELGMA
AIYCREDVGGSGLRRLDGVRIFEQLAIADPTTAAFLSIHNMCAWMIDSYG
TPEQRKAWVPRLAAMDVIASYCLTEPGAGSDAAALSTRAVRQGGDYVLDG
VKQFISGAGASDVYLVMARTGGEGPRGISAFVVEKGSAGLSFGSPEEKMG
WHAQPTAQVILEGVRVPADAMLGGAEGEGAGFGIAMNGLNGGRLNIAACS
LGGAQAAFDKAGAYVRDRQAFGSPLLDEPTIRFALADMATGLETSRMMLW
RAAGALDADDPDKVELCAMAKRYVTDTCFEVADKALQLHGGYGYLREYGL
EKIVRDLRVHRILEGTNEIMRVVIGRAEAARFRATA
41410311NP_963147.1 MmsB [Mycobacterium avium subsp. paratuberculosis K-10]MTERVVVAFLGLGNMGAPMAANLVAAQHAVRGFDPVPAALSAATASGVTG
FDTATDAVTGADVVITMLPNGEVVKRCYAEILPAARPGALFIDSSTISVA
DAREVHAQAQSHGVAQLDAPVSGGVKGAVAGTLAFMVGGEPEALERARPV
LEPMAGKIIHCGAAGAGQAAKVCNNMVLAVQQIAIGEAFILAEKLGLSAQ
SLFDVITGATGNCWAVHTNCPVPGPVPTSPANNDFKPGFAASLMNKDLGL
AMDAVTSTGAAAPLGRHAAEIYAKFAASHGDKDFSAVIEMLRGAC
41410310NP_963146.1 hypothetical protein MAP4212 [Mycobacterium avium subsp. paratuberculosMADSRPHERDPIAAARANWERAGWGDVAPGMVAVTSVMRAHQILLARVET
ALRPYDMSFSRYELLRLLAFSRTGALPITKASDRLQVHVTSVTHAIRRLE
ADGLVQRVPHPTDGRTTLVQITELGRSTVEDATVTLNKQVFADIGMSDTE
SRQLASSIETLRRNAGDF
41410309NP_963145.1 hypothetical protein MAP4211 [Mycobacterium avium subsp. paratuberculosMLTVPRPAAGGIGEALPDAVDPFALSLNENPFPPLPAVRAALIRSVCTAN
RYPEFLPERLRGVIAEHIGVPAELVVLGAGATGVMLQVLQALTAPGDAIA
MATPTFDGYPIVARMARLNTIAVALDEHGQHDLDGLADAAARARVVVLCR
PHNPTGTVEPAAAVFRFLRRVPRDTVVLLDEAYVEFTAPEHRIDVAALVA
CFPNVVVVRTFSKAYGLAGLRIGYGVASPRLARPLWDQQLPFGIAITSLL
AVTASYRAEDELSRRIRSITAERRRLRMRLSALGVYTTNAHANFVYLPPD
PQGRAWQRVFARGGVRARYYPDGAARLTVGSRASTVAVLSAVGKATLERQ
VR
41410308NP_963144.1 hypothetical protein MAP4210 [Mycobacterium avium subsp. paratuberculosMNASTVSLIDVASYLPGEPIPADYYAQFAESDDLRDNVMFCAPKYRHHVG
PDESSIDMIERAAQGLIERHGHDVIEGADVLITHTQVPDMAFYGQGGGIA
HRLGMRPSWVLDLNNGGCAAFVLALNVARTLLSSGQGRTALIAIAQNAAG
QFFDQPTIRRKAQAAVPGDGAAVGLVTVGDSSPVLDVECRSYGEYAGEMT
LSYDPPRKWWQAGPGEGSIGFTDSKITKVLARGNRQVPEVALAVCDRIGL
PAKDIDLLVTNQPNRAFLRNWRDALELPPARHLDTFDECGNLFGAGIPVN
LDRAISEQRIKAGDVVMMAAFAHAGDFAGAAAVRWGGRGGC
41410307NP_963143.1 hypothetical protein MAP4209 [Mycobacterium avium subsp. paratuberculosMSLPALEDIGDLIDGVTRIETSPREKATPIIMDMMRSVYPHDQVFGQYCT
VNDYIDCPPDDLFEYMADTRSLEEWTYSLRGFTPTDEPGLWLAHDRLGSE
TKIYTRTVANAQARTVDYHCAWDQGDHLWMIYLMRVVDAQTVLDKPGSVV
LWTNCHHPFYDHNPYPQTAPPQRPVWVGDFWDMFGAGHLLELRNLKAIAE
YRHRHGLPVTPVWMR
41410306NP_963142.1 hypothetical protein MAP4208 [Mycobacterium avium subsp. paratuberculosMNPSAARLVSSHMLGRHRVVDHIVGHLAAIGTDHLFAVDGANIEDLYDAA
HFRPELTAVLAKHEFSAAAMADGYSRSGAGLGVVAATSGGGSLNLVAGLG
ESLASRVPVLALVGQPAAALDGRGSFQDTSGANGSLDAGALFSAVSVFCR
RVQTPDDIVSLLPQAISAARAGGPAVLLLPKDIQQARVGVGERNGHGAPG
GRVAIAAQWRPPAGDPHPIAAQLRRVTGEIAIIAGEQVARDDARAELEEL
RALLGARVATVPDAKDVAGAPGPDGRTLGVTGVMGHRNVAEAVARSAVCL
IVGTRLAVTARSGLDDALAAVRTVSIGSAPPYLACTHVHTGDLRGSLRLL
IRALRGHRRPVAPAGQGGGRPTELTPPPCRGPGVRYRDAMAVLDGVLPRG
ADIVVDAGNTGAVAIHCLPVRRDGRFVVALGMGGMGYSFGAGIGIALGRN
NSGRPGGRTVVIAGDGAFFMHGMEVHTAVQYRLPMTFVLFNNNAHAMCVT
REQLFYGDRYSYNRFRPSRLGAGLAAMFPGLTSVEVGDVDGFAAAMAAAL
DVDGPAVVSVECAADEIPPFAPFLTTSAVKDAAVKQNSVTKEIRTNVAAS
A
41410305NP_963141.1 hypothetical protein MAP4207c [Mycobacterium avium subsp. paratuberculoMTIEMAGVVREYRVGGQPVRALDRISLQLAGGQFVAVVGPSGAGKSTLLH
LLGALDSPDSGSIRFDGEEIGRLGDEAQSRFRHRRVGFVFQSFNLLPTLS
AWENVAIPRLLDGVRLGRARPDALRLLDRVGLGNRTEHRPAELSGGQMQR
VAVARALMMDPPLILADEPTGNLDSSTGAAILELLAEVAHEGGGHRLVVM
VTHNSDAAAATDRVITLQDGRVGSDVLAVAG
41410304NP_963140.1 hypothetical protein MAP4206c [Mycobacterium avium subsp. paratuberculoMRSGRAVTAAASRLRVFSLREIAVHRRRTTASIAVMTVSATYLVAVFGIF
GSITGSVSRLADGIAGVAALEVSGITDAGFADSVLADVAAVPGVATAAPM
IRTTAATPSGPVLLLGADARTAALGGALTDAVSRPVRELSATPDGVQVGP
RAGYAKGQAFQLGSAPVTVTEVLAGRQFAELNGGHYVLAPLALAQRVTGR
AGQLDSILITFTPGADPAAVRAAVGAAVGGRAIVAAPSSRAARAGDGVRL
MNYMALLGAAVALVVGAFLIYTTMTMAITQRRPVISMLRALGGRRRAVIG
DLLAEAAVLGLIGGALGCGAGILAGRMAIGRLPPAVTQGLEARVEYWLPG
YAVPLALAATALTAVAAAAMAARQVYKVSPVEALAPVGASAADAVPPWLR
AASGVGALALFAVAALAVPAGAPTGVLLGAVLVAELAAGFALTVPIVTAT
SALSRVFGSCGALAAATIRRAPRRVWATVMTVLIGVLTTVVITGTNADMI
GSARAIFAPVAEADVWVSADPPDSFPTDVLPQGLSERLAALPGAARVTEG
ACGFAVVAGTRVLLDGFAAGSRDALFRALDDRVRAEVLAGRGVVLTQNLG
RALNVRAGDRLRLQTPHGPREAAVLAVVPFFSTVIGTVGMDLAQLRAWFD
RPAATTLQVTAAPGVDPRRLLADVRAAVPAPNHVYDGRAALAGLQAPLHQ
SMFIANAVWIIVVAVAAVALLNTLTLSVTERRREIGVLRAMGTGRRLTLR
MVLAEAAGIGCVGGGLGLLLGLADQWLFSRISGDMMNFPVAFRLSPLALA
CTAGALGITLLGSVPPARRAARLNIIEAVSVD
41410303NP_963139.1 hypothetical protein MAP4205 [Mycobacterium avium subsp. paratuberculosMRFRNVLFPYVYRFGQPVFDRLFYHRYRRQAMSHATGRLLMVGLGPGTDL
MFLPAAVTSVAAVEPEASFRRMAARLAARHGVAVDVVAGSGESIPFPDNS
FDSVHIGLVLCSVRDVAATLAEIRRVLVPGGRLVVLEHVRGDGLTGRLQD
LIARPWSWLAGGCEPNRRTGAAIAAAGFDTSMLRSVPRTPVPFPCKPHLQ
GFAVLSPR
41410302NP_963138.1 hypothetical protein MAP4204 [Mycobacterium avium subsp. paratuberculosMNGPGESVRVRGDFDAPSRWLWLVKWCVLAVPHYPILIGLYLVYPLCIVV
AGIAIVCTGRYPRRLFDFNVGVLRWSWRLMNYRFPMNSTDRYPPFTLAAS
PDYPGDLAVDYPRRLKRLAVPIKWLLAIPHVLVCWSMEPLLQVLCLTAAL
TLLCTGTVPPGMFDLLMGIVRWRYRVAVYVSLMRDEYPPFRMDLGSR
41410301NP_963137.1 hypothetical protein MAP4203 [Mycobacterium avium subsp. paratuberculosMVGDARPLRVLVVGAGVAGISVARGLLRDGHDVTVFESRPRLAAAGGAVT
VWSNGETVLRQLGVEMDGAGRQLSSVRAVTSTGRPLATLDVTAMARRLGA
PVRMVPRRVLLERLLDGFPPGRIHCDRRAVALATSRDGVSVEFTDGTVAE
GDVLIGADGLHSMVREWVGARHAKATGWCSWQGLVSLPEIAESDAALMMI
GGGGNLGLWPAGGAEVQWWFDLPWSAGFVRPQHPIETIRSHFAGWSEPVD
RVLAILTDEDLAASPFPHFRHPIPRPGQGRVTLLGDAAHTMPPTLAQGTN
QALLDTMVLCQALADFGRGTPGGQADVANALRWYEKTRRRRVRAVSWVAS
LPVSHGEAVLRPAALVSDRLQAAALTMFLRWTSHRRMSDHINRSLGEAIN
RSLGEAPKIPSRR
41410300NP_963136.1 hypothetical protein MAP4202 [Mycobacterium avium subsp. paratuberculosMRTPVHDVGPPEDRYAMWDAAYVLGSLSAAQRREFEQHMAHCRGCREAVA
DISGVPALLSRLDHDEVAAIDEAGPAPQLSADLLPSLLTAVRRRRRRGRV
ATWVASAAAAAVLAIGVFVGLEGWSSTPARQVTASAEPMAQVGTTLLTST
VQVSGQHWGTSINLRCVCLAPLNAHHDTLAMVVVGRDGSRTRLATWVAVP
GHTASPAGSISTPVDQIAAVQVVAADSGQVLLQRSL
41410299NP_963135.1 RNA polymerase sigma factor SigL [Mycobacterium avium subsp. paratubercMARVVGISRASGTAEAALMKALYDEHAAVLWRYALRLTGDASQSEDVVQE
TLLRAWQHPEVIGDTERSARAWLFTVARNMIIDDRRSARFRNVVGSTDTA
GAPEQSTPDEVNAALDRLLIADAMAQLSAEHRAVIERSYYRGWTTAQIAT
DLGIAEGTVKSRLHYAVRALRLTLQELGVTR
41410298NP_963134.1 methionine aminopeptidase [Mycobacterium avium subsp. paratuberculosis MNALARLRGRKVVPQRSDGELDAMAAAGAVVAAALQAVRAAAVAGVSTLS
LDQIAESVIRDAGAVPSFLGYHGYPASICASVNDRVVHGIPSAAEVLAPG
DLVSIDCGAVLDGWHGDAAITFGVGALDPADEALCQGTRESLEAGIAAMV
PGNRLTDVSHAIELGTRAAETRHGRAFGIVEGYGGHGIGRQMHMDPFLPN
EGSPGRGPLLAPGSVLAIEPMLTLGTGKTVVLDDQWTVITTDGSRAAHWE
HTVAVTDAGPRILTIG
41410297NP_963133.1 adenylate kinase [Mycobacterium avium subsp. paratuberculosis K-10]MRVVLLGPPGAGKGTQAQKLSEKLGIPQISTGELFRSNIENGTKLGLEAK
RYLDAGDLVPAELTNQLVDDRLSEPDAANGFILDGFPRSLQQAKALHEML
ERRGTDIDAVLEFRVSQDELLARLKARGRADDTDEVILNRMKVYRDETAP
LLDYYRDQLKTVDAVGTLDEVFARALCALGK
41410296NP_963132.1 preprotein translocase subunit SecY [Mycobacterium avium subsp. paratubMLSAFISSLRTVDLRRKILFTLGIVVLYRVGAALPSPGVNYPNVQQCIKE
ASGGAAGQIYSLINLFSGGALLKLTVFAVGVMPYITASIIVQLLTVVIPR
FEELRKEGQSGQAKMTQYTRYLAIALAILQATSIVALAANGGLLQGCSLD
IIADQSIFTLVVIVLVMTAGAALVMWMGELITERGIGNGMSLLIFVGIAA
RIPAEGKTILDSRGGMIFAAVLVAALIIIVGVVFVEQGQRRIPVQYAKRM
VGRRMYGGTSTYLPLKVNQAGVIPVIFASSLIYIPHLITQLIRSGSGGVG
NSWWDKFVGSYLSDPSDPVYIGIYFGLIIFFTYFYVSITFNPDERADEMK
KFGGFIPGIRPGKPTADYLRYVLSRITLPGSIYLGAISVLPNLFLQIGNG
GAVQNLPFGGTAVLIMIGVGLDTVKQIESQLMQRNYEGFLK
41410295NP_963131.1 hypothetical protein MAP4197c [Mycobacterium avium subsp. paratuberculoMTRTDQDSWDLASSVGATATMVAAARALASTGERPIINDPFAAPLVRAVG
LDFFRRLVDGEVAPADPQRGERDLQLETDSIAVRTRFFDDFFTGAARDGI
RQSVILAAGLDARAYRLDWPAGAVVYEVDQPKVVEFKTNTMAALDARPAA
QLRTVSIDLREDWPEALRANGFDVTQPTSWSAEGLLMYLPPEAQDRLFDN
ITALSAPGSRLATEYHPDATGTTMAQRAQEFNDRWARVGCDIDLSGLFFD
GERSNVVEYLTGRGWRVSARPRRDLFDDYGLAYPEDDETAQFPNIVAVSA
ELG
41410294NP_963130.1 hypothetical protein MAP4196 [Mycobacterium avium subsp. paratuberculosMTDQDRKAARREIADALLKALERRHEIADVVVESENKAAAVEAIVRLLDT
SHLAAEAVMGMSFDQLTIDSRRKILAELEDLNKQLSFTVGERPASSGETL
ELRPFSATEDRDIFAARTQDMGSAGDGSGGPAGDLDDEIRAATARLDDEE
AAWFVAVDSGQKVGMVFGELLNGEVNVRIWIHPDFRKRGYGTAALRKSRT
EMAWCFPAVPLVVRAPAAKPA
41410293NP_963129.1 hypothetical protein MAP4195 [Mycobacterium avium subsp. paratuberculosMSRKDVTIGIDVGSTAVKALAADADGRVMARVRIPHELRIPAPDRLEHDA
EAAWRRGPSAALDELLHQPGVAAVAVAAMVPSMTAVDGSGTPITPGLLYG
DGRGRTPGGPQNQPLPALGEAAEFLRWTAARAPGAAGYWPAPAVANHALA
GQAVIDVATAATAFPLFDGTGWDAAACAERGARVEQMPRVHSMGAVVGQL
PGGAALATGAIDALCEQLVAGADRDGDVLVMCGTTLIVWATISQARQMPG
LWTIPHTTPGKSQIGGASNAGGLFLGWVDRVVAQADPASAQPGRVPVFAP
YLRGERSPFHDPDRRGVLEALDLTHDAAALRRAAYEASGFVVRQLIELSG
APVSRIVATGGGTRVGPWLQAIADATGHPVEVSAVAEGAALGAAFLARMA
AGLETTLTDAARWVRTERVVEPDPAWAAPVQDRYQRFLELGNRPCPAVVA
R
41410292NP_963128.1 hypothetical protein MAP4194c [Mycobacterium avium subsp. paratuberculoMTSKPRALVTAPLRGPGLDKLRVLAEVVYDPWIEQRPLRIYSAEQLAERI
AAEEAEIVVVVESDSVRGPVFELGVRAIAATRGDPNNVDIDGATAAGIPV
LNTPGRNADAVAEMTVALLLAATRHLLPADADVRGGNIFRDGSIPYQRFR
GGEIAGLTAGLVGLGAVGRATRWRLSGLGLRVIAHDPYHPEARHGLDELL
AESDVVSLHAPVTDETTGMIGAEQFAAMRDGVVFLNTARAQLHDTDALVE
ALRAGKVAAAGLDHFVGEWLPTDHPLVGMPNVVLTPHIGGATWNTEARQA
QLVADDLEALLAGATPAHIVNPEVLAR
41410291NP_963127.1 L-fuculose-phosphate aldolase [Mycobacterium avium subsp. paratuberculoMKFVDDPEQAVLDAAKDMLRRGLVEGTAGNISARRSDGNIVITPSSVDYR
DMQLDDLVLIDPAGSVLQAAQGRSPSTEMQLHLACFAAFDDIGCVIHSHP
VWATMFAIAHQSIPACIDEFAVYCGGDVRCADYAASGTPDVGANAVKALQ
GRGAALIANHGLVAVGPRPDKVLHITALVERTAQIVWGARALGGPVPIPA
DVNRNFAAVYGYLRANP
41410290NP_963126.1 Adh [Mycobacterium avium subsp. paratuberculosis K-10]MKALVYGVAPEPVAVPDDANPLVQNLARTPTGLRDMPEPVLPHEDWVLTR
PRLTGICGSDAKQILMDFGEGDADNAMSAFCSFPQVMGHEVVADVVALGP
GARGLAVGQRVVLNPWLSCGPRGIQPPCPACEAGDYSLCWSFADGDLKPG
IHTGVSADVTGGYAELMPAHDSMLFAVPERVPDEMAVFADPFSVSLHAIT
RHPPPRSGRALVYGAGSLGLCAVAILRALYPEVAVAVVARFDAQAELARR
FGAAKVVAHEPRTAVIEELVGWGGGRLRRPLLGLPMAHPGAVDVVYDTVG
KPETLEVAVRLLRSRGTLVKAGVHAPGRWEDSPLYFKEIALVGSNAFGVE
EVDGQRRHAIAHYLDLAAAGRVDLRPMLTHTFTLDRWRDAFHALADQGRT
GAVKVAFDQR
41410289NP_963125.1 hypothetical protein MAP4191c [Mycobacterium avium subsp. paratuberculoMPAYVISKGCRESREAYSGGSLLYRLNISLATTSTISDRGAHMTSTRYEG
DTWDLASSVGVTATMVAAARAMATRADNPLINDLFAEPLVKAVGVDLLSR
LAGGELDPAELNDVHDGAAGSAGAMSRMADNMAVRTKFFDEFFLNATKAG
IAQVVILASGLDARAYRLAWPAGTVVYEVDQPQVIDFKTTALAQLGAAPT
AERRVVAVDLRDDWPAALRAAGFDPARPTAWSAEGLLGYLPPEAQDRLLD
TITELSAPGSRLATESAPNPAPGEEEKLKERMQAISQRWRAHGFDLDMAG
LVYFGERNEAAPYLAGHGWRLNSVTIRDLFAANGLDPLDDDDTRMGEMLY
TWGIYE
41410288NP_963124.1 hypothetical protein MAP4190c [Mycobacterium avium subsp. paratuberculoMSEGRTDGDTWGPAQSVGATATMVAAARAVASQGPDALLDDPLAEPLVRA
VGLDPFIRIVEGKLDFPDDPLFNRRARAEQITVRTRFFDDFFIDATEAGL
RQAVILASGLDTRAYRLTWPAGTVVYEIDQPQVIAFKTDTLANLGAAPTA
ERRTISIDLRDDWPAALREGGFDVTRPTAWSAEGLLPYLPPEAQDRLFDN
ITALSAPGSRLATEHVPDPNAFSDERLARISERWQRLGLNLNAADLFYRG
ERNVVADYLTGKGWRVTPHPARQLYARNGFEFPEDEMRATFGEMSYVDAT
LTGGRG
41410287NP_963123.1 hypothetical protein MAP4189c [Mycobacterium avium subsp. paratuberculoMTRTHDDEWDLASSVGATATMVAAGRAMATKDPRGLIDDPFAEPLVRAVG
VDFFTKMMDGELDLDAIENATPVRIQSMVDGMAVRTKYFDDYFVDATDAG
VRRVVILASGLDSRAYRLPWPAGTVVYEIDQPRVIEFKSNTLAEVGAEPT
ATRRTIPIDLRGDWPAALSAAGFDPAAPTAWLAEGLLIYLPPEAQDRLFD
NITALSAPGSTIATEFVPGIVDFDAERVREMSGSFRQHGVDIDMASLVYA
GERNHVIDYLNGLGWRAEGVTRTELFHRHGIEVPAPENDDPLGEIIFISA
TRTR
41410286NP_963122.1 hypothetical protein MAP4188 [Mycobacterium avium subsp. paratuberculosMFAVLSSIPGLSKGADEIRALAGRVDTARHHGVPNGCVLELDLRSMPPET
SGFDPLALVTGGSRPASLRDTVDAIHRAAEDPRVAGLIARVQLAPSPSAA
VQELREAIVAFTAAKPSLAWAETYPGTLSYYLASAFGEIWMQPGGSVGLI
GFASNATFLRDALDKAGIEAQFVARGEYKSAVNRFTEHGFTEAHREAVTR
MLDSVQEQVWQAVAESRKLDTDALDALADRAPLLRQDALDSGLVDRIGFR
DQAYDRIAELVGVQDVSPDTEPPRLYVSRYAGAARSRLSPPVPSLPGRRR
PPTVAVINVDGTLVDGRGGPHFLPFGAATVGSDTIAPALREAAADDAVSA
IVLRVNSPGGSVTASETLWREVKRARERGKPVVASMGAVAASGGYYVSVA
ADAIVANPATITGSIGVITGKLVIRDLLGRLGVGSDTVRTNANADAWSID
APFTPEQRAHREAEADLVYTDFVSRVAEGRNLTTDAVERVARGRVWTGAD
AHERGLVDELGGFRIAVRRAKILAGLDEDADVRIVTYPSGSLLDVLRPRA
SSQPAAVSLPDALGALTVKTLGAILDNVERSCSGASALWLGPSRL
41410285NP_963121.1 hypothetical protein MAP4187c [Mycobacterium avium subsp. paratuberculoMRFSIAIPQFDYDGFDGAGLRSFLTRAEQLGFEGGWALEQIIGPAPLLAP
LELLAYCAACTERLRLGVAVLVTSLHDPLQLASAVTAVDRLSHGRLDIGV
APGGGTRKFAAFGVDKDTFVAYFTEGLKLMKAAWSDDPRVTFHGRFRDVD
DLPIAPKPLQRPHPPIWFGGLAPKALARAVRHGDAFMGAGSSTTEAFAGA
VAVLRRELDEQQRDPAEFTIGKRVYLTVDDDAARARERVLAGLGRIYGRM
PGVADVPVSGTPGDVVRGLREVIDAGAQTLLLNPVGADVAENHEQMERLA
AEVIPQLN
41410284NP_963120.1 50S ribosomal protein L15 [Mycobacterium avium subsp. paratuberculosis MTIKLHDLKPARGSKTPRTRVGRGEGSKGKTAGRGTKGTKARKNVPVTFE
GGQMPIHMRLPKLKGFRNRFRTEYEIVNVGDINRLFPQGGSVGVDELVAK
GAVRRNSLVKVLGDGKLTVKVEVSAHKFSGSAREKITAAGGSVTEL
41410283NP_963119.1 50S ribosomal protein L30 [Mycobacterium avium subsp. paratuberculosis MSQLKITQVRSTIGARWKQRESLRTLGLRRIRHSVIREDNPQTRGLIAVV
SHLVEVAPADASSAGTGGSKK
41410282NP_963118.1 30S ribosomal protein S5 [Mycobacterium avium subsp. paratuberculosis KMAEQPAGGQGAGDSRDSRGDRDSRGRRGDGGRGGRDRDGDKSNYLERVVA
INRVSKVVKGGRRFSFTALVIVGDGNGMVGVGYGKAKEVPAAIAKGVEEA
RKGFFRVPLIRGTITHPVQGEAAAGVVLLRPASPGTGVIAGGAARAVLEC
AGVHDILAKSLGSDNAINVVHATVAALKLLQRPEEVAARRGLPIEDVAPA
GMLKARRESDALASAAAAREAAAQ
41410281NP_963117.1 50S ribosomal protein L18 [Mycobacterium avium subsp. paratuberculosis MAQTQADTAARKPVGQSVSATRRVSRLRRHARLRKKIAGTPERPRLVVNR
SARHIHVQLVNDENGTTVAAASSIEDDVRSLQGDKKARSVRVGQLIAERA
KAAGIDSVVFDRGGYTYGGRIAALADAARENGLQF
41410280NP_963116.1 50S ribosomal protein L6 [Mycobacterium avium subsp. paratuberculosis KMSRIGKQPVPVPAGVDVTIDGQKVSVKGPKGTLDLTVAEPITVSRNDDGA
IVVTRPNDERRNRSLHGLSRTLVSNLVTGVTQGYTTKMEIFGVGYRVQLK
GSNLEFALGYSHPVVIEAPEGITFAVQSPTKFSISGIDKQKVGQISANIR
RLRRPDPYKGKGVRYEGEQIRRKVGKTGK
41410279NP_963115.1 30S ribosomal protein S8 [Mycobacterium avium subsp. paratuberculosis KMTMTDPIADFLTRLRNANSAYHDEVTLPHSKLKANIAQILKNEGYISDFR
TEDARVGKSLIVQLKYGPSRERSIAGLRRVSKPGLRVYAKSTNLPRVLGG
LGVAIISTSSGLLTDRQAARQGVGGEVLAYVW
41410278NP_963114.1 30S ribosomal protein S14 [Mycobacterium avium subsp. paratuberculosis MAKKALVNKAARKPKFAVRGYTRCNKCGRPRAVFRKFGLCRICLREMAHA
GELPGVQKSSW
41410277NP_963113.1 50S ribosomal protein L5 [Mycobacterium avium subsp. paratuberculosis KMTTTEKVQPRLKERYRNEIRDSLQQQFGSANVMQIPTVTKVVVNMGIGEA
ARDAKLINGAVNDLALITGQRPEIRRARKSIAQFKLREGMPIGARVTLRG
DRMWEFLDRLTSIALPRIRDFRGLSSKQFDGVGNYTFGLAEQSVFHEIDV
DKIDRVRGMDINVVTSATTDDEGRALLRALGFPFKEN
41410276NP_963112.1 50S ribosomal protein L24 [Mycobacterium avium subsp. paratuberculosis MKVRKGDTVLVIAGKDKGAKGKVLKAYPDRERVLVEGVNRIKKHTAISTN
QRGAQSGGIVTQEAPIHVSNVMVVDSDGKPARVGYRLDEETGKRVRISKR
NGKDI
41410275NP_963111.1 50S ribosomal protein L14 [Mycobacterium avium subsp. paratuberculosis MIQQESRLKVADNTGAKEILCIRVLGGSSRRYAGIGDVIVATVKDAIPGG
NVKRGDVVKAVVVRTVKERRRPDGSYIKFDENAAVIIKPDNDPRGTRIFG
PVGRELREKRFMKIISLAPEVL
41410274NP_963110.1 hypothetical protein MAP4176 [Mycobacterium avium subsp. paratuberculosMFEDAVAWFDELMERCYPSATPESAALVQRIGVFARVENRAAAEQLAAIG
ELFAYRLSRCSECEDWAVDTEAAVSAEVAAQLRIGQGLAAAKVRYARAMR
ERLPRVGEVFRAGEIDFRLFATIVYRTDLITDRRVLAAVDAELAATAARW
PSMTRARLAARVDAVVAKADADAVRRAEKQAATRHVWIAEMGEGLSHLEG
TVSSPDAHALDKRLDALAATVCEHDPRTGEQRRADALGALAAGADRLGCR
CGRADCAAGTGPAAGPVVIHVIAERASVEGTGGGPAVEVGAEGLLPAQLV
AELAASARLMPLVHPADSSPENRYTPSAALADFVRCRDLTCRWPGCDRPA
TECDLDHTIPYAEGGPTHASNLKCYCRTHHLVKTFWGWREQQLPDATLIL
TSPAGQTYVTTPGSALLFPSLCVPTGEPARPVAAGSQPCGERTAMMPTRR
RTRGQNRAARVAAERRANRAARLARATRPAPAASQSWPAGHGPDADPPPF
41410273NP_963109.1 hypothetical protein MAP4175 [Mycobacterium avium subsp. paratuberculosMTATAVAAQAPVTKKRDRPRIAIGVCILAGVVIVYVLSLFGVHFLQRSEG
PLPPLDLSQGGGDATIVQLRLEELKPVANRLSVNVLVYPGVAQYDNRFDV
LANDVAVRLYPTSDLGDLHYPKGKAPAQLSTTVEAHGDPGNWPFDSYRTE
PISADAFVGSGDNLKKVPARVEVTGALDGWQITVDRVRDPAALPTQRGSD
NGDVVITLKRAKGPLIFDLGICLVLISLPTLALLVAIPMAMGRRKFLPPF
ATWYAANLFAIVPLRNILPGAPPPGSWIDQAIVQWVLIALVAAMTLYIIA
WVRQGD
41410272NP_963108.1 hypothetical protein MAP4174 [Mycobacterium avium subsp. paratuberculosMRSELADLPGGSFRMGSTSFYPEEAPIHTVTVEPFAIERHPVTNAQFAEF
VAATGYVTVAEQPIDPALYPGADPSQLQPGAMVFRPTPGPVDLRDWRQWW
HWVPGASWRHPFGPDSDVADRADHPVVQVAYPDAAAYARWAGRRLPTEAE
WEYAARAGATTTYPWGDEPTSDGRLMANTWQGRFPYRNDGALGWVGTSPV
GVFAPNAFGLLDMIGNVWEWTTTEFSTHHRIGAATKPCCAPSGPADPSVN
QTLKGGSHLCAPEYCHRYRPAARSPQSQDSATTHIGFRCVAELGSN
41410271NP_963107.1 hypothetical protein MAP4173 [Mycobacterium avium subsp. paratuberculosMTHQAPPAPPPSVPSEQPPAAPPDAPPARRRRRPVIAAAVVLGFVAVYVL
SLFGVHLLAKTAGPLKPPDLNATSDTVVLVRLEKLDTIANRLTVKVLVIP
EESMFDKRLDVLTTDTAVRMDPPNDLGDLQYPAGKSPAQVATTIEAHGNP
NNWPFYSYRTDTMSAEVLVGQGDTRHYIPARVEVTGGLDGWDVSVQRVGE
ASQESDRADNVIITLHRSKSTLIFDAGICLVLFALPAMALTIALLMLTGK
RGFLPPFVTWFAALLFAVIPIRNFLPGSPPAGAWVDQALVLWVLIALVAS
MVLFLITWYRRTD
41410270NP_963106.1 PhoS2_3 [Mycobacterium avium subsp. paratuberculosis K-10]MRTRSAVIAGVLMATTLVVSACGETPASLPYTAGAKVDCGGKQTLSASGS
TAQANAMTRFIAAYRTACPGQTLDYTANGSGNGIGDFLAGRTDFAGSDTP
LSGDQYAAAKRRCGGADAWNLPVVFGPLAITYNLAAVDSLVLDAPTLAKI
FNGTITRWDDPALALLNASMPAEDIRVVYRSDGSGTTDNFQAYLQSAAGG
VWNKGAGKTFNGGVGTGAVGNTGTAAAVKSTEGAISYNELSFALQQGLFA
AEIKTPASRRSLRPVRIGTDIFGKTIKGARIVGTGNDLVLDLSSFYNPAQ
PDVYPIVLATYEIVCSKYPGFDVAKAVKAFLQAAIGPGQVELARTGYIPL
SADFQAKVSGAVDAISSPQAPNPD
41410269NP_963105.1 AtsA [Mycobacterium avium subsp. paratuberculosis K-10]MVAGSGQSAEFSGRVELDIRDSEPDWGPYAAPTAPPNAPNILYLVWDDTG
IATWDCFGGLVEMPAMSRIAERGVRLSQFHTTALCSPTRAALLTGRNATT
VGMATIEEFTEGFPNANGRIPFDTALLSEALAEHGYNTYCVGKWHLTPLE
ESNMASTKRHWPTSRGFERFYGFLGGETDQWYPDLVYDNHPVSPPATPED
GYHLSKDLADKTIEFIRDAKVIAPEKPWFSYVCPGAGHAPHHVFKEWADR
YAGRFDMGYERYREVVLERQKAMGIVPSDTELSPVNPYLDVTGPRGEPWP
LQDTVRPWDSLNDEEKKLFARMAEVFAGFLSYTDAQIGRILDYLEESGQL
DDTIIVVISDNGASGEGGPNGSVNEGKFFNGYIDTVEESMKLFDQLGGPQ
TYNHYPIGWAMAFNTPYKLYKRYASHEGGIADTAIISWPNGIAAHGEIRD
NYVNVCDITPTVYDLLGMSPPETVKGIAQKPLDGVSFKAALDDPNADTGK
TTQFYTMLGTRGIWHEGWFANTVHAATPAGWSHFDADRWELFHIEADRSQ
CHDLAAENPDKLEELKALWFAEAARYNGLPLSDLNILETMTRSRPYLVGE
RDSYVYYPDCADVGIGAAAEIRGRSFSVLAEATVDTTGAEGVLFKQGGAH
GGHVLFIQDGRLHYVYNFLGERQQEVSSSVPVPLGRHLFGASYARTGTVP
DSHTPLGDLTLFIDDEVVGTLAGVSTHPGTFGLAGAGITVGRNGGSGVSS
RFKAPFVFTGGTIARVTLDLSGRPYRDVETEIALAFSRD
41410268NP_963104.1 30S ribosomal protein S17 [Mycobacterium avium subsp. paratuberculosis MMAEAKKAAPKKAATAASKDADAKGPKHTPPNPKVRGRRKTRIGYVVSDK
MQKTIVVELEDRVKHPLYGKIIRTTKKVKAHDENSIAGIGDRVSLMETRP
TSATKRWRLVEILEKAK
41410267NP_963103.1 50S ribosomal protein L29 [Mycobacterium avium subsp. paratuberculosis MAVGISPGELRELTDDELTERLRESKEELFNLRFQMATGQLTNNRRLRTV
RQEIARVYTVLRERELGLASGPDGKES
41410266NP_963102.1 50S ribosomal protein L16 [Mycobacterium avium subsp. paratuberculosis MLIPRKVKHRKQHHPRQRGIASGGTAVNFGDYGIQALEHAYVTNRQIESA
RIAINRHIKRGGKVWINVFPDRPLTKKPAETRMGSGKGSPEWWVVNVKPG
RVLFELSYPNEQTARAALTRAIHKLPIKARIVTREDQF
41410265NP_963101.1 30S ribosomal protein S3 [Mycobacterium avium subsp. paratuberculosis KMGQKINPYGFRLGITTDWKSRWYADKQYADYVKEDVAIRRLLSTGLERAG
IADVEIERTRDRVRVDIHTARPGIVIGRRGTEADRIRADLEKLTGKQVQL
NILEVRNPESQAQLVAQGVAEQLSNRVAFRRAMRKAIQSAMRQPNVKGIR
VQCSGRLGGAEMSRSEFYREGRVPLHTLRADIGYGLYEAKTTFGRIGVKV
WIYKGDVVGGKRELAAAAPAGAERPRRERPSGTRPRRSGASGTTATGTEA
GRAAASADESTAAGQPAEAAPAAEPQSTES
41410264NP_963100.1 50S ribosomal protein L22 [Mycobacterium avium subsp. paratuberculosis MTTTEFPSAVAKARFVRVSPRKARRVIDLVRGRSVTDALDILRWAPQAAS
EPVAKVIASAAANAQNNNGLDPATLVVATVYADEGPTAKRIRPRAQGRAF
RIRKRTSHITVVVESRPAKDQRSAKSSRTRRAEASKAAAKAPAKKAPAKK
APAKKAPAKTAAKKAPAKTSETSDAKGGSD
41410263NP_963099.1 30S ribosomal protein S19 [Mycobacterium avium subsp. paratuberculosis MPRSLKKGPFVDGHLLKKVDAQNEKNTKQVIKTWSRRSTIIPDFIGHTFA
VHDGRKHVPVFVTEAMVGHKLGEFAPTRTFKGHIKDDRKAKRR
41410262NP_963098.1 50S ribosomal protein L2 [Mycobacterium avium subsp. paratuberculosis KMAIRKYKPTSPGRRGASVSDFSEVTRSTPEKSLVRPLHGHGGRNAHGRIT
TRHKGGGHKRAYRVIDFRRNDKDGVNAKVAHIEYDPNRTANIALLHFLDG
EKRYIIAPQGLSQGDVVESGPNADIKPGNNLPLRNIPAGTVIHAVELRPG
GGAKLALSAGSSIQLLGKEGSYASLRMPSGEIRRVDVRCRATVGEVGNAE
QANINWGKAGRMRWKGKRPSVRGVVMNPVDHPHGGGEGKTSGGRHPVSPW
GKPEGRTRHPNKASNKLIVRRRRTGKKHGR
41410261NP_963097.1 50S ribosomal protein L23 [Mycobacterium avium subsp. paratuberculosis MATVTDPRDIILAPVISEKSYSLLDDNVYTFVVHPDSNKTQIKIAIEKIF
SVKVASVNTANRQGKRKRTRTGFGKRKSTKRAIVTLAPGSKPIDLFGAPA
41410260NP_963096.1 50S ribosomal protein L4 [Mycobacterium avium subsp. paratuberculosis KMALKLDVKAPGGKVEGSIELPAELFDAPANIALMHQVVTAQRAAARQGTH
STKTRGDVSGGGRKPYRQKGTGRARQGSTRAPQFTGGGVVHGPKPRDYSQ
RTPKKMIAAALRGALSDRARNGRIHAITELVSGQTPSTKSAKAFLGALTE
RKQVLVVIGRSDEAGAKSVRNLPGVHILAPDQLNTYDVLRADDVVFSVEA
LRAYIAANTGTPEEVSA
41410259NP_963095.1 50S ribosomal protein L3 [Mycobacterium avium subsp. paratuberculosis KMARKGILGTKLGMTQVFDENNRVVPVTVVKAGPNVVTRIRTPEQDGYSAV
QLAYGEISPRKVNKPVTGQYAAAGINPRRFLAELRLDNPDAAAEYQVGQE
LTAEIFTDGSYVDVTGTSKGKGFAGTMKRHGFRGQGASHGAQAVHRRPGS
IGGCATPARVFKGTRMAGRMGNDRVTVQNLLVHKVDTENGVLLIKGAVPG
RTGGLVMVRSAVKRGEK
41410258NP_963094.1 30S ribosomal protein S10 [Mycobacterium avium subsp. paratuberculosis MAGQKIRIRLKAYDHEAIDASARKIVETVVRTGASVVGPVPLPTEKNVYC
VIRSPHKYKDSREHFEMRTHKRLIDILDPTPKTVDALMRIDLPASVDVNI
Q
41410257NP_963093.1 hypothetical protein MAP4159 [Mycobacterium avium subsp. paratuberculosMTVDAVTRTANVARATLYRHFPSGNDLLAAAFNSLIPASPTPPAEGSLRD
RLVAVVLAQAEAVAQAPTMMTAMTWLALGRDLEAWPQPRADDSVAITTLR
ERIAQQYSEPFDVIFDSPEAAELGEVDRSRAIALLIGPLVLGRLSTLPDF
DYRECALAAVDGFLHVQRARARAARVESAGA
41410256NP_963092.1 hypothetical protein MAP4158 [Mycobacterium avium subsp. paratuberculosMKNAVSHSDVLIVGVGSAGSVVAERLSADPGCTVTVVEAGPALDDPALLA
RTANGLQLPIGVGSPLVRRYQTQLTERPARRHPLVRGATIGGSGAINGGY
FCRGLPRDFDRLGLPGWAWSDVLDSFRAIETDLDFDGPAHGRSGPILVRR
TREMTGTTERFIDAARRAGFGWIDDLNDAAAQPVSGIGAVPLNIVDGVRK
GSGAGYLIPALSRPNLRVQAHSRVARLRLAGTVARGADVVGPHGRATLTA
DRIVLCAGAIETAHLLMLSGIGEPGMLRAAGVPVRVALPVGTSFSDHAEW
VLPTDWPVAPGRPVLEVVLSTADHLEIRPYTGGFVAMTGDGTAGHADWPH
LGVALMQPRARGCLTLVSADPAVPPRIEHRYDSEPGDVAALARGAELARE
LAGGTTDAAAVIWSTSQHLCGTAPMGVDGDPRAVVDPRCRVRGIDNLWVI
DGSVLPAITSRGPHATIVMIGHRAAEFVR
41410255NP_963091.1 hypothetical protein MAP4157 [Mycobacterium avium subsp. paratuberculosMLPHSTVSYVPSAAIICRCSAIREIGGFDETLQSGEDVDLCWRLIEAGVR
LRYEPIALVGHDHRTELRDWLARKAFYGGSAAPLSVRHPDKTAPVVISGW
ALMTWILMAFGSTLSRLASLLLAVLTGRRIARAMRSAETSMTDVVTVAGR
GLWSAALQLASALCRHYWPLALLAATMSRHFRRVVLVAAVMDGVVDWLRR
RDAVGDDVEPIGLPTYLVLKRVDDLAYGLGLWWGVLRERNARALKPQIRS
41410254NP_963090.1 hypothetical protein MAP4156 [Mycobacterium avium subsp. paratuberculosMTAPAPRLPDGFAVQVDRRVRVLGDGSALLGGSPTRLLKLAPAAQDLLCD
GRLKVRDDVSAQLARTLLDATVAHPRPAGGPSHHDVTVVIPVRDNLSGVR
RLVSSLRGLRVVVVDDGSFPPIEPEDFVGAHCDIEVLRHHRSKGPAAARN
TGLAACRTDFVAFLDSDVAPRRGWLEALLGHFCDPTVGAGRAAHRRPVAQ
RERGGPLRGGALLARPR
41410253NP_963089.1 hypothetical protein MAP4155 [Mycobacterium avium subsp. paratuberculosMNSSYHHRVSVLGELGTVTSSQLSGTAVSLLVPLGSTEQHGPHLPLDTDT
RIASAVAGRAVPRLGDDWLVAPAIAYGASGEHQSFAGTVSIGTEALTLLL
IEYGRSAAGWAQRVVFVNGHGGNVAALGRAVGTLRAEGRDAGWCPCVAAG
GDAHAGHTETSVLLHISPAEVRTGAWQAGNRAPLPELLGSMRRGGVAAVS
PVGVLGDPTTATAAEGERILSEMVNECVRRVARWRPGPDGMLA
41410252NP_963088.1 LldD1 [Mycobacterium avium subsp. paratuberculosis K-10]MADEWFETVAIAQQRAKRRLPKSVYAALIAASEKGITVSDNVEAFGELGF
APHVVGAPAKRELTTTVMGQEISMPVLISPTGVQAVDPDGEVAVARAAAA
RGTAMGLSSFASKPIEEVIAVNPKVFFQVYWLGGRDAIAERVERARQAGA
VGLIVTTDWSFSHGRDWGSPKIPEEMNLRTILRLSPEAVFKPRWLWKFGK
TLRPPELRVPNQGRRGEPGPPFFAAYGEWMGTPPPTWEDIAWLRELWGGP
FMLKGVMRVDDAKRAVDAGVSAISVSNHGGNNLDGTPASIRALPAIAEAV
GDQIEVLLDGGVRRGSDVVKAVALGARAVMIGRAYLWGLAAAGQAGVENV
LDILRGGIDSALMGLGHSSVHDLGPSDILVPPGFTRALGVPPAG
41410251NP_963087.1 PqqE [Mycobacterium avium subsp. paratuberculosis K-10]MTTVAPVPRLIEQFEHGLDAPICLTWELTYACNLACVHCLSSSGKRDPRE
LSTRQCMDIIDELERMQVFYVNIGGGEPTVRPDFWELVDYATAHHVGVKF
STNGVRITPEVAARLAASDYVDVQISLDGATAEVNDAVRGPGSFDMAVRA
LQNLADAGFTQNGGAKISVVVTRHNVGQLDEFAALASRYGATLRITRLRP
SGRGADVWDELHPTADQQVQLYDWLVAKGERVLTGDSFFHLAPLGQSGAL
AGLNMCGAGRVVCLIDPVGDVYACPFAIHDRFLAGNVLSDGGFDNVWKNA
PLLRELREPQSAGACGSCGHYDSCRGGCMAAKFFTGLPLDGPDPECVQGH
SAAALAGDREAPRPRADHSRGKRIRQPVPLTLSVRPPVLTPAAPPARLCN
ESPV
41410250NP_963086.1 hypothetical protein MAP4152 [Mycobacterium avium subsp. paratuberculosMRGLLTVPAPAQARAAGAAFDPDRGWRLHPQVAVRPEPFGALLYHFGTRK
LSFLKNRTILTVVQSLAEYPDVRCACRAAGIDDAGQAPYLHALGVLADSN
MLVPREDHP
41410249NP_963085.1 hypothetical protein MAP4151c [Mycobacterium avium subsp. paratuberculoMASSAEMEGPGSGMPQQRVGRRRSTTPHHITDVAIDLFTARGFAEVSVDD
VAAAAGISRRTLFRYYASKNAIPWGDFDTHLARLRELLDNVESRVPLGDA
LRTALLAFNTFDESETARHRQRMRVILQTAELQAYSMTMYAGWREVIAGF
VARRCECKTTDLAPQTVAWMMLGVALSAYEHWLGDESVPLPVALGNAFDV
VGAGLNGLDR
41410248NP_963084.1 hypothetical protein MAP4150c [Mycobacterium avium subsp. paratuberculoMSVEHLVHMLRAQGSFCASSGSPMYGDLFELVASDVEAGGVFADILSGHR
DAPSRDAIPLRLLGGLHRLVLDGRAGSLRRWYPSTGGSWDAGAAWPPILA
AAAEHAAALRAALDRPPQTNEVGRSAALIGGLLHINESCLPVRLFEIGSS
AGLNLRADHYRYRYAGGGWGPADSPVCIDDAWRGALPPARGVRIVERHGF
DIAPVDVGNPDGELTVLSYVWPDQAARLARLRGAIEVARRVPATLERRTA
ADAVGRLSLAEGALTVLWHSITWQYLSAGERAAVCAGVDALGARAGASAP
LVHLTMEPARDGPGAPIRFLVRARGWPDGGPRVLAQCHPHGPPVDWL
41410247NP_963083.1 hypothetical protein MAP4149 [Mycobacterium avium subsp. paratuberculosMTVIDEIYSSSSAIPTVALNDEAKKPVLGLGVAKLSDEETESSVLAALEA
GCRLIDTAASYGNEAAVGRAIAASGIPREELFVTTKLGTSRQGFHSAQES
CKESLDRLGLDYLDLYLIHWPAPTLGKYVESFEGMIEARERGHVRSIGVS
NFTEDLLATVIEETNEVPAVNQVELHPRLNQAELRQVHAQHDVTTQSYSP
LGVGRLIEEPTVTTIAAEYGRTPAQVLVRWNLQLDNVVVSRSSKPERVAE
NLDVFDFTLEPEHMEAIEGLHDGTRVLHDPMTFMGT
41410246NP_963082.1 hypothetical protein MAP4148c [Mycobacterium avium subsp. paratuberculoMKSMQELFEIAWQATQIGATTLKKTQPSSVQHKGDRDLVSDVDLTIQRDI
ANYLSQTTPDVALLAEESDHQPDIETAEWLWVLDPVDGTSNFVHGLPLCA
VSLALLHAGRTVVAVTHAPLLGKTYHAIESKGAFVNGERITASATDSLSG
AIVSLGDYAVGHDAGRLNAHRLALTAELVPRAERIRMIGAATLDLAFVAE
GALDACVMMSNKPWDTAAGTLIAREAGARLTDAQGNPHTHKSASTVVAAP
GIAEQLATVIRNTEVPSDRYAAAVG
41410245NP_963081.1 hypothetical protein MAP4147 [Mycobacterium avium subsp. paratuberculosMSSDASASNGIVIVGGGLAAARTAEQLRRSEYSGPITIVSDEVHLPYDRP
PLSKEVLRKEVDDTALKPRQWYDDNDITLRLGSAARSLDTAAQTLTLEDG
TTLGYDELVIATGLVPRRIPTIPDLDGIRVLRTFDESLALREHASAAQRA
VIIGAGFIGCEVAASLRSLGVDVVLVEPQPTPLAAVLGEQIGELVARLHR
AEGVDVRLGVGVAQVRGDTHVEAVVLTDGTELAADVVVIGIGSRPATDWL
EGSGVAIDSVDRGVLCDEAGRTSAPNVWALGDVASWRDATGHQGRVEHWS
NVADQARVVVPAMLGKEVPPVVVVPYFWSDQYDVKIQCLGEPEADDIVHI
VEDDGRKFLAYYERDGALVGVVGGGMPGKVMKTRAKIAAAVPIAEMLG
41410244NP_963080.1 3-ketoacyl-ACP reductase [Mycobacterium avium subsp. paratuberculosis KMAGQAGSLQGRVAFITGAARGQGRSHAVRLAAEGADIIACDICAPVSASV
TYAPASPEDLDETARLVEDQGRKALTRVLDVRDDAALRELVADGMEQFGR
LDVVVANAGVLSWGRVWELTDEQWDTVIGVNLTGTWRTLRATVPAMIEAG
NGGSIVVVSSSAGLKATPGNGHYSASKHGLTALTNTLAIELGEYGIRVNS
IHPYSVETPMIEPEAMMEIFARHPSFVHSFPPMPVQPNGFMTADEVADVV
AWLAGDGSGTLTGTQIPVDKGALKY
41410243NP_963079.1 hypothetical protein MAP4145 [Mycobacterium avium subsp. paratuberculosMLARYLKAQLVVLLCGGLVGPIFLVVYFTLGLGSLLQWMFYVGLLITVAD
VLIALALANYGAKSSEKLAALEQNGVLALAQITGITETGTWVNNQQVVKV
HLHIAGPGLVPFDSEDRVIASVTRLGNLNARKVVVLVNPTTNEYRIDWER
SALVNGLVPAQFTVAEDNTTYDLSGQAGPLMEILQILKANNIPLNRMVDI
RSNPALRAQIQAVVRRAAQQQAPAGQPAPAGQPATGQPSAPVAAPPGPSI
AARLQELNDLHASGALTEQEYNSRRAAIIAEI
41410242NP_963078.1 hypothetical protein MAP4144 [Mycobacterium avium subsp. paratuberculosMSFVQATPEFVAAAATDLARIGSTISSANTAALGPTSGVLAPGADEVSAS
IAALFDAHSQVYQALSAQAAAFHSQFVQLMNGGALQYAVTEAANTTPLQS
AAGPASVAAQLPAVSGAVGGSAPYGHPTAPLAAAAGASRYTRDGAGSEHP
GGGTQRRGVLGTDSRPDPGQIRRGSRDEFRSRLNERHRHHPATSYGPRGT
TTAKS
41410241NP_963077.1 elongation factor Tu [Mycobacterium avium subsp. paratuberculosis K-10]MAKAKFERTKPHVNIGTIGHVDHGKTTLTAAITKVLHDKYPDLNESRAFD
QIDNAPEERQRGITINISHVEYQTDKRHYAHVDAPGHADYIKNMITGAAQ
MDGAILVVAATDGPMPQTREHVLLARQVGVPYILVALNKADMVDDEELLE
LVEMEVRELLAAQEFDEDAPVVRVSALKALEGDAKWVESVEQLMEAVDES
IPDPVRETDKPFLMPVEDVFTITGRGTVVTGRVERGVINVNEEVEIVGIR
PSSTKTTVTGVEMFRKLLDQGQAGDNVGLLLRGIKREDVERGQVVTKPGT
TTPHTEFEGQVYILSKDEGGRHTPFFNNYRPQFYFRTTDVTGVVTLPEGT
EMVMPGDNTNISVKLIQPVAMDEGLRFAIREGGRTVGAGRVVKIIK
41410240NP_963076.1 elongation factor G [Mycobacterium avium subsp. paratuberculosis K-10]MAQKDVLTDLTKVRNIGIMAHIDAGKTTTTERILYYTGISYKIGEVHDGA
ATMDWMEQEQERGITITSAATTCFWNDNQINIIDTPGHVDFTVEVERSLR
VLDGAVAVFDGKEGVEPQSEQVWRQADKYDVPRICFVNKMDKIGADFYFS
VRTMEERLGANVIPIQIPVGSEGDFEGVVDLVEMKAKVWSAEAKLGEKYD
VVDIPADLQEKAEEYRTKLLEAVAETDEALLDKYLGGEELTIEEIKGAIR
KLTISSEAYPVLCGSAFKNKGVQPMLDAVIDYLPSPLDVPPAEGHVPGKE
EELITRKPSTDEPFSALAFKVATHPFFGKLTYVRVYSGKVDSGSQVINST
KGKKERLGKLFQMHSNKENPVETASAGHIYAVIGLKDTTTGDTLSDPNHQ
IVLESMTFPDPVIEVAIEPKTKSDQEKLSLSIQKLAEEDPTFKVHLDQET
GQTVIGGMGELHLDILVDRMRREFKVEANVGKPQVAYKETIRRKVENVEY
THKKQTGGSGQFAKVIINLEPFTGEDGATYEFENKVTGGRIPREYIPSVD
AGAQDAMQYGVLAGYPLVNLKVTLLDGAFHEVDSSEMAFKIAGSQVLKKA
AAQAQPVILEPIMAVEVTTPEDYMGDVIGDLNSRRGQIQAMEERSGARVV
KAHVPLSEMFGYVGDLRSKTQGRANYSMVFDSYAEVPANVSKEIIAKATG
Q
41410239NP_963075.1 30S ribosomal protein S7 [Mycobacterium avium subsp. paratuberculosis KMPRKGPAPKRPLVNDPVYGSQLVTQLVNKVLLKGKKSLAERIVYGALENA
REKTGTDPVITLKRALDNVKPALEVRSRRVGGATYQVPVEVRPDRSTTLA
LRWLVSFSRQRREKTMVERLANEILDASNGLGASVKRREDTHKMAEANRA
FAHYRW
41410238NP_963074.1 30S ribosomal protein S12 [Mycobacterium avium subsp. paratuberculosis MPTIQQLVRKGRRDKIGKVKTAALKGSPQRRGVCTRVYTTTPKKPNSALR
KVARVKLTSQVEVTAYIPGEGHNLQEHSMVLVRGGRVKDLPGVRYKIIRG
SLDTQGVKNRKQARSRYGAKKEKS
41410237NP_963073.1 hypothetical protein MAP4139 [Mycobacterium avium subsp. paratuberculosMAAQPEPPTAAGRQRAGRPAARPAKLSREGIIDGALTFLDREGWDALTIN
ALATQLGTKGPSLYNHVDSLEDLRRAVRIRVIDDIITMLNRVGEGRARDD
AVLVMAGAYRSYAHHHPGRYSAFTRMPLGGDDPEYTAATRGAAAPVISVL
SSYGLDGEEAFHAALEFWSALHGFVLLEMTGVMDDIDTDALFSDMVLRLA
AGLERRTAHG
41410236NP_963072.1 hypothetical protein MAP4138c [Mycobacterium avium subsp. paratuberculoMKWTTVAGSLAACALAVLAGAVAPPRVAQAKNGDTHIIGQDTEQTIDCND
ATLLVNGTGNVVTALGNCYAVTVMGSSNTVIADSVSHDITVYGYDQTVFY
KSGQPFLWDRGRELGMTNRLQQVPG
41410235NP_963071.1 hypothetical protein MAP4137c [Mycobacterium avium subsp. paratuberculoMPARTPTPVRDRWLRLTVAPAAALLLAGCSSTANPPAGSSTTTTKSTATT
SAGAAPTTGSGGASTTASIEIGNTINYGSMGTTTTLDCAGGKSLNVGGSD
NTLTVTGTCESATVSGTNNKITFDKVNTRITVLGMNNTITYKDGDPKVDK
IGQSNTINKGG
41410234NP_963070.1 enoyl-CoA hydratase [Mycobacterium avium subsp. paratuberculosis K-10]MSDPVRIERNGPVTTVIINRPAARNAVNGPTAAALYAAFEEFDRDDSASV
AVLWGEGGTFCAGADLKAFGTPEANAVHRSGPGPMGPTRMVLSKPVIAAV
SGYAVAGGLELAIWCDLRVVEQDAVFGVFCRRWGVPLIDGGTVRLPRLIG
HSRAMDMILTGRAVAADEAQAIGLANRVVPKGQSRRAAEELAAQLAALPQ
QCLRSDRLSALHQWGATESEALDFEFASISRVAAEANEGAGRFAAGAGRH
GASAV
41410233NP_963069.1 hypothetical protein MAP4135 [Mycobacterium avium subsp. paratuberculosMPDLTARSVVLSVLLGAHPAHARASELVRLTSDFGIKESTLRVALTRMVN
AGDLIRSADGYRLSDRLLARQRRQDDAIDPKVRPWRGQWVTLIVTSVGDD
ARTRAALRNAMHDKRFSELREGVWMRPDNIDTQLGPDVTDRARVITARDD
DPADLAGRLWDLLGWARAGHRLLDEMAAAPDVPGRFVAAAAMVRHLLTDP
VLPDELLPPDWPGTRLRAAYHDFAAELMARRDPLFAEAT
41410232NP_963068.1 enoyl-CoA hydratase [Mycobacterium avium subsp. paratuberculosis K-10]MTHAIRPVDFDNLKTMTYEVTDRVARITFNRPEKGNAIVADTPLELSALV
ERADLDPNVHVILVSGRGAGFCAGFDLSAYADRTGSAGGTGAYAGTVLDG
KTQAVNHLTDQPWDPMIDYQMMSRFVRGFSSLMHADKPTVVKIHGYCVAG
GTDIALHADQVIAAADAKIGYPPTRVWGVPAAGLWAHRLGDQRAKRLLFT
GDCITGAQAAEWGLAVEAPDPADLDERTERLVQRIAAVPVNQLIMVKLAL
NSALLQQGVATSRMVSTVFDGVARHTPEGHAFVADAVKHGFREAVRHRDE
PFGDHGRQASQV
41410231NP_963067.1 FadE8 [Mycobacterium avium subsp. paratuberculosis K-10]MPPLDNYNPAGSPVLVEALIREGGQWGLDEVNEVGALSASRQAQRWGELA
DRNRPILHTHDRNGYRVDEVEYDPAYHELMRTAIAHGLHAAPWADDRPGA
HVVRAAKTSVWTVEPGHVCPISMTYAVVPALRFNPELAKVYEPLLTSREY
DPELRVATTKPGITAGMSMTEKQGGSDVRAGTTQAVPNGDGSYRLTGHKW
FTSAPMCDIFLVLAQAPGGLSCFLLPRVLPDGTRNRMFLQRLKDKLGNHA
NASSEVEYDGAVAWLVGEEGRGVPTIIEMVNLTRLDCTLGSATSMRTGLT
RAIYHAQHRKAFGAYLIDQPLMRNVLADLAVEAEAATMVAMRMAGATDKA
VRGDQREALLRRIGLAASKYWVCKRSTPHAAEALECLGGNGYVEDSGMPR
LYREAPLMGIWEGSGNVSALDTLRAMATRPECVEVLFDELAEAAGQDPRL
GGHVDRLRADLAELDTIQYRARKVAEDICLALQGSLLVRHGHPAVAEAFL
TTRLDRRWGGAFGTMPDGLELAPILERALVKG
41410230NP_963066.1 endonuclease IV [Mycobacterium avium subsp. paratuberculosis K-10]MLIGSHVRNDDPLAAAQADGADAVQFFLSNPQSWKKPKPRDDAEALKASS
VPLYVHAPYLINVASANNRVRIPSRKILQDTCDAAAEINATAVIVHGGHA
DDNDMEAGFERWVKALDYLETDVQVYLENTAGGDHAMARHFDTIGRLWDR
IGDKGIGFCLDTCHAWAAGEALIDAVDRIKALTGRIDLVHCNDSRDAAGS
GADRHANFGTGQIDPDLLVTVVKAAAAPVICETADEGRKDDIAFLREHTK
S
41410229NP_963065.1 DNA-directed RNA polymerase subunit beta' [Mycobacterium avium subsp. pMLDVNFFDELRIGLATAEDIRQWSYGEVKKPETINYRTLKPEKDGLFCEK
IFGPTRDWECYCGKYKRVRFKGIICERCGVEVTRAKVRRERMGHIELAAP
VTHIWYFKGVPSRLGYLLDLAPKDLEKIIYFAAYVITSVDEEMRHNELST
LEAEMMVERKAVEDQRDADLEARAQKLEADLAELEAEGAKADARRKVRDS
GEREMRQIRDRAQRELDRLEDIWNTFTKLAPKQLIVDENLYRELVDRYGE
YFTGAMGAESIQKLIENFDIDAEAEQLRDVIRNGKGQKKLRALKRLKVVA
AFQQSGNSPMGMVLDAVPVIPPELRPMVQLDGGRFATSDLNDLYRRVINR
NNRLKRLIDLGAPEIIVNNEKRMLQESVDALFDNGRRGRPVTGPGNRPLK
SLSDLLKGKQGRFRQNLLGKRVDYSGRSVIVVGPQLKLHQCGLPKLMALE
LFKPFVMKRLVDLNHAQNIKSAKRMVERQRPQVWDVLEEVIAEHPVLLNR
APTLHRLGIQAFEPMLVEGKAIQLHPLVCEAFNADFDGDQMAVHLPLSAE
AQAEARILMLSSNNILSPASGRPLAMPRLDMVTGLYYLTTEVEGDKGEYS
PAAKDRPETGVYSSPAEAIMAADRGVLSVRAKIKVRLTQLRPPAEIEAEL
FGANGWQPGDAWMAETTLGRVLFNELLPVGYPFVNKQMHKKVQASIINDL
AERYPMIVVAQTVDKLKDAGFYWATRSGVTVSMADVLVPPRKKEILDQYE
ERAEKVEKQFQRGALNHDERNEALVEIWKEATDEVGQALREHYPADNPII
TIVDSGATGNFTQTRTLAGMKGLVTNPKGEFIPRPVKSSFREGLTVLEYF
INTHGARKGLADTALRTADSGYLTRRLVDVSQDVIVREHDCETERGIVVE
LAERQPDGTLIRDPYIETSAYARTLGTDAVDEAGNVIVARGEDLGDPEID
ALLAAGITSVKVRSVLTCTTGTGVCATCYGRSMATGKLVDIGEAVGIVAA
QSIGEPGTQLTMRTFHQGGVGEDITGGLPRVQELFEARIPRGKAPIADVT
GRVRLEDGERFYKITIVPDDGSEEVVYDKLSKRQRLRVFKHEDGSERVLS
DGDHVEVGQQLMEGSADPHEVLRVQGPREVQIHLVREVQEVYRAQGVSIH
DKHIEVIVRQMLRRVTIIDSGSTEFLPGSLIDRAEFEAENRRVVAEGGEP
AAGRPVLMGITKASLATDSWLSAASFQETTRVLTDAAINCRSDKLNGLKE
NVIIGKLIPAGTGINRYRNIQVQPTEEARAAAYTIPSYEDQYYSPDFGQA
TGAAVPLDDYGYSDYR
41410228NP_963064.1 DNA-directed RNA polymerase subunit beta [Mycobacterium avium subsp. paMPAEPTQFAANAAGGPGLRESHEVLEGCILADFRQSKTDRPQSSSNGSSS
LNGSVPGAPNRVSFAKLREPLEVPGLLDVQIDSFEWLIGAPRWREAAIAR
GDAEPKGGLEEVLDELSPIEDFSGSMSLSFSDPRFDEVKAPVDECKDKDM
TYAAPLFVTAEFINNNTGEIKSQTVFMGDFPMMTEKGTFIINGTERVVVS
QLVRSPGVYFDETIDKSTEKTLHSVKVIPSRGAWLEFDVDKRDTVGVRID
RKRRQPVTVLLKALGWTNEQITERFGFSEIMMSTLEKDNTAGTDEALLDI
YRKLRPGEPPTKESAQTLLENLFFKEKRYDLARVGRYKVNKKLGLHAGEP
ITSSTLTEEDVVATIEYLVRLHEGQPTMTVPGGIEVPVETDDIDHFGNRR
LRTVGELIQNQIRVGMSRMERVVRERMTTQDVEAITPQTLINIRPVVAAI
KEFFGTSQLSQFMDQNNPLSGLTHKRRLSALGPGGLSRERAGLEVRDVHP
SHYGRMCPIETPEGPNIGLIGSLSVYARVNPFGFIETPYRKVVDGVVTDE
IHYLTADEEDRHVVAQANSPIDDKGRFAEARVLVRRKAGEVEYVPSSEVD
YMDVSPRQMVSVATAMIPFLEHDDANRALMGANMQRQAVPLVRSEAPLVG
TGMELRAAIDAGDVVVAEKSGVIEEVSADYITVMADDGTRHTYRMRKFER
SNHGTCANQSPIVDAGDRVEAGQVIADGPCTENGEMALGKNLLVAIMPWE
GHNYEDAIILSNRLVEEDVLTSIHIEEHEIDARDTKLGAEEITRDIPNVS
DEVLADLDERGIVRIGAEVRDGDILVGKVTPKGETELTPEERLLRAIFGE
KAREVRDTSLKVPHGESGKVIGIRVFSREDDDELPAGVNELVRVYVAQKR
KISDGDKLAGRHGNKGVIGKILPQEDMPFLPDGTPVDIILNTHGVPRRMN
IGQILETHLGWVAKSGWNIDGNPEWAVNLPEELRHAQPNQIVSTPVFDGA
KEEELAGMLSCTLPNRDGEVMVDGDGKAVLFDGRSGEPFPYPVTVGYMYI
MKLHHLVDDKIHARSTGPYSMITQQPLGGKAQFGGQRFGEMECWAMQAYG
AAYTLQELLTIKSDDTVGRVKVYEAIVKGENIPEPGIPESFKVLLKELQS
LCLNVEVLSSDGAAIELREGEDEDLERAAANLGINLSRNESASVEDLA
41410227NP_963063.1 hypothetical protein MAP4129 [Mycobacterium avium subsp. paratuberculosMGVAIEVNGLTKSFGSSRIWEDVTLEIPAGEVSVLLGPSGTGKSVFLKSL
IGLLRPERGSVVIDGTDILQCSAKELYEIRTLFGVMFQDGALFGSMNLFD
NAAFPLREHTKKKESEIRDIVMEKLELVGLGGDEKKFPGEISGGMRKRAS
LARALVMDPQIILCDEPDSGLDPVRTAYLSQLILDINAQIDATVLIVTHN
INIARTVPDNMGMLFRRKLVMFGPREVLLTSDEPVVKQFLNGRRIGPIGM
SEEKDEATMAEEQAALEAGQHAGGVEEIEGVPPQIVASPGMPERKAVARR
QARVREILHTLPQKAQAAILDDLEGTHKYRAHEVGD
41410226NP_963062.1 hypothetical protein MAP4128 [Mycobacterium avium subsp. paratuberculosMRAEVTAFDLPVTGRIPDHLDGRYLRNGPNPVAEVDPATYHWFSGDGMVH
GVALRDGRARWYRNRWVRTAHVCAALGEPAPGGLDPRAGMLSVGPNTNVL
GHAGQTLALVEGGGANYRLTEDLDTVGTCDFDGTLFGGYTAHPHRDPRTG
ELHAVSYSFGRGRRVQYSVIDTAGRARRTVDIEVSGSPMMHDFSLTDEYV
VIYDLPVTFDPVQVMPADVPRWLSAPARLVVQSLLGRVQLPGPMATAMNR
NRQPLHRMPYRWNDAYPARLGVMPRDGGNDEVRWFDIEPCYVYHPLNAYS
EIRDGAKVLVLDVVRYSRMFDRDLRGPGDTRPTLDRWTVNLTTGAVGSEL
RDDRSQEFPRINEALLGRRHRFGYTVGTDGGYPSDGASEMSTGLYKHDYA
TGSRRVAPLDPDLLIGEMCFVPNPAGGQDGAEDDGILMGFGYHRGRDEGQ
LVLLDAQSLEQVATVHLPQRVPMGFHGNWVPAG
41410225NP_963061.1 hypothetical protein MAP4127c [Mycobacterium avium subsp. paratuberculoMPDSYNIDITLLLRRYAGEGTIATMTSQPAPQRNVRDGMLAAAVALLHEH
GPDALQTRKVAGAAGTSTMAVYTHFGGMRGLIAEVAEEGLRQFDAALTVP
PTDDPVADLFVIGAAYRRYAIRHRHMYRLMFGSTSAHGINAPAHNVLTLT
VAEIEQNYPSFAHVVRAVHRCMRAGRITAGPADDDGAVVATAAQFWASIH
GFVMLELAGYCSDDGSAVLPVLGSMTSNLLVALGDSPKRVSQSMRSAMLG
S
41410224NP_963060.1 50S ribosomal protein L7/L12 [Mycobacterium avium subsp. paratuberculosMAKMSTDDLLDAFKEMTLLELSDFVKKFEETFEVTAAAPVAVAAAGPAAG
GAPAEAAEEQSEFDVILESAGDKKIGVIKVVREIVSGLGLKEAKDLVDGA
PKPLLEKVAKEAADDAKAKLEAAGATVTVK
41410223NP_963059.1 50S ribosomal protein L10 [Mycobacterium avium subsp. paratuberculosis MARADKATAVADIAEQFKEATATLITEYRGLTVANLAELRRSLSGAATYS
VAKNTLVKRAASEAGIEGLDELFAGPTAIAFVTGEPVDAAKAIKTFAKEH
KALVIKGGYMDGRALSVAEVERIADLESREVLLAKLAGAMKGNLAKAAGL
FNAPASQVARLAAALQEKKAAEGPAEAPQPATEPPAEAPEAPADAE
41410222NP_963058.1 hypothetical protein MAP4124 [Mycobacterium avium subsp. paratuberculosMDHSIDALAVVIMGLMVGVELAVAVFFHPLIARLPDDAFRTARGGAARAL
GTVMPFWYAMTLLLLGSLAVQERGAPYDWLVGVAAGLMAVVVLVTVTMLV
PINNRIAKWPAGGQLSRELAARWDRRHRLRVVLLLGAYVLLTVAVTGAVT
41410221NP_963057.1 hypothetical protein MAP4123 [Mycobacterium avium subsp. paratuberculosMLTLGLDIGGTKIAAALVDSVGTLVHTAVRPTPNPAPADDVWDVVHALIA
EVVRAAGAPIAAVGIASAGPVDLPSGSVSPINIAGWHRFPLRDKVAAAVP
ATPVVLGGDGLCMALGEQWLGAGRGARFLLGMVVSTGVGGGLVLDGAPYP
GRTGNAGHVGHVVVELDGRPCTCGGHGCVETVASGPSMVRWARENGWSAA
PGAGARDLAAAAASDPLAQKAFHRSADALAAMIASVGAVCDLDVVVIGGG
VAQSGPLLFDPLRERLAHYAGLDFLSGLTVVPGELGGNAGLIGAARLATL
ARPAGS
41410220NP_963056.1 FabD2 [Mycobacterium avium subsp. paratuberculosis K-10]MSGHPVATVAGVPVSSVEVDAAEARLRGGRGAAALPTPGTSEGRQLRRWL
TQLIVTRRVIAAEAAARGLTPAGAPNEAELLPDVTARLEIGSVAAAVLAD
PLARALFADVTAAVDVAERELAAYHARNPLRFAPSRPVQNVWRTTALVAP
PLDEVRPVIREQLRGAARRRAFRLWLDERRAALVRLAPGYEHPGDPRQPD
NTHRH
41410219NP_963055.1 hypothetical protein MAP4121 [Mycobacterium avium subsp. paratuberculosMRAVKCGDAGGFGMEITSALSTELFVGPPEAPLQLVRVAVAGCAERTPVR
VDGPGLRGRALAEAGAEVIEVAVTVDEPVVGQRRPARAGAGEAELPFEFT
VAEPGWTMFMVSHFHYDPVWWNTQGAYTSEWTEDPPGRARQTNGFDLVHA
HLEMARREPEYKFVLAEVDYLKPYWDTRPEDRADLRRFIAQGRVEVMGGT
YNEPNTNLTSTETTIRNLVHGMGFQRDVLGADPATAWQLDVFGHDPQFPG
LAADAGLTSSSWARGPHHQWGPATGDGSDGGVERMQFSSEFEWIAPSGRG
LLTHYMPAHYSAGWWMDSAASLAEAQDATYALFVQLKKVALTRNVLLPAG
TDYTPPNKWVTAIRRDWAARYTWPRFVCALPREFFAAVRAELAQRGGAPS
PQTRDMNPIYTGKDVSYIDTKQANRAAENTVLAAERFAVFAGLLAGAEYP
EAALAKAWVQLAYGAHHDAITGSESDQVYLDLLTGWRDAWELGRTVRDDA
LALLSRRVDGADVAVWNPLNGRRTDVVTARLDAAPGAGVRVLDADGVEVP
AHVEHGGRSVSWLARDVPSLGWRAYRLVAGEAASGWAPLRGSAIANEHYR
LAVDAERGGTVASLIADGRELIAEGRVGNELAVYEEYPSHPSQGEGPWHL
LPKGPVVCSSATRARVRAYRGPLGERVVVHGRIGTLLRYTQTLTLWRGVA
RVDCRTTIDEFTGADRLVRLRWPCPVPGAMPVSEVGDAVVGRGFALLHDG
DRALDTARHPWTLDNPAYGWFGLSSVARVRISDGGLRCLSVAEVVSPAET
TSGPLARELLVALVRAGVTATCSAADGPRYGHLEVDSNLPDVRVALGGPR
RNAFTAAVLADADPAYADELRRQLAATGRARLWVPARAPLAAVWLPDADL
RDARALPVLVVDGRDERELRAAIAALVDDLGDAEITVTQQSPSRTEGFDD
YTVALLNRGVPSFAVDTAGTLHTALLRSCTGWPSGIWIDDPRRSAPDGSN
FQLQHWTHHFDYALVSGPGDWRRAEIPARSAQFGNPLLAVAAGGGAGTGP
GLPPAGSLLRVQPAESVQLAALKAAGNPLASGSAARPDPTAVALRLVETA
GAGTRVAVDSDVATVSDLHAADLLEKPSRQVNSIDLHGYQVATVLARLHA
PAAPAGAAALAPHAEAAQPLYARYWLHNRGPAPLGGLPAVAHLHPARASA
DPDSRVTLRLSAASDCTDATLAGAVVLRCPDGWSADPAELPLRLCAGQHL
QADIAVSVPARAAPGLYPVRAELRLTGEHLPASWRQGVEDVCVVAVGDGE
RAPLIYLADEPAEVTLEPGEAADLTVTVGSHARAELALEAHLISPWGTWD
WMGPAAVGAVLPARGAVDLGFRLAPPAWLDPGQWWALVRIGCAGELLYSP
AVRVTVT
41410218NP_963054.1 hypothetical protein MAP4120c [Mycobacterium avium subsp. paratuberculoMPALARPVADERSALCEFLAYHQSAYFAVSHGLTDGQARSAPSVSALSIG
GLIKHATGMQRSWMARVAAAPGAPPKDTRPFEQVAAEFADQHVMRPDETL
QELLDAFEAQNAESLRLAQTADLDAAVPVPHDIPWFPKDLQAWSVRWVIL
HVINELARHAGHADIIRETIDGATMYELIAAREGWAIEGWVQPWKGGGDR
R
41410217NP_963053.1 hypothetical protein MAP4119c [Mycobacterium avium subsp. paratuberculoMSSTKHREVAKLDRVPLPVEAARVAATGWQVTRSAARVLTKLPAKGPWQQ
KVIKQLPQTFADLGPTYVKFGQIIASSPGAFGESLSREFRGLLDRVPPAD
PDEVHKLFLEELGADPSELFASWDETPFASASIAQVHYATLHTGEEVVVK
IQRPGIRRRVAADLQILKRFAQAVELAKLGRRLSAQDVVADFSDNLAEEL
NFRLEAQSMEAWVSHLHASPLGKNIRVPQVYWDFTTDRVLTMERVSGIRI
DDVAAVRKAGFDGVELVKALLFSLFEGGLRHGLFHGDLHAGNLYVDEAGR
IVFFDFGIMGRIDPRTRWLLRELVYALLVKKDHAAAGKIVVLMGAVGTVK
PEAQAAKDLEKFATPLTMQTLGDMSYADIGRQLSALADAYDVKLPRELVL
IGKQFLYVERYMKLLAPKWQMMSDPQLTGYFANFMVEVSREHSSEFESDV
EV
41410216NP_963052.1 LipG [Mycobacterium avium subsp. paratuberculosis K-10]MVQVRTGHAISGDLKLYYEDMGDIDDPPVLLIMGLGAQLLLWRTAFCEKL
VGRGLRVIRYDNRDVGLSSKTEHRSSGQPLVTRLLRSWLGLPSQSAYRLE
DMADDAAAVLDHLGIDDAHIVGASMGGMIAQIFAARFRQRTKTLAVIFSS
NNSALLPPPAPRALLALLKGPPPDSPREVIIDNAVRVGRIIGSPRYRVPE
EQARAEAAEGYDRNYYPQGVARHFSAVLGSGSLRRYNRRTTAPTVVIHGR
ADKLMRPFGGRAVARAIDGARLVLFDGMGHDLPQQLWDQVIGVLANNFAK
AS
41410215NP_963051.1 MmaA1 [Mycobacterium avium subsp. paratuberculosis K-10]MAKLKPYYEESQATYDISDDFFALFLDPNMVYTCAYFENDDMTLEQAQLA
KLDLGLDKLNLEPGMTLLDVGCGWGGAVVRALEKYDVNVIGITLSRNHYA
RTKERLAAIPTTRRAEARLQGWEEFDEPVDQIISFEAFDAFKKERWPAFW
DWAYKSLPNDSRMLMHSIFTYPQSQWKERGIPITMSDLRFFHFLGKEIFP
GGQMCGEADIVDLSQASGFSLEQVQYLRPHYARTLDTWAANLEANREQAI
AIQSQEVYDRFMRYLTGCAELFRKGISNVAQYTLTK
41410214NP_963050.1 MmaA4 [Mycobacterium avium subsp. paratuberculosis K-10]MAEQPSSPTKTRTRSEDIQAHYDVSDDFFGLFQDPTRTYSCAYFARDDMS
LEEAQYAKIDLNLDKLDLKPGMTLLDIGCGWGTTMKRAVERFDVNVIGLT
LSKNQHARCEELLASLDSNRSRQVRLQNWEDFNEPVDRIVSIEAFEHFGH
ENYDDFFKRTFDIMPDDGRMTVQSSVSYHPYDLAARGKKLSFETARFIKF
IVTEIFPGGRLPSTQMMVDHGEKAGFVVPEPLSLRPHYIKTLHIWGDTLE
SNRDKAIEVTSEEVYNRYIKYLRGCEHYFTEEMLDCSLVTYLKPGAAA
41410213NP_963049.1 hypothetical protein MAP4115c [Mycobacterium avium subsp. paratuberculoMISRERERKPDDAAAAMAAWESFHAKAGPAIKAGDALAPAAAAAVITGGP
DAPVVTDGPFAETAEVACGYYIFEAENLDEALALARDVPVAAFGAVELWP
VVHAVEPSRRITGNDWLALLLEPAESAHTPGTPEWEAVAAKHAELHAAAG
DHIIGGAALHDKSTATTVRVRDGEVLITDGPYVESAEIATGIYLLGAADR
DEAVKIASMIPASTVQLRQLAGVSGL
41410212NP_963048.1 hypothetical protein MAP4114c [Mycobacterium avium subsp. paratuberculoMADLDGVFRREWGPAVAALARWSGDLTVAEDAVQEACAEALRVWPRDGMP
ANPGGWLVTVARNRARDRLRRESARPGKELAAVLDDIRARTDAADPHPVR
DDELRMMFTCAHPALDRPSQLALTLRLVSGLTVAEIARALLQSEAAIGQR
ITRAKNKVRHANIPLRVPPAELLGERTPHVLGCVYSVFTEGYWSTAGPSA
IRDDLCDEGIRLGAELCALLPDEREAHALSALMLLHDSRRATRVDARGVP
VPLEEQDRTRWDRRRITAGLDRLRYAEGSSGAYLPQAVIAALHATAPSWE
QTDWVTICAAYDRLWQLTRSPVVAANRALAIGLRDGPDAGLAALEEVDEP
KLERSNLIATLRADLLRRAGRPAEALPWYRIALQSNGSEPGRKFLRRRIA
ECTSAAESATGDAFPENGRR
41410211NP_963047.1 50S ribosomal protein L1 [Mycobacterium avium subsp. paratuberculosis KMSKRSKAYRAAAEKVDRDNLYTPLQAAKLAKETSSTKQDATVEVAIRLGV
DPRKADQMVRGTVNLPHGTGKTARVAVFAVGEKAEQAQAAGADIVGSDDL
IEKIQGGFLDFDAAIATPDQMAKVGRIARVLGPRGLMPNPKTGTVTPDVA
KAVADIKGGKINFRVDKQANLHFVIGKASFDEKALAENYGAALDEVLRLK
PSASKGRYLKKITVSTTTGPGIPVDPSITRNFAEA
41410210NP_963046.1 50S ribosomal protein L11 [Mycobacterium avium subsp. paratuberculosis MAPKKKVVGLIKLQIQAGQANPAPPVGPALGQHGVNIMEFCKAYNAATEN
QRGQVIPVEITVYEDRSFTFALKTPPAAKLLLKAAGVGKGSAEPHKNKVA
KVSWDQVKEIAETKKADLNANDIDAAAKIIAGTARSMGITVE
41410209NP_963045.1 transcription antitermination protein NusG [Mycobacterium avium subsp. MTTFDGDPSAGDAVDLRETDEATEAADEAAETTEDAAESAETQGEPAEEV
DPAAALKAELRSKPGDWYVIHSYAGYENKVKANLETRVQNLDVGDYIFQV
EVPTEEVTEIKNGQRKQVNRKVLPGYILVRMDLTDDSWAAVRNTPGVTGF
VGATSRPSALSLDDVVKFLLPRGATKKVAKGAASTAAAAEAGGLERPAIE
VDYEVGESVTVMDGPFATLPATISEVNGEQQKLKVLVSIFGRETPVELTF
SQVSKL
41410208NP_963044.1 preprotein translocase subunit SecE [Mycobacterium avium subsp. paratubMSDEGDVANDAASDGADTTDDRAGGGRTAVVTRPQRPTGKRSRQRAAGDA
DAEPSDEAEVSAPEKAEKAKRKKAAKPKKSADTRANPFVFVYNYLKQVVA
EMRKVIWPNRKQMLTYTSVVLAFLAFMVALVGLADFGLTKLVLLVFG
41410207NP_963043.1 (3R)-hydroxyacyl-ACP dehydratase subunit HadC [Mycobacterium avium subsMALKTDIRGMIWRYPDYFVVGREQLRQFALSVKNRHPAHFSEDAAAELGH
DAIIAPLTFATIFAKLVQLDFFRHVDIGMETLVIVQVDQRFVFSKPIKAG
DKLWARMDIVSVDERFGADIVVTKNICTNDDGELVLEAYTTLMSQFNGDQ
SAKLRWDSESGQVVRTA
41410206NP_963042.1 (3R)-hydroxyacyl-ACP dehydratase subunit HadB [Mycobacterium avium subsMPLREFSSVKVGDLLPEKVYPLTRQDLVNYAGVSGDLNPIHWDDEMAKVV
GLDTAIAHGMLTMGIGGGYVTAWIGDPGAVTEYNVRFTAVVPVPNDGKGA
ELVFNGRVKSADPETKSVTIALTATTGGKKIFGRAIASAILA
41410205NP_963041.1 (3R)-hydroxyacyl-ACP dehydratase subunit HadA [Mycobacterium avium subsMPLTTNLVGMHYRYPDHYEVEREKIREYAVAVQNDDAWYFEEKAASELGY
KGLLAPLTFVCVFGYMAQSSFFKHANIAVKDAQIVQVDQVLKFYAPLVAG
DKLYCDVYVDSVRVSHGTQIIVTKNVITNEAGDVVQETYTTLAGRAGEDG
EEGFTDATA
41410204NP_963040.1 50S ribosomal protein L33 [Mycobacterium avium subsp. paratuberculosis MASSTDVRPKITLACEVCKHRNYITKKNRRNDPDRLELKKYCPNCGKHQA
HRETR
41410203NP_963039.1 hypothetical protein MAP4105 [Mycobacterium avium subsp. paratuberculosMVSGYCCRMRKKVEIEVDLELVDEAIRRFHLADAREAVNLALRTLLHEGD
SVASEDEYDEFSDLSAWQPRRNAESG
41410202NP_963038.1 hypothetical protein MAP4104c [Mycobacterium avium subsp. paratuberculoMSDDRLYFRQLLSGRDFAAGDMFATQMRNFAYLIGDRQTGDCVVVDPAYA
ASDLLDTLEADGMHLSGVLVTHHHPDHVGGSMMGFTLAGLAELLERAPVP
VHVNSHEALWVSRVTGISASDLTAHENHDKVSAGDIEIELLHTPGHTPGS
QCFLLDGRLVAGDTLFLEGCGRTDFPGGDSDEMYRSLQRLAKLPGDPTVF
PGHWYSAEPSASLSEVKRSNYVYRASDLDQWRMLMGG
41410201NP_963037.1 hypothetical protein MAP4103c [Mycobacterium avium subsp. paratuberculoMDSMGWIQDSWHGVTHVGSSTWIAWAAWAAIALAVITLIFTNSQIARNRR
AAAEQTRPHVAMFMEPHPADWHVIELVVRNFGQTAAYDIEFSFDNPPTVA
EYESATDGYADVVELRLPRQLPVLAPGQEWRTVWDSALDRAEIGSGIESR
FTGTVTYYDRPAPAGGRRFWQRERTPLHTDVVLDWDALPPVQRIELMTTH
DLAKREKEKLELLRGLLTYFHYASKETRPEVFRSEIERINAAVRETQDRW
RSRQLDEPTDVSLRWSNAEDDLGKHHSQPA
41410200NP_963036.1 EchA3 [Mycobacterium avium subsp. paratuberculosis K-10]MSGPVHYSAKGPVAVIRMDDGKVNALGPTMQQALGEAIDRAEADNAGALV
ITGNERVFSGGFDLKILTSGEVQPAVDMLRGGFELAYRLLSYPKPVGDGL
HRARHRDGRVPVVVGRSPGGRARLQHPGQRGRDRHGHPVCRDGDHEAAAH
AVGLPAGQRAGQNVLRRNRFGRRLCRRDRAARGGGRPRRGGRRRIRRAEP
ARPRRHQVAGPRRRAGGHPRRDRRHRSRIRSIGPQRISAFRPPRPGKSPV
WQQIASRTRGGRAHPMRPAPDGRNASTPIWPTGSPPSRWTAGCNRRRYCI
PTATVWTSPSRTDGSWGCAGAPSTGSTTAGSIPRICSAGRPTPPPTGSPR
RCSGCAARCGRATGTPRWSGSSRAAANCWSATAPARSASTPPGSCSPRST
TPRRPSRTGRSAPTTSTATPGCAPRRPPRR
41410199NP_963035.1 hypothetical protein MAP4101c [Mycobacterium avium subsp. paratuberculoMKESFGCDGQPGSYTDVDHADVIALFGHNVAETQTVLWARMLDRLAGSDP
PAIVCVDPRLTPVARHATVHLAPLPGTNVALMNGLLHEIIGNGWIDRDYI
DAHTVGIDELQCRIGEFTPERVAEICGVAATDLRRAARLIGTARRLLSTV
LQGFYQSHQASAAAVQVNNIHLVRGMLGRPGCGVLQMNGQPTAENTRECG
ADGDLAGFRNWSNDSHVAELAELWNLEPLQIPHYGPPTHAMQMFRFTEEG
TLRMLWVTATNPAVSLPELPRIRDILSQQRLFLVVQDIFLTETAALADVV
LPAAAWAEKTGTFTNADRTVHLSEKAVEPPGSARSDLEIFLDYARRMDFR
DKDGRPFPPWTDPESAFEAWKKCSAGRPCDYTGLSYAKLRGGSGIQWPCN
TDHPDGTERLYEDGRFPAAPDYCEAYGKDLITGAPLQPDEYRSLNPSGKA
IIKAAQYLPPHERPGPDYPFALITGRTVYHFHTRTKTARAQQLQDAAPEV
WVEVSERDARRLDIEAGDLVHVSTPRGRITCAARVGGIRDGVLFVPFHYG
YWDRDGGDHQRAGNELTATDWDPASKQPSFKTAAARLDKAPSHRAAPVSE
AVAAGSPS
41410198NP_963034.1 hypothetical protein MAP4100c [Mycobacterium avium subsp. paratuberculoMKLRLAIRELHRSERKLAHQLTVLAARHHSDQDIFHLARDLAGWSHRHLG
ELARHGRHYGLRLSADPRTAARTGVVQQRISGLLRHRPEPGLVLLADLRR
IHRLAAGVSLDWELLAQGAQAAKDAELLGLASRCHPETLRQMRWANAMLK
ELSPQVLMN
41410197NP_963033.1 hypothetical protein MAP4099 [Mycobacterium avium subsp. paratuberculosMTSKTEPAKPVDLVLSGGVKFIGLVGAIVALMDAGYSIKRVSGVSAGSVV
AAILAAGCHAGELTGAQVKELAFSVPLHKWRDAGPVPYLGAAWGLARDTS
MYRGDVAHDWIRSELKNFGVSTFGDLVFDGDDLPDERRRRLVVTVADVTA
AQLVRLPWDYRRLYGLDPDEQPVADAVRASMAIPFFYRPVKLARADGTAC
TLVDGGVLSNFPIDTFDRPDGRAPRWPTFGITVMPSPTEGIGAVMPALKP
LRFLPQTALLESLLITMLAGHDQTHLSQPWVAARAIAVESTNVGVLDFDV
PRSRLEELYDSGYAAAQAFLSTWDWQGYLDRFRYPGGRG
41410195NP_963031.1 hypothetical protein MAP4097 [Mycobacterium avium subsp. paratuberculosMSSRKLIGVHDHRGEYGVDGSFHTVSARAQAIGIGAQAAGLAVWAGISWA
RGKRRRAALAALSSAGIAANTALYMYATRAGKFVVWDRILSDLRLAGDET
LLDLGCGRGAVLLAAAKRLPRGRAIGVDLWQADQTDNSEQATLANAAAEG
VADRVELHTADMTALPLADESVDVVVSNLAIHNIPTRAGRRQALDEAVRV
LRPGGRLAIADLWETRQHAARLRELCWRNVRRRNLGWRMWYGGPWFSTRI
VTATKPE
41410194NP_963030.1 hypothetical protein MAP4096 [Mycobacterium avium subsp. paratuberculosMEAWDAICARRNVREYQPRAIAGEDLDRIVEAGWRAPSAKNRQPWDFVIV
TDRTQLQELSTVWRGAGHIAGAPAAIAIVVPEPPDERRVVTDNYDVGQAT
MAMMIAATDLGIGTGHSSVGDQDKARAILGVPDGHLVAFLLGVGYPADRP
LTPIRKPNRRPFTEVVHRGRW
41410193NP_963029.1 MmaA2 [Mycobacterium avium subsp. paratuberculosis K-10]MAENLTPHFEEVQAHYDLSDDFFRLFLDPTMTYSCAYWDRNRDISLEEAQ
LRKIDLSLGKLGLRPGMTLLDVGCGWGATMRRAVENYDVNVIGLTLSRHQ
AAHVQQLLDAMDTPRSRRVLLHGWEEFDEPVDRIVSIGAFEHFGYDRYDD
FFATAYRVLPDDGVMLLHTITMLTPEQIVERGLPLTEEQTSFNEFIATEI
FPGGQLPAIEVVEFHSSKMGFTLKRRQSLQLHYARTLDHWADALRAHHSE
AVAIQSEEVYQRYMRYLTGCADAFRAGYIDVNQFTLAK
41410192NP_963028.1 RecC [Mycobacterium avium subsp. paratuberculosis K-10]MPLHLHRAERTDLLADGLGALLANPPADPFALELVVVPARGVERWLSQRL
SHVLGRARDGDGVCAGVQFRSPGSLIAEITGTADDDPWSPDALAWPLLEA
IDCSLDEPWCRTLATHLGHFDTGAEAELRRTRRYEAARRLAGLFAGYARQ
RPRLLVDWLDGDPGDLDEDLRWQPPLWRALLARVAADPPHVRHAETIARL
RRAPSDLPQRLSLFGHTRLACTDVELLDALATHHDLHLWLPHPSDRLWRA
LAGTHGVIPRRDDTSHRAVAHPLLATLGRDLRELQRGLPADPRTDEYLAG
DARPDTLLGWLQSDIAANAVRPVGRSLAAGDRSVQIHNCHGPARQVDVLR
EMLLGLLADDPTLQPRDILVMCPDIESYAPLIMADFGLGDVVHGAHPAHQ
LRVRLADRSLIQTNPLLGVAAQLLALAGGRVRASEVLNLAQTPAVRARFG
FTDDDLDTITGWVRQANIRWGLDRQHRRPYHVDFVHNTWRFGIDRILAGV
AMSDDSNAWIDATLPLDDVSSNRVQLAGQLAEFVARLQHVLDSLTGARPL
TDWLTAVADGIALLTRVRDADEWQSGQLQREFAAVSAQAGSRADTVLRLP
DVRALLTRHLSGRPTRANFRTGTLTVCTMVPMRSVPHRVVCLVGLDDGLF
PRLGVVDGDDALARCPMTGERDIRSEDRQLLLDAIGAATEKLVITYTGAN
EYSGQPRPPAVPLAELLDTLDITTAEPVRDRIVVRHPLQPFDIRNIIPGE
LVPGVPFSFDPTVLRAAHAATGEHCEPPKFISAPLPPPPPADVILADLVG
FFKDPVQGFFRALQFTLPHDVDGVQDAMPVDIDALQEWTVGDRMLRDMLR
GMTPEDARQAEWRRGTLPPGQLGWRRVTEIRDQAARLALEAHQHRAEQPG
GAHDVDIDLGRGRRLTGTVTPVYGDRLVAVTYSRLDGRHLLESWIPLLAL
AAHDRGRDWSAVCIGRMRRGTGIRVQRLGSPDDDPVELLRELVSIYDAGR
REPIPLPLKTSYAWAAARYGGDDPVAEARYRWKSSDRYPGEDQAPAHVRA
WGRGAPLDDLMRPVRPGEECDGEDNRLGAYAARLWLPMLRAERTTA
41410191NP_963027.1 hypothetical protein MAP4093c [Mycobacterium avium subsp. paratuberculoMAYLLDGTEDRLAARRQRLRDALAGFDAATIATTHQFCQLVLRSLGVAGD
TAAGVTLLDSLDELVAEIVDDLYLAHFGQDHDDPVLHYREALRLARDVVN
NPSAQLRPLHPEPGSRAAVSLRFANDVLAELDTRKRRLGVLGYDDLLTRL
ADALATEHSPARLRMHQRWPIVMVDEFQDTDPVQWQVIDRAFSGRSTLIL
IGDPKQAIYAFRGGDIVTYLRAAETAGQKKTLDTNWRSDSALLQRLQVVL
RGAQLGDPAIAVNDVAAHHRGHRLSGAPRNDPFRLRVVSRNTLGRRGIAN
LPIDELRQHIGADLAADIRALLAAGATFDGKPLRAGDIAVIVERHRDAQA
CFTALCDAGVPAVYTGNSDVFTSQAAED
41410190NP_963026.1 hypothetical protein MAP4092c [Mycobacterium avium subsp. paratuberculoMVRAAAATMFFGETAETLAAGGDALTDRIAQTLREWAGHSRERGVAAIFE
AAQLLGMSNRVLGWQGGARHMTDLAHLTQLLGEVAHREHHNLPALRDWLR
RQRDERSGAPERNRRLDSDAAAVQIMTVFVSKGLQYPIVYLPFAFHRNTT
DSDVVLFHDEDGTRCLHVGGKDSPDFKTVERLGRKEDASDDSRLTYVALT
RAQAQVVAWWSPAYHEPNGGLSRLLRGRRPGEPVVPDRCEPAKISDADAL
ARLREWEAAGGPVIEESVPAPAPPLSGVPVPARLENRHFHRGIDTGWRRT
SYSGLIRQAQPSGVGSEPEAAGLDDEVGDILLAPATSVGDVASPMADLPA
GATFGTLVHAVLQTADPFAPDLAAELTARIREHSVWWPVAATPEDMAAAM
VPMHDTPLGPLAGGLTLRRIGLSDRLCELDFELPLAGGDRRSAPPEVRLA
DLSPLLRAHLPADDVLACYADRLTDRSLGAEPLRGYLTGSIDAVLRIPDG
AGHRYLVVDYKTNRLGDAQHPLTAADYDRPRMVEAMLHSDYPLQALLYSA
VLHRFLRWRLAGYEPDRHLGGILYLFVRGMCGPDTPVRDGHPSGVFDWRP
PSSLITALSDLLDAQGVAV
41410189NP_963025.1 hypothetical protein MAP4091c [Mycobacterium avium subsp. paratuberculoMTADVLPERVFDAGPLRPFADAGIFEAADVRVAQRLTALTGESDDRVALA
VALLVRALRGGSVCVDLRAVPAQVGAADLPWPAAGDWLAAVRASPLLGPP
PVLRFFGDLLYFDRYWLEEEQVCTDLLALSAPAGDVESSCYERLFPPGYE
EQRAAARIAVSQALTVLTGGPGTGKTTTVARLLALLVEQAERAGEPRPRI
ALAAPTGKAAARLAEAVAAEIEHLDPADRARLAGLTGTTLHRLLGPRPDT
SVRFKHNRGNRLPHDIIVVDETSMVSLTMMARLAEAVRPDTRLILVGDPD
QLASVEAGAVLADLVDGLAGRAGVRVAALATPHRFGSAIGALAAAIRAGD
ADRVLELLAAGGEHIEWVDSERPADRLREVLVSHALRLRSAALLGAAQAA
LATLDEHRLLCAHRDGPHGAVRWNTLVHNWIAEETGQPAWSQWYAGRPLL
VTANDYGLRLYNGDTGVTVAGADGLRAVIAGAAGPLDFATSRLGEVETMH
AMTIHKSQGSQADEVTVLIPPEDSRLLTRELFYTAVTRAKSRVRVVGPEA
SVRAAIERRAIRATGLRQRLRAVG
41410188NP_963024.1 hypothetical protein MAP4090c [Mycobacterium avium subsp. paratuberculoMDDQEAPDAPASRRAHILRLAVFAGFLAVVFYLVAVARVIDVGAIRAVVS
ATGPAAPLTYVVASALAGALFVPGSILAAGSGLLFGPLLGVFVTLGATVG
TATTASFVGRRAGRDSARALLGPARADRVDALIGRGGLWAVVGQRFVPGI
SDALASYAFGAFGVPLWQMAVGAFIGSAPRAFAYTALGASIGNRSSLLAY
AAVAVWCVSAIVGAFAAHRGYRHWRGRPKDEAR
41410187NP_963023.1 hypothetical protein MAP4089 [Mycobacterium avium subsp. paratuberculosMLPRMIKTQLVLLTAVAVAAVVVLGWYYLRIPSLAGIGRYTLYAELPQSG
GLYRTANVTYRGITIGKVTGVEPTERGARATMSIEDGYRIPADAAAHVHS
VSAVGEQYVDLVSTAGREPYLADGQTIHKSTVPSQIGPALDAANRGLAVL
PRDKIASLLYETSQAVGGLGPSLRRLVDATQAIAHDFRGSIDDVDDIVER
SAPIIDSQADSADTLGRWAANLNTLAAQTARQDPALRSILTNAAPTAEQV
RATFGGVRESLPQTLASLEVVIDMLKRYHNGVEQALVFLPQSGAIAQSVT
AQSPGQAALGVGAISLNQPPPCLTGFLPASQWRAPADTSTAPLPAGTYCK
IPMDATNVVRGARNYPCVDVPGKRAATPRECRSTEPYVPQGTNPWYGDPD
QILTCPAPSARCDQPVKPGLVIPAPSVDNGLNPLPADRLPGTPPPISDPL
QRPGSGTVVCNGQQPNPCTYTPSALYDVRSGTVVGPDGVVYSVANSATIG
DEGWKTMLGQAR
41410186NP_963022.1 LprL [Mycobacterium avium subsp. paratuberculosis K-10]MRRVAVAGRRALVVALAAMLTSCTWRGIADVPLPVGRGTGGDHMTIYVQM
PDTLALNTNSRVRVADVWVGTVRAITLKDWVATLRLDLDPGVRLPANATA
KIGQTSLLGTQHVELAAPKNPSAQRLKSGDTLLLQNSSAYPTVERTLASV
AVILNGGGIANLDAIQTEVLNILDGHAGQIREFLGRLDTFITELSSQRDD
LTRAIDSSNELLTVFANRRDTLDRVLTELPPLIRHFADTRELFADATESL
GRFSDAADRALTDARANLYRSLLSLQRPLRQLVPAAPFVAGALKLGLTAP
FNIDDVAQVIRGDYVNVSAALDLTLSTIDNTMLTGTGLSGALRALEQSWG
RDPATMIPDVRYTPNPNDAPGGPLVERGE
41410185NP_963021.1 hypothetical protein MAP4087 [Mycobacterium avium subsp. paratuberculosMSTIFDIRNLRLPKVSARVLVIAALAAVFVFIAAVAGVQLYRKLTTTTVV
AYFSETLALYPGDRVQIMGVRVGSIDKIEPAGDKMRVTLHYNNKYRVPAN
ATASILNPSLVASRTIQLSPPYTGGPVLRDGAVIPIERTRVPVEWDQLRD
SINAILRQLGPTPQQPVGPFGDIIESAADNLSGKGKQVNETLNSLSQALT
ALNEGRGDFVAITKSLARFVTALYQHKQQFVALNDNLAQFTDWFTQSDHQ
VSDTIAHLDQVLDAARKFVNDNGSALTHDVGNLADVTTTILQPEPRDGLE
TALHVLPTFAGNFNNLYQPAHSSLVGLFVFPNFANPIHFLCSAIQAGSRL
GYQDSAELCAQYLAPVLDAIKFNYPPAGLNPFNSAATLPKEVAYSEERLR
PPPGYKDTTVPGIFARDTPFSHGNHEPGWVVAPGMQGTDVQPFTAGMLTP
ESLAELMGGPDAAPPPPGVTAAGPPNAYDESNPPSPPWFSRPTPPGPGR
41410184NP_963020.1 hypothetical protein MAP4086 [Mycobacterium avium subsp. paratuberculosMHAAMRTLTEFNRTRVGLMGALVTVLVVGVGQSFTSVPMLFATPTYYAQF
TDAGGINVGDKVQIAGVNVGLVSSLVIRGDRVLVGFSMPGKTIGAQSRSA
IRTDTFLGRKNMAIQPRGADPLPPHGIIPSGQTTTPYQIYDAFVDVTKAA
TDWNIDVVKRSLNVLSETFNQTAPHLKAALDGVARFSGTIGNRDEQIKQL
LTNADKITRVLGDRSGQVDALLVNANTLLAAFRQRSQALSALLSNVSAVS
TQVSGFIKENPDAHQVLRQLGTVSDELVKRKKELSDVLVLVSRYTASLTE
AVASGPFFKAIVANLLPYQVLQPWVDAAFKKRGIDPENFWRSAGLPAFRW
PDPNGTRLPNGAPPPAPPVAEGTPDHPGPAVPPGSPCSYTPAADSPPRPG
NPLPCALSGQGPFGPVPDGFPAPLDVETSPPAPDGPPPSPGVPSAGRPGE
APPDVPGTPVPLPVHAPPGARTENPPDATGGSTR
41410183NP_963019.1 hypothetical protein MAP4085 [Mycobacterium avium subsp. paratuberculosMRITGTAVKLVVFWSVLAMFTVMIIVVFGQVRFDRTTGYSAVFTDAGGLR
AGQFVRASGVEVGKVAAVTLSDKDSRVLVEFNVDRSLALDQGTTASIRYL
NLIGDRYLELKRGTSGRRLPPGGRIPVEHTQPALDLDALIGGFRPLFQAL
DPNKVNSIAQSIITVFQGQGATITDILDQTAALTAALADRDKAIGEVINN
LNTVLATTVKHEKEFDRTVDKLELLITGLKNRADPLAAAAAHISDAAATV
AGLLGEDRPSLHGTLGHLEGIQQALINDLPTVDNVLEKLPGAFRVIGRAG
GIYGDFYNFYLCDISIKVNGLQPGGPVRTIKLFGQPTGRCTPQ
41410182NP_963018.1 Mce2 [Mycobacterium avium subsp. paratuberculosis K-10]MRWFWPWYTCNFAGTSPPKTKLTMVATRAGLVMETGSKVTYNGVAIGRVA
DISEIERDGAPAAKLVLDVDPRYVNLIPANVVATIEAATLFGNKYVSLSA
PENPSRQRISPRDVIDARSVTTEFNTLFETVTSIAEKVSPIELNATLSAL
AQALDGLGGKFGESIVNGNQILAQLNPRMPQIRYDVRRLADLAGAYTKAA
PDLLDFLSNAVTTARTLTRQQGDLDAALLAAVGVGHEGEDIFARGGPYLA
RGAADLVPTAELLDTYSPELFCMIRNFHDAAPEVAKAAGGNGYSLAAAGS
IVGAPNPYVYPDNLPRVNAHGGPGGRPGCWQKITRDLWPAPYLVMDTGAS
LAPYNHLEIGQPLATEFVWGRQYGENTINP
41410181NP_963017.1 hypothetical protein MAP4083 [Mycobacterium avium subsp. paratuberculosMAAISAPGALRARYPRTAANLDRYGGGTVRRLWQIGIFARFARISIGQTG
WALRHYRRETLRLVAEIGMGTGAMAVVGGTVAIIGFVTLSGGSLIAIQGF
ASLGNIGVEAFTGFFAALANTRIAAPIVAGVTLAATVGAGATAQLGAMRI
SEEIDALEVMGIKSISFLVSTRILGGLAVIVPLYALALDMAFTSGQVVTT
VFYGQSNGTYEHYFRTFLRPEDVGWSVFEVVIIAVVVMITHCYYGYTASG
GPVGVGHAVGRSMRFSLVSVVVVVLLAQLALYGVDPNFNLTV
41410180NP_963016.1 hypothetical protein MAP4082 [Mycobacterium avium subsp. paratuberculosMSSQAVIANYLRGQIQPGIDAVGGFFRTCVLTGKALFRRPFQWRETIEQG
WFITSVSLLPTLAVAIPLTVLIIFTLNILLAEFGAADISGAGAALGAVTQ
LGPLTTVLVIAGAGSTAICADLGARTIREEIDALEVLGIDPIHRLVVPRV
VAATIVATLLNGAVITIGLVGGFVFGVFIQHISAGAYVGTLTLITGLPEV
VISVVKSATFGTIAGLVGCYRGLTTKGGPKGVGTAVNETLVLCVIALFAV
NVVLTTIGVRFGTGR
41410179NP_963015.1 hypothetical protein MAP4081 [Mycobacterium avium subsp. paratuberculosMALQPVIRRSVPEAVFDQIATDVLSGELPAGSALPSERRLAEVFGVSRPA
VREALKRLSAASLVEVRQGGVTTVRDFRRHAGLDLLPQLVFRDGELDAGV
FRSILETRLRIGPKVAELAAEQHGPELAALLDDSLRRLEASRSAVEWHRG
TLEFWDHMVDSSGSIVFRLMYNPFRAAYERAVGVLAAAIPAEINRTDAYR
ALAQAICAGDADEAGRGAREVLELANATMIGALERR
41410178NP_963014.1 hypothetical protein MAP4080c [Mycobacterium avium subsp. paratuberculoMVSVVGKNTSFSLDEHYSAFIESEVASGRYRSASDVVRSALRLLEDRETQ
LRALREALEAGERSGTSTPFDFDTFLDRKRTEASDGR
41410177NP_963013.1 hypothetical protein MAP4079 [Mycobacterium avium subsp. paratuberculosMWNWHSAPQLPPELIEAEPTIPLQQQAMVGYMASRTAFFDSFFLEATGAG
IRQAVILAAGLDARSWRLPWPAGTTVYELDQPRVLEFKESTLAEHGAQPA
CNRVAVPVDLRHDWPEALRQAGFDASAPSVWSAEGLMPYLPAAAQDLLFD
RIQGLTVAGSRVAVEALGPKFLDPQARAKRRERMDRIQALMARIDPDRAV
PRTDELWYFEEREDVGEWFGRHGWDVRVTPSDELMAGYGRGRRRPRSATS
CRGTCSSPRSGGRPEGLAFRQGESRARRHRRDVAGQHGFGNQCGGPDCGS
AQHRRAQVDHPAQQRGFSDDAPDAAPAERGEPGERGGQVVRLVDARGQHR
GVLEPLATALTQVRAHRMSRVADHHDGPARPGPGGGAVVKVVAQHLVAGR
RCQHPRNRFGPIGESCLQIGQFAARRELPFRSALGGEPIQAIRTHRHMAG
FDAGTKCLAGQLGVHRRSPHRAMRCSRRTGRRAGR
41410176NP_963012.1 hypothetical protein MAP4078 [Mycobacterium avium subsp. paratuberculosMPRTDDDSWEITESVGATALGVAAARAAETESENPLISDPFARVFLDAAG
DGMWNWFAAPNLPAQIAEAEPDLKPRMQGMVDYMAARTAFFDNFFLAATH
AGVRQVVILAAGLDSRAWRLPFEDGTTVYELDQPRVLEFKATTLAEHGAR
PTCHLVSVPVDLRHDWPAALRQAGFDAHAPSAWSAEGLLPFLPAAAQQLL
FERVQTLAAPGSRIAVEAPGPDFIDEAARERQRQTMQRVRDLMADLEPDR
DIPDVQDLWYFEEREDVGDWLGRHGWDVTVTPAPELMARYDRRPPHDIED
AIPQTRFVAAQRTERTRPDR
41410175NP_963011.1 hypothetical protein MAP4077c [Mycobacterium avium subsp. paratuberculoMRVDGRDIIVSGSLLQPLTRRTNDILRLGMALIFLAVVITGSVITRPQWI
ALEKSVSQIVGVLSPTQSDVVYLVYGLAIVALPFMILIGLIAAGQWKLLG
AYAAAGLSAIVLLSISGTGLAAPRWHFDVLDRLTTLPAQLLDDPRWIGML
AAVLTVSGPWLPARWRRWWWALLLAFVPIHLVVSAIVPARSLVGLAVGWV
VGALVVLVVGTPALEVPLDAAVRALAKAGFEVCRLTVVRPAGRGPLILSA
DGQDADHTALIELYGPHQRSGGALRQLWGKLKLRDAETAPLLTSMRRAVE
HRALMAIAIGEAGLANTATVAVATLDRGWMLYSHKPPRGTPIDRCAKTTP
VQRLWEALRVLNDHQIAHGDLRAHHITVDDGAVLFGGFGSAEYGATEAQL
QSDIAQLLVTTSAHYDPKSAVRAAIDVFGADTILSASRRLTKVAVPKSVR
RSAPDSGAVISGARAEVKRQTGADQIKPQTITRFTRSQIIQLVLFGALVY
VAYPFISTAPTFFSQLRTADWWWALLGLLVSALTYVGAAAALWACADGMV
NFWMLSIAQVANTFAATTTPAGVGGLALSTRFLQKSGLSAMRATAAVALQ
QSVQVIAHLALLVLFSAAAGASMNLSHFVPSATMLYLIAGVALGIVGTFL
FVPTLRRWLATEVRPKLDEVVSDLAKLAREPRRLALILLGCAGTTLGAAL
ALWASIQAFGGDTTFVAVTVVTMVGGTLASAAPTPGGVGAVEAALIGGLA
AFGVPAAIGVPAVLLYRMLTCWLPVFVGWPVMRWLTKHEMV
41410174NP_963010.1 hypothetical protein MAP4076 [Mycobacterium avium subsp. paratuberculosMRSRMAPIALVATLAVVMTVIAPAPPRGYDGPPLFVANPVDHVVTLIGTG
TGGETVGEINNFPGATVPFGMVQYSPDTAGNYAGYNYDNPRATGFSMTHA
SVGCAAFGDISMLPVTGGLGVQPWNATERIAHDDTERGVPGYYTVRLPGA
GVTAELTATAHTGVGRFSYPGDGRPALLQVRSGSSLAGNSRATIQLGEDN
TTITGWATSGGFCDKPNAYTVYFAMKFSRPFISYGSWDGSTVYPGARSAN
APYSGGYVEFPAGSVLEARTAISYVGIEGARANLAAEGNAGFDDVRAAAA
RQWNAALSRVTVAGRNTDDLTTFYTALYRTMLHPNMFNDADGRYVGFDGG
IHRVADGHVQYANFSDWDTYRCLAALQALLFPDRAADMAQSLVTDAQQSG
ALPRWAFANAATGEMSGDSVVPLIVNLNTFGANDFDTAAALRYMVDGATK
GGVGLAGYVERRGIATYLRLGYAPFTLEFGRNGWIADASITLEWSIDDFA
ISRFADSLGDAATAAEFANRAQYWQNLFNASTRSVVPRSWSGFFRPGPAV
VVSPDNFGQVGYDEGNAEQYVWSVPHNVAGLVTALGGRAAVAERLDRFTK
KLNVGPNQPYLWAGNEPSFGVPWLYNYIGQPWKTQHTVDRVRGLFGPTAD
GEPGNDDLGALAGWYVWAALGLYPATPGTPILTVAAPLFDRIEIALPAGK
SIRIAAPGASGPHHPAYISGLKVDGRPTEHTWLPESIIRTGGTLAFSLAA
YPDKHWGTAESDAPPSFGAGSSAVAVNVPQPVVSIAPGHRGSVTLDAQRM
IDGAGAYTVSGAASDPGVAVTPTSGQFDAGGAASVSVPITVAPTVPQDYY
LVSLTTTVGQSTRTTTVLVDTQAEPESR
41410173NP_963009.1 LpqN [Mycobacterium avium subsp. paratuberculosis K-10]MKHLTLATISVALSLALVGCGHDHKSGDKTSSSTSTSTSTSTATSSKSST
APAAQAKYTIADYVKDNHISETPVHRGDPGPNVDLPVPAGWQLNQNSGTS
YGGIVQSQPADPSDPPTVSALFSKLTGDVDPAKIIQYAPGEVQNLPGYSG
SGDGSASTLGGYQAWQLGGTYQRGGKTRVIAQKTVVIPSQGAVYVLQLNA
DGLESDQGPLMDATHIIDEQTTITG
41410172NP_963008.1 hypothetical protein MAP4074 [Mycobacterium avium subsp. paratuberculosMGWFRFYFEGERWVWSDQVQRMHGYQPGTVTPTTELVLSHKHPADRPQVI
DGINDMIRRRQAFSTRHRIVDTAGIIHHVVVVGDQLFDDSGELVGTHGFY
IEVTPAATRNREDSISAKVSEIAGRRGVIDRTKGMLMLVYGIDEDAAFNM
LKSLSQHGNIKLSVLAQRIAEDFTALGKEVITARSRFDQRLRTAHLRPPG
AGEAGSG
41410171NP_963007.1 hypothetical protein MAP4073 [Mycobacterium avium subsp. paratuberculosMPVSEPAGYVEVRAYAELNDFLPAESRGAAVRRPFRAHQTVKDVLEAMGI
PHTEVDLIVVNGSVHGFDHRPRAGDRIAAYPMFEALDIGPTARLRPVPLR
DPRFVVDVNLGRLAWLLRLFGFDVWWSNDADDQTLAAISAEQHRILLTRD
RGLLKRRAVTHGLFVRPDDPEEQALGVIRRLDLTGRLAPLSRCVRCNAGP
41410170NP_963006.1 galactokinase [Mycobacterium avium subsp. paratuberculosis K-10]MTVRYAAPGRINLIGEHTDYNLGFALPIALPQRTVASFTRADDDAITVVS
DRADAPVRIPIDTGPGDVTGWAAYPAGVMWALRTAGHPVPGGVMSITSDV
PMGSGLSSSAALECAVLGAISSAAGIRIDATEQARLAQRAENEYVGAPTG
LLDQLAALYGRPATAVLIDFADLAVTPVAFDPDAAGVALLLIDSRERHTH
AGGDYAARRLSCERAAADLSASSLREAADRGCTDLAAVRDAVDARRARHV
LTENRRVIDCVAALNNSDYPEAGRIFTASHASMRDDFGITTERIDLIADT
ALRAGALGARMTGGGFGGCVIALAPVQRAEAIGHAVRRAATQAGFAQPVV
TRTRAAAGAGPCR
41410169NP_963005.1 hypothetical protein MAP4071 [Mycobacterium avium subsp. paratuberculosMGPTRAKLADGRDLLFFSLPGHRASPVEDRRPLPPRTAETVAPGGQSQLR
FDRSTGQWVIIAALRQDRTYKPPPDACPLCPGPTGLTSEVPAADYDVVVF
ENRFPSLSGAAPGLLAAGADGFVSAPAHGRCEVVCFSADHTGSFAGLPPA
HARLVVQAWRHRTAELMDTPGIEQVFCFENRGEEIGVTLTHPHGQIYGYP
YLTPRTAAMLGQADEHRKRHGGNLFGDLLAREVADGSRIIARDDLFTAFV
PFAARWPVEVHIYPNRFVPNLTALRDDEVDGFVAVYLDVLRRFDRMYDAP
LPYISALHQYTGTGAQAQGYFHVELMSIRRSATKLKFLAASESAMDAFIS
DVTPESVAQRLRELR
41410168NP_963004.1 hypothetical protein MAP4070c [Mycobacterium avium subsp. paratuberculoMIGSDPGLLRLRMATRTTAALGLSLLALWLLTRATGQPLTVALLGVVITM
VASRSVNEPDPRQQRITMALLPVPAAVAITAAAVLAPHPVAGDVVFVLIV
FAAAYIRRFGARGRALGTVCTYVMTSHVLPDRPERVLRATIRALRARMAI
VIDTTAEAVRTGRLDERRRRRMRARTIRLNETALMVQSQIEDRADPGTLW
PGVTAEQLAPWLLDAELAIEWVATAGRRAAALGAELPEAARAELVSALTQ
LGRAIRLPEPGGLRDAASRARRLLDAATDDRPAGTAVRRLALAIINAATA
TADVRAIVDGAAGAAVPDVAGSERPPAAAGAAAEEPAEQEEEQPAGLRPT
TRQAIQVSVAASLAIITGELVSPARWYWAVIAAFVIFAGTNSWGETLTKG
WQRLLGTMLGVPAGVLVATLLTGHEAAALAGIFVCLFCAFYFMTVTYSLM
TFWITTMLALLYGLLGQFSFGVLMLRIEETALGAVIGATVAVVVLPTNTR
TAIRADTRAFLTSLSALIEACAAAMSGSAASPSEQARQLDRDLQQFRVTA
KPLLAGVAGLAGRRGIRRALRIFTACDRYGRALARSSEQYRGSPGPGPQL
AQAFSAAAAQTRRNLDALLEAIDSGHPPTLVSAADELDAAETAARQHDSD
GDGETRPDVRRFLTAVHALRQIERAVISTATNLGGHEDVRTTTAAPR
41410167NP_963003.1 hypothetical protein MAP4069c [Mycobacterium avium subsp. paratuberculoMSEPVAPRVAVYLDFDNIVISRYDQIHGRNSFQRDKAKGLEQFTERLEQA
TVDVGAILDFASSFGTLVLTRAYADWSAEINAGYRGQLVARAVDLVQLFP
AAAYGKNGADIRLAVDAVEDMFRLPDLTHVVIVAGDSDYIPLAQRCKRLG
RYVVGIGVAGASSRALAAACDEFVIYDALPGVTALDRTPAPAETVPAKPR
TRRGKAAQPEEPDPQAAATALLTRALQIGFEKDDVDWLHNSAVKAQMKRM
DPSFSEKSLGFRSFSDFLRSRSDVVELDETSTTRMVRLRPHE
41410166NP_963002.1 hypothetical protein MAP4068c [Mycobacterium avium subsp. paratuberculoMTVGAAPPSVFDSDLPTLHYHSDETPAQVYPRLREAQRRAAVAIGPHGPE
VLSYHLVRSVLRDPRFQIPPGINLLAQGIDSGPLWDKVANSLLCLEGDAH
HRLRSLCSKAFTPRTVARLHDTMAAVMNELVDRVAAAGRCDVVTDIARPY
PVPIICALLGAPREDWRRFSSWADDVFKAFSFTVDLREVEPVVMRAWREL
DDYVDEMVARRRHNLTDDLLSDLIRVGDEGDRLDAAELRMLAGGLLLAGT
DTTRNQVAASVQVLCEHPDQWELLRQRPELAMRAVEETMRHSPIACGTLR
LVVEDAELDGHLFPAGTAVLVNTFAANRDPVVYNDPDRVDITREAAPPIL
TFGGGVHYCLGANLARREIAEALNVLANRLRNPRLAGPAPWKPMVSLSGP
TSLPIEFDR
41410165NP_963001.1 hypothetical protein MAP4067c [Mycobacterium avium subsp. paratuberculoMRAARRSTARRRPAASRGAALAALGCLALASCSDTVPAPPLSATTSTSKS
TSKAGPDSAAAPSMTGPLEKDWKSYGGTAYFGCPQRFSFSKSALQDIRPK
VFDPKTGQYLAPGVPSVPAGETVTGAICALTGTAEQLRVVYIVTTAAKTI
GYVFDLTSGQPLVTKDLQAPAPDQRLAAPKDWSLASTASGVAWLNAVTDG
HAAAAPPRTVVLSGQDLSTLWSDPEPARVWPDVLAFTRSGDPAQTPGTRL
RLPGGEEIYQDNDVVSVDAELTDGSSKLVQLTRRDPANPAEVSTLFYDLD
AKSVIKIGDSERISGGGLTAALSDGKLFVDGHNRDNSQFGFGVWNLRGQQ
WDFLKNRDDARKLSLAKVAFFEDHLYLTGSGGTFSVIALPAGDPVASNWA
LRPFQRISGWTLVCRGETAPGANGECKEILNDVVKPPR
41410164NP_963000.1 hypothetical protein MAP4066 [Mycobacterium avium subsp. paratuberculosMTVTEVVVAQPVWAGVDAGKADHYCMVINDDAQRLLSQRVANDEAALLEL
IAAVTTLADGGEVTWAIDLNAGGAALLIALLIAAGQRLLYIPGRTVHHAA
GSYRGEGKTDAKDAAIIADQARMRHDLQPLRAGDDIAVELRILTSRRSDL
VADRTRAINRMRAQLLEYFPALERAFDYNKSRAALILLTGYQTPDALRSA
GGARVAAFLRKRKARNADTVAATALQAANAQHSIVPGQQLAATVVARLAK
EVMALDTEIGDTDAMIEERFRRHRHAEIILSMPGFGVILGAEFLAATGGD
MAAFASADRLAGVAGLAPVPRDSGRISGNLKRPRRYDRRLLRACYLSALV
SIRTDPSSRTYYDRKRTEGKRHTQAVLALARRRLNVLWAMLRDHAVYHPA
TTTAAA
41410163NP_962999.1 hypothetical protein MAP4065 [Mycobacterium avium subsp. paratuberculosMAIIHGADRGARPQSWEEVARVTETTTQPVADAVADRPSVSLRTRGRWLR
WGLLSVWGPGLVVMLADTDAGSLITASQSGAQWGYRMVLPQLILMPVLYV
VQEMTVRLGIVTGRGHGSLIRERFGRGWAWLSAFTLFASAIGALLTEFAG
VAGVGELFGVSRWVSIPVATIALLALALTGSYRRVERIGLAVGAAELAFL
VAMVMARPDPGALAHGLTSMPLGDSSYLLLIAANVGAVIMPWMIFYQQGA
VVDKHLSESTIRQARYDTAFGAVLTQLIMIAVVITMASTIGRHGDGAPLE
TVGQIAQSLTPYLGHVGGTVLFGLGMLGAALVAAIVASLAGAWGLAEVFG
WKHTLNQRPNRATAKFYLTYSLAHIVGAVLVLASVDLVNLAVDVEIMNAL
LLPIVLGLLLALEARALPEQWRMRGLHKHVTRALCLVTIGFGLYMVPQAL
GWA
41410162NP_962998.1 hypothetical protein MAP4064c [Mycobacterium avium subsp. paratuberculoMTVPNDDTWGPATSVGTTATMAAAARAIATRDGVINDPFAEPLVRAVGVN
FLTRWAIGELVASDVDVEGSPWGLAQMPASIAARTRYFDEFYADAAAAGI
RQAVILASGLDTRAYRLDWPAGMTVFEIDQPAVIEFKTTALARLGAEPKA
DLRTVAVDLRDDWSTALATAGLDSSKPTAWIAEGLFGYLAPEAQDGLLDA
VTALSTPGSRLGSEAVPNTADMDPHAARERMRAATAKWRDHGFELDVDVI
SFAGERHDVGAYLQAHGWTTVATPMAELLADHGLPAIARADDDRQTMNGV
TYYTSTLGTGRQR
41410161NP_962997.1 nucleotide-binding protein [Mycobacterium avium subsp. paratuberculosisMADSSFDIVSKVDRQEVDNALNQAAKELATRFDFRGTDTTIAWKGDEAIE
LTSSTGERVKAAVDVFKEKLIRRDISMKAFDAGEPQASGKTYKVNGTLKQ
GISSESAKKITKLIRDEGPKGVKTQIQGDEIRVSSKKRDDLQAVIAMLKQ
ADLDVALQFVNYR
41410160NP_962996.1 hypothetical protein MAP4062c [Mycobacterium avium subsp. paratuberculoMTVTPQEAADHGAAEADYFDVLIVGAGISGIDAAYRITERNPQLSYAILE
RRARIGGTWDLFRYPGVRSDSSIFTLSFPFEPWTRKEGVADGVHIREYLT
ATAHKYGIDRHIRFNSYVRSADWDSTSDTWTVTVEDGARDGERKLYRARF
LFFGSGYYNYDEGYTPDFPGIEEFTGTVVHPQHWPEDLDYTGKKVVVIGS
GATAVTLLPSLSDRAAKVTMLQRSPTYLISASKYGKVAAVARKVLPRKPA
HLVIRMYSALTEAVFFALSRKAPRLVRWLLRRKAINSLPPGYAVDIHFKP
RYNPWDQRMCLIPDADLYNAITAGRADVVTDHIDHFDATGIALRSGAHLD
ADIIITATGLQLQALGGATISLDGNEIKTNDRFVYKAHMLEDVPNLFWCV
GYTNASWTLRADITARATAKLLEHMTTHGYTHAYPHRGNEPMTEKPSWDI
NAGYVLRSVHALPKSGTKRPWNVRQNYLADAIDYRFDRIEEAMVFGRAAD
RAALAG
41410159NP_962995.1 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase [Mycobacterium aviMAAQMREPKVVVLGGGSWGTTVASICARRGPTLQWVRSRETADDINENHR
NSRYLGNDVVLSDTLRATTDFCEAANTADVVVTGVPSHGFRGVLTELARE
LRPWVPVVSLVKGLEQGTNMRMSQIVEEVLPGHPAGILAGPNIAREVAEG
YAAAAVLAMPDQHLATRLSGLFRTRRFRVYTTDDVVGAEMAGALKNVFAI
AVGMGYSLGIALVIARALREMTKLGVAMGGSPDTFPGLAGLGDLIVTCTS
QRSRNRHVGEQLGAGKPIDEIIASMNQVAEGVKAASVIMEFGLTMPIARE
VDAVINHGSTVEQAYRGLIAEVPGHEVHGSGF
41410158NP_962994.1 hypothetical protein MAP4060c [Mycobacterium avium subsp. paratuberculoMQDIQRADDALPTASRAERLRGVIRHDLPSSLVVFLVALPLSLGIAIASN
APVLAGLIAAIVGGIVVGALGGSPLQVSGPAAGLTVVVAGLVSDFGWGVT
CFITVAAGAVQVLLGLSRVARAALAISPVVVHAMLAGIGITIALQQTHVL
LGGKSKSTAWHNLIGLPGQIIGAHRPGVLLGVLVIVILVAWRWVPAKVRR
VPGPLVAIVAVTVISVVFPFHVRRIDLDGSPLDALQLPDLPHGNWSGVAV
GVITVALIASVESLLSAVSVDRMHNGPRTDFNRELVGQGAANMISGAVGG
LPVTGVIVRSSTNVNAGARSRASAIMHGVWILLFTIPFAGLVDEIPTAAL
AGLLIVIGIQLLKPAHIETAMKHGDLAVYVVTAVSVIFLNLLHGVMIGLA
LAIALTGWRVIRAKIEAAQLDGEWRVTIEGAACTFLALPRLTRVLASVPR
GATVTVAIAVHYLDHAAHQAITDWQRQQEATGGTVRIEGAVVATGRRDEP
QVEAEMPGAAA
41410157NP_962993.1 heat shock protein HtpX [Mycobacterium avium subsp. paratuberculosis K-MTWHPHANRFKTFALLVGMSALIVFVGSLFGRTAMFFAVLFAIGMNVYTY
YNSDKLALRAMHAQPVSELQAPAMYRIVRELATAAHQPMPRLYISDTNAP
NAFATGRNPRNAAVCCTTGILGILNERELRAVLGHELSHVYNRDILISCI
AGAMASVITALANMAMFAGMFGGNDRDGENPFALLLVSLLGPIAATVVRL
AVSRSREYQADESGAVLTGDPLALASALRKISGGVQAAPLPPEPQLASQA
HLMIANPFRAGERIGSLFSTHPPIEDRIRRLESMAGR
41410156NP_962992.1 GrcC1 [Mycobacterium avium subsp. paratuberculosis K-10]MNTPATVVAGVDFGDPAFAATVRDGVGRIEQLMDTELRSADDIMTESLTH
LFKAGGKRFRPLFTVLSAQIGPDPDAAEVTIAGAVIELVHLATLYHDDVM
DEAEVRRGTPTANVRWGNNVAILAGDYLFATASRLVSRLGPEAVRLIAET
FAQLVTGQMRETRGRKQGSDPIEHYLKVVYEKTACLIAAAGRFGAMFSGA
DADQVERLSRLGGIVGTAFQISDDIIDIDSDSHESGKLPGTDVREGVHTL
PMVYALREPGPDAARLRELLVGPIDDDEVVAEALTLLRASPGMAKAKQSL
REYAAQAHRELDQLPDVPGRRALQTLVDFTISRHG
41410155NP_962991.1 hypothetical protein MAP4057c [Mycobacterium avium subsp. paratuberculoMTTAATRADLVVVGAGPAGSAAAAWAARAGHDVLVVDAARFPRDKACGDG
LTPRAVAECERLGLGGWLDSRIRHRGLRMSGFGAQVQVDWPGPSFPSTGS
AVARTELDDRIRRVAEDSGARMLLGTKAVGVQRDSSGAVRALTLADGTGV
QCRQLIVADGARSSLGRALGRRWHQETVYGVAARGYLSTPHADDPWLTSH
LELRGPDGARDKVLPGYGWIFPLGNGEVNIGVGALSTSRRPAELALRPLI
DHYTDLRRDEWGFVGRPRAVASALLPMGGAVSGVAGPNWMLIGDAAACVN
PLNGEGIDYGMETGRLAAGLLGCPDLSQEWPALLREHYARGFSVARRLAL
LLTYQRFLPATGPVAMRSTTLMRIAVRVMANLVTDDDADWVARAWRGAGR
LSRLIDRRAPFS
41410154NP_962990.1 hypothetical protein MAP4056c [Mycobacterium avium subsp. paratuberculoMLATIGAAAVAAFALAAPAQLSAPAQADPPPTAPYPTPRTPSPPSDYDAP
FKNTVNGFGIYQPQDQLAWLGKITCDRLDHGVDHDAHQSATFIQRNLPRG
TSEGQSLQFLGAAVDHYCPEHIDVVQAAGR
41410152NP_962988.1 hypothetical protein MAP4054 [Mycobacterium avium subsp. paratuberculosMRVAIVAESFLPEVNGVSNSVIRVLEHLRRTGHEALVIAPDTPPGQPRAE
RIHDGIRVHRVPSRMFPKVTTLPLGVPTPRLVSVLRGFDPHVVHLASPAL
LGYGGLRAARWLGVPTVAVYQTDVPGFAASYGIPMTARAAWAWFRHLHTL
ADRTLAPSTVTMESLVAHRFPRVHRWARGVDVLRFAPSARSEALRRRWSP
QGKPIVGFVGRLAPEKHVERLAGLAASDAVQLVVVGDGVDRAKLQSAMPT
AVFTGALYGDELAAAYASMDVFVHPGEHETFCQVVQEALASGLPVIAPDA
GGPRDLVTPWRTGLLLAVDEFETKLPAAVAHLIGERHRYAPAARRSVLGR
SWPVICDELLGHYEAVLSPFVRHQVRAGRYAQGE
41410151NP_962987.1 hypothetical protein MAP4053 [Mycobacterium avium subsp. paratuberculosMTISPKALLHILIHGRSDPPETTRGRIALRWARIAVLIVTGLVTLQSVLL
VAGAWRNDLAITHNMGVAQAEVLSAGPRRSTIEFVTPERVTYRPELGVLY
PSHLATGMRIYVEYNKNDPNLVRVQHRNAGLAIIPAGSIAVVGWLGAAVL
LALLALADKWLDRRGKGAGPADFA
41410150NP_962986.1 2-succinyl-6-hydroxy-2-4-cyclohexadiene-1-carboxylic acid synthase/2-oxMNPSTTQARVVVDELIRGGVRDVVLCPGSRNAPLAFALADADRAGRIRLH
VRIDERTAGYLAIGLAIAAGAPVCVAMTSGTAVANLGPAVVEANYARVPL
IVLSANRPYELLGTGANQTMEQLGYFGTQVRAAISLGLAEDAPERLDALN
ATWRSATCRVLAAATGSRTANAGPVQFDIPLREPLVPDPEPHGAPTPAGR
PGGRPWTYTPPVSFDQPLDIDLSPDTVVIAGHGAGTHPNLAQLPTVAEPT
APAPDNPLHPLALRLLRPKQVIMLGRPTLHRPVSALLADPQVPVYALTTG
PRWPDVSGNSQATGTRAVTTGAPSPAWLHRCEQANRHAVAAVRGQLAAHP
LTTGLHVAAAVADALRPGDQLVLGASNPVRDAALVGLDSHHIRVRSNRGV
AGIDGTVSTAIGAALAHEAAHDGRTVALIGDLTFVHDSSGLLIGPTEPTP
RRLTIVVSNDNGGGIFELLEQGDPRFSDVSSRVFGTPHDVDVGALCRAYH
VESAQIEVGELAAALDEPGPGMRVLEVKADRSSLRQLHAAIKAAL
41410149NP_962985.1 BpoC_2 [Mycobacterium avium subsp. paratuberculosis K-10]MINLAYDDRGSGEPVVFIAGHGGAGRTWHPYQVPAFLAAGYRVITFDNRD
IGATENAQGFTTETMVADTAALIEGLNAAPARIVGMSMGAFIAQELMLAR
PELVSAAVLMGTRGRMDRARQFFRDAEAELADGGVALPASYEAKIRLLEN
FSRKTLNDDTAVADWIAMFSTWPVKSTPGMRAQLDVAPYTNRLSAYRSIA
TPVLVIGFSDDVLTPPYLGREVADALPNGRYVQIPDTGHLGFFERADAVN
AAMLKFFGEQH
41410148NP_962984.1 O-succinylbenzoate synthase [Mycobacterium avium subsp. paratuberculosiMIPPLQDLLDRLHVVALPMRVRFRGITTREVALIDGPAGWGEFGAFVEYG
PPEAAHWLASAVESAYRPAPPVRRDRIPINATVPAVPPAAVPDVLARFPG
ARTAKVKVAEPGQTLADDVARVNAVRDLVPTVRVDANGGWSVDEAARAAR
ALSADGPLEYLEQPCATVGELAELRRRPDMPDVPIAADESIRKADDPLAV
VHARAADIAVLKVAPLGGISALLDIAARIDIPVVISSALDSAVGIAAGLT
AAAALPVLGHACGLGTGGLFVEDVADVAAPVDGALPVGPVTPDPARLRAL
AAPPQRRQWWIDRVTACHGLLVPSSG
41410147NP_962983.1 hypothetical protein MAP4049 [Mycobacterium avium subsp. paratuberculosMAWLLLIAWLCIVAGATHGARLERVAIPVSRTLGPIASVHMGQADLVLTG
TVLTVDEARPTAEALAVADGRIVAVGTRAEIAAHVGPHTQTVDIGDGCVM
PGFVEAHGHPLMEAVALSDRIVDIRPVTLANADDVVAAVKSEVGKRGEAG
AYLNGWDPLLQQGLPQPTLAWLDDIAPDGPLVIIHNSGHKAFFNSRAAQR
HGLNRDTPDPKGARYGRDADGELDGTAEETGAVFPLLDGAIDTAGYPRML
HAECARLNRAGLTTCSEMAFDPRFRPLVEQLRGQLTVRLRSYEISNPQLR
TDATLGEGDDMLRQVGIKIWVDGSPWIGNIALSFPYLDTEATRTIGVIPG
SCGCANYTTEQLHEIVSAYFPLGWQLACHVQGDAGVDTILDVYEEALKRH
PRDDHRLRLEHVGAIRPDQLQRAADLGVTCSIFVDQIHYWGDVLVDGLFG
EERGSRWMPAGSAVATGMRISLHNDPPVTPEEPLRNISVAATRKAPSGRV
LAPEERLTVEQAIRAQTLDAAWQLFADDVIGSLEVGKYADLVVLSADPRA
VPPERIADLQVRATYLAGRRVYPQ
41410146NP_962982.1 acyl-CoA synthetase [Mycobacterium avium subsp. paratuberculosis K-10]MGDELLRHPIHSGHLTVGALKRNKDKPVLHLGDTTLTGGQLAERISQYIQ
AFEALGAGTGATVGLLSLNRPEVLMIIGAGQTQGYRRVALHPLGSLDDHA
YVLDDAGVTSLIIDPTPAFVERALGLLEKVPGLKQILTIGPVPEALSGSA
VDLVAEAAKYAPKPLVAADLPPDHIGGMAYTGGTTGKPKGVLGTAQSITT
MTTIQLAEWEWPENPRFLMCTPLSHAGAAFFVPTIIKGGELVVLTKFDPA
EVLRVIEEQKITATMLVPSMIYALMDHPDSHTRDLSSLETVYYGASAMNP
VRLAEAIRRFGPIFAQYYGQSEAPMVISYLAKKDHDEKRLTSCGRPTLFA
RTALLDADGNPVPQGEVGEICVSGPLLSGGYWNLPEETAKTFKDGWLHTG
DMAREDEDGFWFIVDRVKDMIVTGGFNVFPREVEDVVAEHPAVAQVCVIG
TPDEKWGEAVTAVIVLRPDHPSDEESVAKVTAEIQAAVKKRKGSVQSPKQ
VIVVDSVPVTALGKPDKKAVRARFWEGAGRAVG
41410145NP_962981.1 hypothetical protein MAP4047 [Mycobacterium avium subsp. paratuberculosMVAPEGCGETLENAEGPPHSQPSRNGGSSALVGRSDARRNRQRLLEAATA
AFTAHGASVSLESIARDAGVGIGTLYRHFPNREALVEAVYRAELAEVAAA
AAQLLQRHPPKTALRRWMDRYANFVATKRGMAESLQAIFESGALVPSQTR
DSIVGAVETLLRAGADDASLRADVQADDVVSSLIGIFLVSGSPEQTGRML
DLLVAGVTR
41410144NP_962980.1 hypothetical protein MAP4046c [Mycobacterium avium subsp. paratuberculoMTDKPRPGGIGDLGGLPVARVGYGAMQLFDTSPDEAAAVLRRAVELGVNH
IDTASFYGPGEVNRRVRAALAPYPDDLVIVSKVGARYTGEQPIPLASAQR
PAELRAAVEDDLSQLGLDRIPVVNLRRMDLGPSAAAGGDQDVDLDDQLAE
MIALRDEGKIGGIGISSVPLEVLRRALPAGIVCVQNAYSLLDRSQEAMVD
VCAAEGIAWVPYFPLGSAFPGLPKVTDNAVVVDIAGELGVTPAQVGLAWI
LARAPHTLLIPGTRSITHLEENMGAAGVTLSAEAIARLDAVGSAAGHDYA
VTGGHQ
41410143NP_962979.1 hypothetical protein MAP4045c [Mycobacterium avium subsp. paratuberculoMTELSAAEARPVLRAFPTEVPTGVGFMKRAGLVTDGRPEEFEALAGRCAV
FRLDPA
41410142NP_962978.1 naphthoate synthase [Mycobacterium avium subsp. paratuberculosis K-10]MSDNPFDSGQWQPVAGFDDLTDITYHRHVDDATVRVAFDRPEVRNAFRPH
TVDELYRVLDHARMSPDVGVVLLTGNGPSPKDGGWAFCSGGDQRIRGRSG
YQYASGETADTVDPARAGRLHILEVQRLIRFMPKVVICLVNGWAAGGGHS
LHVVCDLTLASREHARFKQTDADVGSFDGGYGSAYLARQVGQKFAREIFF
LGREYTAEQMHHMGAVNAVVEHAELERAGIEWAREINAKSPQAQRMLKFA
FNLLDDGLVGQQLFAGEATRLAYMTDEAVEGRDAFLEKRPPDYSRFPRYF
41410141NP_962977.1 short chain dehydrogenase [Mycobacterium avium subsp. paratuberculosis MSKSPLRRFADQLVLATMRPPMAPQVLVNRPLIKPVELAGKRVLLTGASS
GIGEAAAEQFAREGARVVVVARRKDLLDALAERITRAGGEAIAMPCDISD
LDAADALVADVQQRLGGVDILINNAGRSIRRPLAESLERWHDVERTMVLN
YYAPLRLIRGIAPGMIERGDGHIINVSTWGVLSEASPLFAVYNASKAALS
TVSRVVETEWGDKGVHSSTLYYPLVATPMIAPTKAYQGVPALTPEEAGRW
MITAARTRPVRIAPRMAIAAKALDTFGPRWVNAVMQRQTVQPNREAGA
41410140NP_962976.1 hypothetical protein MAP4042c [Mycobacterium avium subsp. paratuberculoMEILASRMLLRPADYQQSLTFYRDRIGLAIAREYSGGTVFFAGQSLLELA
GYGAPDHSGGPFPGALWLQVRDLEATQAELRGRGVAIAREARQEPWGLHE
MHVVDPDGITLIFIQIPADHPLRRDTRGERQAKPG
41410139NP_962975.1 hypothetical protein MAP4041c [Mycobacterium avium subsp. paratuberculoMPLPPESGAVNIQLFLLIIVVITALAFDFTNGFHDTGNAMATSIASGALK
PKTAVALSAVLNLVGAFMSTAVAATIAKGLIDSNIVTLELVFAGLVGGVV
WNLLTWLLGIPSSSSHALIGGIVGATIAAVGAHGVIWKGVISKAIIPAIV
SAILAILVGAVATWLVYRITRGVPKKRTEAGFRRGQIGSASLVSLAHGTN
DAQKTMGIIFLALISYGSVSKTAAMPPLWVIVSCALAMATGTYLGGWRII
RTLGKGLVEIQSPQGMAAESSSAAVILLSAHFGYALSTTQVCTGSVLGSG
LGKPGGEVRWGVAGRMGVAWLVTLPLAGLVGAVTYWIVHLIGGYPGAIIG
FALLVAVSATIYLRSRKVKVDHHNVNAEWKGDLTTGLEGADDHSPPPDAG
PPFGGPGDRYQSDDPTLKASAS
41410138NP_962974.1 hypothetical protein MAP4040c [Mycobacterium avium subsp. paratuberculoMSHLGDWFNYQASLKILLFAMLAGAALPGLFALGIRLQSAGAGDITLDGA
DGGPARRNPLLTGLAWAIYALVIAVITLALLYIARDFIAHHTGYPFLGAK
AK
41410137NP_962973.1 hypothetical protein MAP4039c [Mycobacterium avium subsp. paratuberculoMNGFLSSIVSWLRAGYPEGVPPTDTFPVLALLARRLSGDEVKDVASELIR
RGEFDDVDIGVLITQITDELPTPDDVERVRVRLAAQGWPFDDADQAGDPA
41410136NP_962972.1 O-succinylbenzoic acid--CoA ligase [Mycobacterium avium subsp. paratubeMLDGRDPALVVLGPPGDRESATLRAGLRVGEPVDDDVALVAATSGTTGAP
KGAMLTAAALRASATATHERLGGPGSWLLALPAHHIAGVQVLVRSLLAGS
TPVELDVSRGFDVTQLPAATRALGTGRRYASLVAVQLAKALGDPAATAAL
AELDAVLLGGGPAPRPVLQAAAAAGITVVRSYGMSETAGGCVYDGVPLDG
VRVRVSDGRIALGGATLAKGYRNPVDPDPFAEPGWFLTDDLGAVDDDGVL
TVFGRADDAISTGGLTVLPQPVEAALCTHPAVADCAVFGLPDDRLGQRVV
AAIVLRDGRAAPSPDALRAHLSRTLDATAAPREVHVVAALPRRGIGKVDR
AALVRRFAGGGEQ
41410135NP_962971.1 hypothetical protein MAP4037c [Mycobacterium avium subsp. paratuberculoMRIARRDAVAAAVGAALVAAAFLLPRLNLGVRQRLDVGPERFATHAGAAP
IFGEWLIHAGWGTGPAVALAAAVVAWGPVLAQRLSWWALTLGSWAVAAGW
AFALAMIDGWQRGFAGRLTTRDEYLWEVPGIHDIAAAVRTFSSRIVDYQP
HSWTTHVSGHPPGALLTFVWLDRLGLHGGGWAGLLCLLAGSSAAAAVLIG
VRALADEPTARRAAPFVALAPTAIWVAVSADGYFAGVAAWGIALLAVAVH
RPVRFPALTAAGAGLLLGWGVFCNYGLMLMGLPAAAVLAAAPRLPRDGRT
QWRAVLRALGPAALGAIAVAVAFAVAGFYWFDGYTLVQQRYWQGIAKDRP
FQYWSWANLACVVCAIGLGGVAGVGRVFDRAAIRRRSGFPLLLLAVLAAI
ACADLSMLSKAEVERIWLPFTIWLTAAAALLPVRTHRIWLALNAVGALAV
NTIILTHW
41410134NP_962970.1 hypothetical protein MAP4036 [Mycobacterium avium subsp. paratuberculosMIPVTLLVVAKAPEPGRAKTRLAAAVGERAAAEIAAAALLDTLDAVAAAP
VAARVVALTGDLDGAARGAEIRARLASFTVIAQRGNDFGARLANAHADAA
DGLPVLQIGMDTPQVTAELLAGCARRLLDAPAVLGLARDGGWWVLGVAAP
VLADCLRAVPMSAADTGELTLKALRDNGIEVATVQTLVDVDVVGDVAVVR
DACPPASRFARATRAAGL
41410133NP_962969.1 hypothetical protein MAP4035 [Mycobacterium avium subsp. paratuberculosMPGTDGRVTVVLPCLNEEESLPGVLATIPPGYRALVVDNNSTDDTAGVAR
RHGAQVVTETRAGYGAAVHAGVLAATTPIVAVLDADGSMDGADLPRLVAA
LEAGADLVTGRRRPVPGLRWPWVARVGTVVMSWRLRTRHGLPVHDIAPMR
VARRDALLGLGVADRRSGYPLELLVRAAAAGWRVVELDVRYGPRTGGKSK
VSGSLRGSITAILDFWKVIS
41410132NP_962968.1 hypothetical protein MAP4034 [Mycobacterium avium subsp. paratuberculosMDVVLGVAVTGPVARLALVGSRGTDVIDQSVVDLADNPIETLTETVVGTN
RLLAGENHRLVGTRLCWTDHPRADQLRRALGDSGVHNVAVLSESQAVAAL
MRAAGQPGAALVMDDATGTLSMVSPAAGDPDAPPTLLARQPLGGAVGGDV
TAALQTMMANLSAHPDAPGEVYLVGASPDLDRVAEQLRDASTMRVQVADD
PTFALARGAAIAAAPALAAGDATAMAPAVGVTGDATAMAPAAGDATAMAP
AAGLTGDETTVVPAPELAEPQDRQLAYSMADDAGIYPGEMDEYDPEFDDY
DADYDDGEEAAPAKLSRRSLVIGNAVIAFAVIGLASLATAIAVAVEPTAS
RQPVVGVQNGTPGKFMPILPSQQQAPLPPPPADAPNAGFQGGVVQAPSNA
PAPQPAVPAPANPAPEAPSNPGVVPNPNPGWAPNPNPLVPVPIPIPVPIP
GWNPPYNPPYTPPYNPTTPYTPPTTTYEPPTTTYQPPTTTYQPPTTTYQP
PTTTYQPPTTTHEPPTTTYQPPSTRATTEAPLPTHTQQTVPPTHSQPLFP
QEPHTHRGF
41410131NP_962967.1 hypothetical protein MAP4033c [Mycobacterium avium subsp. paratuberculoMVSQSSDDTPTGPIAGQPRQPAARRIIRSHATGATPPPGPATTGRRVAAD
LTAVALLLAAVLLPWNLYFGVGIPDSNPIVFTVLVAVTALALAALAVAGS
WRAGGARFDPARAARLRLALNVPYLLLVLAFVGFDAVQTVRFGGTVDVPG
GVGPGAWVGIAGALLSAQAVPAGTAAAPVPGTPGGDEATGWHRAARIIGA
LSMLAAVLSFGFNLYWRVRYALQSSGGAAQFGKENIAVIATAVVYGVVAL
VAVLVASRWLLRSDRASRLTTIALGTSTLGAGILVWLLPAGRDLDAFHGI
AQNTSTAGVGFEGYLAWAAGAALFAPRSLFERRTPSHTEESAWRATARSG
LLLIAVWALGSMAMRITDLAVAVTLNYPFSRYDSLVLAAFDLVTAVLAIW
LRRRLANLAARLVTSLCGLVAALAVARVVVGVQLAPRFADTPNSPVHHPV
YGNNLAQQITSVFDVTLCGLALGILVAAVVAGQLGRRRRARRSARRRAAQ
ANAAAPTTRIPVSQGAAPSAAATTRIATGGPGADHEPPTTEIPPLAGSPR
IFRGDDSGTRQIPVPKPQIYRPPQQ
41410130NP_962966.1 hypothetical protein MAP4032 [Mycobacterium avium subsp. paratuberculosMVALRYHNVYGPGMPRDTPYSGVAAIFRSALEKGEPPRVFEDGGQMRDFV
HVDDVAAANLAALACRDGFTAVNVCSGQPISILQVATALCDARGGAVAPV
VTGQYRSGDVRHIVADPSRAARLLGFRAAVQPGDGLREFAFAPLR
41410129NP_962965.1 hypothetical protein MAP4031 [Mycobacterium avium subsp. paratuberculosMRVLVTGAAGFIGSRVAAALRAAGHDVVAVDALLAAAHGPNPLPPNGCHR
VDVRDADALAPLLAGVDVVCHQAAMVGAGVDAADAPAYGGHNDLATTVLL
AQMFAAGVRRLVLASSMVVYGQGGYRCERHGPVHPAAAAACGPGRRGLRA
PVPDRR
41410128NP_962964.1 5'-methylthioadenosine phosphorylase [Mycobacterium avium subsp. paratuMHHNGRMLGVIGGSGFYTFFGSDADDVTVDTPYGPPSAPVTVGAVGGHRV
AFLPRHEFSAHTVPYRANLWALRKLGVRRVLAPCAVGSLVPELGPGAVVV
PDQLVDRTRGRADTYFDSGAVHVDFADPYCPALREAVTGLPGVVDGGTMV
VIQGPRFSTRAESRWFASAGFSLVNMTGYPEAVLARELEICYAAIALVTD
LDAGVSAGEGVKAVEVFAEFEKNIEPFKKLVRDAIGRVAAERSCTQCSPH
TGVSLPIELP
41410127NP_962963.1 1-4-dihydroxy-2-naphthoate octaprenyltransferase [Mycobacterium avium sMANLGQWISGARPRTLPNALAPVVAGTGAAAWLHAAVWWKALLALVVAVA
MTVGVNYANDYSDGIRGTDDDRAGPVRLVGSRLAAPRAVLGAAIVSLTVG
AIAGLVLALSSAPWLIAVGAACIAGAWLYTGGSKPYGYTGFGEVAVFVFF
GLVAVLGTEYTQALRVDWVGLVLAVAVGALSSSVLVANNLRDIPTDARSG
KITLAVRLGDARTRVLYQALLSAAAALTLVLVAATPWCAAGLVATPLALR
AATPVRSGRGGAELIPVLRDTGLAMVVWAVAVAAALTWGT
41410126NP_962962.1 3-oxoacyl-ACP synthase III [Mycobacterium avium subsp. paratuberculosisMKQIAATSGPTNIGLLSVGSYRPQRVVTNDELCQNIDSSDEWIYSRTGIK
TRRFAARDESTASMATEAGREAIAKAGLEASDIDCVVVATSTHFLQTPAC
GPAVAAALGATGVPAFDISAGCAGFGYALGVAADMVRGGTAGKVLVLGSE
KLSPTVDMTDRSNCFIFADGAAGVVVGETPTQGIGPTVWGSDGTQATAIR
QDIDWMDYLDRPTGPRPFLRLEGSAVFRWAAFEMGKVGQQAMDAAGVRPD
EIDVFLPHQANSRINEILAKSLELRPDAVIANDIEHTGNTSAASIPLAMA
EVLATGAAKAGDLALLIGYGAGLSYTAQVVRLPPG
41410125NP_962961.1 hypothetical protein MAP4027 [Mycobacterium avium subsp. paratuberculosMAVSQQGSDGSTPGPGGAVVPVLAYAAARLLLAVVLTGVIYGVARLAGIT
EFPVVVAALFALVIAMPLGIWVFGPLRRRATAALAVAGERRRRERELLQA
RLHGDVPPER
41410124NP_962960.1 hypothetical protein MAP4026 [Mycobacterium avium subsp. paratuberculosMSEHPTAGVGAPEEQTTQIPPAAAAGDEKKDAAEPQPEPGGDAPTKAFAG
FRTERRVPAPEREPAPPTAPRPGGMPPWDSTPVTGIPRVDPTAYGAYYAG
PDAPPTQIQGPPPRQEHLPHTPYPELSTGMLLRPVQPPPSEGWRLLLYKL
SGGLINLGESPRAARYNNLVAQVNRPLRGSYRVAFLSLKGGVGKTTIAAT
LGATFASIRGDRVVAVDANPDRGTLSQKIPLETAATVRQLLHDAGTIERY
SDVRRYTSKGPSGLEVLASETDPAVSEAFSADDYVRILDILERFYGLVLT
DCGPGLLHSVMKSVLEKADALVVVSSASIDGARSASATLDWLDAHGHEDL
VRNSIAVINGVRPRPGKVDMNKVIDHFSRRCRAVQLVPFDPHLEEGAEID
LDRLRRGTREALTELAAIVADGFPGAQRNPGVLG
41410123NP_962959.1 CcsB [Mycobacterium avium subsp. paratuberculosis K-10]MNTVHVNIELARYSDWAFTSAVVALVIALLLLAFELAYAGGRRADARARV
LAGAVSADSATPGVVDEVARRPVDERAGRAGLAVVYLGTGLLLACLVLRG
LATLRVPWGNMYEFINLTCLCGLVAGAIVLRRPQYRPLWVFLLLPVLILL
TVSGRWLYTNAAPVMPALQSYWLPIHVSVVSLGSGVFLVAGIASILFLLR
TSPLGDPGNDSAPARLVRRFPDAQTLDRIAYRTTIFAFPVFGFGVIFGAI
WAEEAWGRYWGWDPKETVSFVAWVIYAAYLHARSTAGWRDRKAAWINVAG
FVAMVFNLFFVNLVTVGLHSYAGVG
41410122NP_962958.1 hypothetical protein MAP4024 [Mycobacterium avium subsp. paratuberculosMALATLRATARNTWRALTSMGTALVLLFLLALGAIPGALLPQRNLNAGKV
DDYLKAHPVIGPWLDRLQAFNVFSSFWFTAIYVLLFVSLVGCLTPRMIEH
VRSLRATPVAAPRNLARLPKYAGHRIAADAEDLNTLANTLVGRLRGWRTA
IRHHDGAGPDAVEVSAEKGYLREFGNIVFHFSLLGLLVAVAVGKLFGYEG
NVIVIADGGPGFCSASPAAFDSFRAGNTVDGTSLHPLCIRVDDFDAHYLP
SGQAVSFAANIDYQSGADLAANTWRHYRLQVNHPLRLGGDRVYLQGHGYA
PTFSVTFPDGQIRTATVQWRPDNPQTLLSSGVVRIDPPAGSYPTAAERRQ
HEIAIQGLLAPTEQLDGTLLSSRFPALNAPAVAVDIYRGDTGLDTGRPQS
LFTLDPRLIEQHRLTREKRVNLRAGQAVRIDQGPAAGTVIRFDGAVPFVN
LQVSHDPGQTWVLVFAVTMMAGLLVSLLVRRRRVWVRLTPDAGGAPGTVN
VELGGLARTDNSGWGDEFERLSQRLLDGLAEPASRASQRSTEVDVK
41410121NP_962957.1 CcsA [Mycobacterium avium subsp. paratuberculosis K-10]MTGLTQIAAAGPLLAALGVCLLAGLVSFASPCVVPLVPGYLSYLAALVGV
EEQPQAGAVQAPPGARWRVAGSAALFVAGFTAVFVLGTVAVLGMTTTLIT
NQLLLQRAGGVLTIVMGLVFVGLIPALQRQARFSPRQLTTVAGAPLLGAV
FALGWTPCLGPTLAGVITVASATDGASVARGIVLVIAYCLGLGIPFVLLA
FGSAGAVAGLGWLRRHTRAIQIFGGVLLITVGALLVTGLWNDFVSWLRDA
FVSDVRLPI
41410120NP_962956.1 hypothetical protein MAP4022 [Mycobacterium avium subsp. paratuberculosMSARVLAMAGAVLAGLLTGCSSGHDAVAQGGTFEFVSPGGKTDIYYDPPS
SRGRPGPLSGPDLADPAHTLSLDDPIFAGRVVVINIWGQWCGPCRSEVSQ
LQQVYDATRGAGASFLGIDVRDNNRQAALDFVNDRHVTFPSIYDPAMRTL
IAFGGKYPTTVIPSTLVLDRQHRVAAVFLRELLATDLQPVVQRVAQQ
41410119NP_962955.1 hypothetical protein MAP4021 [Mycobacterium avium subsp. paratuberculosMGEQTRVHVVRHGEVHNPDGVLYGRLPGFHLSEAGRAQAAAVAEALAPRD
IVAVIASPLQRAQETAAPIAARHGLAVDTDPDLIESANFFEGRRISPGDG
AWRDPRVWWQLRNPFRPSWGEPYTEIAARMETAVDKARARGTGHEVVCVS
HQLPVWTLRLHLTGRRLWHDPRKRECGLCSITTLVYDGDRLVDVEYSEPA
AP
41410118NP_962954.1 glutamate-1-semialdehyde aminotransferase [Mycobacterium avium subsp. pMGSSDQATAHARAQAASARLFDDACAVIPGGVNSPVRAFTAVGGTPPFIT
AARGCRLTDADGNHYVDLVCSWGPMILGHAHPAVVEAVAKAAASGLSFGA
PTPAESELAAEMIARVAPVERIRLVNSGTEATMSAVRLARGFTGRAKIVK
FSGCYHGHVDALLADAGSGVATLGLPSSPGVTGATAADTIVLPYNDIDAV
RQAFTEFGDQIAAVITEASPGNMGVVPPAPGFNAALRALTADHGALLIVD
EVMTGFRVSRSGWYGIDPVDADLFTFGKVMSGGLPAAAFGGRAEVMERLA
PLGPVYQAGTLSGNPVAMAAGLATLRHADAAAYAALDANADRLARLLSDA
LTNAGVPHQIPRAGNMLSVFFTDTPVTDFASARATQTWRYPPFFHALLDA
GVYPPCSAFETWFVSTALDDDAFDRIAAALPAAARAAAGADEGNS
41410117NP_962953.1 hypothetical protein MAP4019 [Mycobacterium avium subsp. paratuberculosMMGDTPGNAAGRRSSELSRRGRDLAAGKVITAADVQCAAERAETSRQRDL
DAHRRDEHRHYQAAIAHERAAEVEDRAVAEGLGDVAAHQRAADREREAAR
RNFMAAQQANSYDAD
41410116NP_962952.1 hypothetical protein MAP4018c [Mycobacterium avium subsp. paratuberculoMSPGACELDGGMQLPQGLARFNRHVTNPIQRMWAGWLPPFGIVEHVGRRS
GKPYRTPVNLFSADVDGKPGVAILLTYGPDRDWLKNLTAAGGGRIRSRGK
TFGVADPRVVSKAEAASHLRPGVRGVFARLPFEQAVLLTRTP
41410115NP_962951.1 hypothetical protein MAP4017c [Mycobacterium avium subsp. paratuberculoMVRITGIVERAVRLDAPGRGGPANAVVDFSGHTVSLVAVLTDAVRRGRPV
AGVAFDSIGRFAQSGILRDRLIPRVLAAAPDALLDGSGFLDPAAVAACAL
TDEKPGGHGDRAAAVAALELACWDLNAKLRDEPAWVTIARHAGRQPAPAV
PVYAAGGYYHPAGGVDALRREMGEYLELGYRAVKMKIGGAALGEDLARVE
AVIDVVGDAGRVAVDANGRFGRAEAIRWAGALAGYGLRWFEEPGDPLDYA
LHRAVTDCYDGPVATGENLFSVPDVTNLVRYGGMRPDHDVFQMDPGLSYG
LSEYLRMLDVLADHGFDRGCAFPHGGHLINLHVAAGLGLGGCEAYPGVFA
PFGGYPDGCVVSSGMIAPPDAAGFGLEQKPGLAELIAELTGERR
41410114NP_962950.1 hypothetical protein MAP4016c [Mycobacterium avium subsp. paratuberculoMKIAVIGCGAMGSIYAAKLAAAGEQVLAVDRHRPSVERINRDGLRVTGPG
CDQVVPLRASTGAVDETMDLVVLAVKAADVEAAARQALPMLGPDTAVLTI
QNGLGSAETVAGVVGTQRVAVGIASGFGASRVAPGHVHHNAMRAMRFGPY
SSLPHARVESIARTWAHAGFDAVAVTDIAAMQWEKLICNVAYSAPCALTG
MTVGQVMDDAEMGPVSRAAATEAWSVARASGVAIAVADAVEHVRAFGAQM
PDAKPSALLDHEARRVSEIDVINGAVPRQGARVGVDAPVNATLTAVVKSI
ERRWR
41410113NP_962949.1 hypothetical protein MAP4015 [Mycobacterium avium subsp. paratuberculosMARVAPNTVFLFLLNSSGAIILFVYWLIALSQIVLRRRTPAERLSVKMWF
FPVLSVLTLAGITAVLVQMAFDATARSQLWLSLLSWAVVVALYFVACSRG
RVAAR
41410112NP_962948.1 hypothetical protein MAP4014 [Mycobacterium avium subsp. paratuberculosMLALGGVIGAGLFVGSGVVIKDTGPAAFLTYALCGLLIVLVMRMLGEMAA
ANPSTGSFADYAAAALGRWAGFSVAWLYWYFWVIVVGFEAVAGGKVLNYW
FHAPLWVLSLGLMLLMTATNLFSVSSFGEFEFWFAGIKVATIVIFLAVGA
AYVVGLVPGHHDGLTNLVSHGGFFPRGVGAVFAAIVVVIFSMVGAEIVTV
AAAESRDPRRAVQKATRSVVTRIGIFFVGSVFLLVAILPWDSVELGASPY
VAALKHLGLAGADQVMNAVVLTAVLSCLNSGLYTASRMLFVLAERGEAPA
RLVRLSGRGVPHIAIL
41410111NP_962947.1 hypothetical protein MAP4013 [Mycobacterium avium subsp. paratuberculosMSLAFHWFLPTYGDSRNLVAGGHGTPMSGDRPATLRYLHQICSAAEDNGF
EAVLTPTGLWCEDAWLTTAMLVESTETLKFLVAFRPGLLSPTLASQMAGT
FQRHSQGRLLLNVVTGGEPHEQRAYGDFLDKEARYARTAEFLHVVRQLWT
SPQPVTFAGEHIRVEGAQLNNPPDPIPAVFFGGSSASAGPVAAKHSDVYL
TWGEPLTAVAKKLDWVRGLAVDAGRILQYGLRIHVISRDTSDAAWAEADR
LLSAIDPADIERVQASLARSESEGQRRMRELHGGNSGKLLVGPNLWAGVG
LVRGGAGTALVGSHAEVAERLAEYAKLGITHFILSGYPHLEEAYWFGEGV
LPLLERMGLWGTPIVGRVRRRRRRSRWPRRTDGHGSHLARAGARRARRRP
SGRRIRRAAAPPTAHRGGRQPAGHHRRVVRLLPVRHGGRAGLQQGVLPER
KFFGGNAIGVRDVCRRIRHAAHRGPGVRPHRRSDRPQAQPGADHAHHGRR
DRADRGVADGRADRGLGAGAAAGVAGAAGVRARRRVGRGGAAGRRTQPGR
PARPLRGGAAGRAGTRIGFGHRHIRFPADRAGPGPVPVLRLAHRVPVERT
AGGHRHRGAVAGGRDTGVPGTAGPAGRVHRADPGHPARAAFPA
41410110NP_962946.1 hypothetical protein MAP4012c [Mycobacterium avium subsp. paratuberculoMRVRPPCTGVPSWSRCRRRARVETFEIASPRAAAISAGIGARQRRRRRPG
PRCGGGTGGGRRRARSQARLRVLPRGTRWARRNMRTRGK
41410109NP_962945.1 hypothetical protein MAP4011c [Mycobacterium avium subsp. paratuberculoMTARSRQITQCLQYGVARRVMPAGRGIIAIMPDLTRRAVLRMGAGASLGA
AGVFALSALLDPGTARAATLPQAPAPFEPPTAGKTLPTRLTGSFVSAARG
GIKTNYVIAIPPGQTGMLRPVIALHGVDGDANQMLDMGVPDGLAQLVKAG
KPPFAVVGVDGGNTYWHKRTSGEDSGAMVLDELLPMLSTMGFDTSRVGFM
GWSMGGYGALRLGAKLGPSRTAGICAISPALYTSYATSAPGAFDSNEDFV
QNSVLGLPALNSIPLRVDCGNFDRFYFATKQFVYQLKTPPAGSFSLGGHD
IAFWRSQLPAELAWMAT
41410108NP_962944.1 hypothetical protein MAP4010c [Mycobacterium avium subsp. paratuberculoMTPRPESLASSPQPVERRGSRRGFRPDIEGLRAVAVIAVVLYHAGIPGIG
GGYIGVDVFFVISGFLITGLLFREASTTNTVALGRFYGARARRLLPAAAI
VGTVTAIGAAAVLPPLQARSVFLDGVASALYVGNYRFALRGTDYLTADAP
SPFQHYWSLGVEEQFYLVWPLLIIAVAASVRRVRPLRATPRPVPYAVVLA
LIGAASLVAGVLWTRTSPSWAFFSLPTRAWELAAGGLVALSIQQWRRLSL
RTASIARWGGLALILLTCTQLNAHTPYPGTEALLPVLGTALIIGGGAVTG
GLGPGRLLCRPAMRAIGRISYSWYLWHWPVLLLMPALLGEPAGLPARLSA
TAVSAGLAVLTLHLVENPGRFAAALRRSAKVSLVVAGGASAATACACLVL
LNVIPAPVGHGVAAPRANIIATPPSNVPAISAQEAAVRQAFAQARVILAA
AAGVRAVPSNLDPPLAQAPANKAAVFVNGCVRSWRDVGQSECATGDTASP
TTVALIGDSHAAMWNPAFEQLAGQRHWRLETLAKVTCPLAELHIVSPYLG
REYTECEQWRAQIMARMNAEHPRLVVLDMSRRYGADFGFTSYDPAWIDTL
GRTVAQLRGTGATVLVLGPSPDPHSSAPVCLSAHLDDVTACAPTRSAAID
GDGVAAEQAATLGNGGHYADLSDLFCTPDRCPLIVGNTLVFRDDNHVTTE
YARLLAPVLGALADRALAEG
41410107NP_962943.1 hypothetical protein MAP4009 [Mycobacterium avium subsp. paratuberculosMRTRRRPAMPLTVEVGVSRLATFLIGVSLLLGVGLVAYPAQLRTYETLTL
DFRLNHVAVIGDSYTTGTNEGGLGARSWPSRAWQVLSARGSRVSADVAAE
GRAGYAVTGDHGSIFEDLTARAVQSDDALVVFFGSRNDQGVDPGLLIEKT
HAALDLARRLAPAARLLVIGPPWPTADVPPSMYLIRDILGGAAGAAGATF
IDPIAEHWFVGRPDLIGADGVHPNDAGHQYMADKIAPLIRTQLST
41410106NP_962942.1 hypothetical protein MAP4008 [Mycobacterium avium subsp. paratuberculosMRRPPRPLSRAARERNSRIQTGKSNVRGGEIRGEIKALTGLRIVAALWVV
LFHFRPMLGDASPDLRDALAPVLNCGAQGVDLFFILSGFVLTYNYLDRMG
RSFSTRATLHFLWLRLARVWPVYLVTLHLAALWVIFTLHVGHVPSPDAAS
LTAISYVRQILLVQLWFVPFFDDSSWDGPAWSISAEWLAYVLFAGLVLVL
LRMKQATRARSLMVLAFAASLPPVVMLLASGHFYTPWSWLPRIVTQFTAG
ALACAAVRRLRLTDRGRRIAGYISLLLLAAMVGVLYWFGAHPISGVVEND
SGGVVDVLFVPLVISLAVGLGSLPRVLSARAMVYGGKISFCLYMVHELVH
TSWGWAVEQFELVTQDNPWKWNVIGLLAIALAGAVVLYHGVEEPARRWMR
KMVDVRAVSARSDPGEPANTKLHPIDRPLEAISARAV
41410105NP_962941.1 hypothetical protein MAP4007c [Mycobacterium avium subsp. paratuberculoMTIAGTETRHDNCVFDCDGAQVRAHHRHLATVVHIRGVIDDANVDRISHH
IRRFTLGENPVVLDVADVTQFAEAGISLLYAFDADCRAAEVEWTLVASSA
VTAVLDDTGHDASFPIMRSVHEVLRDRADAIAVRRRMALPLVKKTS
41410104NP_962940.1 hypothetical protein MAP4006 [Mycobacterium avium subsp. paratuberculosMRQGGCRETGLALTSDTTGDDVQPKRLFYEPGASWWWVACGPASAAAMVL
IEIWSGAKVSLVVPAIFLVLVSAFVGLQVKAARIHVSVELTEEALRQGTE
TILVREIVKVYPEAENNEASGKELARWQSARALGELVGVPRGRIGIGLKL
TNGRTAQAWARRHRQLRAALTPLVQERVEPSRTDVLDRDPDDDAGTAQ
41410103NP_962939.1 delta-aminolevulinic acid dehydratase [Mycobacterium avium subsp. paratMAYPRQRPRRLRSTPALRRLVAQTSLEPRHLVLPMFVADGIDEPRPIASM
PKVVQHTRDSLRAAAASAVAAGVGGLMLFGVPRDEDKDPIGSAGTDPDGI
LNVALRDLAKDLGDATVLMADTCLDEFTDHGHCGVLDDRGRVDNDATVAR
YVNLAVAQAESGAHVVGPSGMMDGQVGAIRDGLDAAGFTDVVILAYAAKF
ASAFYGPFREAVSSSLSGDRRTYQQETGNSREALREIRLDLDEGADIVMV
KPAMSYLDVVAAAAEVSPVPVAAYQVSGEYAMICAAAANNWIDERAAALE
SLTSIRRAGADIVLSYWAADAAGWLS
41410102NP_962938.1 hypothetical protein MAP4004 [Mycobacterium avium subsp. paratuberculosMTTRGRKPTPGRITYVGSGPGDPGLLTARAATVLANAALVFTDPDVPEPV
LALIGKDLPPVSGPAPAEPASNGEGSGSEQGQAQPAVISGGPDIRPALGD
PAEVAKTLTAEARTGVDVVRLVAGDPLTVDAVITEVNAIARSHLHIEIVP
GLAPTNAVPTYAGLPLGSSHTMADVRGDVDWEALAAAPGPLILQATASHL
ADAARTLIEHELAENTPCVVTAHGTTCQQRSIETTLQGLTDSAVLGGTDP
AGPLTGPLVVTIGKTVSARTKLNWWESRALYGWTVLVPRTKDQAGEMSER
LTSYGALPIEVPTIAVEPPRSPAQMERAVKGLVDGRFQWVVFTSTNAVRA
VWEKFGEFGLDARAFSGVKIACVGESTADRVRAFGISPELVPAGEQSSLG
LLDDFPPYDSVFDPVNRVLLPRADIATETLAEGLRERGWEIEDVTAYRTV
RAAPPPAETREMIKTGGFDAVCFTSSSTVRNLVGIAGKPHARTIIACIGP
KTAETAAEFGLRVDVQPETAAVGPLVDALAEHAARLRAEGALPPPRKKSR
RR
41410101NP_962937.1 porphobilinogen deaminase [Mycobacterium avium subsp. paratuberculosis MIRIGTRGSLLATTQAGGVRDALIARGHPAELVTITTAGDRSSGPIESLG
VGVFTTALREAIEEGRVDAAVHSHKDLPTADDPRFAVAAIPARNDPRDAV
VARDGLVLAELPPGSLVGTSSPRRAAQLRALGLGLEIRPLRGNLDTRLNR
VSSGDLDAIVVARAGLARLGRLGDVTETLEPVQMLPAPAQGALAVECRAG
DSRLAAVLAELDDADTRASVTAERALLAELEAGCSAPVGAIAEVVESIDE
DGRIFEELSLRGCVAALDGSDVIRASGIGTPGRARELGLSVAAELFELGA
RELMSGARHDPARGN
41410100NP_962936.1 glutamyl-tRNA reductase [Mycobacterium avium subsp. paratuberculosis K-MSVLLFGVSHRSAPVSVLEQLSIDESDHGKIVDRVLQSPLVTEAMVLSTC
NRVEVYAVVDAFHGGLAVIGQVLSDHSGMSMSDLTKYAYVRYSEAAVEHL
FAVASGLDSAVIGEQQVLGQVRRAYATAETNRTVGRVLHELAQRALSVGK
RVHSETAIDAAGASVVSVALDMADRRLGGLAGKTAVLVGAGAMGALAAAH
LSRAGIGQVHVLNRSLSRAQRLVRKIRETGVRADALPLEHLADALAGADV
VVSCTGAVSPVVSLADVHHALAAAGRSAADETAHPLVICDLGMPRDVDPA
VAGLPGVWVVDVDRVQHEPSAHAAAADVDAARTIVATEVAAYLAGQRMAE
VTPTVTALRQRAADVVEAELLRLDNRLPGLDSAHREEVARTVRRVVDKLL
HAPTVRIKQLASAPGGDSYAEALRELFELDQTAVDAVAAGELPVIATGFD
AGAPQQPTE
41410099NP_962935.1 hypothetical protein MAP4001 [Mycobacterium avium subsp. paratuberculosMTSATPRPQVELLTRDGCTICERIHARLVELAAELGFELSTTDVDAAAAA
GNPGLRTEFGDRLPVILLDGREHSYWDIDEPRLRADLAR
41410098NP_962934.1 hypothetical protein MAP4000c [Mycobacterium avium subsp. paratuberculoMGRVTRHYVPAMSDNTVRVDPVVMQGAAASLSGAAEHLSAQLGQLDDQVG
QMLGGWQGASGSAYAAAWELWHRGAREVQLGLAMLARLVGQAGEAYASNE
AGAAQAERAVRGG
41410097NP_962933.1 hypothetical protein MAP3999c [Mycobacterium avium subsp. paratuberculoMDPAALADAVQRMAEFQRYAEDMIAEIDSRVTRLHQTWTGEGAAAHAEAH
QHWVRGEAMMREALAQLGKAASTAHGNYTGAMSKNLGMWS
41410096NP_962932.1 hypothetical protein MAP3998c [Mycobacterium avium subsp. paratuberculoMAPLACDPTALDHAGATVVAAGESLGSVISTLTAALAGTSGMAGDDPVGA
ALGRRYDGAAAKLIQAMADTRNGLCSIGDGVRMSAHNYAVAEAMSDLAGR
ASALPAPQVTGPLTVGAPPSAVGHGSGAPAGWGWVAPYIGMIWPTGDSAK
LRAAAAAWATAGANFMAAETAAGGGTMAAIGAQQIPEGAAINKALADASS
ATADVARQCQTIAAQLNSYAAKVDQVHAAILDLLSRICDPLTGIKEVWDL
LTDEDEDEIKKIADDIRTVVDNFGREADTLGGQIEATVSAVAAATENMSH
WAGKEWDHFLHGTPVGRALNQVGQAFKGVGEEGWGFLKGLYEVSPNRMLL
DPVGYGKTMAGMVEGAGTLVGLGPDGVPGAFDAWKALGKDVTHWDEWGSN
PAEALGKSTFDVATLALPGGPLSKLGKFGHTAADALKGLKKPPGVPKPPE
VKPPAAPKAPDSGQPAPSGKPGPVAPSGKPAPGPADGPLPHSPTESKPPA
GGTPPAAEPPKPTAAPHSGEPKPIATPPESVGKPVTPAPAEGAPAQPHEP
VPAHAPASPGEPLATPAPAAAVPAAAAAPASAPAPAAAAAAPVPSASSVP
MGGGAPAETPSGLGDVPHGGEPGAHPVEPPHDGAPHVPGGGDGPYHPGDG
GPHGPGDGHPLADGSGPHQPGGHHPPGDGDRPPGSHPPHDGAPPDEPADG
HPPEIPTPSDLPPWHQAQLALAESPEKLVKDLIEHGCPRELAESAGANSP
YAGMTAQEILNKWWDPATGTWDWPKVEGFADGIYKTARSIPKDAWLDRIG
EVSDAKGDFMGAVGDSYPHRGLAPGSSGDYNRFHGTGKELPEGWEVRYGE
VGDAFGQPGGGTQWVVIDKNKKTVLIKWLIENGYLDWG
41410095NP_962931.1 hypothetical protein MAP3997c [Mycobacterium avium subsp. paratuberculoMTSSDPVNADPTGHVDLESLAADASAARAIEGMQEAAATQDDRPQPPIDL
TAAAFFDVDNTLVQGSSAVHFGRGLATRNYFTYSDVLGFIYAQAKFQVLG
KENSNDVAAGRRKALAFIEGRSVEQLVALGEEIYDEIIADKIWPGTRELT
QMHLDAGQQVWLITATPYELAATIARRLGLTGALGTVAESVDGVFTGRLV
GDILHGTGKAHAVRSLAIREGLNLKRCTAYSDSYNDVPMLSLVGTAVAIN
PDARLRALARERGWEIRDFRTARKAARIGVPSALALGAAGGALAALASRR
QSR
41410094NP_962930.1 hypothetical protein MAP3996c [Mycobacterium avium subsp. paratuberculoMTVPKEAEGLIGSHYRAPDYFEVGREKIREFALAVKDDHPAHFDESESAA
AGYPDMVAPLTFLAIAGRRVQLEIFTKFSIPINIARVIHRDQKFKFHRPI
LAHDRLYFDTYLDSVIESHGTVLAEIRSEVTDADGKPIVTSVVTMLGEAA
HQEADAAATAAAVASISAGKLGAI
41410093NP_962929.1 CmaA2 [Mycobacterium avium subsp. paratuberculosis K-10]MTSQGETQLKPPVEAVRSHYDKSNEFFKLWLDPSMTYSCGYWEEGAKTLE
EAQYAKRKLALDKLNLEPGMTLLDIGCGWGSTMRHAMEEYDVDVIGLTLS
ENQYAHCVAEFDKMDSPRRKEVRIQGWEEFPDEPIDRIVSLGAFEHFADG
AGDAGYERYATFFKKYYDLLPDDGRMLLHSIVVPTREEGNAMGLKVNMTL
LRFISFILKEIYPGGKLPQVNLVDKYATDAGFKIERHHFIGKNYVPTLTA
WGDALEAHKEEAIALKGQETYDIYLKYLRGCAELFRDGYTNVCQFTMVK
41410092NP_962928.1 hypothetical protein MAP3994 [Mycobacterium avium subsp. paratuberculosMAGETRANVIPLHTNRGRVAARRRADQRAESARQHPSLLSDPSGRASAEQ
IAAVVREIDDHRRAAGASSPEAPLNELAQRVAAVAGFLRQRLTGDYSVDE
FGFDPHFNSAIVRPLLRVFFRSWFRVEVSGIENLPAEGAALVVANHAGVL
PFDGLMLSVAVHDEHPAHRDLRLLAADMVFDLPVVGEAARKAGHTMACTT
DAHRLLAAGELTAVFPEGYKGLGKRFEDRYRLQRFGRGGFVTAALRTKAP
IIPCSIIGSEEIYPMLTDVKLLARLFGLPYFPVTPLFPLAGPIGLVPLPS
KWHIAFGEPIYTGDYAASDADDPMVTFELTDQVRETIQQTLYRLLAGRRN
IFFG
41410091NP_962927.1 GalE1 [Mycobacterium avium subsp. paratuberculosis K-10]MDPSNGHNSGPDDTAGNTVHYPKIVLVTGACRFLGGYLTARLAQNPMIKG
VIAVDAIAPSKDMLRRMGRAEFVRADIRNPFIAKVIRNGDVDTVVHAAAA
SYAPRSGGTAALKEINVMGAMQLFAACQKAPSVRRVVLKSTSEVYGSSAH
DPVMFTEDSTSRRPFRAGFAKDSLDIEAYARGLGRRRPDIAVTILRLANM
IGPAMDTTLSRYLAGPLVPTILGRDARLQLLHEQDALGALERAAMAGKAG
TFNIGADGIIMLSQAIRRAGRIPLPVPGFGVWALDSLRRANRYNEISRDQ
FDYLSYGRVMDTSRMRSELGYQPKWTTAEAFDDYVRGRGLTPIIDPDRVR
SLESRAIALAQRWGSRNPIPWGGVR
41410090NP_962926.1 hypothetical protein MAP3992 [Mycobacterium avium subsp. paratuberculosMTSTNGPSARDSAGKARDAGSGDGQQGRTQFLTVAEVAALMRVSKMTVYR
LVHNGELPAVRVGRSFRVHAKAVHDMLETSYFDAG
41410089NP_962925.1 pyrroline-5-carboxylate reductase [Mycobacterium avium subsp. paratuberMSAMLSGMARIAIIGGGSIGEALLSGLLRAGRQVKDLVVVERVPERAKYL
ADTYSVLITSVADAVENASFVVVAVKPADVESVMSEIARAAGQAESDTAE
QVFVTVAAGVTIGYFESRLPAGTPVVRAMPNAAVLVGAGVTALAKGRFVT
APQLEGVSALFDSVGGVLSVPESQMDAVTALSGSGPAYFFLLVEALVDAG
VAAGLSREVAADLTAQTMAGSAAMLLERMDADRRLGEAETPGLRVDATAT
QLRATVTSPGGTTAAGLRELERGGLRAAVDAAVQAAKMRSEQLRITSE
41410088NP_962924.1 hypothetical protein MAP3990 [Mycobacterium avium subsp. paratuberculosMNALFTTAMTLREAGSGVYDGELDKRWTIGPKVHGGAMLALCANAARTAC
AGGPESAQQPVAVSASFLSAPDPGPMRLVTSIRKRGRRISVVDVELTQGE
RTAVHAVVNLGEPEHFPADGSAAIAKPLLSANPVTALMPPEPPDDIEPIG
PGHPLAGLVHLGEGCDVRPVLSTMQPSADGRPPVIQMWARPRGVAPDALF
ALMCGDLSAPVTFAVDRTGWAPTIQLTAFLRGLPADGWLRIIATCTEIGH
DWFDEDHTVVDSLGRLVVQARQLALVPAAP
41410087NP_962923.1 hypothetical protein MAP3989 [Mycobacterium avium subsp. paratuberculosMRPAIKVGLSTASVYPLRAEAAFEYAARLGYDGVELMVWAESVSQDIAAV
KKLSRRYRVPVLSVHAPCLLISQRVWGANPIPKLDRSVRAAEQLGAQTVV
VHPPFRWQRRYAEGFTEQVATLEAASDVMIAVENMFPFRADRFFGAGQSL
ERMRRRGGGPGPAISAFAPSYDPLDGHHAHYTLDLSHTATAGTDSLDMAR
RMGNGLVHLHLCDGNGLPADEHLVPGRGTQPTAEVCQMLAAGHFAGHVIL
EVSTSSARSATEREAMLAESLQFARTHLLR
41410086NP_962922.1 hypothetical protein MAP3988 [Mycobacterium avium subsp. paratuberculosMTGPHSETESPGTRPISVAELLARNGTIGAPAVTRRRRRRRGDSDAVTVA
ELTGEIPVIRDDEPDDQPGATDTVDTAAPAQPVAESAEPVAEDEPKTPYW
SEPEPRWPKSPPQPKRAPGPERSAYPRPLPEPGPSANGTGRRSSGAEDMS
PDPMDHYADIPVDVMDSEVREAEPALEDSAYVRSYLQSDSALDDDLDEDL
DDDHADAATLTDEDLDAAHLEDEDAEAAHPAPGRLEAIWRGSVVVLQSIL
AVAFGAGLFVAFDQLWRWNSIVALVLSVLVILGLVVGVRVVRKTEDIAST
LIAVAVGALITLGPLALSLQSG
41410085NP_962921.1 hypothetical protein MAP3987 [Mycobacterium avium subsp. paratuberculosMRLGVLDVGSNTVHLLVVDAHRGGHPTPMSSTKATLRLAEATDSAGKITK
RGAEKLISTIDEFAKIADSSGCEELMAFATSAVREAGNSEEVLNRVRKET
GVELRVLTGVDESRLTFLAVRRWYGWSAGRIINLDIGGGSLEMSSGLDEE
PEVALSLPLGAGRLTREWLPDDPPGRRRVAMLRDWLDAELAEASENILEA
GTPDLTVATSKTFRSLARLTGAAPSGAGPRVKRTLTANGLRQLISFISRM
TTADRAELEGVSAERAPQIVAGALVAEASMRALSIESVDICPWALREGLI
LRKLDSEADGTALMEPSVRNAGGQVVDRNQNRSRGDKP
41410084NP_962920.1 hypothetical protein MAP3986c [Mycobacterium avium subsp. paratuberculoMDDVANSHPQPGQPGQEVELDFAREWVEFYDPDNPEHLIAADLTWLLSRW
TCVFGTPACQGTVAGRPDDGCCSHGAFLSDDDDRARLDDAVKQLTDDDWQ
FREKGLGRKGYLELDEHDGQPQYRTRKHKDACIFLNRPGFAGGVGCALHS
KALKLGVPPLTMKPDVCWQLPIRRSQEWVTRPDGTEILKTWVTEYDRRGW
GSGGADLHWYCTGDPAAHVGATQVWESLADELTELLGAKAYAELAAMCKR
RSKLGLIAVHPATRIAE
41410083NP_962919.1 hypothetical protein MAP3985c [Mycobacterium avium subsp. paratuberculoMDDEKRSAAAPRRRGRPGRLEVWYATLSDPRTGAGLWVHCETVAPLRGAA
YGHGWATWFPPDGPPRTGRFGPVPAHPATGPDWFACAGVRVADERLRGRA
GALAWELSWTDPTRPLWTFPRLAWERELLPGAQVVLAPTAEFTGRLHLDG
APARVEGWRGGVAHIYGHGNARRWGWMHADLGGGDVLEVVSAVSHRPGLR
RLAPLAFVRFRLDGNDWPASVLPSLRMRTRLQLPHWQLAGRIGGRRVCIR
ADLPPERCVSLGYTDPDGGTAVCTNTERADIRVEIDDRRWSVLGHAEVGL
RGAEAPAVNERIPA
41410082NP_962918.1 hypothetical protein MAP3984c [Mycobacterium avium subsp. paratuberculoMTPVPDFIVELRRRIGHAPLWLPGITAVTIRGRKVLLVKRSDNGAWTAVT
GIVEPGENPADCAAREVREETGVSARATRLAWVHVTRPAIHANGDHAQYL
DHVFRMEWLSGEPFPADDESTAAAWFDLDELPPMTADMRRRITLSANDDE
RTVFDTDGPPPARPSG
41410081NP_962917.1 RegX3 [Mycobacterium avium subsp. paratuberculosis K-10]MTSVLIVEDEESLADPLAFLLRKEGFEATVVTDGSAALAEFDRAGADIVL
LDLMLPGMSGTDVCKQLRARSSVPVIMVTARDSEIDKVVGLELGADDYVT
KPYSARELIARIRAVLRRGGDDDSEISDGVLESGPVRMDVERHVVSVNGD
TITLPLKEFDLLEYLMRNSGRVLTRGQLIDRVWGADYVGDTKTLDVHVKR
LRSKIEADPANPVHLVTVRGLGYKLEG
41410080NP_962916.1 SenX3 [Mycobacterium avium subsp. paratuberculosis K-10]MTVFSALLLAGVLSVLALAAGVAVGTRLSPRAAQRRQRISTEWTGITVAQ
MLERIVALMPLGAAVVDAHRDVVYLNDRAKELGLVRDRQLDDQAWEAAQQ
ALTGVDVEFDLRPAKRSGGRAGLSVHGQARLLSEEDRRFAVVFAHDQSDY
ARMEATRRDFVANVSHELKTPVGAMALLAEALLASADDSETVRRFAEKVL
VEANRLGDMVAELIELSRLQGAERLTNVTEVNVDSVVNEAISRHKVAADN
ANIEVRTDAPSGLRVLGDETLLVTALANLVSNAIAYSPPGSPVSISRRRR
GDNIEIAVTDRGIGIALEDQERVFERFFRGDKARSRATGGSGLGLAIVKH
VAANHNGTIGVWSKPGTGSTFTLSIPAAVASHRGDGESEQPQGRDVRPNR
SQREEELSR
41410079NP_962915.1 phosphoglyceromutase [Mycobacterium avium subsp. paratuberculosis K-10]MGETATLVLLRHGESEWNSLNLFTGWVDVGLTDKGRAEAVRSGELLAEQG
LLPDALYTSLLRRAITTAHLALDAADRLWIPVRRSWRLNERHYGALQGLD
KAETKARYGEEQFMAWRRSYDTPPPPIERGSTYSQDADPRYADIGGGPLT
ECLADVVVRFLPYFTDVIVPDLRSGKTVLIVAHGNSLRALVKHLDQMSDD
DVVGLNIPTGIPLRYDLDARLRPLVPGGTYLDPEAAAAGAAAVASQGRG
41410078NP_962914.1 hypothetical protein MAP3980 [Mycobacterium avium subsp. paratuberculosMSATVERVIEDTLQASGLTYSKHAGAHGGPSGLVVELPGERKLKTNTILS
VGEHSVRVEAFVCRKPDENHEGVYRFLLKRNRRLYGVAYTLDNVGDIYLV
GRMSLASVSGDEIDRVLGQVLEAVDSDFNTLLELGFRSSIQKEWEWRVSR
GESLKNLQAFAHLIDDDEG
41410077NP_962913.1 hypothetical protein MAP3979 [Mycobacterium avium subsp. paratuberculosMCCALGPGGEPSCKDDRVRHDDVFRLNEPRRVAVLAVHTSPLAQPGTGDA
GGMNVYVLQTALHLARRGIEVEIFTRATASADPPVQRVAPGVLVRNVVAG
PFEGLDKYDLPTQLCAFAAGVLRAEASHEPGYYDIVHSHYWLSGQVGWLA
RDRWAVPLVHTAHTLAAVKNAALAQGDSPEPPLRTVGEQQVVDEADRLIV
NTDDEARQLISIHHADPARIDVVHPGVDLDVFRPGDRRAARAALGLPLDK
DIVAFVGRIQPLKAPDIVLRAAAKLPGVRIVVAGGPSGTGLASPDGLARL
ADELGISARVTFLPPQSRPNLATLFQAANLVAVPSYSESFGLVALEAQAC
GTPVAAAAVGGLPVAVRDGVTGTLVAGHDVDHWADALAGLLRAPAPAAAA
MSRAAAAHAATFSWDHTTDALLASYRRAIREYTTERRGVGA
41410076NP_962912.1 hypothetical protein MAP3978 [Mycobacterium avium subsp. paratuberculosMGHAPGPKPHRAVRRQIVPPALHIPESAAASVFRAVRLRGPVGRDVIANV
TSLSIATVNRQVIALLEAGLLRERADLAVSGAIGRPRVPVEVNHEPFVTL
GIHIGARTTSIVATDLFGRTLDTVETPTPRNPAGPALASLADSARRYLRR
WHRRRPLWIGVAIGGTVDSATGQVDHPRLGWRQAPVGQVLADALGLPVSV
ASHVDAMAGAELLLGMRRFLPSSPTSLYVYARETVGYALVIGGRVHVPTS
GPGTIATLPAHSELLGGTGQLESTVSDEAVVAVARQLRILPFAPANRASG
SAAGIADLLRVARAGNEQARELLAERGRVLGEAVALLRDMLNPDELVVGG
QAFTEYPEAMEQVEAAFAARSVLGPRDIRLTAFGNRVQEAGAGTVSLSGL
YADPLSAMRRAGALDARLREVARDESSA
41410075NP_962911.1 hypothetical protein MAP3977c [Mycobacterium avium subsp. paratuberculoMVGTGRNERVAVVTGASSGIGEATARTLAAQGFHVVAVARRAERIHALAN
EIGGTAIVADVTDDAAVAALASKLSRVDVLVNNAGGARGLEPVAEADLEH
WRWMWETNVIGTLRVTRALLPKLVDSGDGLIVTVTSVAALEVYDGGAGYT
AAKHGQGALHRTLRGELLGKPVRLTEIAPGAVETEFSLVRFDGDQQRADA
VYTGITPLVAADVAEVIGFVASRPAHVNLDLIVMKPRDQASASRFNRRG
41410074NP_962910.1 hypothetical protein MAP3976 [Mycobacterium avium subsp. paratuberculosMIFVTPSSAPRPFNRRVALATLGIGALAPGVLAACGGGTAKEAEKKEQPA
LRLKYQPADAAQNVVPTAPVSVEVSDGWFQHVTLSNSSGKAVAGTFNSDR
TVYTTTEPLGYDQTYTWSGSAVGHDGKTVAVAGKFSTVSPSKKISGAFQL
ADGQTVGIAAPIILQFDAPISDKAAVEKALTVTTNPPVEGSWAWLPDEAQ
GARAHWRTREYYPAGTTVNVQAKLYGLPFGDGAYGAEDISLNINIGRRQI
VKAEVSSHRIQVIRDEGVIMDFPCSYGEADKARNVTRNGIHVVSEKYADF
YMSNPAAGYSHVHERWAVRISNNGEFIHANPASAGAQGNTNVTNGCINLS
TSDAEQYYQSAIYGDPVEVTGSSIQLSYADGDIWDWAVDWDTWVAMSALP
PPTAHPPSTQIPVTAPVTPSNAPTLSGTPTTSTTTPASTGPATPGG
41410073NP_962909.1 UDP-N-acetylenolpyruvoylglucosamine reductase [Mycobacterium avium subsMKSSGAGAAFAGASVADAAPLAPLTTLRVGPTARRLITCASSEQVIATLR
RLDTERLAGQRDPVLVFAGGSNLVISDALSDLTAVRLANDGITVEGNLVR
AQAGAVWDDVVLTAIEHGLGGLECLSGIPGSAGATPIQNVGAYGAEVSDT
LTRVRVLDRGSGQVRWVPGTELEFGYRTSVFKRRADDGLEIPSVVLEVEF
ALDASGRSAPVRYGELAAELKVPVGQRADPRTVREAVLALRARKGMVLDA
ADHDTWSVGSFFTNPVVAPDVYERLAGSVDGPVPHYPAPGGVKLAAGWLV
ERAGFGKGYPVPDPGGPEAPCRLSTKHALALTNRGTARSDDVIALARTIR
DGVRSVFGITLVPEPVLLGCRL
41410072NP_962908.1 hypothetical protein MAP3974c [Mycobacterium avium subsp. paratuberculoMPRSFDLSAHYDGSVDEVHRAFTDADYWRARLASSGVDVATLESMRVGGQ
SGDEDVVEVVTLQVIRSDKLPGMVTQLHSGDLCIRREETWGPVTGGTATG
SVVGSIVDAPVNLAGDAVLEPAEDTGGARLTFRATVQVRVPIIGGKLENF
IGARLAELIAAEQRFTTEWIAQTA
41410071NP_962907.1 hypothetical protein MAP3973c [Mycobacterium avium subsp. paratuberculoMRIALAQILSGTDPAANLALVGEYTRRAAGAGARLVVFPEATMCRFGVPL
APIAEPVDGPWADGVRRIATEANVTVIAGMFTPSGDGRVKNTLLVANSDD
QAVTHYDKIHLYDAFGFTESRTVAPGREPVVVGVDGVRVGLSVCYDIRFP
ELYTELARRGAQLIAVCASWGAGPGKLDQWTLLARARALDSMSYIAAAGQ
ADPGEILSASGAPTGVGGSLVASPLGEVVASAGAQPQLVLADIDVDRVAQ
ARKTIAALSNRSDFAQVGRAESVG
41410070NP_962906.1 hypothetical protein MAP3972c [Mycobacterium avium subsp. paratuberculoMTNPQGPPNQDPSTWGRPANQGPYGQPPTERPTERINTGGPGQAPGQVPP
PPPAPAPPPPGQTERFGAPRPQMQQPGYPPPPTPPAGPTERLATAPNPDN
GPAKKKRRFLRDPVSVLLIFIIVFALLIAGFIGAELYVRHVADTKVAQAV
ACEVKDQATASFGVTPLMLWQQATKHYTNISVQTAGNNIRDAKGMKLSIN
INDVRLKDNGNSKGTIGALDATIDWTTDGIKQSVQNAIPVLGPFVTNTVT
THPADGTIELKGMLDNITAKPVISGTGLQLQIVSFNALGFTMPKESVQST
LDDFTSNLTKNYPLGIHADSVQVTDKGVTSHFSTRNAAIPTGNNNDPCFA
NL
41410069NP_962905.1 deoxyribose-phosphate aldolase [Mycobacterium avium subsp. paratuberculMTPTRAQLAAFVDHTLLKPEATAADVAALVTEAAELGVYAVCVSPTMVPA
AVQAGAGVRVASVAGFPSGKHVSAVKAHEAALAVASGAAEIDMVIDVGAA
LAGDLDGVRADIAAVRDAVGGAVLKVIVESSALLALADEHTLVRVCRAAE
DAGADFVKTSTGFHPTGGASVRAVALMAEAVGGRLGVKASGGIRTAADAL
AMLDAGATRLGLSGTRAVLDGLG
41410068NP_962904.1 hypothetical protein MAP3970 [Mycobacterium avium subsp. paratuberculosMRVPLAAPAALLLALCWPIAPAAAPDPGAGTADPPFIDHTDWAQWQGRSS
LRVFPTPAGRTAAKTPGSMAMADEAWAEVLALAPDADTAGMRAQFLCHWQ
FAELGRPGKLSWNLEPWRPVVDDAEMVASGCNPGGPEESFG
41410067NP_962903.1 hypothetical protein MAP3969 [Mycobacterium avium subsp. paratuberculosMLVLQIAVLVTAIYAFVHAALQRPDAYTAADKLTKPVWLLILGGAVALTS
VLGYVFGVLGMAIAACAAGVYLVDVRPKLLEIQGKSR
41410066NP_962902.1 hypothetical protein MAP3968 [Mycobacterium avium subsp. paratuberculosMKGTTMAENPNIDDLRAPLLAALGAADLALATVNDLIANLRERAEETRAE
TRTRVEERRARLTKFQEDLPEQFTELRDKFTTEELRKAAEGYLEAATNRY
NELVERGEAALQRLRSQTAFEDASARAEGYVDQAVELTQEALGTVASQTR
AVGERAAKLVGIELPGKAEAAGKKAQKAIAKAPAKKAPAKKVTQK
41410065NP_962901.1 hypothetical protein MAP3967 [Mycobacterium avium subsp. paratuberculosMAPEEKLSAKVSNAASDMASDIGSFIRSQRELAQVSVRQLAEKSGVSNPY
LSQVERGLRKPSADVLNQIAKALRVSAEVLYVRAGILEPSDKSQVRDAIV
TDTAITERQKQILLDIYASFTQQNEATHEECPTQPDSE
41410064NP_962900.1 hypothetical protein MAP3966 [Mycobacterium avium subsp. paratuberculosMSSHQSAGKIDDGVVAHRASGRTSFAESFAGADPQADAQRRVALRRMKAV
ALSFLIGATGLFLACRWAQAQPGVGAWVGYVGAAAEAGMVGALADWFAVT
ALFRHPLGIPIPHTAIIKRKKDQLGEGLGTFVRENFLSPEVVETKLRDAQ
VSGRLGKWLSEAAHAERVAGETATVLRVLVELLRDEDVQQVIDRMIVRRI
AEPQWGPPVGRVLATLLAENRQEALIQLLADRAFQWSLNAGEVIQRVVER
DQRVVERDSPTWSPRFIDHLVGDRIHRELMDFTDKVRRNPDHELRRSATR
FLFEFADDLQHDPDTIARADAIKEQLMARDEIANAAATAWKTLKRLVLEG
VDDPSSALRSRIADTVVRIGESLRDDADLRDKVDNWLVRAAQHLVSQYGV
EITAIITDTIERWDAEEASRRIELHVGRDLQFIRINGTVVGSLAGLVIYA
VAQLLF
41410063NP_962899.1 hypothetical protein MAP3965c [Mycobacterium avium subsp. paratuberculoMAEQITAASVKMDGRKRRWHQHKVDRRNELVDGTIDAIRRLGGALSMDEI
AAEIGVSKTVLYRYFVDKNDLTTAVMMRFTQTTLIPNMAAALTSGLDGFD
LTREVIRVYVETVANEPEPYRFVMSNSSASKSKVIADSERIIARMLAVLM
RRRMQHAGMDTGGVEPWAYLIVGGVQLATHSWMSYPRMSRDELIDYLTML
SWNALKGIVEVGGSLEKFREEPHPSPIVPPREAAL
41410062NP_962898.1 UmaA2 [Mycobacterium avium subsp. paratuberculosis K-10]MSVQLTPHFGNVKAHYDLSDDFFRLFLDPTQTYSCAYFERDDMTLEEAQI
AKIDLALGKLKLEPGMTLLDIGCGWGATMRRAIEKYDVNVVGLTLSENQA
EHVQKTFDAMDTPRTRRVLLEGWEKFHEPVDRIVSIGAFEHFGRQRYGRF
FRMAYDVLPPGGIMLLHTIVRPSFKDARAKGMKLTHEIVEFSRFILAEIF
PGGWLPTPQTVGEYGVTAGFDLTRVQSLQLHYARTLDLWAQALEANREQA
IAIQSQEVYDRYMKYLTGCAKLFREGYTDVNQFTMEKK
41410061NP_962897.1 UmaA1 [Mycobacterium avium subsp. paratuberculosis K-10]MTGLEPYYEESQSIYDVSDEFFALFLDPTMAYTCAFFERDDMTLEEAQTA
KFDLALGKLNLEPGMTLLDIGCGWGGALKRALEKYDFNVIGITLSRNQFE
YSKKLLAGFPTDRNIEVRLQGWEEFDDKVDRIVTIGAFEAFKMERYSAFF
DRAYDILPDDGRMLLHTILTYTQKQQHERGVSITMSDLRFMRFIGQEIFP
GGQLPAQEDIFKFGEAAGFSVERVQLLREHYARTLNIWAANLEANKDKAI
AIQSQAVYDRYMHYLTGCENFFRKGISNVGQFTLVK
41410060NP_962896.1 3-hydroxybutyryl-CoA dehydrogenase [Mycobacterium avium subsp. paratubeMSDAAIQRVGVVGAGQMGSGIAEVSVRADVDVTVFETTEALITAGRNRIV
KSLERGVSAGKVTERERDRALSKLTFTTDLKDLADRQLVIEAIIEDDAVK
AQVFAELDRVVTDPDAVLASNTSSIPIMKLAAATKNPQRVLGLHFFNPVP
VLPLVELVSTLVTDEAAAARTEEFASAVLGKQVVRCSDRSGFVVNALLVP
YLLSAIRMVEAGFATVEDVDKAVVAGLSHPMGPLRLSDLVGLDTLKLIAD
KMFEEFKEPQYGAPPLLLRMVEAGRLGKKTGQGFYTY
41410059NP_962895.1 isocitrate lyase [Mycobacterium avium subsp. paratuberculosis K-10]MPTSVVGTPKSAEEIQKDWDTNPRWKDVTRTYTAEDVVALQGTVVEENTL
ARRGAEVLWEQLHDLEYINALGALTGNMAVQQVRAGLKAIYLSGWQVAGD
ANLSGHTYPDQSLYPANSVPTVVRRINNALLRADQIAKVEGDTSVKNWLA
PIVADGEAGFGGALNVFELQKAMIAAGVAGSHWEDQLASEKKCGHLGGKV
LIPTQQHIRTLTSARLAADVCDVPTVVIARTDAEAATLITSDVDERDQPF
ITGERTKEGFYRVRNGLEPCVARAKAYAPYSDLIWMETGTPDLELAAKFA
EGVKAEFPDQMLAYNCSPSFNWKKHLDDATIAKFQKELAAMGFKFQFITL
AGFHALNYSMFDLAYGYARNQMTAYVELQEREFAAEERGYTATKHQREVG
AGYFDRIATTVDPTSSTTALTGSTEEGQFH
41410058NP_962894.1 hypothetical protein MAP3960 [Mycobacterium avium subsp. paratuberculosMSLDKQMMPVPDGHPDVFDREWPLRVGDIDRTGRLRLDAAARHIQDIGQD
QLREMGFEETHPLWIVRRTMLDLIRPIEFNDMLRLRRWCSGTSNRWCEMR
VRIDGRKGGLIESEAFWININRETQMPSRIADDFLAGLHKTTSVDRLRWK
PYLKPASRDDAVEIHEFPVRVTDIDLFDHMNNSVYWSVIEDYLASHTELM
RTPLRVTIEHEAPVALGDKLEIISHVHPAGSTDQFGPELADRTVTTLTYA
VGDEAKAVAAIFAR
41410057NP_962893.1 hypothetical protein MAP3959c [Mycobacterium avium subsp. paratuberculoMPTTCAEHQSRRGHRGCQLCEPGLHRPGNLGGVSKTFVGSRVRQLRHERG
FSQAALAQMLEISPSYLNQIEHDVRPLTVAVLLRITEVFGVDATFFSSQD
DTRLVAELREVTMDRDLDIDVDPTEVAEMVSAHPGLARAVVNLHRRYRIT
TAQLAAATEERFFDGSGTGSITMPHEEVRDYFYQRQNYLHELDTAAEDLT
IKMRLHHGDLARELTRRLTEVHGVHINRRIDLGDTVLHRYDPETKTLEIS
NHLSWGQQVFKMAAELAYLEFGDLIDSLVAQGKFTSEESHKLARLGLANY
FAAAAVLPYRQFHDVAENFRYDVERLSSFYSVSYETIAHRLSTLQRPSMR
GVPFSFIRVDRAGNMSKRQSATGFHFSSSGGTCPLWNVYETFANPGKILV
QIAQMPDGRNYMWVARTVERRAARYGQPGKTFAIGLGCELRHAHRLVYSE
GLDVSGGPGTVATPIGAGCRVCERDNCPQRAFPALGRALDLDEHRSTVSP
YLVKQS
41410056NP_962892.1 hypothetical protein MAP3958c [Mycobacterium avium subsp. paratuberculoMTAPRIPAGRFRQLGPINWVIAKLGARTVGAPEMHLFTTLGQRRLLFWTW
LAYGGRLLRGKLPTADTELVILRVAHLRGCEYELQHHRRMARTAGLDPDL
QAAIFAWPQRLEPVQARLTVRQQALLAATDEFVNDRTVSEATWRQLAEHL
DRRQLIEFCLLASQYDGLAATMSALAIPLDHPEGS
41410055NP_962891.1 hypothetical protein MAP3957 [Mycobacterium avium subsp. paratuberculosMLRTLTPQTIAAALGGLATGYVLWLLAISNGDNATVGQWGPLVLVASVVL
GGAAAVWGAWQRRRGSRPRAAFAFALPVLPVLLTLAILADVYL
41410054NP_962890.1 dihydrolipoamide dehydrogenase [Mycobacterium avium subsp. paratuberculMTSHYDVVVLGAGPGGYVAAIRAAQLGLSTAIVEPKYWGGVCLNVGCIPS
KALLRNAELAHIFTKEAKTFGINGEATFDYGAAFDRSRKVAEGRVAGVHF
LMKKNKITEIHGYGRFTDPHTLAVELNDGGTETVTFDNAIIATGSSTRLV
PGTSLSANVVTYEEQILSRELPESIIIAGAGAIGMEFGYVLHNYGVEVTI
VEFLPRALPNEDADVSKEIEKQFKKLGVKILTGTKVESISDDGSQVTVVV
SKDGNSQELKAAKVLQAIGFAPNVEGYGLEAAGVALTDRKAIGITDYMRT
NIEHIYAIGDVTGKLQLAHVAEAQGVVAAETIAGAETLALGDYRMMPRAT
FCQPNVASFGLTEQQARDEGHDVVVAKFPFTANGKAHGVGDPSGFVKLIA
DANTVSCWAGTWSATTSPSCCRSSPWRRSGT
41410053NP_962889.1 hypothetical protein MAP3955 [Mycobacterium avium subsp. paratuberculosMADDKDASSPGTEAFVPDFSDDDDAADTGTQSWAPDFDDDAEDDDAEAAE
PAAEREPEPEPEPEPEPAGFAGPVPPVAVPGRYFYVKWWKLVLVLLAVWA
ASAVIGLGLFSWWYHSIDKTPALFAVLVFVMVCVVGGVMLAMVEARPLIS
ALAVAVLSGPFAALAAAAPLYGYYYCARVGHCLVGVVPY
41410052NP_962888.1 hypothetical protein MAP3954 [Mycobacterium avium subsp. paratuberculosMIPLPRPWVLAGAMLIGSAVGLLAGVAFTVAVQAHVRPDLAIAAVVGIPS
VIGLALILFSGRRWVTTLGAFVLAVAPGWFGVLVALRVTAGG
41410051NP_962887.1 hypothetical protein MAP3953 [Mycobacterium avium subsp. paratuberculosMEPRPPSGVVITAAAAEVLARLQRQHGPVMFHQSGGCCAGSSPMCYPVGD
FLVGDRDVLLGVLDVGADGVPVWISGPQYAAHYRDKHTQLVIDVVPGRGG
GFSLEAPDGVRFLSRGRVFSAAEQAAVAAAPIITGADYQRGERPAARGAV
VADAACRTCP
41410050NP_962886.1 hypothetical protein MAP3952 [Mycobacterium avium subsp. paratuberculosMTVFARPGSAGALMSYESRYDNFIGGQWVAPARGRYFENPTPVTGQTFCE
VARSDEADVDKALDAAHAAAPAWGKTAPAERAAILNKIADRIEENLESLA
VAEVWDNGKPIREALAADIPLAADHFRYFAGALRAQEGSLSQIDDDTVAY
HFHEPLGVVGQIIPWNFPILMGAWKLAPALAAGNAVVLKPAEQTPVSVLY
LMSLIGDLLPPGVVNVVNGFGAEAGKPLASSNRIAKIAFTGETTTGRLIM
QYASQNLIPVTLELGGKSPNIFFSDVMAKADDYQDKALEGFTMFALNQGE
VCTCPSRSLIQADIYDEFLELAAIRTKAVRQGDPLDSETMLGSQASNDQL
EKVLSYIAIGKDEGATIITGGERAELGGDLSGGFYMQPTIFAGNNKMRIF
QEEIFGPVVAVTSFTDYDDAISIANDTLYGLGAGVWSRDGNTAYRAGRDI
QAGRVWVNCYHAYPAHAAFGGYKQSGIGRENHKMMLDHYQQTKNMLVSYS
NKAQSFF
41410049NP_962885.1 hypothetical protein MAP3951c [Mycobacterium avium subsp. paratuberculoMTSHARTDAAAEYDPYLWLEDMTGEQALDWVRARNEPTLARFRDAEFERM
RVEALEVLDTDARIPYVVRRGEHLYNFWRDADNPRGLWRRTTLDSYRTDA
PEWEVLIDVDELGRADGEKWVWAGAAVIHPEYTRALISLSRGGSDACIVR
EFDMQTKQFIDDGFALAEAKSQLSWEDPDTVLVGTDFGPGTLTESGYPRV
VKRWRRGTPLDEAQTVFEGARSDVNVVASVSRIPGFGRTLIGRALDFWNE
EVYELRGGQLVRIDTPTDASVSLHRRWLLVELRSDWTLGTRTYAAGSLLA
ADYEEFLSGARDFRVVFEPDEHTALNHYAWTEDRLLMVTLVDVASRVEIV
RPGDWRREPVAGIPAATNTVVVSADDTGDEFFLDSSGFDSPSRLMRGTDD
GRLEQLKTAPAFFDAENISVAQYFVDSTDGTPIPYFVVRPTGPAADRPGP
TLLYGYGGFESSNTPGYSGVLGRLWLARGGTYVLANIRGGGEYGPGWHTQ
AIREGRHKVHEDFAAVATDLVDRGITTVAQLGAQGGSNGGLLMGIMLTKY
PEKFGALVCSVPLLDMKRYHLLLAGASWVAEYGDPDNPDDWAFISEYSPY
QNISATRRYPPVLITTSTRDDRVHPGHARKMAAALEAAGHRVYYYENIEG
GHAGAADNEQVAFKSALTYSFLWQTLGRP
41410048NP_962884.1 hypothetical protein MAP3950c [Mycobacterium avium subsp. paratuberculoMSAQRIELTLLATGLIFILVSAAQARYRFINDRRAGRRFYWATSVIGIVC
FAFGTGRLWPNGVLAAAIFAAVVAFSAYLTTPYLKINGRIYASSPENREP
DP
41410047NP_962883.1 enoyl-CoA hydratase [Mycobacterium avium subsp. paratuberculosis K-10]MPSDFETLLYTTAGPVATITLNRPEQLNTIVPPMPDEIEAAVGRAERDPA
IKVIVLRGAGRAFSGGYDFGGGFQHWGEAMMTDGRWDPGKDFAMVSARET
GPTQKFMAIWRASKPVIAQVHGWCVGGASDYALCADLVIASEDAVIGTPY
SRMWGAYLTGMWLYRLSLAKAKWHALTGRPLTGVQAAEIELINEAVPFER
LEARVAEVAAELARIPLSQLQAQKLIVNQAYENMGLASTQTLGGILDGLM
RNTPDALEFIKIAETRGVRAAVERRDGPFGDYSQAPPELRPDPSHVIVPD
RDG
41410046NP_962882.1 hypothetical protein MAP3948c [Mycobacterium avium subsp. paratuberculoMSRLSRGLRAGAAFVALGVTAAIFPSTAVADSTEDFPIPRRMINTTCDAE
QILAATRDTSPVYYQRYMIDFNNHPNVQQATIDKAHWFYALSPQDRRNYS
ENFYAPPRPIRCGRPGPTT
41410045NP_962881.1 MmpL4_7 [Mycobacterium avium subsp. paratuberculosis K-10]MSEPVEAAPRVDQPLIPPFLPRMIHRLALPIVLVWLGIVFITNTVAPQLE
VVAKTHSVSMSPTDAASFQSMMKVGATFKEFNSDNSAMILLEGDKPLGAE
AHRYYDEIVRRVEQDKKHVQHVQDFWSDPLTAAGSQSHDQKAAYVQVYLA
GNMGGGLANESALAVRKIVDSVPAPPGIKAYVTGAGPLFADQSHAGEKGV
AVVTLITFVVIIVMLLVVYRSIITVAVMLGMVFIELAAARGVVATLGNYG
VMGLSTFANNMLVLMAIAAGTDYAIFVVGRYHEARGLGETREQAFYTMFH
STAHVVLGSGLTIAGAMYCLSFCRLPYFQSLGVPCAVGMLVAVLAALTLA
PAMLTVASFFKLMDPKRTLQTRGWRRMGTAVVRWPAPVLAVTIAVALVGL
LALPGYKTDYDNRHFLPADTPANVGYAAADRHFDQARLNPELLMIETDHD
LRNPADFIVLDKVAKAVFHIPGIGRVQTITRPLGTPLDHSTLGFQMGAQA
AGRLQTQHYQEEQANNLLKQADELRKTMATLHEQMQVTQDLSNTTHETTR
LTKETVQITERLRDDIANFDDFLRPIRSYFYWEKHCYDIPVCWALRSVFN
ALDGIDQVAENIVNLSANLDKLDRIQPKLVALIPPQIESQQRNLDTIMSN
YAITQGLNDQAKAQADNATAQGDAFDKAKNDDTFYLPPEAFKSPDFARGL
KNFISPDGRAVRLIISHEGDPASPEGIRHIEPIKQAVHEAIKGTPWEGAK
VYLGGTAATYKDMHDGSNIDLLIAGIAAATLIFIIMLVITRSVVAAFVIV
GTVLLSLGASFGLSVLLWQYILGLKLHWMVLAMAVILLLAVGSDYNLLLI
SRFKEEIHAGLKTGTIRAMAGSGSVVTSAGLVFAATMATFMFSPLLVMAQ
VGTTIALGLLFDTLIVRSFMTPSLATLLGRWFWWPQHVRPRPASTMLRPY
GPRRAVRELILADVDEHPPGGVVQPR
41410044NP_962880.1 hypothetical protein MAP3946 [Mycobacterium avium subsp. paratuberculosMNKQDSAGREGGETARQRARKKGFLGRFWLVLTIAAVVALSGFVVYRLHG
IFGVHPGSFGGGTSGEVLDEFNAKTITLQVWGPPGSTATINYLDENSHPQ
QALNVPLPWSKVLSSTKPGIPANLVAQGDGSWIACQFVVNKHDGSGDVIK
TPNRSDPNQTVNAFVYCLDKSA
41410043NP_962879.1 hypothetical protein MAP3945 [Mycobacterium avium subsp. paratuberculosMRYARPVAQLTFQRARTEEKKRQRAEALVEAARSLALETGVASVTLTAVA
RRAGIHYSAVRRYFTSHKEVLLHLSAEGWVRWSNTVSDKLAQPGAATPSR
IAETLADALADDPLFCDLLANLHLHLEHEVDAERVVEVKRISTAATLSLA
DSIQRALPELGRSGSLDILLAAYSLAATLWQVANPPERLTDAYAEEPEVV
PPEWNLDFASALTRLLTATCIGLIPQSA
41410042NP_962878.1 hypothetical protein MAP3944c [Mycobacterium avium subsp. paratuberculoMYNARGVICRGPLSPAATRQAGRVQTIALIGFLGGLITGISPCILPVLPV
ILLSSMDGDRRGVGSAARPYLVIAGLVCSFSVATLIGSALLTALHLPQDA
IRWTALVVLTVIGLGLIFPPLQQLIERPFAYLPQRQSRPGADGFGLGLTL
GALYVPCAGPVLAAIVVAGGTSSIGPGALVLTATFAAGNALPLLAFALAG
RRVAQRVAAFRRRQRAIQVAGGIAMIVLAVALVFNLPAMLQRAVPDYTTA
MQNRLGANDIQRSLSPAGPPPTQGGALQLSPDDVTGGGALSDCSDGSAEL
QRCGPAPALTGITGWLNTPDGKPLDPAVVRGKVILIDFWAYSCINCQRAI
PHVIDWYDRYHDSGFLVIGVHTPEYAFERVPGNVASGAADLHIGYPIALD
NDYATWNNYQNLYWPAEYLIDATGQVRHTKFGEGDYDGTERLIRELLTAA
HPGARLPAPANTADTTPQSRLTPETYLGVGKAGNYGGTGDYRSGTATLSY
PATLGEDRFALRGRWTLDDQGATAAGDDCAVRLNYTAKDVYAVVGGTGTL
TVTRDGTTTTTPIGGAPTLHRIVADDSAHRDQLDMRVSPGLQVFSFTFG
41410041NP_962877.1 hypothetical protein MAP3943 [Mycobacterium avium subsp. paratuberculosMAVPAGWVQLHVVDADGYAALARRAAADPALQSAMAAELTTRAMALIAEH
GGGRYPVDGTQVHDAAAAFTAGPAFPPLFAQANRAAHAWLFDESGAGGGQ
WAVDVAPMLDDPSIRPLLRRHNVAVPAKLTVPLTVSVPRQGRLSGLTRWG
PWLSLGSAALCGVGALLTLAAARRRGKALSGLGVAALLVGAAGWAGLEAA
GRYVNDALNHTTGNVRRIAEVMVAHAESGVHQWLDATLLAGAALAGLGVL
VAVLGGLAGAASRR
41410040NP_962876.1 hypothetical protein MAP3942 [Mycobacterium avium subsp. paratuberculosMRADSDAVTRELLRDAFTRLIEHVDELTDGLTDKVSGYRPTPDANSIAWL
IWHSARVQDIQLADIAGVEQVWTRDGWVDRFGLDLPRNDTGYGHSPEDVA
KVRAPADLLSGYYHAVHELTCEYIAGVTAGELSRVVDTNWDPPVTASARL
VSIIDDCAQHLGQAAYVRGIQ
41410039NP_962875.1 hypothetical protein MAP3941 [Mycobacterium avium subsp. paratuberculosMIDHVGINCANYAESQRFYDAVLGTLGFSRQLDVGPAIGYGRAGKPTFWI
SDALAGPNREVHLAFEAADEDAVRAFHRAAVDLGAEVLHPPRLWPEYHPG
YFGAFVRDPDGNNVEAVWHGA
41410038NP_962874.1 hypothetical protein MAP3940c [Mycobacterium avium subsp. paratuberculoMTYDLIIRNGSIVDGLGGEPYVGDVAVRDGVIAAVGAVNGATANREIDAT
GRLVTPGFVDLHTHYDGQAVWSERLTPSSAHGVTTVVMGNCGVGFAPCRQ
SDHDVLVDVMAGVEDIPGVVMTDGLPWTWETFPEYLDTLEAGKRDIDVAA
YLPHSPLRVYVMGQRGADREPATAEDLAKMRALAKEAVEVGALGFASSRL
TIHKTESGSPIPSYDAAREEIEQIARGVVDGGGGLLQFVPDIPADGYQPV
LQTVFDVAEDVGLPLTFTLVVANSGDPTWPDAITMIEKANAAGGDITAQL
LPRPIGLIIGLQLSANPFVLYPSYREIAHLPLAERVAQMRKPEVRARILA
DKPGEGHPILYVAQMWDWIYPLGDNPDYEPDPSTSIAARARARGVDPMEE
AYDRLLDDDGRAMLLVATSNLQGNSLDTVGELLHRDDVVLGLGDGGAHYG
MICDASYSTYFLTHWARDRKSGRFSVADAVRRLTSVPARVAGLGDRGRIA
VGYKADLNVIDHAALRLHKPVISHDLPAGGRRLDQTADGYVATIVSGEII
AENGVPTAARPGKLVRGRRPGPAPLR
41410037NP_962873.1 hypothetical protein MAP3939c [Mycobacterium avium subsp. paratuberculoMTNPHFAWLPPEVNSALIYSGPGPGPLLAAAAAWDGLAEELASSAQSFSS
VTSDLASGSWQGASSAAMMTVANQYVSWLSAAAAQAEEVSHQASAIATAF
EVALAATVQPAVVAANRALVQALAATNWLGQNTPAIADIEAAYEQMWASD
VAAMFGYHADASAAVAKLPPWNEVLQNLGFSNASTAVTRPAGSGAVARGY
TSRIAGFLAPRAPQ
41410036NP_962872.1 hypothetical protein MAP3938c [Mycobacterium avium subsp. paratuberculoMRSKKKVDLQALADALADYPYAYLITVDDDYRAHTVTVEPVLRESILDVG
LIGGRTQQNLARRRDVTLLWPPTEPGGYSLIVDGTAQVSEAGDAVRLAVA
PTRALLHRDADSADAAKGCLHDCVVFSLPA
41410035NP_962871.1 hypothetical protein MAP3937 [Mycobacterium avium subsp. paratuberculosMRTRYRKVFRDVYIAKDAELTPAGKARAAWLSTGATLAGLSAAAIHGTKW
LDAAAPAEIVRADRHGQRGILVRSYTLADDEADSVSGMRVTTAARTAFDI
GCGLPAAKALPILDALLNATGIKPADVVAVADRHRGARGIRRLRASLELA
DGGAESPQETRLRVLLVRAGLPKPQTQIELRELRVRVDMGWREWKVAVEY
DGIQHWDDPYQRAWDIERIALLEAAGWAVIRVSAAMLSRPQVIVERVTAK
LAERGAYGRPRASSRA
41410034NP_962870.1 molecular chaperone GroEL [Mycobacterium avium subsp. paratuberculosis MAKTIAYDEEARRGLERGLNALADAVKVTLGPKGRNVVLEKKWGAPTITN
DGVSIAKEIELEDPYEKIGAELVKEVAKKTDDVAGDGTTTATVLAQALVR
EGLRNVAAGANPLGLKRGIEKAVEKVTETLLKSAKEVETKDQIAATAAIS
AGDQSIGDLIAEAMDKVGNEGVITVEESNTFGLQLELTEGMRFDKGYISG
YFVTDAERQEAVLEDPFILLVSSKVSTVKDLLPLLEKVIQAGKPLLIIAE
DVEGEALSTLVVNKIRGTFKSVAVKAPGFGDRRKAMLQDMAILTGGQVIS
EEVGLSLESADISLLGKARKVVVTKDETTIVEGAGDSDAIAGRVAQIRTE
IENSDSDYDREKLQERLAKLAGGVAVIKAGAATEVELKERKHRIEDAVRN
AKAAVEEGIVAGGGVALLHAIPALDELKLEGEEATGANIVRVALEAPLKQ
IAFNGGLEPGVVAEKVRNSPAGTGLNAATGEYEDLLKAGIADPVKVTRSA
LQNAASIAGLFLTTEAVVADKPEKAAAPAGDPTGGMGGMDF
41410033NP_962869.1 hypothetical protein MAP3935 [Mycobacterium avium subsp. paratuberculosMRSSLPVSIAKVEASEDVRVRRLLDAQDKAAQLFDEIERRGMIRPGVAER
QLSDEIHDLAGAMFGVRQHWHRRIVRAGPNTLQPFQERPPDRTIAADDIV
FLDLGPVFEEWEADFGRTFLLGDDPHKKAVRDALPRVWQAGRDYFAGHPD
VTGAELFDAVVAVARAEGFEWGSHIAGHLIGEFAHKKIAGPGIEWYIMPG
SDKPMRRTDPRGRTCHWILEIHLVDRRRGFGGFYEQLLDLP
41410032NP_962868.1 hypothetical protein MAP3934c [Mycobacterium avium subsp. paratuberculoMLTGRLDLMSLVVPPYPPARYTKDQPETSAWLKRADEPPDYQTAGVKYHY
LANQHDTAGDYGLYRVDIAPAGGGPGPHFHRAMSEAFFVLSGTMKLYDGT
EWTDGHQGDFLYVPPGGVHGFRNEADDPASILMLFAPGAPREAYFEGFAA
LADMTDEERREWFARHDNFWVQ
41410031NP_962867.1 short chain dehydrogenase [Mycobacterium avium subsp. paratuberculosis MAPHDKQHRDWSEADVGDQSGRVVVITGANTGIGYETAAVLAHRGAHVVL
AVRDLEKGNAALSRIVAASPNADVTLQQLDLASLASVRSAAEALRAAYPR
IDLLINNAGVMWTPKQVTEDGFELQFGTNHLGHFALTGLLLDHLLGVRDS
RVVTVSSLGHRLRAAIHFDDLHWERRYDRVAAYGQSKLANLLFTYELQRR
LAAAPDAKTIAVAAHPGGSNTELARHLPGIFRPVQAVLGPVLFQSPAMGA
LPTLRAATDPAVQGGQYYGPDGFLEQRGRPKLVESSAQSHDEQLQRRLWA
VSEELTGVHFPV
41410030NP_962866.1 MoaA3 [Mycobacterium avium subsp. paratuberculosis K-10]MRSVAEHQRVVAGLIRARPPVAVPLAQAQGLVLADDVVAGLALPVFDNSA
MDGYAVRAEDTAGATPERPVVLPVAEDIPAGRTDELTLQPGTAHRIMTGA
PVPAGATAVVPVEDTDGGVDVVSIRASREPGKHIRRAGEDVSPGTTVLRR
GQVVTPAVLGLAAALGIAELSVIPRQRVLVISTGSELVAPGAALRPGQIY
ESNSIMLAGAVRDAGAELVAVATAEDEVAQFSSIIDRYAAGTDLIITSGG
VSAGAYEVVKDAFGREGDQGVEFVKVAMQPGMPQGVGRVAGATIVTLPGN
PVSALVSFEVFIRPALRAAMGLPDPERPHRSAVLAESLTSPRGKRQFRRA
VLDDDAGTVVSYGPPASHHLRWLASANGLLDIPEDVVEVPEGTTLEVWDL
R
41410029NP_962865.1 hypothetical protein MAP3931 [Mycobacterium avium subsp. paratuberculosMPRGHLTEPVTDSSPPAKGTFTVDMLSRAKRGVTAVFVAHGLLFASWAAH
IPQVKAGLGLDDAALGTALFGAPLGSVLATLAGHWALPRWGSHRLIPVTV
AGYAAAGTTVGLARSGPALFAALALWGMFQGTLDVAMNTQAGTVERRAGA
PMMARFHGMWSLGTLAGALIGAACVGAGIGLTAQLTVLGAVVLLVVVMLT
RRLLPDAADSVAAPPEPAAGRRMTPAVAILAAVSFASFLCEGAATDWSAT
YLRDVVGAGPSVAAASYAAYTLTMVVTRFGAARLHARLPSRRLLPALAVL
AVAGMSVALATADAAAGVLGFAALGVGVALLVPTAFSAAYGARGAGSAIA
IVAATGWLGYLLGPPLIGHLSEWVGLSGALVTIPVMMTVVAVAIRYTPAF
DTADEFHRAPAG
41410028NP_962864.1 phosphatidylserine decarboxylase [Mycobacterium avium subsp. paratubercMARRPRTIGPSAADPGFSPQHALELVRSAIPPVHPAGRPFVGAGLALALA
GRRHRWLRRAGLLAAGACAGFFRHPPRVPPTRPGAIVAPADGEICVIDVA
TPPAELSMGDVALPRVSIFLSLLDAHVQRAPVSGEVIDVQHRPGRFGSAD
LAAASTENERTSLRIRTPGGAEVVAVQVAGLLARRIICDAHVGDKLSIGD
TYGLIRFGSRLDTYLPAGAQPLVTVGQRAIAGETVLAELP
41410027NP_962863.1 hypothetical protein MAP3929c [Mycobacterium avium subsp. paratuberculoMISKPRGRRAVNLQILPSAMTVLSVCAGLTSIRFALEHQPKAAMALIAAA
AILDGLDGRVARILDAQSRMGEEIDSLADAVNFGVTPAIVLYVTLLTTSP
AGWVAILLYAVCVVLRLARFNALLDDGSQPAYTHEFFVGMPAPAGAVSMI
GLIGLKLQFGDGWWTSPLFLCIWITGTSILMVSKIPMRKMHAVAVPPSWA
APLLAVLAICAAAAVLAPYVLIWVIIVAYLCHVPFAVRNQRWLAAHPEAW
DEAPKQRRAARRAIRRAQPNRRSVTRLGLRKPGRRVP
41410026NP_962862.1 hypothetical protein MAP3928c [Mycobacterium avium subsp. paratuberculoMTGSGSARQLTLTARLNTSAVDSRRGVVRLHPSAVAALGIREWDAVSLIG
SRTTAAVAGLAGPEIPSGTVLLDDVTLSNAGLRDGTAVVVSPVTVYGARS
VTLSGSPLTTRSVSPVTLRQALLGKVLTVGDAVSLLPRDLGPGTSTSEAT
RALAAAVGISWTSELLTVTGVDPDGPVSVQPNSLVGWGAGAAPAAASRAS
VEEARPQTVVEELKGCQPQAAKLVEWLKLALDEPHLLKTLGAATFLGVLV
TGPAGVGKVTLVRAVCGDRRLVTLDGPEVGALGADDRLKAVASAVQTVRD
GGGVLLITDVDALLPATAEPVASLILAELRGAVASEGVALIATSARPDQL
DARLRAPDLCDRELSLPLPDAATRKALLESLLRNVPTDGLDLDEIASRTP
GFVVADLAALIREAALRAASRASSDGRPPALHQEDLTGALSVIRPLSRSA
AEEVSVGDITLDDVGDMAQARQALTEAVLWPLQHPDTFARLGVQPPRGVL
LYGPPGCGKTFVVRALASTGQLSVHAVKGSELMDKWVGSSEKAVRELFRR
ARDSAPALIFLDEVDALAPRRGQSFDSGVTDRVVAALLTELDGVDPLRDV
VVLGATNRPDLIDPALLRPGRLERLVFVEPPDAAARREILRTAGKSIPLS
ADVDLDELAAGLDGYSAADCVALLREAALTAMRRSIDATDVTAADLAAAR
ENVRPSLDPAQVASLRAFAEAP
41410025NP_962861.1 hypothetical protein MAP3927 [Mycobacterium avium subsp. paratuberculosMAPPRKHETDVILDAARALVLDGGPRAASVAAIAKASGAPAGTLYHRFGN
RDGILTAAWLRALERFQARALAADGDTPEDTAVAMAVAAVGFARALPDDA
RLLLTIRPGDLLDGEPDAAFRQTLAAMNAPLTQRLAQLARHLYGNARPRS
VDAVARAVADLPYAVVRRHAHDDPMPSWLETDVAASARAVLRSFGERP
41410024NP_962860.1 hypothetical protein MAP3926c [Mycobacterium avium subsp. paratuberculoMERLPYIDEHAITIEANRDDTWAALLRVLCRDPHDPSTVPLGFALDEARP
PVRFALKGRHPFAVYRWVFELDTLDGPARTRLRAATWAAFPGVHGKAYRA
LVIGTGGHRIVVRRTLNRVARAAARADYTDVFEVPLPQGDSRSAEETFRD
AVGRPGAGGDAVRWVHRHVLRLGGWTIVRSARDEVVLAARGPLMDARLTL
RREDGRRAVLTTRLHYRHKLAARAVWALVGPLHRIVAPRLMRRAAVMAPA
AAPTPTTAAR
41410023NP_962859.1 EchA8_2 [Mycobacterium avium subsp. paratuberculosis K-10]MTTDLTAEIDSGVAVLTLNRPDRLNAYTAEMGELLGRAYRECDEDDDVRV
IVLTGAGRAFCAGADFSGGASPFDAPAGDGAFTASPITPAAFELRKPVIA
AVNGHAVGIGLTIALQADIRIVAEDAKYGVVQVRRGVLPDCMAHWTLPQL
TNLGVAADLLLTGRMFGGAEATALGIANRALPADRVLDEAMALARDIAVN
VAPMSAALCKRLLWDSAINRYPPRQVAALETLLHERVMGGGDAAEGVAAF
LEHRAPRFTARLSSEWEPLPEP
41410022NP_962858.1 hypothetical protein MAP3924 [Mycobacterium avium subsp. paratuberculosMKVQLQVDGSPVRAAASAAEIAATGADGLFTFEGQHDVFFPLLIAAEATG
CELMTNVAIAPPRSPMHLAYAAYDLQLYSGGRFRLGLGSQIKVHVEKRYG
SRWEPPAARMAEAISAIKAIFAAWEGRARLDFRGEFYTHTIMAPTFDPGP
NPYGAPPVLLGALGPVMTRTAAEVADGLLVMPFNSARHFAERTLPAIGEG
LRRSGRTLTEFPIIAQAMVAVGRDEADLATAIDAVASLIAFYGSTPAYLP
VLQVEGWDGIQPELNALSKQGRFAQMRGLITDEMVARIGIVGTPEQCAEQ
IAARFGEHADEVCCYFPGYTPRPADVADLIGALHRVPALP
41410021NP_962857.1 hypothetical protein MAP3923 [Mycobacterium avium subsp. paratuberculosMTEPVALPMFPLESALLPDQDLPLRIFEPRYGALVRHCLDTGEQFGVVLI
ARGREVGGGDARCDVGVLSRIVDCVDQGAGRYLLNCRTGQRIRVSEWLPD
DPYPRATVMPWPDEPGAAVTPEQLRGVEDRAVALFERIAQARGITLPGRD
VLLGRHDPERPPGQRLYELASRIPIGTADRYTVLCAPSAAERLAALREAV
DAVTEVVEFQLSE
41410020NP_962856.1 carboxylate-amine ligase [Mycobacterium avium subsp. paratuberculosis KMTPASGWRAVSSVPARRGDAHIDFARSPRPTIGVEWEFALVDAQTRDLSN
EATAVIAEIGENPRVHKELLRNTVEVVSGICRTVPEAMEDLRQTLGPARR
IVRDRGMELFCAGAHPFAQWTTQKLTDAPRYAELIKRTQWWGRQMLIWGV
HVHVGISSPNKVMPIMTSLLNYYPHLLALSASSPWWTGVDTGYASNRAMM
FQQLPTAGLPFQFQTWAEFEGFVYDQKKTGIIDHVDEVRWDIRPSPHLGT
LEMRICDGVSNLHELAALVALTHCLVVDLDRRLEADESLPTMPPWHHQEN
KWRAARYGLDAVIILDADSNERLVTEDLDDVLNRLEPVARKLQCADELAA
VADIPRHGASYQRQRRVAEEHDGDLRAVVDALVAELEI
41410019NP_962855.1 SodC [Mycobacterium avium subsp. paratuberculosis K-10]MPKLLPPVVLAGCVVALGACSSPQHASSLPGTTPAVWTGSPSPSGAGAAE
AAPAAAPSITTHLKAPDGTQVATAKFEFSNGYATVTIETTANGVLTPGFH
GVHIHKVGKCEPSSVAPTGGAPGDFLSAGGHFQAPGHTGEPASGDLTSLQ
VRKDGSGTLVTTTDAFTMEDLLGGRKTAIIIHAGADNFANIPAERYNQTN
GTPGPDEMTMSTGDAGKRVACGVIGAG
41410018NP_962854.1 hypothetical protein MAP3920 [Mycobacterium avium subsp. paratuberculosMKERVPDSTGLPLRAVVMVLLFLGVIFLLLGWQALGSSGNSEDDSASPVS
SSTATSSASASPTNKPAANQAEVQVYNISSKEGVAARTKDQLTSAGFKVT
KVDNLAVPDVSATTVYYTDADDEHATADAVGKNLGAPVEPRIPALSGQPP
GVIVLVAG
41410017NP_962853.1 hypothetical protein MAP3919 [Mycobacterium avium subsp. paratuberculosMDSAMARANRSGDDAEIADGLTRREHDILAFERQWWKFAGVKEDAIKELF
SMSATRYYQVLNALVDRPEALAADPMLVKRLRRLRASRQKARAARRLGFE
VT
41410016NP_962852.1 peptide deformylase [Mycobacterium avium subsp. paratuberculosis K-10]MAVVPIRIVGDPVLHTPTQPVPVGDDGSLPADLGKLIADMYDTMDAAHGV
GLAANQIGVGLRVFVYDCADDRGLTERRRGVVVNPVLETSEIPETMPDPD
TDDEGCLSVPGESFPTGRASWARVTGLDADGNPVSIEGHGLFARMLQHET
GHLDGFLYLDRLIGRYARSAKRAVKSHNWGVPGLSWMPGEGPDPFGH
41410015NP_962851.1 hypothetical protein MAP3917c [Mycobacterium avium subsp. paratuberculoMDARRGTGPVRSLMFSWPDPGTRVTVRYRRPPGSVPPLTDAVGRLLTVDP
TVRVQTKTGAVVEFAPADVVALRVLTDTPIRTSQIRALEHAAAWPAAEQT
WLHGWLLRAGPPPGRPAGPSTDSAVPLDLSAHAEAIPEIAGWYQRRGLTP
RLAVPDRMLTPPPGLTCERTEQVVVQDLSRPSGDEPGVRVDASVAQAAVS
AAPDGTRWVGLWVPPGGHDAEARAGCEALLAWGAGRGATRAYLAVPDDDT
AALELAGALGFRLHHRRRYLTVPAGPVG
41410014NP_962850.1 hypothetical protein MAP3916c [Mycobacterium avium subsp. paratuberculoMRLATWNVNSIRSRLPRVLDWLARTEVDVLAMQETKCADGQFPTLPFFEL
GYEVAHVGFNQWNGVAIASRVGLDDVRVGFEGQPSWSGKPEVAAAAEARA
LAATCAGVRIWSLYVPNGRAVGDPHYAYKLDWLAALRDSAAAWLREDPAA
QIALAGDWNIAPQDDDVWSMEFFAGATHVSEPERRAFNAILDAQFADLVR
PFAPGPGVYTYWDYTALRFPKRQGMRIDFILGSPALARRVTHAQIDREER
KGKGASDHAPVLVDVSRDEPPS
41410013NP_962849.1 hypothetical protein MAP3915c [Mycobacterium avium subsp. paratuberculoMSVIGGAVRGVSQAVNRAASATTAAAGAVGGAAVNGVIGGVTGAAEGVKR
GMNSGSHSTPAAALAFGALGVAGLVEWPVLLAVGGGALLLQRLNRKERQP
EPRAVKANLKSVPAESAPARKAPAKTAAKSTAKKAPGRRAGAGDLRSTN
41410012NP_962848.1 hypothetical protein MAP3914c [Mycobacterium avium subsp. paratuberculoMMAEKKARRGTSQREAVEKIREGETFVVNLPGLGQVEIPRPEQLAYFGGL
AALAALELIDWPVAVVIAAGHLLASNHHNKILEELGEAMEEV
41410011NP_962847.1 thiamine biosynthesis protein ThiC [Mycobacterium avium subsp. paratubeMTAIVEPSVTTGPIAGSSKVYRELDGVPGARVPFRRVHLSTGDHFDLYDT
SGPYTDPDATIDLTAGLPARPGRVRDRGTQLQRARAGEITAEMAFIAARE
GMPAELVRDEVARGRAVIPANHNHPEIEPMIIGKAFATKVNANIGNSAVT
SSIAEEVDKMVWATRWGADTIMDLSTGKNIHETREWILRNSPVPVGTVPI
YQALEKVKGDPTLLTWEIYRDTVIEQCEQGVDYMTVHAGVLLRYVPLTAK
RVTGIVSRGGSIMAAWCLAHHRESFLYTNFDELCEIFARYDVTFSLGDGL
RPGSIADANDAAQFAELRTLGELTKIAKSHGVQVMIEGPGHVPMHKIVEN
VRLEEEWCEEAPFYTLGPLATDIAPAYDHITSAIGAAIIAQAGTAMLCYV
TPKEHLGLPDRKDVKDGVIAYKIAAHAGDLAKGHPHAQQRDNALSQARFE
FRWNDQFALSLDPDTAREYHDETLPAEPAKTAHFCSMCGPKFCSMRITQD
VRDYAAKHGLDSEEAIEAAMADKSREFAEHGNRVYLPLAQ
41410010NP_962846.1 phosphomethylpyrimidine kinase [Mycobacterium avium subsp. paratuberculMTGPPPTLPLAPPGTTPRRVLSIAGSDSGGGAGIQADLRTMAMLGVHACV
AVTAVTVQNTLGVNSFHEVPADVVAGQIEAVAGDIGIQAAKTGMLASSPI
IAEVAATWRRLELSVPLVVDPVCASMHGDPLLAADALDTLRGQLFPLATL
VTPNLDEVRLLVDIDVTDAASQRAAAKALHALGPQWVLVKGGHLRSSQRS
CDLLYDGDSCYEFDAHRLATGNDHGGGDTLASAVACALAHGFTVPDAVAF
GKRWVTECLRASYPLGHGHGPVSALFRLSGDG
41410009NP_962845.1 hypothetical protein MAP3911c [Mycobacterium avium subsp. paratuberculoMNLDRIAGIAHRPDGTPEGVVVLTHGAGGNRDSPLLQQVCDEWAQRGWLA
VRYNLPFRRRRPTGPPSGSGAADRAGIVEAITLCRGLADGPLIAGGHSYG
GRQTSMVVAAGDAAVDVLTLFSYPVHPPGKPERARTEHLPAITVPTVFTH
GTSDPFGTPEELNAAAALVGGTTAVVEIASARHDLRSKTLNVAALAVDAA
LQLLGRN
41410008NP_962844.1 hypothetical protein MAP3910c [Mycobacterium avium subsp. paratuberculoMTPSQTAVLTRLWKEGPSSASALAAAERVRPQSMATILAALGQRRLIERS
PDPNDKRRQVVSLTAAGRKRAESDRRAREEWLARAIQERYTEAERRVIVD
ALSLLERLTEQ
41410007NP_962843.1 hypothetical protein MAP3909c [Mycobacterium avium subsp. paratuberculoMELGLHFIDFLPGDPARLGPTLTEAARAAEQGGATLLTLADHFFQMEQLG
PAENPFLEGYTSLGFLAAQTSTIELALLVTGVTYRYPGVLAKTVTTLDVL
SQGRSMLGLGAAWYEREHTALGIPYPALSTRFEMLEETLQICRQMWSDDD
GAYQGKHYRLAETICAPQPIRRPPILIGGDGEKKTLRLVAQYADVWNSMS
NDLAELEHKIEVLHRHCDAVGRDPRDIRKTCGGLATLDPFENLDEYLRTA
ERFGRLGIDMINVGPLPGNPDPVGYIRRLGDEVIPRLAEIG
41410006NP_962842.1 LpqM [Mycobacterium avium subsp. paratuberculosis K-10]MHSHALRSAFVWAAAVLLVAGCSTFVEGRALSMLNDPFLVGGLPATNGPS
GIRSNAPAPTGKVLNTDNGSIDSLSLLSINDIEDYWRSVYGQSLKGKFVP
ISKIVSYNSTDPSSPIVCHNDTYQLVNAFYTSRCNLIAWDRGVFMPVAQK
YFGDMSVTGVLAHEFGHALQQMAALVTKRDATIVREQQADCFAGVYLFWV
ADGKSPRFTLSTADGLDHVLAGIITTRDPVMDSETANDDAHGSALDRISA
FQMGFLNGASACASINRREIEQRRGDLPNALRVDTSGAPETGEVPINQDT
LSTLMELLGKIFAPANPPALSYQPAACADAKPSPPASYCPATNTIAVDLP
KLAALGRVADENEHSLPQGDDTALSVVMSRYALAVQHERGLAMQSPWTAL
RTACLTGVVHRRMAEPIELPSHNQLLLTAGDLDEAVAGLLTNHLVASDAD
GTSVPAGFTRIAAFRGGVTGNADACYSRYPG
41410005NP_962841.1 LpqL_2 [Mycobacterium avium subsp. paratuberculosis K-10]MLLAGCSSAGPGLPTAAPDLGHGLAKKVTADAMMAHLRALQNIANTNGGN
RADGTPGFQASVDYVAKALRDKGFDVQTPQFDRLYPVSPGKPTLTVAGRG
YPVDQASMLVQTPPGGLTGPAVRPAQPSGCAASDYPGALPKGAIAVVDDT
RCSVVDKQNSAVARGASALIVVSAPDGHGAPPTLFTPGYYKQLSVPVAVV
NPSGAAALAGAGGPVRLILDAVNVKVTSRNVVAQTKTGSAHEVVMVGAHL
DGSRAGPGINDNGSGVAAVLETALQLGPLAPVSNAVRFVFWGAGEDGLGG
VMDYLFGLDRDQLNDIALYLNFTMLGSPNAGFFTDDGDQSGPPAPGISAA
DVPEGSAGIERTLAGYLNLAGKRAADMPLNTRADYHPFMVAGVPIGGMTT
GASQPKTTVQSRLWGGQAGVPFDPNFQSPRDTADNINRDALAVMGSGVGF
AVGSYAQSIGGVNGVPPHDKRHRTRVP
41410004NP_962840.1 LpqL_1 [Mycobacterium avium subsp. paratuberculosis K-10]MVNKFTTFPALLAVVALTALATGCGHRSSGAGQTTGDPAAAEFASGLRNK
VTTDAMMTHLTKLQDIANANNGTRAVGTPGYEASVDYVVKTLRDSGFNVQ
TPEFSARVFHAEKPDLTVGGRPVEAHALDFSLGTGPDGVSGPLVAAPPNN
PGCAVTDYGSLPVQGAVILLDRGTCPFAQKEDVAAQRGAVALIIADNVDE
QQMGGTLGPSTEVKIPVLSVTKSVGVQLRGQPGPTTIKLTASAQSFKARN
VIAQTKTGSEHDVVMAGAHLDSVPEGPGINDNGSGVAAVLESAVRLGSSP
PVHNAVRFGFWGAEELGLIGSRNYVESLDLTALKNIALYLNFDMLASPNP
GYFTYGGDQSLPMDARGQPVVPEGSAGIERTLVAYLKSAGKTAQDTSFDG
RSDYDGFTLAGIPAGGLFSGAEGKMSADQAKLWGGTADQPFDPNYHQKTD
TLDHIDRTALGINGGGVAYAIGLYAQDLGGHNGVPAMADRTRHVLAKS
41410003NP_962839.1 hypothetical protein MAP3905 [Mycobacterium avium subsp. paratuberculosMVIRRGAVQQNLTAPVVVAASATVLCAAVWAGDPTTPGGPLPVCPTKALL
GVDCPGCGSLRMVYALMHGNLLGAARFNALGLAAVVLLMWAYFAWTYGHL
VGRRIRSWQHHRWAAAVTLSLVLAWFVVRNIPVAPFTALHV
41410002NP_962838.1 hypothetical protein MAP3904 [Mycobacterium avium subsp. paratuberculosMTQPPPPPPPPGYPPQQPAAQAPNNYLVWSILVTLFCCLPFGIVAIVKSS
QVNGLWAQGRYAEAQASADSAKKWVIWSAAIGVVVGIIYGILMAVGALNT
NTNAALAAMF
41410001NP_962837.1 hypothetical protein MAP3903c [Mycobacterium avium subsp. paratuberculoMMSEFSNALRAATAAVFTGGFVFAGSAAAAADPAGTPNPSDINTLAASLS
KGYGLNICTAGNIDRGRQLAVLTCGQSPDPKGPAQAKYVLFTNAENLATA
FRATIKEDVLTPCGDAHESPSSWRKDGSSASAGQAACGTFRNAAEIIWTI
DAKNILSYLRASNTDVAALYHWWRANG
41410000NP_962836.1 hypothetical protein MAP3902c [Mycobacterium avium subsp. paratuberculoMSYRNTALRLVSAAAFTGSVALAGSAPALAEPNTGSASDMNTLAAALSKG
YGLNNCKPQELTESGELAELLCGQSPDPSGPGSGVYALFSNGTNLASAFS
STIKDVSLANCGDAGQSPGTWKQNGQTGGQIACGTYKNYATLTWTTDAKN
VLGHLTAANSDVNALYQWWRTNG
41409999NP_962835.1 hypothetical protein MAP3901 [Mycobacterium avium subsp. paratuberculosMAAGPGIRPRAAGAPRWSGRSARNYAHLVAARCGYDLVDVTFSGATTAHV
LTERQHGAAPQIAALDGSESLVTVTIGGNDVGYIPLLTVAALPRPLRRLP
LLGDRIAELLDAEARNGALEAVFESLCAVGTAVRQRCAEARIFFVDYLTM
LPPAGVPAAPLSPADADLGRHVAATLERMTADAAAATGCDLIPAAAASRE
HHAWSADPWTTLPARYGLPLPGRPAPLHPNAAGMRAVAELIAARL
41409998NP_962834.1 thiazole synthase [Mycobacterium avium subsp. paratuberculosis K-10]MVDSKLTIADRSFNSRLIMGTGGAGNLAVLEEALIASGTELTTVAIRRVD
AEGGTGLLDLLNRLGITPLPNTAGCRGAAEAVLTAQLAREALNTNWIKLE
VIADERTLLPDAVELVRAAEQLVDDGFVVLPYTNDDPVLARRLEDAGCAA
VMPLGSPIGTGLGITNPHNIEMIVAGAGVPVVLDAGIGTASDAALAMELG
CDAVLLATAVTRAGDPAAMAAAMSAAVTAGYLARRAGRIPKRFWAQASSP
PR
41409997NP_962833.1 sulfur carrier protein ThiS [Mycobacterium avium subsp. paratuberculosiMIVVVNEQKVDVDAHTTVAALLDELGFGGRGVAVAVDDAVLPRSRWTTEL
SEGARLEVVTAVQGG
41409996NP_962832.1 hypothetical protein MAP3898 [Mycobacterium avium subsp. paratuberculosMGAPALTVTPDPDHAGEGRPRMPSDCGSLAVVGGGVIGLAVARRAAQAGW
SVRVHRSGERGASWVAGGMLAPHSEGWPGEERLLRLGLESLRLWREGGFL
DGLPGRLVTARESLVVAVDRADVADLRTVADWLSAQGHPVVWESAARDVE
PLLAQGIRHGFTAPTELAVDNRAVLEALDAACERLGVRWAPPLHDLAEAD
ADAVVIANGIDAQALWPGLPVRPVKGEVLRLRWRKGCMPVPQRVIRARMH
GRQVYLVPRADGVVVGATQYEHGRDTAPVVSGVRDLLDDACAVLPALGEY
ELAECGAGLRPMTPDNLPLVGRLDARTLVAAGHGRSGFLLAPWTAEQIVS
ELAPVGAHR
41409995NP_962831.1 thiamine-phosphate pyrophosphorylase [Mycobacterium avium subsp. paratuMHQRLATLAAARLYLCTDARRERGDLAEFADAALAGGVDVIQLRDKGSPG
EQRFGPLEARDELAACEILADAARRHGALFAVNDRADIARAAGADVLHLG
QGDLPLEVARAFVGPDVLLGLSSHDRDQMAAAAAGPADYFCVGPCWPTPT
KPGRAAPGLALVRAAAELHTGKPWFAIGGIDAQRLPEVLDAGARRVVVVR
AITAADDPAAAARRLSSALAAAR
41409994NP_962830.1 hypothetical protein MAP3896 [Mycobacterium avium subsp. paratuberculosMHGDGDGWVISERGAHYWGRYGAAGLLLRAPQPDGTPAVLLQHRAVWSHQ
GGTWGLPGGARDSHETPEETAVREANEEAGLLVDRLAVRASVVTAEVAGV
GGTRWSYTTVIADADELLHTVPNRESAEMRWVAEDEVADLPLHPGFAASW
HRLRTEPARLPLSHGDERRQYLPRTIELEDGVFVWCMPGDPADTDEASAQ
LCRRISALLPAPS
41409993NP_962829.1 hypothetical protein MAP3895c [Mycobacterium avium subsp. paratuberculoMTVELAHPSTEPQGSRSPAEPAHPRWWFISTTPGRILTIGIVLAALGGLS
AFATSTTINHRQQVLTTVLNHTEPLSFAAGRLYTTLSVADAAAATAFIAE
AEPPPVRQRYEQAITDAAVAVTRASSGLTDEPMVQLLGRINAELAVYTGL
IETARTNNRQGNPVGSSYLSEASGLMQSTILPDAARLYQATSKRVDEETT
ASTQIPAPVIMVVGATVVFGAFAHRWLARRTRRRINPGLVVGALAILVMV
VWVGTALTISTTASRSAKDTAAESLKTVTNVAITAQQARADETLSLIRRG
DEEKRKQSFYQRLDSMHRQLDEYMSRSDAVDKPDLEGADQLLLRWRQAND
RITSYISVGNYRAATQVALGSSEEDSTPAFDKLQDELMKAMDQGRIHLRN
DVINARSGLSGAQVGGVVLSLGAAIAVALGLWPRLKEYR
41409992NP_962828.1 GlnH [Mycobacterium avium subsp. paratuberculosis K-10]MLVAAGCGHTESLRVASVPTLPPPTPVGMEQLPPQPPLPPDGPDQNCDLT
ASLRPFPTKAEADAAVADIRARGRLIVGLDIGSNLFSFRDPITGEITGFD
VDIAGEIARDIFGAPSHVEYRILSSDERVTALQRGEVDVVVKTMTITCDR
RKQVNFSTVYLDANQRILAPRDSPITKVSDLSGKRVCVAKGTTSLHRIRQ
IDPPPIVVSVVNWADCLVAMQQREIDAVSTDDSILAGLVEEDPYLHIVGP
NMATQPYGIGINLNNTGLVRFVNGTLERIRRDGTWNTLYRKWLTVLGPAP
APPTPRYLD
41409991NP_962827.1 PknG [Mycobacterium avium subsp. paratuberculosis K-10]MAEPDNKSEQPEPGAEQMGPGTQPAEVGDDAQAGAATGRLQATQALFRPD
FDDDDDDFPHISLGALDTDSADRMTVATQALPPVRQLGGGLVEIPRGRDI
DPREALMTNPVVPESKRFCWNCGKPVGRSTKKSKGTSEGWCPHCGSAYSF
LPQLNPGDIVANQYEVKGCIAHGGLGWVYLAVDHNVNDRPVVLKGLVHSG
DAEAQAIAMAERQFLAEVVHPQIVQIFNFVEHVDRHGNPVGYIVMEYVGG
QPLRHGKGEKLPVSEAIAYVLEILPALGYLHSIGLVYNDLKPENIMLTEE
QLKLIDLGAVSRINSFGYLYGTPGFQAPEIVRTGPTVATDIYTVGRTLAA
LTLNLPTRNGRYVDGIPDNDPVLGTYDSFRRLLRRATDPDPRRRFSSTEE
MSAQLMGVLREVVAHDTGVPRPGLSTIFSPSRSTFGVDLLVAHTDVYLDG
QVHSEKLTAREIVTALQVPLVDPADVAAPVLQATVLSQPVQTLDSLRAAR
HGTLDADGVELSESIELPLMEVRALLDLGDVAKATRKLDDLAERVGWQWR
LVWYKAVAELLTGDYDSATTHFTEVLDTFPGELAPKLALAATAELAGDVD
EHRFYETVWKTNDGVISAAFGLARTLSAEGDRAAAVRTLDEVPATSRHFT
TARLTSAVTLLSGRSKSEITEEEIRDAARRVEALPPTEPRVLQIRALVLG
CAMDWLEDNKASTNHILGFPFTEHGLRLGVEAALRNLARVAPTQRHRYAL
VDMANKVRPTSTF
41409990NP_962826.1 hypothetical protein MAP3892 [Mycobacterium avium subsp. paratuberculosMHSRSRGRRRRARVSRMGETPVVGSEELASGRLNRHRLRVAYRPVFPNVY
LPAQVEPTLPLRIRAAWLWSGRTAVIAGAAAAAVHGAAWIPDAVPIELIH
HNTRAPDGVLIRRDGLCPGETQICDGLAVTTPERTAFDIGRRGAVRSAVV
RLDSLARATGFKADDVLRVAGAHPRSPGLRRLEAALGLVDPGAQSPRESY
LRLLLIDAGLPRPQTQVPVPGADGMPVAYLDMGWPEWMVAVEYDGDHHRT
DRRQYVKDIRRLEMLEQLGWVIVRVVAEDRPADIVRRVRAALAKSGVAPR
LSV
41409989NP_962825.1 hypothetical protein MAP3891 [Mycobacterium avium subsp. paratuberculosMGQPQSQMEPESKLRQRTEGRLDRSRDPAILDAALAALAEHGYDATNMND
IAARAGVGKAAIYRRWSSKAALMTDALIYWRPELLNDDAPDTGSLAGDLD
AIVKRAKRNDNALISNDLVLRVALEAAHDPELATALNDLILFKGRRVLSA
VLAQAADRGEIDPNRDWSLVADVLTAMGLLRAISGQRVDGKFVRRVIDTL
ILPAVRAAPE
41409988NP_962824.1 MmpL4_6 [Mycobacterium avium subsp. paratuberculosis K-10]MSNPHAQSRLPVIPRLIRVLSLPITLGWVFVAVALGVLSPSLDDVASQHS
VPMTPRDAPAFKSMMHIGDKFNEFHTDSTAMVVLEGKDKLGDSAHEFYDR
IVRKLRDDHQHVQNIQDFWSDPLTAAGSQSPDGKSAYVQVFLNGAQGTTP
SYESVAAVRKIVDSTPAPPGVKAYVAGNTVLNADTSIVGHKSMATMALVS
IVVIFVMLLVVYRSIVTTVLSLVIIGIELFAAQGITATAGNLNIIGLTPY
AVSMITMLSIAAGTDYVIFLLGRYHEARSFGQDREEAFYTAYHGVSHVIL
GSGLTIAGACLCLTAARLPYFQTMGLPCAIAMVVIVLAALTLAPAILAVG
SRFGLFDPKRAIDVRGWRKVGTAVVRWPKPIIVVTAAIAVIGFISLLTYV
PNYDDQKFTPKDMPANAAMTAAERHFSQARMNPELLMVEADHDLRDPADM
LVVDRIAKSVFHLRGIERVQTITRPLGAPIEHSSIPFQIAMQNSGTLQTA
KFMNDTMANMLEQADELDKTIAVMEHMYGVMKELTATTHSMVGRTHEMVD
TTNELRDRIADFDDFFRPIRSYFYWEKHCFDIPVCWSMRSLFDALDGIDE
LSDQISGLTIDLDHMDRLMPQLLADFPKTIDSMKTMRDFMLSTHSTMAGI
QAHQQEAAEGSTLMGQYFDEAKNDDSFYLPPEVFKNPDFKRGLKMFVSPD
GTAVRFIITHQGDPASVEGIKHVAGVKDAVADAIKGTPLESSKVYLAGTA
SMYSDMQEGVIIDLLVAGISCLILIFTIMLIITRSVVAALVIVGTVAASL
GTACGLSVLMWQDLIGLGVQWIVLPLSIVILLAVGSDYNLLLVSRLKEEI
PAGLNTGIIRGMGASGRVVTAAGLVFAFTMASMIVSQLRVIGELGTTIAL
GLLVDTLIVRSFMTPSIAAALGHWFWWPINTIRMTRRTHHDEEAHTAPIR
QPALR
41409987NP_962823.1 hypothetical protein MAP3889 [Mycobacterium avium subsp. paratuberculosMRASRRRRLSRPAKNEGRQRILRILRRAWMPLLLVVVISLGAYAVVRIRD
TFGTHGGVTSGEGAGDNTKPFHPKHITYEITGAPAGTVNANYLDENGQPH
LVESAPLPWSFTIVTTLPSMSANIVAQASEQVHALRCRVIVDDQVRDDRN
TNDYQPFIYCLVKSV
41409986NP_962822.1 hypothetical protein MAP3888c [Mycobacterium avium subsp. paratuberculoMEPQENRKNPQRIFSCTPHSYSMAGQSTLWVGTARMLRRAGFGVTGPEVD
AAVARGWPGHLDAMLAADPDADPGALATPMPALPAPQPPGKRATPAARKQ
YNQQLTEQQGVLSDWWIRRMVVVRQPFHEKLTLLWHNHFATSAQKVRVAA
QMAAQNQKLRTLSLGDFRTLAYAMLTDAAMLRWLDGQTSTAKAPNENLAR
EFMELFALGHGNGYTESDVRNGARALTGWVIGAGGATSVLPKRHDATAKT
LFGRSANFDAAGFCDAVLAQPKSAGYVAGRLWQQLAGDDPPSPPALDRLV
AAYGPGRDLRALTRAILTDPEFTGARASMVNTPIEWLIGVIRSLRVPVDD
PKRLKMIDATLRTLGQRPFYPPSVGGWPSGQVWLSTASAGARLRAATELA
HAGDLSGIENTPPTDRIDAVGYLIGVGAWSDRTARALQPLVGQPPRLVAA
AVNTPEYLTS
41409985NP_962821.1 hypothetical protein MAP3887c [Mycobacterium avium subsp. paratuberculoMRAARDRPLAPGAGVLVIATLYGGNDGINTLIPYADNAYHDARPELAYAP
QDVLHLDQQLGLNPALKGMAGLWNQRKLAVVRGAGYPKHDHSHFRSMDIW
QTASPDEPVSTGWIGRWLDATGDDPLRAVNIGAVLPPLAVGAKCTAAALS
PGGGAGKAGQFDAVTTALGDDDPDDTPAMAAVCKAYRAARTADATFASVK
PPAKQNNSLAAQLDVVAQAVKARVPARVYTVQLGGFDTHAGERGTQQRLL
QTFDEAVTGFVAQMAGRNVVLMAYSEFGRRVRANASQGTDHGTAGPVLIA
GAPVNGGFYGEQPSLTDLDNGDLKYTTDFRDIYHELLARTVGTDPAPSVG
AGRRDLGFLSA
41409984NP_962820.1 acetate kinase [Mycobacterium avium subsp. paratuberculosis K-10]MDGSDGARRVLVINSGSSSLKFQLVDPEFGVAASTGIVERIGEESSPVPD
HDAALRRAFDMLAGDGVDLNTAGLVAVGHRVVHGGNTFYRPTVLDDAVIA
RLHELSELAPLHNPPALQGIEVARRLLPDIAHVAVFDTGFFHDLPPAAAT
YAIDRELADRWQIRRYGFHGTSHRYVSEQAAAFLDRPLRGLKQIVLHLGN
GCSASAIAGTRPLDTSMGLTPLEGLVMGTRSGDIDPSIVSYLCHTAGMGV
DDVESMLNHRSGVVGLSGVRDFRRLRELIESGDGAAQLAYSVFTHRLRKY
IGAYLAVLGHTDVISFTAGIGENDAAVRRDAVSGMEELGIVLDERRNLAG
GKGARQISADDSPITVLVVPTNEELAIARDCVRVLGG
41409983NP_962819.1 phosphate acetyltransferase [Mycobacterium avium subsp. paratuberculosiMADISAIYVAAPEPETGKSTVALGLLHRLTATVAKVGVFRPITRDGQDRD
YILELLLSRTTAGLSYQQCVGVTYQQLHADGDAAIATIVDAYHAMAELCD
VVVIVGSDYSELGQAIRPAELSTNARIAVNLGAPILLTVSGKGRTAAEVA
TVVQVCLAELDAQHAHTAAVVVNRCEPAELDAVAEALRGFPQRCYVLPDE
PLLSAPTVAELEKAVAGSPVSGEESLREREVTGILVAGMTADHVLERLAD
GMAVITPGDRSDVVLAVASAHAAEGFPSLSCIVLNGGFALHPSIAALVAG
LRLRLPIVATALGTYDTASAAAAARGRVTATSQRKIDTALELMDRHVDIA
DLLEQLAIPIPTVTTPQMFIHQLTLQARADRKHIVLPEGDDDRILRAAGR
VLQRRVADLTILGDEARIRQRSGELGVDLSDVKVIDPRTSALRPEFAQQY
AQLRKAKGVTVEQAREIMRDATYFGTMLVYTSQVDGMVSGAAHTTAHTVR
PAFEIIKTVPDVSTVSSIFLMCLPDRVLAYGDCAIIPNPTPEQLADIAIS
SARTAAQFGIEPRVAMLSYSTGDSGTGADVEKVRTATQLVRQRNPDLPVE
GPIQYDAAIEPSVAATKLRDSPVAGRATVLIFPDLNTGNNTYKAVQRSAG
ALAIGPVLQGLRKPVNDLSRGALVEDIVNTIAITAIQAQGLPGGR
41409982NP_962818.1 hypothetical protein MAP3884 [Mycobacterium avium subsp. paratuberculosMAELKLGYKASAEQFAPRELVELAVAAEAHGMDSATVSDHFQPWRHEGGH
APFSLAWMTAVGERTTRITLGTSVLTPTFRYNPAVVAQAFATMACLYPGR
IFLGVGTGEALNEIATGYQGEWPEFKERFARLRESVRLMRELWRGDRVDF
DGEYYRLKGASIYDVPDGGVPIYIAAGGPAVAKYAGRAGDGFICTSGKGE
ELYKDKLIPAVKEGAAINDRNVDDIDKMIEIKISYDPDPELALENTRFWA
PLSLTAEQKHSIDDPIEMEKAADALPIEQVAKRWIVASDPDEAVAKVKDY
VDWGLNHLVFHAPGHDQRRFLELFEKDLAPRLRRLG
41409981NP_962817.1 hypothetical protein MAP3883c [Mycobacterium avium subsp. paratuberculoMAELVQVTDAVHLARGDAVNWTLVADDTGVMLVDAGYPGDREDVLGSLAE
LGYGPGDVRAIVLTHAHIDHLGTAIWLASEHGIPVYCHADEVGHAKREYL
EQVSIVDVALRIWRPRWAKWTAHVVRSGGLIRDGIPTARPLTAEVAAGLP
GRPTPVFSPGHTNGHCSYLIDGVLVSGDALITGHPLLRHRGPQLLPAIFS
YSQRDCIRTLSALALLDTEVLLPGHGDVWRGPIKEATDAALALATGR
41409980NP_962816.1 hypothetical protein MAP3882 [Mycobacterium avium subsp. paratuberculosMTPESSPPADGRLRFVPATHDDPLARPLLAELAVEYAQRYGGTPSAHLSW
LPVPRDELAPPDGGLLIGVVDGVPVTGGAFRRYDAETAELKRIWTDAAHR
RRGYARALLAALEERTRACGYRRLYLITGNRQPEAEALYDATGYTRVPPD
PLPDWGPFRPIAFEKWLVPDER
41409979NP_962815.1 hypothetical protein MAP3881 [Mycobacterium avium subsp. paratuberculosMAATAEVGVTATLGAAARAVATRQGLLNDPYAEPLLGAVGIDYLTRAIAD
HTFAADESPVGDDPAVTSLLDALAAHTRFVDEFLAEAGRAGIRQVVILAS
GLDTRPYRLWWPRGTTVYEIDRPRVLDFKAGVLRGLDARLATNRCAVGID
LRDDWPAALRRVGFDAAQPTAWVAEQLLVGYLKPAEQNRLLRRLTAASAA
GSRLAADHLPTWDPLQLEAERAFVEGWRRRGLDIDLASLTHLGEYHYVPE
YLATHGWEPAARSIADLLGGLGLGPRRGAGSGGAQFIPEYVTATRV
41409978NP_962814.1 hypothetical protein MAP3880 [Mycobacterium avium subsp. paratuberculosMLRLRRLAWFAVDVLGVLVFCAVGRRSHDEGLSATGVAVTAWPFLTGTAL
GWLVSRGWRQPTAVLPTGVVVWLCTVIVGMLLRKASSAGVAASFVVVAST
VTALVLLGWRVAAGLTLRRRSDA
41409977NP_962813.1 hypothetical protein MAP3879c [Mycobacterium avium subsp. paratuberculoMNLDSSAMNTHSHRRLAVVTGAGSGIGRAIALGLAAGGDRVVAADLDEAS
AAATAAEQPDLITAAPVDVADPARVAALRDRIHADIGVPGVVVNAAGWDR
TDQFLNATPEFAQKVVAINYLGPVHVCSAFLPGMIETHGGGRVVNVASDA
GRVGSAGESIYAGAKGGVIALTKSLAREMARHQITVNCVCPGPTDTPLFH
AQPEKLKEALVKAIPLRRLARPEEVAAAVLFFASQAASFVTGQVISVSGG
LTMAG
41409976NP_962812.1 FadE7 [Mycobacterium avium subsp. paratuberculosis K-10]MSTETSTKTPPSFDRYDPLGLDALLSDDERAVRDTVRGFCAEHVLPHVAE
WFEIGDLPVRELAREFGRLGLLGMHLHGYGCGGASAVHYGLACVELEAAD
SGLRSMVSVQGSLAMFAIWNFGSEEQKRQWLPGMATGELLGCFGLTEPDV
GSDPAAMKTRARRDGSDWVLDGRKLWITNGSVADVAVVWAGTDDGIRGFL
VPTDTPGFTANTIHHKLSLRASITSELVLDDVRLPGEAMLPGATGLRGPL
SCLSEARYGIIWGARGAARSAWQAALDYATQRTQFGRPIAGFQLTQAKLV
DMAVELHKGQLLSLHLGRLKDSTGLRPEQVSFGKLNNTREAIEICRTART
ILGGNGISLEYPVIRHMVNLESVLTYEGTPEMHQLVLGQAFTGADAFR
41409975NP_962811.1 FadE20_3 [Mycobacterium avium subsp. paratuberculosis K-10]MAAHLQYTSEHHQFRELVRDFVQRTVVPNHEKWERDGQWDRSLFVEAGKL
GLLGFSVPERLGGPGVDDFRYNAIVVDELQRAGAAAEAIAFSLQNDIVLP
YLVELTTPEQQRRWLPGVVTGETVLGIAMTEPGTGSDLAGIRTTAVRDGD
HYLVNGAKTFISNGQVGDLFVVAVRTAPDRHKGLSLLVVDADTPGFGRGR
NLEKIGLHAQDTSELSFTDMRVPAENLLEAEGRGFYQLMKNLPQERLSLA
VGAVAAAEAVFAETLDYVKQWHAFGAPIAAFQNSQFVLAELATEIDVART
YLDDCLAAHLAGELTAARAARLKWWTTDLQVRTADRCLQLHGGYGYMREY
GVARAFVDARIQTIYGGTNEIMKTIIAKDLGL
41409974NP_962810.1 hypothetical protein MAP3876c [Mycobacterium avium subsp. paratuberculoMAVDYSELPAEEAVRAARAGARRRQVLDAAVKVMGRNGFHRMSMHDLAAE
ADVSVGLLYKYFGGKQDLLLATIVRILDVFRDQLAPVIDGAGDDVVDQLS
AGIRRYIQIVDENLDGVVLTYRESRTLGAAGRAQIKDLEIATAAPLRAVI
ETGIAQGVFRSVDVDLAVFDIMLLAHGWALKHWHFGPIYTLDEYFALQTR
HLLNGLISDERRADYADVLK
41409973NP_962809.1 hypothetical protein MAP3875c [Mycobacterium avium subsp. paratuberculoMSATARRIGALTALATLCAGTAPAAADPPPGLPPMTSGGSGPIIGGGSAA
AQAISQQLFSFGNPGVVQEVDGSDAAQFITAAAGAANQQLAAPFSLLRRA
LTCQDNNAGFGARAYRRNDGQWGGAMLVAAKSATPSPDNLAACAKTNWRR
ATAGGETAMCNSGWTTPTSYESRRGETYYILLAGTAADFCSDLNAKYKSD
ATGWPF
41409972NP_962808.1 hypothetical protein MAP3874c [Mycobacterium avium subsp. paratuberculoMELRWADRPPGTAEGTGMSRHRVVIIGSGFGGLTAAKALKRVPEGTQVDI
TLISKTTTHLFQPLLYQVATGILSEGDIAPTTRLILRKQKNVRVLWGDVS
AIDLTARTVTSHLMGMDTVTPYDSLIVAAGAQQSYFGHDEYAAFAPGMKS
VDDALELRGRILGAFEAAEVATDPAERRRRLTFVVVGAGPTGVELAGEIV
QLAERTLAGAFRTITPSECRVILLDAAPAVLPPMGPKLGLKAQRRLQKMD
VEVQLNAMVTAVDYMGITVKEKDGAERRIECACKVWAAGVQASALGAMIA
EQSDGTETDRAGRVIVEPDLTVKGHPYVFVVGDLMSVPGVPGMAQGAIQG
AKYAAGIIKQAVKGQDNPAERKPFRYVNKGSMALISRYSAVAQVGRVEFA
GFIAWLAWLLLHLYYLIGHRNRLAAMFAWGISFLGRTRGQMAITSQMIYA
RPVVEWLERQAQDGTLAAAEHVDSAEKQAG
41409971NP_962807.1 O-succinylhomoserine sulfhydrylase [Mycobacterium avium subsp. paratubeMSQAGDDSVRTPPALPDGVSQATIGVRGGLLRSEFDETAEALYLTSGYVY
ESAAVAEQSFTGELDHFVYSRYGNPTVTMFEERLRLLEGAPAAFATASGM
AAVFTSLGALLAAGDRLVAARSLFGSCFVVCNEILPRWGVQTVFVDGDDL
AQWEEALSVPTAAVFFETPSNPMQSLVDIAAVTELAHAAGAKVVLDNVFA
TPLLQQGIPLGVDVVVYSGTKHIDGQGRVLGGAILGDRDYIDGPVQKLMR
HTGPAMSAFNAWVLLKGLETMAIRVEHSNSSAHRIAEFLETHPAVRWVRY
PYLPSHPQYDLAKRQMSGGGTVITFALDCPDDKAKQRAFEVLDKLTLIDI
SNNLGDAKSLVTHPATTTHRAMGPEGRAAIGLGDGVVRISVGLEGTDDLI
ADIDRALG
41409970NP_962806.1 hypothetical protein MAP3872 [Mycobacterium avium subsp. paratuberculosMSTERAHSYAGDVSPLEAWKLLSDNPNAVLVDVRTDAEWRFVGVPDLSSL
GREVVFLEWNTSDGRHNPDFADQLRRQIEPAPAGQERPVLFLCRSGNRSI
GAAEVATQLGITPAYNVLDGFEGHLDANGHRGETGWRAIGLPWKQG
41409969NP_962805.1 phosphoribosylglycinamide formyltransferase 2 [Mycobacterium avium subsMTDGVTDGRDDETTALAVPRPAPADRGPAPADGSPAPADGRPAVMLLGSG
DISRELAIALGRLGARVIAVDAHPQAPAHAVADQALVLPSTDAGELSAAI
HRLRPDVVVSTTDAVAVPALEALDGTGAEPVPSARAVRLAADREGLRRLA
ADELGLPTAPFWFAGSLGELEAVGAHAGYPLLVKPVVGAVGPRQSVVAGR
EDIAAAWHRAVDGQPGARVLAETVVEVQFHVTLLAVRSEGAAGPAIEFCS
PIGHRGAGGRVLESWQPQKMSPAAMDAAKSIAARIVKALGGRGVFGVELM
VNDDEVYFADVTAHPGDSAWVTVRSQRLSAFELQARTILGLPVDTMMVSP
AAARVVDSADPGDRAALSGALGVPESDLRVCGGGFRALATAPEVAAARER
AGQVAARLTAGAGGVVGAGG
41409968NP_962804.1 hypothetical protein MAP3870 [Mycobacterium avium subsp. paratuberculosMTEPDPTELDPEYEHHGGFPEYGPASPGPGFARFVESMRRLQDLAVSADP
GDDVWDDAAERVAALVELLDPFEADEGAAPAGRTPGLPGMGSLLLPPWVL
TRYGPDGVEMTGHFSRFHVGGNHAVHGGVLPLLFDHMFGMISHAAGRPIS
RTAFLHVDYRKITPIDVPLLVRGRVTGTEGRKAFVAAELVDGDQTVLAEG
HGLMVRLLPGQP
41409967NP_962803.1 adenylosuccinate synthetase [Mycobacterium avium subsp. paratuberculosiMPAIVLIGAQWGDEGKGKATDLLGGRVQWVVRYQGGNNAGHTVVLPTGEN
FALHLIPSGVLTPGVTNVIGNGVVVDPGVLLDELKGLEDRGVDTSRLLIS
ADAHLLLPYHVAIDKVTERYMGNKKIGTTGRGIGPCYQDKIARIGIRVAD
VLDREVLTHKIEAALELKNQILVKIYNRKALDPHQVVECLLEQAEGFRHR
IADTRLLLNTALEAGETVLLEGSQGTLLDVDHGTYPYVTSSNPTAGGAAV
GSGIGPTRITAVLGILKAYTTRVGSGPFPTELFDENGEYLSKTGGEFGVT
TGRRRRCGWFDAVIARYATRVNGITDFFLTKLDVLSSLETVPVCVGYRID
GARVNEMPMTQSDLHRAEPIYEELPGWWEDISAAREFDDLPAKARDYVLR
LEELAGAHVSCIGVGPGREQAIVRRDILAARP
41409966NP_962802.1 hypothetical protein MAP3868 [Mycobacterium avium subsp. paratuberculosMLRTPLCRAGAVLASVVLLCSASATASADESIVIDLVRHGQSVANAAGLI
DTAVPGASLTQLGQQQAQTVAGVLAARGPVAAIFASQLIRTQQTAAPLAT
ALGMNVQVLPGLNEIDAGIFNGQPQFSLGGLAYLLAPIAWMLGLRIVPML
APGSADANGYEFRRRFDGALQTVYGSAAANAGGFGDVLQAVYAGAVTNPV
RAANGRITGVAFSSEFAIGVGTMMTVKNPDPLLLLFDPLPNTGIVVIQGS
PRDGWTLISWNGKPVHPGWSATRNGRGANGLCLMLDPSTPTGVCAAKPPG
PASAPVTARPGLS
41409965NP_962801.1 hypothetical protein MAP3867c [Mycobacterium avium subsp. paratuberculoMLGDKDIGCSPIGWAVTQQDRAAAVLQFGRRHGYRPLRGMPTHRVAGDTD
VDAAIGPYRRLIVLGGDAELALVLTRLLRAERLDVEVAYVPRRRTRATRN
YRLPTGFRAARRAARGAARRVPLIRDETGSAIVGRACWAAPGGQRWLHGE
AVVDDTTLFDGDVTAVWIEPTAAMPGLRAAVAGRPWRRWVTGRAAQLGST
GATVLRDGVPAARPARRSAFYRNIEGWLLVR
41409964NP_962800.1 hypothetical protein MAP3866c [Mycobacterium avium subsp. paratuberculoMSFRAPQHESVRPSPIFLALLGLTALGGALAWLTGSSPRPLAYLGVFVFV
IAGWLVSLCLHEFGHAVIAWRFGDRDAAVRGYLTLDPRRYSHPALSLVLP
MVIIALGGIGLPGAAVYVQTWFMTPARRTLVSLAGPAANLVLAAVLLALT
RAFFTADHAVLWAGVAFLGFLQLTAVLLNLLPIPGLDGYDALEPHLSPET
QRALAPAKQWGFFTLLFLLLAPGLNRWFFGIVYWLFDFSGVPHWLAGAGN
VLTRFWSRWV
41409963NP_962799.1 hypothetical protein MAP3865c [Mycobacterium avium subsp. paratuberculoMGAGHNHTPAETGDARLIPRMVMAAAILAAFFVVELVTSLLINSIALLAD
AGHMLTDVVAVFMGLAAVTLARRGSSSPARTYGWHRAEVFTAVANAGLLI
GVSVFILYEAIQRLREAPAVPGVPMIAVALAGLAANFVVALLLRSHSSGS
LAVKGAYLEVIADTVGSLGVLIAGVVTVTTRWPYADVVVAVLVALWVLPR
AISLARDALRILSESSPTHIDVEELRAALGAVDGVTGVHDLHVWTLSPGK
DMCTAHLISTGDSARVLRDARAVLSARGLAHATVQIDCPDDTECSDSF
41409962NP_962798.1 hypothetical protein MAP3864 [Mycobacterium avium subsp. paratuberculosMVEVRPAGETSELQNRAMTPMGDLLGPDPILLPGDADAEAELAAGENPGI
VAAAHPTASVAWAALAEQALADDRAITAYAYARTGYHRGLDQLRRNGWKG
FGPVPYSHEPNRGFLRCVAALARAADTIGETDEYLRCLDLLDDCDPAARK
ELGL
41409961NP_962797.1 hypothetical protein MAP3863c [Mycobacterium avium subsp. paratuberculoMPNPPEPGRGGPPKRPGFDPRASRASDEWTPETGEEPDGGFDSSEDATES
VPMVPSDAETETVVINKPDPPSGPQETPDGPQRERRFTAPGFDAKETTII
ATTPEPATEAFVPPGQDNTTQFGVPPKAAVPQSIPPRLGGKLRTSRQINW
GWILALVVIVLALAAIAILGTVLLTRGRHTNVSQEDQVRHTIGNFDAAIQ
RGDLTTLRSITCGTTRDGYADYDEHAWAETYRRVSAAKQYPVIASIDQVV
VNGQHAEANVTTFMAYDPQVRSTRSLDLQYRDDQWKICQSASG
41409960NP_962796.1 hypothetical protein MAP3862c [Mycobacterium avium subsp. paratuberculoMSTAVTALPDILDPMYWLGADGVFGSAVLPGILVIVFIETGLLFPLLPGE
SLLFTGGLLAAHPNPPASIWVLAPAVAIVAVLGDQTGYFIGRRIGPALFK
KEDSRFFKKHYVTESHAFFEKYGSWAVILARFAPFVRTFVPVIAGVSYMR
YPVFLGFDIVGGIAWGGGATLAGYFLGNVPFVHHNLEKIILGILVVSLMP
AFVAAWRGYRGRRRPTRTPERESERLPASE
41409959NP_962795.1 ScoB [Mycobacterium avium subsp. paratuberculosis K-10]MSKVHPDAESALHGLLKDGITVAAGGFGLCGIPEKLIQALVDSGIKDLTI
VGNNAGVDDFGMGLLLKGRQVKKVIASYVGENKEFERQVLSGELDLVLTP
QGTLAEKLRAGGAGIPGFYTRTGYGTTLAEGKDTRVFDGVEYVLEEGIRA
DLAIVKAWKGDKAGNLVYRKTARNFNPMIATCAAVTVAEVEELVEVGDLD
PDLIHTPGIYVDRIIQGIGYEKRIEFRTTSGGAALKNDSPIRERMAQRAA
KELRDGYYVNLGIGIPTLVANFIPDDIQVTLQSENGLLGIGAYPSEDTVD
PDLINAGKQTITSLPGSSFFSSADSFAMIRGGHIDLSILGALEVASNGDL
ANWMVPGKMVKGPGGAMDLVSGVKRVIVLMDHTAKDGSPKVLEQCTLPLT
GKGVVDMIITTLCVFDVEPGRGLLLTELHPGVTVEEVRAKTGCDFTVAL
41409958NP_962794.1 hypothetical protein MAP3860 [Mycobacterium avium subsp. paratuberculosMHTRRRWAAGREAGSSGMDQLWANRAASCEAAVTQRHLRRLWGLPATQLG
VVAWPPARRERLFGTWHYWWQAHLLDCLVDAQQRDPQPQRRARINRQVRS
HRLRNNLSWTNSYYDDMAWLALALERAARIAGVHRRKALPKLANQFLRAW
VPEDGGGIPWRKSDQFFNAPANGPAGIFLARYGDHLKRAEQMANWIDETL
IDPETHLVFDGIKAGSLVRAQYTYCQGVVLGLETELAARTDGPARQRHAA
RVRRLVAAVAEHMAPAGVLAGAGGGDGGLFAGVTARYLALVATTLPGSVA
EDVAARDTARRIVLASAKSAWDYRQTVDGLPVFGPFWDRDAQLPTAGGKQ
AEFVEGAVTASEIAERDLSVQLSGWMLMEAACNVSAESSHENRSAL
41409957NP_962793.1 hypothetical protein MAP3859 [Mycobacterium avium subsp. paratuberculosMDAAMSEPGPTEWSATPSAGVGPWRGELPDDPRYDPILLRDGDTRNVVDA
YRYWSREAIIADIDRRRHPLHVAIENFGHDANIGSVVRTANAFAVHTVHI
VGRRRWNRRGAMVTDRYQRLCHHDSTAELLDFAAAAGLTVVAVDNVPGAA
RLEETTLPRECLLVFGQEGPGITDDTRTGATLTVSIAQFGSTRSINAGVA
AGIAMHAWIQQHADLSQAW
41409956NP_962792.1 hypothetical protein MAP3858 [Mycobacterium avium subsp. paratuberculosMHCCARLLAIVACLLACVTACSNPHPAARPYGAQGARLGESLALLGWNMS
VSNLRWDGDYVLVDVDASPASAKGPHAKPEDIRFGLYGALAHPMEATGLG
SCDSTTTSLHDVPAPLSAPPDRLTGTVCLGPLKDRSQVRGVYGYSPRDRI
PNSSSAYPVAFPVGLLPTNPNDSGGLAVKTASLSAWRADGTPVTKAQLGD
PGAFTGNGYMLLGLEATAVAARYRDESVQRGGPMMLLASPTLPGRGLNPA
CAAYGSSVLILPDASLDAVHVNASLCTQGEINDALLYATLAIDGTHAGVW
TQR
41409955NP_962791.1 orotate phosphoribosyltransferase [Mycobacterium avium subsp. paratuberMAEPELEELAELVRRLSVVHGRVTLSSGKEADYYVDLRRATLHHRASALI
GRLMRELTTDWDYAVVGGLTLGADPVATAIMHAPGRPIDAFVVRKSAKTH
GLQRLIEGSEVAGKRVLVVEDTSTTGNSALTAVRAVQQAGGHVLGVATVV
DRATGAAEAIEAEGLPYRSVLGLADLGLG
41409954NP_962790.1 hypothetical protein MAP3856 [Mycobacterium avium subsp. paratuberculosMPRPVALITGPTSGIGAGYARRYASDGYDLVLVARDVDRLTALAGELRDR
AGNIEILPADLGDAADRQRVAERLAAGVRVLVNNAGFATSGDFWHTDPAL
LQSQLDVNVTAVMHLTRAALPAMLDAGAGTVINIASIAGLLPGRGSTYSA
SKAWVISFSEGLSVGLQGTGVSVHAVCPGYVRTEFHARAGIDMSKSPSFL
WLQVDDVVDQSLADIARGKVISIPGLQYKAIVAAERLIPRTLMRAITKRV
GGGRGRT
41409953NP_962789.1 hypothetical protein MAP3855 [Mycobacterium avium subsp. paratuberculosMVPLWFTLSALCFVGAGVLLYVDIDRRRGRSRRRKSWARSHGFDYEREST
DILKRWKRGVMSTVGDVAAQNVVLGQIRGEAVYIFDLEEVATVIALHRKV
GTNVVVDLRLKGLKEPRESDIWLLGAIGPRMVYSTNLDAARRACDRRMVT
FAHTAPDCAEIMWNEQNWTLVAMPITSTRTQWDEGLRTVRQFNDLLRVLP
PLPEETPQEAPAAPRNSSPSRPLAPAGRAELPPRRAQQDVAGLLGPDVQP
GRRAAEPVRRDQPRPEARPDTLRRPPPGGRNGHQATNYQR
41409952NP_962788.1 hypothetical protein MAP3854 [Mycobacterium avium subsp. paratuberculosMQQPLAEGLLMRSSRYAVVGRRFWELVRAGMSADDAGVAVGVSMAAGRLW
FADAGGVRPRFVDQSIPRRRPRLTVEEREEIQDGVARSESIRVIARRLGR
HPSTVMREIERNAICRGRYRARYRFGVRWRGGHDPRPRYRASLAHTRAHV
KARRSRPGKLATNQLLHDEVQTRLNEQHSPQQIAWRLRRDFPDDAEMWVS
QETIYQAIYVQGKGNLRRELHTCLRTGRALRKPRRRPGERRGHLRDMVNI
SERPPEVADRAVPGHWEGDLILGSTASGSAIGTVVERTTRFVMLLHLPDG
HGAEAVQEAIVAKMAGLPATLRQTLTWDQGKEMANHAAIAAATELDIYFC
DPHSPWQRGTNENTNGLLRQYFAKGTDLSAFPADYLDYVASKLNRRPRQT
LDWKTPAEALDELLCKPFTPPAVA
41409951NP_962787.1 ClpB [Mycobacterium avium subsp. paratuberculosis K-10]MDSFNPTTKTQAALTAALQAASAAGNPEIRPAHLLMALLTQADGIAAPLL
EAVGVEPATIRAEAERMLARLPQASGASSQPQLSRESLAAITTAQHLATE
LDDEYVSTEHLMVGLATGDSDVAKLLTGHGASPQALREAFVKVRGSARVT
SPDPEATYQALEKYSTDLTARAREGKLDPVIGRDNEIRRVVQVLSRRTKN
NPVLIGEPGVGKTAIVEGLAQRIVAGDVPESLRDKTVIALDLGSMVAGAK
YRGEFEERLKAVLDDIKNSAGQIITFIDELHTIVGAGATGEGAMDAGNMI
KPMLARGELRLVGATTLDEYRKYIEKDAALERRFQQVFVGEPSVEDTVGI
LRGLKDRYEVHHGVRITDSALVAAATLSDRYITARFLPDKAIDLVDEAAS
RLKMEIDSRPVEIDEVERLVRRLEIEEMALAKEEDEASKERLEKLRSELA
DQKEKLAELTTRWQNEKNAIDVVRELKEQLETLRGESDRAERDGDLAKAA
ELRYGRIPEVEKKLEAALPQAEARENVMLKEEVGPDDIAEVVSAWTGIPA
GRMLEGETAKLLRMEDELGKRVVGQKRAVQAVSDAVRRARAGVADPNRPT
GSFMFLGPTGVGKTELAKALADFLFDDKRAMVRIDMSEYGEKHSVARLVG
APPGYIGYDQGGQLTEAVRRRPYTVILFDEIEKAHPDVFDVLLQVLDEGR
LTDGQGRTVDFRNTILILTSNLGSGGSEEQVMAAVRSAFKPEFINRLDDV
IIFHGLEPGELVQIVDIQLAQLQKRLAQRRLTLEVSLPAKQWLAHRGFDP
VYGARPLRRLVQQAIGDQLAKQLLAGQVHDGDTVPVNVSPDGDSLILG
41409950NP_962786.1 hypothetical protein MAP3852c [Mycobacterium avium subsp. paratuberculoMSGCSTPSRLSLFRSTLSSFGRPGVRGTRRAMTQTTQPLMRTQVRADIPD
SERDPARARRGGKRVARLRAGAVCWLAIAVCCLAAAGLAATGARTGLGGG
SPAPVVPEAGTLQVSGAGTTKSLPCHAGYLSVSGKDNTVTLTGHCTSVSV
SGNGNRIAVDSSDAVSAAGAGNVVVYHWGSPKVVNAGSGNVVRQG
41409949NP_962785.1 hypothetical protein MAP3851c [Mycobacterium avium subsp. paratuberculoMSLEDAEALRVLRDAFAPCDAGRPGDSGDLVHRFYTHWFALDPSVRDLFP
PEMGAQRVAFGHALHWVYGELVARRAQEPVAFLAQLGRDHRKYGVLPRHY
QTLSRALLATLRSHLDAAWTDAVEDAARTSLNLITGVMSGAADADEGPAW
WDGTVIEHLRVSRDLAVVRLRLDQPMPYHPGQYVNVQVPQCPRRWRYLSP
AIPADPGCGIEFHVRLVPGGLVSTAIVNETRPGDRWRLSSPHGGLRVDRD
GGDVLMVAGSTGLAPLRALIMDLSRFAVNPRVHLFFGARYRCELYDLPTL
WQIASHNPWLSVSPVSEYRADPPWAADYPDVTPPRGLHVHQTGRLPEVVT
KYGGWGDRQVLICGGPRMVAATKAALIAKGAAAQRIQHDPLSR
41409948NP_962784.1 hypothetical protein MAP3850c [Mycobacterium avium subsp. paratuberculoMDVVALRDPVSSVVARFVPRAGMIGTSLRDGEVELLGQRRGLDAYVADGK
TMGIPILYPWANRLGGNTYAAEGAAVTLTPGRNGVRADPNGLPLHGVLAG
YPGWRVTAQTANELTAQLDFGADPKLLAGFPFPHLLQVAVRLAGRTLTLT
TTVTATGDTAVPVCFGFHPYLQLPGVPRAEWVIETPPLRHLGLDDHGLPT
GESELQPARREPLRDKTFDDAYDRVDEGAVFAVSGGGRRLEVCFEHGYPA
AQIFTPPAKPGEEAVICFEPMTAPTDALRRGGYRRAHPGRRAATRFSIRV
41409947NP_962783.1 hypothetical protein MAP3849 [Mycobacterium avium subsp. paratuberculosMSEHIRTPASLARRPTVAVLGAGIAGLTAAHELAERGFVVTVYEAQQDER
NGLGSEPAGAYPPVKLGGLAASQYSTVGTHDGSHAELRPFPGRPSRPTDL
GRAVAGEHGFRFFPAYYLHIWDLFQRIPVYELRNPGGWAPTARTVYDNVR
RVITQGVTIDGKPSLVFPRELPRSGAEFLGILGQLATVGLTFGDVATFQG
RMLRYLVTSPLRRARELQNMSAYDFFVGHDRRTGLNQYSYTPRCDALLRQ
MPKVLVAFDSRWGDARTNISTYLQLYLNMDRRDDKADGVLNGPTTESWFD
HWYRHLVALGVRFVRAAATRLDPVPVDPSRPPHLRPRVQITLTDGTRVTP
DYIVVAVDAPGAEFLTAPMRAAGTGGTVAGLDGFATSVPPPDGPLQPQST
RPRQRRDPYSMDELGRVPWDRFQTLCGIQYYFDTEFQLLRGHLLYAGTEW
ALSSINQTGMWERPPILDRDGHVSVLSVDIGDFNAASSHLVDESGRGKAA
RDCTPDEIATEVWRQIVAALTSSTGPAGEEFMPRPVWYALDRGLIMESGP
GQGRGRAVRNATPYLVPIVGDWDNRPSSDPWNPHGTSWSSVPPEDWWLED
LWRRNVWQARHGGYQVHNNAVVFAGTWNKTFTRLTSMEAACESGRHAVNA
ILDHYIWVQSGGLDRREKTTLSWEFPFGFLDQGLSSPIRMPTPAGDYCYV
FDIENREPADTRALRILDSRFCEWSLPHPLDVGAPTSFIPPPAGGQEMFG
PTTDYNQQLLAYLQAWRELLERWTAMSAATPSPAAPFTPPAAPFTPPFMP
PAAAPAPMPPAPADYTQQLFGYLQAWRQYLEQMAGASSGSAQQPTAPPTA
PPTMPPTMPPPPPPPSTPSTGGQAFGAAPPGQPGTSGDPTPGGSTPVSAT
AKGSTLTWPPPLLGLEPSSYVGTQDPPVSRFLPPNLVNRAEDRQEVLLRP
NDEYGYLHDLFSLNPGLARAISSTGPAPVASGSSFLGAMNRVGPDVSARV
APRSLFSSRAARAPSAGAITPGSRTG
41409946NP_962782.1 hypothetical protein MAP3848 [Mycobacterium avium subsp. paratuberculosMVAMSTVLARSDFLRAPMLATARPAGFKEWHHFVVHGRGVRLLINFSFNN
EAFGADGARLTPRVIVIARDERWTGAVARFDERAVHVSADLGELSVGGNR
MTIVPDGYRVAIDLPDKDIHGELHFTSTSRPFVVRNEPAGEGRVSWLFVP
RLRADGWLRIGGADHRVCDDLAYHDHNWGRFRWGDDFGWTWGTILPAEPD
DPWSMVFAQITDRSRLRCVSRSLYVWHRDEPAAIFRHAAVRARTEGPLDR
PADCTLPPPMRLLLDGEVPGVPERIEITATRAADTVRAEFRSRSYVRLAQ
PSETRLDRSTVLCETDGTVAASGTVRGEKFDFAGTGVFEFLHG
41409945NP_962781.1 hypothetical protein MAP3847 [Mycobacterium avium subsp. paratuberculosMTLTDPRDALADQSDFIGYLVGLAGLADVVHTLAGDGPRAAADPRAPDDF
VHLLLGVASVGAGIARLADSTVAQSFPAAGMASTARWLR
41409944NP_962780.1 IdsA [Mycobacterium avium subsp. paratuberculosis K-10]MTSTLPDARPAVAALNPLEDYLAACKQACDREIVRLYGSGERGSNGLYQL
ILDYPLRGGKALRPALSIATCLGLGGHLEAILPTAATLELYHNAFLIHDD
IEDESWWRRGKPTLHIDYGVPVAVNVGDAMLSLSLQPLLDNVERVGLGPA
LRILRAVATMTRKTVDGQALELDWVHSNTWRLDDADYLEMVELKTSWYSF
ITPLQAGTVAAGATPDRMAPLESLGRHLGAAFQITDDLLNLRADPQEYGK
EIGGDLWEGKRTLMLLHTLRHAEPGDQQRAVQILSRRRPSPDAEFDLTEL
LDRLTAGGQLSVSGRTEIDARLRRHHHSEVKSLNDIRWLYELMHRVGSLN
HARDVAVRQARQAAAVLAGLDWFPRSRHRDMLAALVDYVHGRAR
41409943NP_962779.1 hypothetical protein MAP3845 [Mycobacterium avium subsp. paratuberculosMIWATGRRAAPMYLNAERLALANQTVKETFEQCSVAWQAIPHWDTGDPSQ
TTVPNDNVNPPNNFLPLTSLPKPFEVTLAAAIAPTPDELLATVVYYTAKL
AADFDAAVIPGLLTATTPSQLVPGISPAQLLTALIEARAKVEKGGYRAPS
CLITDTIGVETLAASTIANGYAGTDVLLPPANINSLQRVDTLATDPQVRG
WLLGRRQRIAPGAAAEASPGEEAVDLAVSVPPSLEVVGDTSNNAIKLDVR
LSYALRIKDEAGLVVFRA
41409942NP_962778.1 hypothetical protein MAP3844 [Mycobacterium avium subsp. paratuberculosMTDRQRELARLRAAVDAAARGGGECVLISGVPGVGKSALMKAFGVEVAGR
GCVFAYGRCRDGAPAPYAAVRDALGSLVRTMAATAPAERDRWRADLAGGV
SPIAGVLGELVPDLPRVLGETASHPELDATDSRRQLHRAATRLLSATASY
RTVVLAIDDLQWADRDTLLLLAELLTVSLRDVLVVGAHRAGGFDPAAAGI
AAENLTTIELEPLARDDVEELLATVCGKSGELPEVAAEFHHRTGGNPLQV
RQLLYRAQREGALLPVGSGGPPRWDLRVLTSIEVSATAAEFLGRYLDQLR
SADREVLSALSCIGGEFDLDDAAAAAARTPDVVAHALWACLELRLLEALD
MTGQRISNAISRDARYRFSHDRVAEAARAGLSPDEMRAVHLRIGRRLITL
GDDRLFEAARHVGVGGLAVADEAERTRFVEVLRRAAHQARAQASFPLALG
YCRDALDLLGEQRWAGQFALTRELALDAADAALRVGDVPVLNALLEEAEE
FLREPPDRARLAYLRMKGRVAENRLQEALEIGLAALDELGERVATQAGKP
RMGNAIVRMRLTMARWSTERLLQLPHCTDQRVIALHPILAELCNMAVLVR
PNLLPLLVRKQLELTLAHGHTSSSPLVITGYGIILVLLGDHAGSQRFGEV
GMLLAQRPELREARPQTVFMYLDYIHHWRHPIRDGLGELRDAVEEALDRG
DQENAGFLTAVLLSQSFWVGRPLPEIDALASSLIPHIRSQPVPSALCQAV
QQLCLNLMGRSADPFLLAGESAYDERQVLPAARQQGDEVALGAAAAIKQG
LHFWCGDHAGAAEATTEAIEHLGGLAGVAASQLVHLIGALSMIHCAPRDS
ATIRFVRQALASHRKWAAGAPENYAAPYALIQGAWARARGQHGKAERHLH
QAIELAEEHRLPAIGARAHEEAAALYAETGRQTLREHMLRSAYQRWLNLG
FAVRADWLAREHPWLLRRDLRTGSAGIDPIGAHQLVHALSGARTPDALAN
IILGSVADTTGAGRVLFITGEADNQSVRAIHDHGEVLIVEGPWTEVPYRR
DIVRRVIDGGAPVSVAADRAAATNSVLAAPITLHDRTLGVIYAEQGEPGR
NFGADHEEAIAFLCAQAAAPLWSFQLEARLRAADEYRQSLIDVQSRFVPN
ELLRILDIDDLRRVRNGHRVEREMTVLISDIRSYTAMIEDMNVAEAGNLA
MGFLRAVELPIISYHGMIQDVRGDEIVAVFESEADAVRAGLGMLRSLHEH
NQERRALGSEELRAGIGINTGAVAVGLVGGVNRMVLTIIGDAVNLAARIE
STNKRYGSALLISDRTYQRIAGSEEFDVRRMERVMVVNRRRPVTIYEVYN
GDSGPLRAAKRAAQPAFDEAFALFDAGDVDAARAAFQRCRDMLPDDPIAP
LHLAHCDAVARGEMLPGQEIALQNK
41409941NP_962777.1 HspR [Mycobacterium avium subsp. paratuberculosis K-10]MAKNRKGHESRTFLISVAAELAGMHAQTLRTYDRLGLVSPQRTSGGGRWY
SEHDVDLLREVQRLSQDEGVNLAGIKRIIELTNQVEALQARVKELTEELA
QVRAGQRRDLAVLPKSTALVVWQPRKGGTRT
41409940NP_962776.1 molecular chaperone DnaJ [Mycobacterium avium subsp. paratuberculosis KMAQREWVEKDFYKELGVSSDASPEEIKRAYRKLARDLHPDANPDNPAAGE
RFKAVSEAHNVLSDPAKRKEYDETRRLFAGGGFGGRRFDTGGFGGFNVGG
DGAEFNLNDLFDAAGRSGGTNIGDLFGGLFGRASGGRPSRPRRGNDLETE
TQLDFVEAAKGVAMPLRLTSPAPCTNCHGSGARPGTSPKVCPTCNGSGVI
SRNQGAFGFSEPCTDCRGSGSIIEHPCDECKGTGVTTRTRTINVRIPPGV
EDGQRIRLPGQGEAGLRGAPSGDLYVTVHVRPHKVFGRDGDDLTVTVPVS
FTELALGSTISVPTLDGKVGVRVPKGTADGRILRVRGRGVPKRSGGHGDL
LVTVKVAVPPNLDGAAQEALEAYAAAERASGFDPRAGWAGNR
41409939NP_962775.1 hypothetical protein MAP3841 [Mycobacterium avium subsp. paratuberculosMTQGNQKTEGNPPEQVTVTDKRRIDPETGEVRHVPPGDTPGGTAPQAATA
ESGGAATDKVAELTADLQRVQADFANYRKRALRDQQAAADRAKAAVVNQL
LGVLDDLERARKHGDLESGPLKSVADKLESALTGLGLTAFGEEGEEFDPV
LHEAVQHEGDGSKPVIGTVMRQGYKLGDQVLRHALVGVVDTVTEEGDGEA
AATDEPTAAAAETRPPESDDNAGASGD
41409938NP_962774.1 molecular chaperone DnaK [Mycobacterium avium subsp. paratuberculosis KMARAVGIDLGTTNSVVAVLEGGDPVVVANSEGSRTTPSIVAFARNGEVLV
GQPAKNQAVTNVDRTIRSVKRHMGTDWSIEIDGKKYTAQEISARVLMKLK
RDAEAYLGEDITDAVITVPAYFNDAQRQATKEAGQIAGLNVLRIVNEPTA
AALAYGLDKGEKEQTILVFDLGGGTFDVSLLEIGEGVVEVRATSGDNQLG
GDDWDDRIVNWLVDKFKGTSGIDLTKDKMAMQRLREAAEKAKIELSSSQS
TSINLPYITVDADKNPLFLDEQLTRAEFQRITQDLLDRTRQPFKSVIADA
GISVSDIDHVVLVGGSTRMPAVTDLVKELTGGKEPNKGVNPDEVVAVGAA
LQAGVLKGEVKDVLLLDVTPLSLGIETKGGVMTKLIERNTTIPTKRSETF
TTADDNQPSVQIQVYQGEREIAAHNKLLGSFELTGIPPAPRGVPQIEVTF
DIDANGIVHVTAKDKGTGKENTIKIQEGSGLSKEEIDRMIKDAEAHAEED
RKRREEADVRNQAESLVYQTEKFVKDQREAEGGSKVPEETLSKVDAAIAD
AKTALGGTDITAIKSAMEKLGQESQALGQAIYEATQAESAQAGGPDGAAA
GGGSGSADDVVDAEVVDDDRESK
41409937NP_962773.1 hypothetical protein MAP3839c [Mycobacterium avium subsp. paratuberculoMPMSTDELDQLLLDRFNLRRSDLIAALKTLSAHRPWAATLTTDEARLLDD
AGFTEDPGAYAEIAADVTAHMARLYGTAYSAADVSKGLGVNDSRVRQRRL
AHTLWAIDDGGTWVYPAIQFEIVDRGRDEPLTLKQVRGLDAVLPALLARD
LHPTAVAGFLMTAQPDLRIDGQPKSVRDWLLHGESVGPVLELIEIADWTA
T
41409936NP_962772.1 hypothetical protein MAP3838c [Mycobacterium avium subsp. paratuberculoMLPEPPAPHILRSLGIGDDEMRAIGVDEIWWRVHRTAGEHVLAWNALRTF
GPVLRFDPHPLPRGEHARHGVWYGASSPCAALGEAYQVDRTIDRERGRPY
LTGLSFTRPLRVLDLAADSRGAWATRVGGTFAISTARHTVTQQWAQHITA
AFPHLDGLRYNSRFAGDPCLVLFPPAASAMPARPRLSLPLAHPDLAGRVA
GAAKRLGYGVV
41409935NP_962771.1 LpqJ [Mycobacterium avium subsp. paratuberculosis K-10]MSGERQVRLSENARRSLAGGALLLVVLPGGAGLVSGCSTVIGGRPVASPG
AGPTEPSFPTPRSTPPSATAAPAPTALPPPSPSAPAGAIPLPPDQNGYVY
IETKSGSTRCQINKDTVGCEAPFTNSPLQDGEHANGVSINAGGKVQWVLG
NLGAIPTVKLDYRTYSAQGWTIVANADGTRFTNDQTKHGMFVSIEKVNTF
41409934NP_962770.1 hypothetical protein MAP3836c [Mycobacterium avium subsp. paratuberculoMQLKHLTIAELVAGAGGDPWEVNRTLQAGRPAQIERLAEAFHGAGRHTAE
SDHAFAQAQQRFNAAWNHQDGGPNPINSSAEVQRTVKSLGAQSEQLPKIG
ADLENIAAALSEAQKSGAAEIATLEGQLEQLDHMIDLAEQDLRDHPDAAS
QQELHAIIKALRTAAVNDTKDALGQLHATRDSYSSSLRKAQTNLANDGYD
PTSTFGADAHEAETPDQARQDVTDALAGDKGAASRVNGVLNSITPDQLAG
KVPLTAEQASVLSQLQAQEHGMSMDALKTAEQRLGDEKGVIGNSLQLMSN
PNLMFPQTPLSIGAKQGTDMVKGGANQLPTSVQQLLNSPRPDLRHLNQLA
DIVKDGNHTFQANTDLDRGMVKQASTLMNSPFWRAGEGGPGDLNPGIDPT
VSNVLSAASPDHQVVHDAMTTGDHDRFLQNLTHHSWQDHGQAVSSLFSWT
GDATQGPEASIAAQTAHAYSTYIGHHQQDLLNLPGNHTLGQVNPNLVQGM
AHGLGPYVDNIAGTTGGLPGFGDSLDNEGDTRSGALPVAKGVFSVLNSDQ
AAGQYFNGQAYAHAVAHEAAFGNEPTHSGYDTQLYDAATLKGLVDVGTHN
AYHANEVNGYHQQLSEYELKKQAYEAGLTGLGTVAGLPPGVGTVANPALN
VLGHGLENSILGPAPSAPGENPIQPMDIGVADQGMANAMLAAGHNVQLPD
GYVVYDDQHPHGRLATLDEARAKFPGLTASQYDGVIGPALSHAIALPPEE
KMSPDEWMAIRYDNVVGVPHADQGRPK
41409933NP_962769.1 hypothetical protein MAP3835c [Mycobacterium avium subsp. paratuberculoMTNVLRKFGGIATCVVFAVISIAGCHSGAHRSEASSTPATPPAGWPAALN
DFTFVWTAEPGIDVTAGPAVPVRAYTESYLLASIMGDNRYLYPGFQQSVD
PNQSINHPIGTQSLWPKTNAPQQQWIGTVQVHILSVTTADRDVTVVACEY
TFGTAQPARNGYEPNIGKPPPYSGIDPLRITMKAPAKPGPESPQRGPARS
PSVDVFNGWRITSHQGGYFAQSGVGDEWPNAIEDRNTCLAKAPQHPDLQR
GGEYPRTDFPTLPPSPGWPAPSAAS
41409932NP_962768.1 hypothetical protein MAP3834 [Mycobacterium avium subsp. paratuberculosMRDDDSANRWSGVREAPTAPSRQLTGAVVIIALVAAISGMLYGYDTGVIS
WALLQLTQDFNITEGWQQVIAASILLGAVAGALTCSWLSDLRGRRGTLLM
LAVVFIVGALWCADAADSVMLSLGRLVLGFAVGGATQTAPMYVAELAPPA
YRGRLVLCFQIAIGVGILTATLVGAGGSISWRGPIGLACVPAAIMLWLLL
RLPESPRWLVKKDNRDAARAVLEHVRPEGYDVAAELDEATELARVERTAA
TRGWRGLRDAWVRPALVLGCGIAVFTQLSGIEMIIYYSPTILTDDGVYRS
VALQVSVCLGAAYLIAQLVGLAIIDRVGRRRLTLIMVPGAAVSLFALGLL
FITSDSGRDVIPYIMICLIAFMLFNGGGLQLMGWLTGSETYPLAVRPAAT
ALQSATLWGTNLVITLTMLSLIKAIGVGPLMWLYALFNVAAWIFVFFRMP
DLTGKTLEEIEYQLSEGKFRPSDFGR
41409931NP_962767.1 hypothetical protein MAP3833c [Mycobacterium avium subsp. paratuberculoMPVADLVKSSSDEASYIVPERDSTHEPPDGCVGRHSRRREPTRYTGQDRR
CAVRVPTPRLPIGISGLAGAVSTIGAVASNGPRDEFHNQLTQHADFGMSQ
QPPTGELPPPGFPPDRPEGFEQPGNVDPFDQQAEPTPWYRRPAMLIAWVV
SVVVLIGLIVFGVIELIGGQQGVSHVPKSTTSTTTTTTTTTTPTTTTTTT
TPSSTSPGSSAEQPPAQQPSQQPGGGQTQQPSHHHRLPQLPPVITIPQVP
TVITVPPGLR
41409930NP_962766.1 hypothetical protein MAP3832c [Mycobacterium avium subsp. paratuberculoMRDMSEPLGLSIGVANLVAARAGSVPVIRSSVLTLFEQRPTEVGLPDENP
NLTEPGLVLRGFVERVGDRAPLVAADGTKYLGAALTVEAVEAMARAVGYG
APITIAVPAYWSDDQFAALREEFFAQSDLAREGVAPMLVSDATAALAMLR
GTPGFPSDGVIALCDFGAGGTTVTLMDGRAGFAPVGPSLRYTDFSGDAID
QLVLDHLLASDVSTAMLGGSGRIGSQSRLLGACRRAKEQLSTAVAATVAG
APGQGAQLTRAEFEQLISTPLDRFLDWCQEALRRNGIGNSTLRGVAIVGG
GASIPLLTARLSGRFGVPVHSTAQPGLSAALGAATLGAQYASGAAPTAAA
AAAVETPTEMVGAGGLDMTQAAWAAQATDVDDALAWSQDADTSDEPVPYT
GRDATGEYASEARRFDDAAAGGLPWYKRTALVLSVAGAGAAVLIALVLAI
NLLLTKSTQDRPTSPPSTPAPPQTVTITGPNDSTTVTVVPAPPPPSSEAP
PPPATTTTAPPEPSTTTTTTTPPPSSTTTTSAAPTTTAQPSTTSAASTTT
RVRPIPPIFQPPFGR
41409929NP_962765.1 hypothetical protein MAP3831c [Mycobacterium avium subsp. paratuberculoMTTQMLIRLVVGMGMTLIVAALAARRVLWLFKLITSGKPAPGHTDDPGKR
VWAEVSEVFGQRRLLKWSIPGLAHFFTMWGFFILLTVYIEAYGLLFQDNF
HIPIIGRWDALGFLQDFFATAVFLGIATFAVIRLMRSPREIGRSSRFYGS
HTGGAWLVLFMIFNVIWTYVLVRGSAVNNGTLPYGKGAFLSQLFGAILRP
LGQPANEYIETAALLAHIAVMLAFLIIVLHSKHMHIFTAPINVVFKRLPN
GLGPLLPIEYDGKPIDFENPPDDAVFGRGKVEDFSWKAMLDFATCTECGR
CQSQCPAWNTGKPLSPKLVIMDLRDHWMAKAPYILGDKQSPLESTPEGGV
GEELSGEKHAEAHHVPESGFGRVMGSGPEQATRPLVGTEEQGGVIDPDVL
WSCVTCGACVEQCPVDIEHVDHIVDMRRYQVMMESEFPSELSVLFKNLET
KANPWGQNASDRTNWIDEVDFDVPVYGEDVDSFDGYEYLFWVGCAGAYDD
KAKKTTKAVAELLAVAGVKYLVLGAGETCNGDSARRSGNEFLFQQLAAQA
VETLDGVFEGVETVDRKIVVTCPHCFNTLGREYRQLGANYTVLHHTQLLN
RLIRDNKLVPVTPVSQDITYHDPCYLGRHNKVYEAPRELIGAAGANLTEM
PRHAERSFCCGAGGARMWMEEHIGKRINHERVDEALATGAATVATACPFC
RVMVTDRVNDRQEEAGRSGVEVLDVAQILLGSLEYDKASLPEKGTAAKEA
EKRAAQAPKATATVEAPAKETTKEPAEAAPKAEAAPAAPAAPVKGLGIAG
GAKRPGAKKSAPAAEAKNEAPAEAKTEAPAAPAKGLGIAAGAKRPGAKKS
APAAQAPKTEAPKTEAKTEAASEAKTEAPAAPAAPVKGLGIAAGAKRPGA
KKAAPKAEAPKAEAEAAKAEAEPAPKAEPAKQTNGDDAPSQPPVKGLGIA
RGARPPGKR
41409928NP_962764.1 aminotransferase AlaT [Mycobacterium avium subsp. paratuberculosis K-10MDSDGTIGGVTTHQLPVHSSAHHRQQRTFAQSSKLQDVLYEIRGPVHQHA
ARLEAEGHRILKLNIGNPAPFGFEAPDVIMRDMIQALPYAQGYSDSQGIL
PARRAVVTRYELVDGFPRFDVDDVYLGNGVSELITMTLQALLDNGDEVLI
PSPDYPLWTASTSLAGGTPVHYLCDETQGWQPDIADLESKITERTKALVV
INPNNPTGAVYSGEILSQMVDLARKHELLLLADEIYDKILYDDAKHINVA
SLAPDMLCLTFNGLSKAYRVAGYRAGWLAITGPKDHAGSFIEGINLLANM
RLCPNVPAQHAIQVALGGHQSIEDLVLPGGRLLEQRDVAWSKLNEIPGVS
CVKPAGALYAFPRLDPEVYDITDDEQLVLDLLLQEKILVTHGTGFNWPAP
DHLRIVTLPWARDLAAAIERLGNFLVGYRQ
41409927NP_962763.1 hypothetical protein MAP3829c [Mycobacterium avium subsp. paratuberculoMERVTHSHSHGLPSGPAPVDRLPARIVVGLLIAIGVAVAAGAIVLWPSRQ
HVDIPMPLQNAAGGAVSTQAGHVLSSGLGDCGSPSVSQVLTGPPQPALPG
AGRCVLTQVAIDSGPNAGAATLLESSPGPGQPKFAVGDRIRIVRQVDDQG
ATSYAFYDFERGWALVGLAVAFAVVIVAVARWRGLLALVGILVAFVVLVT
FLLPALRDGAPAVPVALVAAVAILYAVIYLAHGVSLRTSAALLGTLSSLL
LAAGLSWAAIQLAHLTGLSDEQNSTVSAYLGSVSIGGLLLAGFIIGSLGV
LNDVTVTQSSTVFELARLGGSRRAIFTGALRVGRDHIASTVYTLVLAYAG
SSLPLLLLFSVANRSLTDVLTGESVAIEIARSAVGGMALALSVPLTTAIA
AVLAKPSGGRKRGEAGRGGPPPSV
41409926NP_962762.1 RmlA [Mycobacterium avium subsp. paratuberculosis K-10]MRGIILAGGSGTRLHPITTGISKQLLPVYDKPMVYYPLSTLMMAGIRDIL
VITTPHDAAGFVRLLGDGSQFGINITYVTQERPDGLAQAFVLGADHIGND
SVALVLGDNIFYGPGLGTSLRRFQTITGGAVFAYWVANPSAYGVVEFSDD
GMALSLEEKPKTPKSNYAVPGLYFYDNDVIEIAKGLKKSERGEYEITEVN
QIYLSRGRLSVEVMARGTAWLDTGTFDSLLDASDFVRTLERRQGLKVSVP
EEVAWQQGWITDEQLSERAQSLLKSGYGGYLLDLLERSRFH
41409925NP_962761.1 hypothetical protein MAP3827 [Mycobacterium avium subsp. paratuberculosMTTSEIATVLAWHDALNASDLDTLIALSSDDIEIGDAHGAAQGHEALRNW
AAARRGTAELGRMYVHDGVVSSNRRSPAPTTRAPSARPPRRSASCTTGSR
RCSGTTAWPRRWRPPN
41409924NP_962760.1 hypothetical protein MAP3826 [Mycobacterium avium subsp. paratuberculosMAPARERHAGVTLGAERERSLTGVDYAGAFLDENRAFAELFRDADESTPV
PTCPDWTLRQLFRHVGRGDRWAAQIVRDRLDSYLDPRMVEGGKPPPDPAD
AISWLHGGAQRLVDAVELTGVQTPVWTFLGPRPANWWIRRRLHETAVHLA
DAAIALGREFTLRPELAADAITEWLERVAVQAGGQGAPLPLDNADTLHLH
ATDPGLGDAGEWTVAVEQGRIAWSHEHGKGSVALRGGATDLLLAILRRRP
LADTGAELFGDDAVWQRWLDRTPL
41409923NP_962759.1 UdgA [Mycobacterium avium subsp. paratuberculosis K-10]MRCTVFGTGYLGATHAVGMAELGHDVLGVDIDPGKVAKLAGGDIPFYEPG
LRKLLNENLAAGRLRFTTDYDMAAGFADVHFLGVGTPQKKGEYGADLRHV
YAVIDELVPRLTTSAVLVGKSTVPVGTAAELNQRAAALAPRGVDVEIAWN
PEFLREGYAVQDTLRPDRIVLGIKQDSPRAQAAVRELYGPLLDAGVPFLV
TDLQTAELVKVSANAFLATKISFINAISEVCEAAGADVSLLADALGYDPR
IGRQFLNAGLGFGGGCLPKDIRAFMARAGELGADQALTFLREVDSINMRR
RTRMVELASAACGGSLLGANVAVLGAAFKPESDDVRDSPALNVAGQLQLN
GAAVNVYDPKALDNAQRLFPTLNYAVSVEEACERADAVLVLTEWRQFVEM
DPDDLADRVRARVVVDGRNCLDVTRWQRAGWRVYRLGAPRP
41409922NP_962758.1 hypothetical protein MAP3824 [Mycobacterium avium subsp. paratuberculosMDTVLGVSMAPTAVRMVLVEGENGDGATVDEDNFDVATSEDAATVTASDQ
VLSAILGTRQGAAEGGYQLASTGVTFTDPVEAAALRDKLAAHKVENVMLV
SAFLAAAALAQAVGHRTNYAHTALLYIEPDTATLAVVDSADGSIADVRRQ
PLPEDDEAAVAELASMVSNAENLETRPDAVFVVGSGIDIPLIKPALEAAT
TLPLTAPEEPDTALARGAALASAHAPLFASSTAALAYAQDPGTGAINPLA
VAPGYFETPADAGADGLAYSAVPDDPDEFFTGTQAAATELVDADYADRSS
FKLVGSAVAAIFVIGVVALVVSLAIAIRPTANVRPSPNQNVVVAPTRPAP
AAPAPAPVQVAPVPVPEAPAPAPAAPPPPPPAVAPIPVPIPLPIPGLGGP
GFGGPPGHGGGDGGGHGGGGFPGFPGGGGHGGGGFPGFGGGHGGFGHH
41409921NP_962757.1 hypothetical protein MAP3823 [Mycobacterium avium subsp. paratuberculosMAAARTLSKSRLTLKSRAPTRLRSHPAQQPTFGRFGGAVDVVLGVSMAPE
TVRMVLVEGESAGGLTVDQDGFDVTADATPAAAANHVVAAILETRDSATQ
GGYRLKSSGVSWTDPVKAAALRDALAARKIENVMLVSAVMAAAALAQAMG
SATNWARTALLLVEPTSATLAVVDTRNGTVTDVHRHPLPGHDDAALAKLT
AMVSGAESMRSRPDGLFLVGSDVDIPAIKPTLEAATSLSVTTPEEPEMAL
ARGASLAAANARLGAPRTVEMAPTHLSSTATAPPAAELAYSADTHDDPAS
EPTREGRSPKSVATIAAVAVIFVGGIVALAWALAFIRPHADQRPEVGTQV
VAPDNPPPPSAAPSPPPAAPVPAAPPPQAPVSPAPSPHSGDHEHWDDWLH
RHLGPGVPVP
41409920NP_962756.1 hypothetical protein MAP3822 [Mycobacterium avium subsp. paratuberculosMLPGGRVGQRSKWGRGLEAVAGIVLGVAMTPTKVRMVLVEGESADGVTVD
EDDFDVDTRRTALPGTAPDQVISAILGTREGAADSGYQLLSTGVTWTDHV
EAAMLRDALIAHKVENVMLVSAFMAAAALTQAVGDATNYARTAMLFVEPY
SATMAVVDTADGSVSEVRRRPLPEDEDQAVAELVDMAASAESLPTRPEGL
VLVGSGVDVPLIKPALEAATSLELSVPDEPEMALARGAALASANAPLFAS
STAALAYALDPGTGEVDPLALAGQSPGLLPGYQPEYHSRIAAQAADAGEG
KANVAYSAVPDDDAEAKTLIDLDERARRRKSLLLVSSTLPVIFIAAVVAL
GDRPGDQHPAHRRVAAQPQREHHRPRPGAAPARATGPGAAEDHAAAAAGR
AAPDRTTAPGPAAHRRPRSRPFAAGVRSAAARAARPPTRARSRPLRRPRP
VRWGPRSLRRARSVRRPRSLRRGSRPVRRAWSLRRRPRVRRRARVRWRPR
PPVARIPARLRV
41409919NP_962755.1 hypothetical protein MAP3821 [Mycobacterium avium subsp. paratuberculosMEGFVLNIVLGVSMAPSSIQMVVLEGEYADGATVEEDAIDVTGADDAATA
SAPDRVISAILGTREGAADAGLQLSSIGVTWTDQLEAAALRDALAARRID
NVMLVSAFLAAAALAQNVGGAMGYERTAVLLVEPDTATLAVVETSDGSIP
DVYKQQIRAESYGDAAGQLSAMVAGLEKLESLPGGLLLVGSGVDVAPLKQ
VLQTTTFLDVSVAEEPETALARGAALAAANAPLFASSTAALAYAQDPGTG
AVDQYSLPDYLYVPVGPEPGDDELAYSAVGDEDAESPTVVIEKLFLPEDS
EPRRRPVLLVGSGLAVVGISAVLALEIALAIGIRTTGTVALQPTPNQHLI
VPTEQAPAPPPVQASAPQPKISVPEPVAAPKPLSLPVAAPLPAAPPPAAP
PLPEAPPIPAAPPVVPVPVVVPPVPVPVPVRIPVPDPVSPPQLLAPPRLS
VPQPVQPPVRVPQPPSPPQVGGTVPQSPPQHQTPPGEGTPPKPDSPGNYG
GGHAPTPGAGGSGGSGGGHVPTPGAGGSGGGHVPTPGAGGSGGGHVPTPG
AGGPGGTGGSGGGHVPTPGAGTPGGSGGGHLPIPGAGSTPGGSGGGHLPT
PGAGTPGGGLGGFGGGHAPAPGGGLGGFGGGHAPAPGGGLGGFGGGHAPA
PGGGLGGFGGGHAPAPGGGLGGSGGGHSGGGLGGLGGGHK
41409918NP_962754.1 deoxycytidine triphosphate deaminase [Mycobacterium avium subsp. paratuMLLSDRDLRAEITAGRLGIEPFDDALVQPSSVDVRLDCMFRVFNNTRYTH
IDPAKQQDELTSLVEPQDGEPFVLHPGEFVLGSTLELITLPDDLAGRLEG
KSSLGRLGLLTHSTAGFIDPGFSGHITLELSNVANLPITLWPGMKIGQLC
ILRLTSPAEHPYGSTRVGSKYQGQRGPTPSRSYQNFITST
41409917NP_962753.1 hypothetical protein MAP3819 [Mycobacterium avium subsp. paratuberculosMGRHALARKRRKPSATLAAVLAPAAVFFAVSADVHPFAERETAKPVINEP
APCCAEIVTLASTRLSKGFGDGQPVAASRYHTRSRFLPAGVAPERGLQVR
TILTARSISAEFPQIHEIGGVRPDPLPWHPLGMAIDVMIPDPESAQGIAL
GNAIVAYVLQNADRFGIQDAIWRGVYYTPNGAQTSRLGHYDHVHVTTIGG
GYPTGDEVYLR
41409916NP_962752.1 hypothetical protein MAP3818 [Mycobacterium avium subsp. paratuberculosMRTPVTVGQHRHPFGRDIYVGRSGYVTEDAISIGGVNLADPDTYRAGMPY
GAFRKLRERAPVAWHPQKDGSGFWALTGYEEIHAVSRDSATWSSQINGAM
FDAPPPGEVPPVMIFMDPPQHTALRKLINKGFTPRQVTRLNEHIVEMAKQ
IVDDVIERGECEFADDVAGALPSYVIAEMLGIPLEDGRRLYQITEILHTG
SVGDSDDERQQAMVEMFQYGVELAVRKRAEPGDDIATSLLHAEVDGQSLS
DLEFNLFFMLLIDAGGDTTRNLVAAGILALLEHPQELQRLKADPSLMPTA
IEEMLRYTSPVTAFLRTATKDTELRGVPVKAGERVAMFYPSGNRDDSHFA
DPDRLDVGRAPNPHLAFGGGGTHFCLGANLARVEASAMVPEVLSRMNDLE
LAGPVERLRSDLINGIRSMPVRFTPGKRLGTA
41409915NP_962751.1 hypothetical protein MAP3817c [Mycobacterium avium subsp. paratuberculoMTSEDHTAVATDTLTRSPSQTDARWQVLRASCWVLLVLTLLAAVVMAVRP
SLAAQAGAAQMGFLILFVVVHAWLGYSARGMAAFVAIAGIVAFALEAIGV
ATGFPFGSYTHHLPGPKPLGVPPVAIASWIIFGWLAWALARVIMRPVPGV
AVGGAERFTTPIVATLILGGYDLVYDPIGATAHDWYSYDHPTGALGVPLS
NFLGWLLTGWLIFQLVALVEPRFPGSPVTRTRTYWLLPCLFWLSTTTQIF
TSLIHPPDGFAVRGGKTIQLADVYESGASAALFTIVLTGIMALVRLYRRQ
ASKTLRSSADEA
41409914NP_962750.1 hypothetical protein MAP3816 [Mycobacterium avium subsp. paratuberculosMSPQQSFRSLRYTYASLCLAARIRPIDIAELMGHRDVKTTLTVYAHLINT
DDHTGNMAALGSLAAPLQKPNYGNVIPLHG
41409913NP_962749.1 hypothetical protein MAP3815 [Mycobacterium avium subsp. paratuberculosMSVAVPIVSVMPALDPRERVERFVLRARKVMAHSLVRDRSDLLKELASGT
IKVQIQVDTVTGEATHQFSMELPPEEAFESFAARVRPFTIPKEPVYWAVV
LDALEELVSEDTLANIIDIEDLRAHWKTVVEGKKVAQAFYVVTEKGQLSD
VQLAEMWLNSDALHTQLIQSEVGKELSLDQRYRAATGVYARLGSCVNATH
YLVKYLVEEGLLELDPEVFTLPVLAKTSVEIKGAVYSAELGAEMPTDLSN
LDPEVWRPIHKDIDLLASSEHGSPEDGSSREPEE
41409912NP_962748.1 hypothetical protein MAP3814c [Mycobacterium avium subsp. paratuberculoMGARGLPSPPTGTRGDSCFFEWSSAARLRCRPVSLFGNLEPRVSGLLLAE
CLGHARRTRGLTADLEKLWKVIGLSEQDTVRVVMEPTRNAWVALASWFRH
HGARISMVPTTQSADLRAYYSKHTKNDHLDSKLLARLPLLHPEGLRDHSG
DGPGEPLRRLVKIRSSIVKRRTAVFQRLDAQLELLGPAWYDALGSSYGKA
ALALLARYADPHSLIRLGHARLTRFLIRHSRGAWREPHATLLLTAAQESL
QLWGSGANARIDFAELAADIATEAEQAQMLTEQIDDLDERAANLYAEADP
RGIIASAPGLGPVTCAVIAGRIGDPHRFHSLAAIRAYSGLVPKVSQSGQA
EQRHGLTKAGDPLLREALFAAADQARKTDPQLAAKYKRLMTTERHHDSAI
CHIATTLLTRIATCWRTGAHYVLRDTDGRPITFEEGRRIVRAHHAVDKKT
RINAASKRYSQRQKGRTGREPQESPSAPIHRPVHPSIKPTEVA
41409911NP_962747.1 hypothetical protein MAP3813 [Mycobacterium avium subsp. paratuberculosMDTRKRRCGALGDGDPYEQMRERKALRPREYDVIRLLRPLPEHNLPAGSR
GTIVMDYTKDSDSTLPSAYEVEFSDVDGVTQALVTLSGDDLEVVWRPDPD
A
41409910NP_962746.1 hypothetical protein MAP3812c [Mycobacterium avium subsp. paratuberculoMRTGVRCVLATVGVAACVVVTPAGVSLAAATQSHAFAIASVLPSSGEMVG
VAHPVVVTFRAPITDPAKRHAAEQTIDVKSTPAMSGKFEWLDNRVVQWVP
DRYWPAHSTIALTVGGVSTEIKTGPAVIGVASISEHTFTVSIDGVEAGPP
TSLPAPHHRPHFGEQGVMPASMGRPEFPTPVGSYTVLSKERAVTMDSSSV
GIPVDDPDGYLLTVNYAVRITNRGLFVHSAPWAVRSLGLENVSHGCISLS
PDDAEWYYDHVNVGDPVIVQD
41409909NP_962745.1 hypothetical protein MAP3811 [Mycobacterium avium subsp. paratuberculosMTLMAIVDRFNMKVVASAGLCGAAIALSPDAAAAPLITGGHACIQGQSGE
VAPAAGGPVAGGAPAAGGAVAAGATDMCAAPLTDMSGVPMAVPGPVPLGA
PVPVPLGAPLPLGAPVPLAPPVPVVPAGAPLIALGGPAAAGAPVEAAAPL
IDMSGVKDAPTGPAPTGGPVPGQPVRPGPSGAS
41409908NP_962744.1 hypothetical protein MAP3810c [Mycobacterium avium subsp. paratuberculoMFARRFFALLCQSASSASGTDEGEGWMAARRLVGRVTGAALTAGPLVLAG
MLTATVTAGPARADQAAFLNDLHNAGIHAVNGGDDALLQMGADLCQQLSW
GASPQQLEGLALQRSDADQGTGGINGRQAADVVIFALRDLCPNA
41409907NP_962743.1 hypothetical protein MAP3809c [Mycobacterium avium subsp. paratuberculoMKLNAHNLTGLKIPVPTYDRSQIGIGIAHFGVGGFHRAHQAMYLDRLLND
GLARDWGICGIGVLPDDRRMRDALRSQDYLYTLILEHPDGTQEPRVIGSI
VDFRYAPEDPGSVVDLLADPATRIISLTITEGGYQPPLSAAFELVAEALN
RRRERGLPSPTIVSCDNIIKNGDVARRAFTAHAEQVNPELAQWIRENTTF
PNSMVDRITPTPTPDLVDRLAAEFGVQDAEPVVAEPFAMWVLEDDFADGR
PPLDKAGVRLVDDVAPYEAIKLRLLNAGHQGLCYFAYLAGYREVHEAAQD
PVIAEFLARYMDSEAMPTLPRMPGLEDFRDGLIPRFANAYVGDQVARLCA
DSSDHIPKWLLPVVHDNLRSGGPVQLSAAIVASWARYAEGVDEQGRPIEV
VDRLADTLVPLARSQRENPDAFLANRAVFGDLIDAPRFREAYRWALDSLH
RRGARATLRALIGADGS
41409906NP_962742.1 hypothetical protein MAP3808c [Mycobacterium avium subsp. paratuberculoMDAQGYCARWRQNADRRGVAARVVDEIVRRHGITPARFAVLETLTEFRDP
LGKSYFLLRPDTPGEHAREAVLMTYILNAGTDYGIGKAPTDFPPTPYSAA
EAVRIIARQHANDWSYRRDVRFVHRNGARLVTTPNGMLMGLGGNGIQRLF
SARGGTTWGDIFMVNLGRLADPVDQLHRIIRSGRAWGRDAHGVPRAAHLD
LDRLLHHEERHAAQWAARGYFGMLTGYGRELFRELVFRVVNRFEEDAGLC
DGGYRASIPW
41409905NP_962741.1 hypothetical protein MAP3807 [Mycobacterium avium subsp. paratuberculosMAGLPLMAGSWGTVLTGLVPLGLVISLSPLTVIPAVLVLQAPRPRPSSLA
FLGGWLLSLAALTALAVAASHLLGGLDRSPPRWSSWLRVVLGAGLIGYGI
FRWHTRHRHSESPAWMRSFASITPARAGITGAVLAVVRPDVALICVPAGL
AIGSSGLGPIGDWMAALFFVAVAASSVAIPILAYLAAGSRLDDALARLRD
WMDRNNAALLAAVLVVIGAMVLYHGIDAL
41409904NP_962740.1 hypothetical protein MAP3806 [Mycobacterium avium subsp. paratuberculosMEPSWASVLSKLVALAAVIALSPITVIPAVLVLHAPRPRPASLAFLGGWV
LGLVGLTAAFVGGSELLSGLHATPPKWASWVRLVFGVALLALAAYHWFTR
HRQRSMPRWMRSFATLSPVRAGVVGAVLVPLRPEVLILCAAAGLAVGNSS
LSAGAQLVAAAIFVVLAASTVAVPILAYAGAGDRFDDALERLKAWMEANH
DAMLAVILLLIGLIVLYNGIRALA
41409903NP_962739.1 hypothetical protein MAP3805c [Mycobacterium avium subsp. paratuberculoMYPIDASGSIDRSYVRIPGCPSPPGGPTGVWQHGGVSSPTRPAVPAALDP
WIVAALAAAVSLAGAARPSFWYDEAATISASYSRSLTQMWHMLGNVDAVH
GLYYLLMHGWFRLVPPTEFWSRAPSGLAVGAAAAGVVVLGRQFSSRTVAV
VSGVFCAVLPRTTWAGVEARPYALSMMAAVWLSVLLVFAARRQSRWPWLC
FGLALVCSVLLDAYIALLLAAYAVFVGVCCRTRTVLWRFGISSAVAVGVL
LPFLLTVAGQAHQISWVASIGHRTVEDVVMQQYFERSPPFAVLSALLICA
AIALWLSRSAPPGPSERQLLVLATCWVGIPTAAIVAYSALVHPIYTPRYL
CFTAPAMALILGVCSAAIAAKPWVTTAVVGVFAIAAVPNYVRAQRNPYAK
YGMDYSQVADLITAKAAPGDCLLVNDTVTFMPAPMRPLLAARPDAYRKLI
DLTLWQRAVDRNDVFDTNLIPEVVAGPLSHCAVLWIITQADPSEPAHQQG
PALPPGPVYGATPAFAVPHDLGFRLVERWQFNLVQVFEATK
41409902NP_962738.1 hypothetical protein MAP3804 [Mycobacterium avium subsp. paratuberculosMDRRSMMLMSGIGMLGAAMRLPGAWATPPAPEAPPSAGGGPYIFADEFDG
PAGSPPDPGKWTIQTWQDDVFPPVAGIYRDDRRNVFQDGNSNLVLCATQE
MGTYYSGKLRGNFRSMINQTWEARIKLDCLFPGLWPSFWGVNEDPLPDGE
VDIFEWYGNGQWPPGTTVHAASNGKTWEGKSIPGLVDGNWHTWRMHWGEE
GFEFSRDGAEYFKVPNKPIHVAGGAPDDFRWPFNNPGYWMTPMFTLAVGG
VGAGDPAAGVFPSSMLIDYIRIW
41409901NP_962737.1 hypothetical protein MAP3803 [Mycobacterium avium subsp. paratuberculosMPDLPNRQILLRRRPSGLVRPDDTELVTTPAPEPAEGEALLRTTYVGIDA
AARTWLDDQPSYLPPVQLGEVIRAAGIGEVVASRCDAFAVGDVVTTLTGF
QEYAIIRDDLFSTPIPGEHDQLAIMSVYGPTGATAYFGMTDIGRPQPGET
VVVSAAAGATGSIAGQIAKIAGARVVGIAGGPEKCRAVVADFGFDACIDY
KNDDVAAALKQHCPRRVDVYFDNVGGPILDAVLGRLAPQARVVLCGVISS
YLTGDHPGPANYVNLLSKTALMQGFNALDQWGRFDEAFAALRKWEAEGRL
HHRQTIFEGIESCVDALNGLFTGVNIGKTLVKLSEPGAG
41409900NP_962736.1 hypothetical protein MAP3802c [Mycobacterium avium subsp. paratuberculoMAANDDPEERIRELERPLADSARASEQGSAPPTGPGYPPAPAPWSYGGPV
PGPPGQRPSGNRVWWVVGTLIAVGVLALTGGIAAFAAHQLSGVKSIINSP
PTISRTFGPPPGISTTPAPSTSRRTPTSPAAPPGTELSVAGINENRTLAC
DDNPVSVSGVSNTVVITGHCTSLSVSGVQNTVTVEAVERIDASGFNNKVT
YHSGTPSISNSGGSNVVGRG
41409899NP_962735.1 hypothetical protein MAP3801 [Mycobacterium avium subsp. paratuberculosMRDLPAMPSPGPVRVARGSARPWRRYVDIVLGVSMAPGTVRLVAIEGQNA
DGVTVEQEEFAVGAAENSANSAADQVIDAIIGTREGVFEGGHRLTSTGVT
WTDPTGAAALRDAIASHELGNVMLVSPLLAAAALAQTVGYALGYGHIGML
FVEPRSATLAVVDVSDGSIVDLHRHQIPHGPGAPVAAELAAMVAGLDARD
TRADGVFVVGCGTDIVAVKPALEAASPVPVTGPEEPDMALARGAALASAN
APLFASSTAALAYALDPGTGEMDPPAFNPTYLDVWGDTGAGTGVRAYSAV
PDEEEPAPRRPWSMLLAGGALAGIAAVIGGVVLVTLTSDGHGSNTRHNQG
VSVATPGIQLPAPPPSNPPAAQPPAPSTPAPAPTPTEVAAPAPEPVQQAA
PQTPVTTAPPAPVYRAPARPTPQYQPRPVEQPAPPPAAAPAPAAPPPVPA
PPPAAPPVPHQPPVTMYLHFPFVTVPIPITPPAPPPGP
41409898NP_962734.1 hypothetical protein MAP3800 [Mycobacterium avium subsp. paratuberculosMYDPLGLSIGTTNLVAARNGSPPVSRRCVLTLYPHCAPKIGAPEENPLLA
EPGVPMKGFVERIGDSVALVSPDGSAHDPELLTVEALDAMVLAAGADAAS
SEISIAVPAHWKPGTVQALRDALRTHLGFVRSGMAPRLVSDAIAALTAVK
SELGLPDEGVVGLLDFGGSGTSATLVNVAGDFELVSATMRYTALSGDEID
QELQLRAFEELGHGSGLDPASTAGVGQLAALREQCRAAKERLSTDVVTEI
TAELGGRSCSLTLTQDDLEELMQDRLTGFIYAFDDLLVRYRKSWSDLAAV
VTVGGGARIPLVTERLSMHGRTPILTPSQPAFAAAAGALLLASRGGELDM
RTRTSIGLLAAADAAGDVVDLGAGDVLVIDDEALTDRELAWSQTEYPGDL
RMRFGGETYDEDGPAGWSMRLNVIDPPKPRRPWRRLRFSQLIIGMSAAVA
MTAIGGVAYTLTGIENRQAPPAPSVAPLPPVSRVVPPSAVAPPTAVPPPP
PPSAQPVPSPAPPPPQPPPPPPSPPPAPPPPVVVTTAPPAPTYTPRHTAP
PTAPPALTTTAPTPSPTPTTTPPPPTTTQEPTTTSTTTTVPMTTEWIHVP
LLPVPIPVPVPQKQAPATPQYPSNEYPQYPQYPGNEYPQYPGNSQNPYYG
PGY
41409897NP_962733.1 hypothetical protein MAP3799 [Mycobacterium avium subsp. paratuberculosMAQSPYARLSRSELAVLVPELLLIGQMMDRSGMAWCISSFGRDEMVQIAI
EEWAGASPIYTRRMQRALGYEGDDVITIFKGLQLDIGAPPQFMDFRYTVH
DRWHGEFQLDHCGALLDVEPMGPDYVFGMCHTIEDPTFDATAVATNPRAQ
VRPIHRPPREPADRHPHCAWTVIIDESYPEAQPIPALHIVRQTRAAGWEL
DPIDASDEGMADYSGPLLSDLDFGAFSHSALVRIADEVCLQMHLLYLSFA
IAVRKRAADDAEAVSVCTRGLTGVAGLAAERIHRAVGSGGGIDAVLRVLE
LHPLLNPAGYVVSEIAGNRLLVHRSPAHEDAAWISLCSPGSVQPLQAIAT
AVNPRIGVRVSGTDTDWTAEFVETDTDADELPEVSVTKVSGGSTFQFEPR
RSLPLTVV
41409896NP_962732.1 hypothetical protein MAP3798c [Mycobacterium avium subsp. paratuberculoMSIAAGQQPGRPAGPTRRTTAPRKRGDDTRARIIDETVRCIIEEGFAAAT
AKHVAERAGVTWGVIQYHFGDRNGLLMAAVDDGVARLVESLSSADVSELP
LRQRVEVVIDTAWSCYSSPTSMAAFEILHATRGALGDSSRRHLLDMNAAI
GQLGRLITTDPANAGVAEVIWATLRGVVLAQMVIGTTVDWSLERRALIDM
VTRVLQ
41409895NP_962731.1 hypothetical protein MAP3797c [Mycobacterium avium subsp. paratuberculoMCCNDPMTLDDLADIEAIKQVKYRYLRALDTKHWDDFADTLAEDITADYG
PSIGNELHFTNRAELVEYMRTSLPANVITEHRVTHPDIVVDGDTATGSWY
LQDRVMVAELNFMLIGAAFYRDTYRRTERGWKISGTGYDRTYDATMSLEG
LNFTLKPGRAIAGAD
41409894NP_962730.1 hypothetical protein MAP3796 [Mycobacterium avium subsp. paratuberculosMHRLLTSLCAAACVIVASVVLSPISAAAGAPWFANAVGNATQVVSVVSTG
GSNATMEIFQRTGTGWQSLRSGVPTHVGSAGMAPQAKSGVPATPMGVYSL
DSAFGTAPNPGTGLPYTQIVGPNYWWSGDDHSPTFNSMQVCPKAQCPFNT
AESENLQIPQYKHAVVMGVNKNKTPGGGAAFFFHTTDGKPTEGCVAVDDA
QLVSIMKWLRPGAVIAITK
41409893NP_962729.1 hypothetical protein MAP3795 [Mycobacterium avium subsp. paratuberculosMLPSMTARAPSRGRAGIDGAMMRPRPAPAAAIALLATAVYAVMWIGYRHG
WGWLARMDWSLLNGTRDLAVKHPDWLRAAEVVSVVLGPGTLAVLGIAVTL
CAVVLRRLRAALVLALACAPCNELVTAGAKALVDRPRPPTALVGAASTSF
PSGHALEATAGLLAMTLFALPMLNRVLCGLLVAAVAVALPAVGLSRVMLN
VHYPSDVLAGWSLGYLYFLLCLLVFRPSAPDRSG
41409892NP_962728.1 hypothetical protein MAP3794c [Mycobacterium avium subsp. paratuberculoMAVFVRRLFGIGKLPDDLHAQVEAEGLIYLADYVAVTRRFSGTIPGVRLP
HSVASYTGSLVFTSERVLATLSMLPRLAGPTVNVAWDAPQTGAAQVEISS
TGLQVDVDVSRVDEKFSGELSLHYKVAIPADVLSGLPRHSLAFDMPPEYV
FRAVGVTYSP
41409891NP_962727.1 hypothetical protein MAP3793 [Mycobacterium avium subsp. paratuberculosMKPSDVLEQLAADRGADRGYGEPYQTPDGTTVIVVGKPQGVFTIRDGQAR
WTPAVDTGRVALIGVITGLLAAVIGSLAVLRQPPWPRITIRDYR
41409890NP_962726.1 hypothetical protein MAP3792c [Mycobacterium avium subsp. paratuberculoMTGPAFSPQERRAVYRVISERRDMRRFVAGAVVDEQVLARLLAAAHAAPS
VGLMQPWRFIRITDAALRRRIHALVEQERPRTAAALGERAQEFLALKVEG
ILECAELLVVALGDDRDKHVFGRRTLPQMDLASVSCAIQNLWLAARAEGL
GMGWVSLFEPRPLAELLGLPDGAEPVAILCLGPVPEFPDRPALELDGWAT
PRPLAEFVCENRWAQPQLP
41409889NP_962725.1 AtsG [Mycobacterium avium subsp. paratuberculosis K-10]MTQLTPGDAGDRNDAGRKDNVLIVHWHDLGRYLGAYGHRDVSSPRLDRLA
AEGILFTRAHATAPLCSPSRGSLFTGRYPQTNGLIGLAHHGWEYRSGIRT
LPQILSEAGWYSALFGMQHETSYPKRLGFDEFDVSNSYCDYVAQRADEWL
RQSAEGVVGQPFLLTAGFFETHRPYPEDRYPPADSAEVQPPDYLPDTPEV
RGDLAAFYGAISTADAAVGRLLDTLADTGLDASTWVVFFTDHGPAFPRAK
STLYDAGTGIGMIVRPPTGRGLPPRVYDELFSAVDLVPTLLGLLGISVPP
DVDGVSHASALLRPDPDAAPVREHVYTMKTYHDSFDPIRAIRTKDYSYIE
NYASRPLLELPWDIEESPSGMAVAPLVTAPRPERELYDLRADPTEITNLL
AGDDADADEVAANLAVLLHDWRQRTGDVIPSEFAGTRIAARYTETYLQIH
HGARPTARSAIAADRGIEEEGNPAQR
41409888NP_962724.1 hypothetical protein MAP3790 [Mycobacterium avium subsp. paratuberculosMGSGRLPGLCRPSGPSLLRSAVAGGRRAGAPRRRSRVRARPPDQVPGPAL
AGRGHRGDGQLPGDGRRGQGARHRRRHRRSAQLETQTRHRRGGQQRRPAL
GARTLRPAAALGRAAGARVVDRGADAGQLRVPVLRRGARPGPPGAVREVV
ARIPFRVGAVVQPPTHYANMLLDAGCKVDVWETTYLHQLTGEHPVLEWIT
GTALVPVRERLDDDAWEQFREELIPLLRDAYPPRADGTTIFPFRRVFIVA
EVGSGRPAA
41409887NP_962723.1 hypothetical protein MAP3789c [Mycobacterium avium subsp. paratuberculoMAPDLDPFDPPIPVPDVPGADVPPGAGGLPPTSALSPRQRMVVEASALGD
LALRTWVASLLSTTVAPFVVANALRHADAATERANLEFYAELGAAADPDR
SFPPPTEPPRVTSRRASPLAEWVARGTVDNLAFDSSFTAVNPAMRARWSG
WGRNNVVRAQHWRHDDGPRPTLCVIHGFLGSSYLANGRFFSLPWYYRAGY
DVLMYTLPFHGKRSERFSPFSGFGYFAGGLSGFAEAMAQAVHDFRSLIDY
LRHTGVERIALTGISLGGYTSALVASVDDRLEAVIPNCPVVTPATLFDEW
FPANKLVGLGLRSSDISRAQLAAGLAYHCPLTYRPVLAKDRRMIITGLGD
RMAPPERAVKLWQHWDRCALHWFPGSHVLHISQLDYLRRMTAFLQQVMF
41409886NP_962722.1 hypothetical protein MAP3788 [Mycobacterium avium subsp. paratuberculosMRPPNGSDALPLPLIAGYLDRYGIRADKVRITSRDNASDESRRQTWIGLT
VSAPDNLAALQARSPRIPLAETAQVAARRLADHLRETGWEAGVVPPDDVP
RLLTSNPRERWRGVQRGPSDYLAAYQIPVDESLPETLEAIRSYPARQSCV
ALEIAGDKAAPTIAVACAFQTDTAPDRGAPLAGLIPQRGNHLPALTALDL
LSTGRLDGHTAATADLLDRLHWPTQGAPAGDADTVAAART
41409885NP_962721.1 hypothetical protein MAP3787 [Mycobacterium avium subsp. paratuberculosMIRPASACLAAALALLPATATWASPPALAISPPTVDPGVPPPSGAPGPGQ
PMEQRAPCTTSGVIPGSEPAAVTPSQSALNLPAAWRFSRGDGQLVAVLDT
GVRPGPRLPNVEPGGDFVETTDGLTDCDGHGTLLAGLVAGQPSPDDGFAG
VAPAARVVSIRTTSAKFSPRTPGGDPLLARAAAEVGTLARAIVHAADLGA
RVIDIGSATCLPVDRPVDQAALGAAVRYAAVDKDAVIVAAACDSGPTGSF
AGGTSCESNPLTDLSRPSDPRNWAGVTSLSIPSWWQPYVLSVASLTPDGQ
PSKFTVAGPWVGVAAPGERIVSIGNGDGAGLTNGLPDEHQQLAALNGTGY
AAGYVAGVAALVRSKYPDLSATAVVHRITATAHNGARDPSNVVGAGSVDP
VAALTWQLPAGDQPGPAAKPIAVPPAPAPPDTTPRTVAVAGTAALVVLVA
VAGAVIALAARRRKDPSA
41409884NP_962720.1 hypothetical protein MAP3786 [Mycobacterium avium subsp. paratuberculosMTSGTVMPIVRVAILADSRLTEMALPAELPLREILPAVQRLVVPAAANGD
SEDGAPSRGAAEVGGAVQLSLAPIGGAPFSLDASLDTVGVVDGDLLALQP
VPAGPAAPGIVEDIADAAMIFSTSRLRPWGTTHIQRFALAAVIAVALLAT
GLSVSYRVATGALAGLVAVSAVAALTAIVGLLATARSPRTGMALSIAALV
PIGAALALAVPGRFGPAQVMLAAAGVTAWSLIALMAPSAERERLAGFFTA
TAVLGAAVLLAAGAELLWHITPVALGCGLIVAALLVTVEAAPLSALWARF
PLPVIPAPGDPTPSAPPLPVLEDLPRRVRIGDAHQSGFIAAAVLLSVLGS
VAIALRPETLSAAGWYVVGATAATSVLRARVWDSAACKAWLLAQPYLAAG
VLLVLYTATGRYAGALGAVLVLLALVAVWIVVALNPGIAAPESYSLPVRR
LVGFVATGLDASLIPVMAFVVGLFGWVLDR
41409883NP_962719.1 hypothetical protein MAP3785 [Mycobacterium avium subsp. paratuberculosMDPAPNAVELTVDHAWFIAETTGAGSFPWVLAITCPYRDAAERNAFLDRQ
RAELSEMGLVSDAGLINPAVAEWIKVVCFPQRWLDLRYVGPAKDTGEGGG
SELLRGIVAQRDGAGGRSITVVALRSAQLITFTAMDIDDPRALVPVLTVG
LAQRAPASFDEFSMPTRVGARADERLRAGAPLSEVLDYLGIPQSARPVVE
SVFNGPRSYVEIVAGCHRDGRHSTTEVGMSIVDAREGRVLVSPSRAFDGE
WVSTFSPGTPFAIAVAIEHLTALLPDDGWFAGHRLARDFSVQH
41409882NP_962718.1 hypothetical protein MAP3784 [Mycobacterium avium subsp. paratuberculosMSQIMYNYPAMLSHAADMSGYAGTMQGLGADIASEQATLSNAWQGDTGMT
YQVWQAQWNEAMESLVRAYQSMASTHEANTMSMLARDQAEAAKWGG
41409881NP_962717.1 hypothetical protein MAP3783 [Mycobacterium avium subsp. paratuberculosMSMLDAHIPQLVAAQSAFSAKAALMRSTISQAEQEAVSAQAFHQGESSAA
FQAAHARFVEVAARVNTLLDIAQANLGDAAGTYVAADAAAASGYTAF
41409880NP_962716.1 hypothetical protein MAP3782 [Mycobacterium avium subsp. paratuberculosMTSPFGPIWMASPPEVHSALLSAGPGSGPLLAAAGAWASLSAQYATAAAE
LSALLGQVQAGSWEGESAEQYAAAHLPYLAWLQQASADSAGAAAQQEVAA
TAYTTALAAMPTLAELAANHTIHGVLLATNFFGINTIPIAVNEADYARMW
VQAATTMGTYQAVAGSALAAAPRTAPAPSIVKPGGEANNLAANAAQNSSG
DWWQNFIQQLSQFFQNIQKMLQDFWANLPAFLAANGPLLFFVAYQVFFNA
VGWPTWGAILTAPFLLPLLLGIGLSSLLAAPAEIAPVAAPAAITPVLASN
KPPTLPAAVALAPSVATPAGAPASTVAAGSGASAAPAPAAAAGNFAYLVA
FGGDPDTGVGPTLSGRGGAKAPAATIPAAGAAAPARAEARARRRRRAALH
DYSDEFLDMDSGFGVPPDYGAEEELAAAVASGQGAGTLGFAGTQQRRKAF
QAAGLTKLADDDFGGSPRMPMVPGTWEQDTQNGAHPTEPGKGG
41409879NP_962715.1 hypothetical protein MAP3781 [Mycobacterium avium subsp. paratuberculosMTLRVVPEGLAATSAAVEALTARLAAAHAAAAPAITAVVPPAADPVSLQT
ALGFSAQGQEHSAVAAQGVEELGRAGVGVGQAGASYLAGDTAAAATFGIA
GA
41409878NP_962714.1 hypothetical protein MAP3780 [Mycobacterium avium subsp. paratuberculosMSRLIFEARRRLAPPVTRKGTIAIEAPPELPRVIPPSFLRRAMPYVLVIL
IVGMIVALFATGMRLISPQTLFFPFVLLLAATAMYRGNDNKTRTEEVDAE
RADYLRYLSVVRDNIRTQAAAQRAAAQWSHPEPAALAAVPGSRRQWERDP
HDPDFLVLRAGRHHVPLATALRVNDTADEIDLEPVSHSALRSLLDTHRTV
RDVPTGIDLAKVSRITVLGSEDEARSAMRAWVAQAVTWHDPTVLGVALVT
PDLENPDWSWLKWLPHIDIPGELDGVGPARFMATNVDELVAKLGSALVDR
PAFTGEPADALRHLLIIVDDPDYDLSASTLAMGRAGVTVVHRGATAPHRE
QYSDPEKPILRITGADGAGGRTHSIERWQTGGWQPYIDDADQLGADEAAH
LARQLSRWDSNPTHTGLRSAATRGATFTTMLGIPDASQLDVPTLWAPRRR
EDELRVPIGVTATGEPLMFDLKDEAEGGMGPHGLMIGMTGSGKSQTLMSI
LLSLLTTHSADRLIVIYADFKGEAGADSFRHFPQVVAVISNMAEKKSLAD
RFADTLRGEVARRETLLREAGRRVQGSAFNSVVEYENAIAAGHDLAPIPT
LFVVADEFTLMLADHPEYAELFDYVARKGRSFRIHILFASQTLDVGKIKD
IDKNTSYRIGLKVASPSVSRQIIGVEDAYHIESGKEHKGVGFLVPAPGAT
PIKFRSTYVDGIYDPPQKAKSLVVPSIPEPKVFTAGRVEPDQDTVITSPD
EVELTGPPRKLIATIGEQLARYGPRAPQLWLPPLDEPIPLSAMLARAGVP
PRQWQWPLGEIDKPFDMRRDPLIFDAASAAGNMVIHGGPKSGKSTALQTF
ILSAASLHSPREVTFYCLDYGGGKLRALEDLAHVGSVASALEPERIRRTF
GELEQLLLSRQRRQAFRDSRGGVPDDGFGEVFLVIDNLYAFGRDNTDQFN
TRNPLLAKVSELVNIGLAYGIHVVITTPSWLEVPLAMRDGLGLRLELKLH
DPRDSNVRVVGALRRPAEAVPHDQPGRGLTMAAEHFLFAAPELDQIAAIN
DRYPGMAAPPVRLLPTNLAPHAVGALYRGPEQVVIGQREEDLAPVVLNFA
DNPLLMVFGDSKTGKTTLLRHLIRTVREHSSPDQVAFTVLDRRLHLVDEP
LFADNEYTANIDRIIPAMLGLANLIESRRPPAGLSPQELSRWTYAGHTHY
LIIDDVDQIPDSPAMSGPYVGQRPWTPLIGLLSQAADLGLRVIVTARATG
SGHALMTNPLLRRSNDLQATTLMLAGNPQDSGKIRGQRFGRLPAGRAILL
GDSDAPTYVQLVNPLAGESVMASEAQREE
41409877NP_962713.1 hypothetical protein MAP3779 [Mycobacterium avium subsp. paratuberculosMTSNQQPDERRSFSSRTPVNDNPDQVEYRRGFVTRHQVSGWRFVMRRIAS
GIALHDTRMLVDPLRTQSRAVAMGAVLLVTGLAGCFVFSLIRPNGTAGTN
AVLADRSTAALYVRVGEDLHPVLNLTSARLITGRPVDPTMVKSSELDRFP
RGNLIGIPGAPERMVQNPSTDANWTVCDAVSEPGGHAAHSAGVTVIAGRP
DSSGARAATLPSRQALLADRDGTTWLLWDGKRSQINLTDHAITNALGLGQ
GNSEIPAPRPIALGLFNAIPEAPPLTAPGIPNAGAPAPFTAPAPIGGVVV
SYTLDQSSSGAPRYYAVLPDGLQQISPVLAAILRNTNSYGLDQPPRLGAD
AVAKLPVSRMLDTARYPDQQVGVVDAAKSPVMCAYWSKPAKAASSSVNLL
TGSALPVAESIRTVDLVGGGSPATAARVALAPGTGYFTQTVGGGPNSPGA
GSLFWVSDTGVRYGIDNEAEHSAAGQNKTVEALGLTGSPVPIPWSVLSLF
ASGPTLSRADALLAHDGLAPDQKPGRVTAAAREAEGAPR
41409876NP_962712.1 hypothetical protein MAP3778 [Mycobacterium avium subsp. paratuberculosMEHGDTGMLTVQPANSRVDTRVDGDVVSRFATCCRALGIVVYQRQRPADL
AAARSGFAALTRIAHDQCDAWTGLAAAGDTSLRVLEAVSRTAASAGVLQR
QVDLAPNSLGFRYDTGLYLQFRATTPDDFHLAYAAALATAGRFADADAIV
AGLTAERPNWREARWVSVVINYRAERWSDVVKLLTPIVNDTDLDEAFSHA
AKIALGTALARLGMFAPALSYLEEPEGPVAVAAVDGALAKALVLRAHVDE
DSASEVLQDLYAAHPENEQVEQALTDTSFGIVTTTAARIEARTDPWDPET
EPSAEDFVDPAAHERKAVLLHEAERQLAEFIGLEEVKNQVSRLKSSVAME
LVRKQRGLAVAQRAHHLVFAGPPGTGKTTIARVVAKIYCGLGLLKRENIR
EVHRADLIGQHIGETEAKTNAIIDSALDGVLFLDEAYALVATGAKNDFGL
VAIDTLLARMENDRDRLVVIIAGYRADLDKFLDTNEGLRSRFTRNIDFPS
YAPSELVEIANKMAEQRDSIFEKAALDHMEELFTKLATESTPDANGISRR
NLDIAGNGRFVRNIVERSEEEREFRLDHSEHAGTGEFSDEELMTITDDDV
ARSVEPLLRGLGLSVPA
41409875NP_962711.1 hypothetical protein MAP3777 [Mycobacterium avium subsp. paratuberculosMRQVVVLAAGLDSRAYRLDWPAATTIFELDQPQVLDFKREVLARAGAQPR
AERREIAIDLREDWPQALRDSGFDPAKPSAWIAEGLLIYLPASAQEQLFT
GIDGLAGHGSHVAVEDGAPMKPEDFETAVAEERAATAQGDQRVFFQLVYN
EQCAPATEWFGNRGWTAVGTPLADYLREVGRPVPGPETEAGPMIARNTLV
SAVRA
41409874NP_962710.1 hypothetical protein MAP3776c [Mycobacterium avium subsp. paratuberculoMATVGACCRSGGPAGVPRNRAGAHRDADRVSGKSRALDMKTVIVCGVGGL
LSRWHGAPIATVLVLTVVTSCSSSPTQTAEGSRNAASPSAIGRTAAPPCP
TAPLAVVVSVDQWGDIVSELGGACANVKTVLASSSVDPHDYEPSPADAAD
FMNAKLIVVNGAGYDSWASKLAGSSASGAPLVSAAAVTTTPDGANPHLWY
LPSAVTAVADAVTQELSRMEPPAAGYFSQRRAQFTSATRLYVNLIAKIKA
EAAGKSYGATETVFDYQAQAAGLVNKTPAGYRRASANESEPSPGDVDAFL
TALAGRHIDLLIYNTQTEGSIPEEIRSAAEQSSVPVVKITETVPPGETSF
EDWQYGQLVQLAKALHVAV
41409873NP_962709.1 hypothetical protein MAP3775c [Mycobacterium avium subsp. paratuberculoMRGGRLIWSHATFDIPAGGIVAVIGSNGAGKTTLLNMVLGLIPSATGRLE
IFGRRPGQANDNIGYIPQHYADSSGEAIRAADAVLLGLTGRRWAFGRSTT
SQQTRVAEALAAVEATDLGCRRLSTLSGGQRQRIAIAVALVARPQLLILD
EPLASLDLRSQRDIVALLARLHAELAVTILVVAHDLNPLLPILDSVIYML
DGRPRYVPVGDIMDDTLLTRLYGTPIHVHRARDGALYMRSAL
41409872NP_962708.1 hypothetical protein MAP3774c [Mycobacterium avium subsp. paratuberculoMTVRVLALQYEPHWWSILTSGFMTNALIGGTIVALAAGLVGYFVVIRQSA
FAAHALAHIGLPGATGAVLLGVPVAAGLGVFCVGGALAIGVLGKRAADRE
VVTGTVLALAIGLGLFFNSLATKSSGTMTNVLFGNLLAISRDQLAGFAIL
LAVLALIVGIIYRPLLFASVNPVVAEAKGVPVRALAMIFMALLGLTVTMA
VQAVGTLLLFALVVTPAATAIMLTPRPSMAMLVSTAIGLSSVLLGLGASA
MFNLPPSFPIVVLACGIWSAVWASNHRHRVIAKAVDEATNAPPALMSSTE
PTATTRK
41409871NP_962707.1 hypothetical protein MAP3773c [Mycobacterium avium subsp. paratuberculoMSSPAAPRRRRATVKQRTVLEVLRAQENFRSAQQLYQDIRQNQQLRIGLT
SVYRILRALAADRIAETQRAEDGEILYRLRTEAGHRHYLLCRQCGRAVAF
TPVDIEEHTRRLSRQHHYADVTHYVDLYGTCPLCQNTQP
41409870NP_962706.1 hypothetical protein MAP3772c [Mycobacterium avium subsp. paratuberculoMPPQSSTPLPVTVLSGFLGAGKTTLLNHVLANQEGRRVAVIVNDMSEVNI
DAALVAGTGFLDRTEEKLVELTNGCICCTLREDLIESVARLASAGRFDYL
LIESTGISEPMPVAASFSWEFENGFSLSRIARLDTMVTVVDASTFLRELA
RGEALAARHLAAGDGDVRTIADLLVDQVEFADVILLNKTDLVSEKTNATV
AAVLRRLNPAAKIVPTDHGRVALSEVLDTGLFDPHLAAESAGWAEELANG
HSPETEEYGISSVTFRAARPLHPQRLHVALGQLQGVLRSKGFCWIASRPD
IAAIWSQAGPNLVIEPAQYWSTADFPAGQEIVFIGVNLDHSRVLDLMQAA
LLTDTELAQGPQRWVGYPDPLPPWDVVHAH
41409869NP_962705.1 50S ribosomal protein L31 type B [Mycobacterium avium subsp. paratubercMKSGIHPDYHPVVFQDATTGATFLTRSTITSSRTIEWETPHGVRTYPLVV
VEITSDSHPFWTGSRRIVDTAGQVEKFHRRYGSRRQTNHRDDAAHSP
41409868NP_962704.1 hypothetical protein MAP3770 [Mycobacterium avium subsp. paratuberculosMRTPVILVAGQKDTDPVVGALLRMPGTLVVEHRMEGHVVLRTTVMLQHGV
LTTAESALELAHGCVSCTIRNDLLVLLRQLHRRAEVERIVVHLAPWLEPE
PICVAISHVRVRVAAGYVDGPAALDVSIAAVVTCVDSSVWVSQALGDEEL
DDGRTQAQVVVGQAEFADVLVLNRADPFTAAALRRLAPRARIQVGANGIG
DTLNNLYRDARQGRSDDPHDPLLSGQPPLNSRGPINLVEFHARRPFHPRR
LHECLDVVLDGVIRTRGRLWLASRPSHAMWLESAGAGLRVSSAGKWLAAL
APSELAHIDPGRRAFAELEWDADHGDRHTAMTILVCGANASDILDALNGA
LLTDREFASRPWVFDDDPFGDWHEDPCGDPAQGTEENTPAHYSTDGDH
41409867NP_962703.1 50S ribosomal protein L33 [Mycobacterium avium subsp. paratuberculosis MARNEIRPLVKLRSTAGTGYTYITRKNRRNDPDRLVLRKYDPVIRRHVEF
REER
41409866NP_962702.1 30S ribosomal protein S14 [Mycobacterium avium subsp. paratuberculosis MAKKSKIVKNDRRRATVARYAERRAELKEIIRSPRSTPEQRTAAQNELAH
QPRDASAVRVRNRDAVDGRPRGHLRKFGLSRVRVRELAHAGQLPGVRKAS
W
41409865NP_962701.1 30S ribosomal protein S18 [Mycobacterium avium subsp. paratuberculosis MPKKPARTRRPAPLAGRARKKNLLDSLGLRTVDYKDTATLRVFISERGKI
RSRQVTGLSVQQQRQVATAIKNAREMALLPYPGQGIKP
41409864NP_962700.1 hypothetical protein MAP3766 [Mycobacterium avium subsp. paratuberculosMPVATLKPGRRPGSMELLVGILLACALAATTLRNAVINSAALSTVGTVFC
GVFVQAIPFLVLGVVVSGLIAVFVSPERLARWLPRRASMAVLAAGIGGAA
LPGCECGSVPLARRLFGEGAATGAAALTFMLAAPAINPVVLVATAVAFPG
APRMVFARMIASLLTAVVMGWVWSRWGRAEWITRRLPAAGTATESRWTTF
TEAARHDFLQAASYLVLGAIAAALLHVMVPQWAFAHLADNPVLAVALMAA
LAVVLALCSEADAFVAASMTMVPLLPRLVFLVVGPAVDVKLFAMQAGMFG
RAFAARFAPCTFAVATASAGAIGLFVLGPG
41409863NP_962699.1 hypothetical protein MAP3765 [Mycobacterium avium subsp. paratuberculosMTAPIWMASPPEVHSALLSSGPGPGSLLAAAGAWNSLSAEYASTAEELSA
VLASAQAGAWGGPSAESYVAAHAPYLAWLTQASANSAEMAASHEVMATAY
TAALAAMPTLPELATNHVVHGVLLSTNFFGINTIPIAVNEADYARMWTQA
AATMSTYQAVSTAAVAATPPTDPAPPIVKSAALSDDSDDSGDVDHDPKID
NWLDELIARFLKQLGINWDPAQGTVNGLDYDAYTNASQPIFWVVRALELL
EDFQQFGYYLVHNPALAFQYLVQLALFDWPTHILEILTTAPQLLAPALLL
AVAPFGAIGGFAGLAGLAAIPHPAVVPATVAAPPPAPTPSIPPAIAMAPT
PVAPAAAPASAPAPAPATTATTVAPAPAAPAPVAAGAGFFPPYVVGPPGI
GTGSGMAASASSSAKRKAPEPDSAAAAAAASAREAARARRRQRQRQRGFG
DEYMDMNVDVDPDWGGPHPGRESVASDQGARNVGFAGTARRNAAAAAGGL
TTLADDEFGGAPKIPMMPGTWDPVGDGERREQGDGRDH
41409862NP_962698.1 Pks2 [Mycobacterium avium subsp. paratuberculosis K-10]MTHPLRRGTTMDESATPVAVIGMACRLPGAIDSPDALWAALLRGDDFVTE
IPLDRWDADEHYDPEPGLPGRSVCRWGAFLDDVGGFDADFFGISEREATA
IDPQHRLLLETSWEALEHAGINPAALTGSRTGVFVGLMHDDHTLRTADAG
ALDQPYGFMGNSFAVASGRIAHTLGLHGPALTVDTACSSGLVSVHVACRS
LHHGESDLALAGGATVLLEPRKLAAGSAQGMLSATGRCRAFDAAADGFVS
SEGCAMVLLKRLPDALRDGDRILAVVRGTAANQDGRTLSLATPSLTAQTA
VYRSALAAAGVDAGTVAMVEAHGTGTPVGDPIEYASLAELYGQDGPCALT
SVKTNFGHTQSAAGTLGLVKAVLALQHGVVPQNLHFTRLPDKIGQLNTNL
FVPQDNTPWPRKLQQPRRAAVSSYGVSGTNAHAIVEQAPNASGGVKPTPA
GPLLFTVSSSSDEGLRETAKRLAGWVKERAASVELSDLAYTLARRRAHRP
VRTAVIAGSVDELAAGLHEVADSRTSYLAAFGRDDCGPVWVFSGQGSQWT
QMGAELLANEPVFATTVAEVEPLIARESGFSVTEAMSAPHTLTGIDKVQP
TIFAMQVALAATMKSYGVRPGAVIGHSLGETAAAVVAGALSLQDGVRVIC
RRSRLMSRIAGAGAMASVELPAQQVLSELMARGIDDVVVSVMASPTSTVI
GGVTSTVRELVAAWEERDVLAREIAVDVASHSPQVDPILDELADALVELE
PTAPEVPFYSASLFDPREQPLCDADYWLDNLRHTVRFGAAVQAALEDGHR
VFVELSPHPLLTYAIEQTAASLDTPAAALAAMRREQALPHGMRDLLAEVH
SVGAAVDFSMLYPDGRLLDVPLPAWTHRHLLLGLDSRDTQPQAGPTVAVH
PLLGSHVRLPEEPERHAWQAEVGTATLRWLADHRIHEVAALPAAAYCEIA
LTAAHTALGDASEVRDLRFDQMLLIEDETPVFALAVMASRSAAEFVVETF
EEGERVRRATAILAAAGPGERPPAYDVPALLAARSSSVDGAELRNRFAER
GVQYGPAFTGLTAAHTSGDTVLAEVALPGAMRSQQRAYRIHPALLDACFQ
SVGAASEIQNSGGGSLLLPLGVRRIRAYASARTAHYCYTRVTSTTATGFE
ADLDVLNEHGAVLLSIQGLQMGTGASEEASRDRALNERLLTVEWHRQELT
EVDPVDAGTWLLVSTSAMADVAATELTDSLKLLGADCTSIRWSSRADPVA
NGKTLRDQLRVGRFTGVVLLTGPKDGDRDDECAARGGEYVRHVAHIVREL
AAAPGEPPRLYVVTRNAQTVLEGDGANLEQGGLRGLLRVIGNEYPQFRTT
QIDTDMHTGASLIARQLVSGSEEDETAWRNDEWLTARLRLSPLRPDERRT
AVVDHEHDGMRLHIRAPGDLQTMELVACERIPPGPGQIEVAVTASSINFA
DVLLAFGRHPSFEGRLPQLGTDFAGMVTAVGPDVIEHKIGDHVGGLCPNG
CWGTFVTCDANVAVTLPPGLTDAQAAAVTTAHATAWYGLHDLARVKAGDK
VLIHSATGGVGQAAIAIARAAGAEIFATAGSSQRRKMLHDKAIEHVYDSR
SVEFAEQIRRDTDGYGVDVVLNSLTGAAQLAGLKLLAPGGRFIEIGKRDI
YGDTKLGLFPFRRNLAFYGVDLGLMSVDHPLRVRELLDTAYERVADGLLP
MPASTHYPLTDAATAIRVMSAAEHTGKLVLDVARSGKSSAVLHPDSGRVF
RPDGSYIITGGLGGIGLFLAEKLAAAGCGRIVLSSRSEPNQRVQEMIELV
RAIGSDVVVECADITQPGTAERLVAAATTTGLPVRGVLHAAGVVEDSALG
GITGELLERCWAPKVVGAWNLHRVTAGEPLDWFCLFSSAAALVGSPGQGA
YAAANSWLDAFTHWRRAQGLPATAIAWGAWSELGRATGFAEDVGTAITPD
EGAYAFQALLCHDRAYTGYAPVIDTAWLSAFAERSRFAEAFRSTGKSPTG
TTRFLAELNTLPHDQWPTRLRRLVSEQVSLILRRTVDPDRPLSEYGLDSL
GNLELRTRIEAEAGVRIKSTAITTVRGLAAHLCDTLAEAAPTSQVRAE
41409861NP_962697.1 PapA3_2 [Mycobacterium avium subsp. paratuberculosis K-10]MVLVGKVEVGPIHEWLPAAGSVVSWQASPASLDKARHAPNSAVPASYQQA
QHLRRFRENAARGIDMSRLLTAGWDIPGRCDIRVMTHVINAHLRRHDTYH
SWFEVEDGGRIARRTIDDPASIKFTPIEHGEMTSDEVRDLVLDTPNPLCW
DSFRFIVIQRADHFTICLCVDHLHIDAMFVGVGFAEIHLMYRALVAGRAP
LTLATAGSYDDYCVRQHRELDALTLESPEVRGWVEFFEDNNGTLPAFPLP
LGDGPVPCDMLSVQLLDERQTARFESVCLAAGARFSGGVFACAALVEHEL
TGTETYYGVIPVDIRRSQDELATTGWFVGFVPLTVSVAGSFSDIVRTAQA
SFDSNKDLANVPAERVVEMAPWLRMPQRGAPLLFFLDAGVPPLSALVNSH
LDGANARLYHDGRIPSQVAIRVNRLESETQVIVLFPNNPIARQSVTRYLA
VMKSVYARVVDGGDPVESHLNHAAMHPQLGSRREARNEWAGSNWSHPMQR
VAQPFG
41409860NP_962696.1 hypothetical protein MAP3762c [Mycobacterium avium subsp. paratuberculoMKFALAVYGSRGDVEPHAAIARELLRRGHEVCVAAPPDLRGFVESAGVTA
IDYGPDTRDVLFGKKTNPIKLLSTSKEYFGRIWLEMGETLTSLANGADLL
LTAVAQQGLAANVAEYCDIPLATLHCLPARVNGRLLPNVPSPLSRLAVSA
FWCGYWCVTNKAEESQRRRLGLSKASGSSTRRIVGRKSLEIQAYEDFLFP
GLAAEWAHWDGQRPFVGALTLGLPTDADAEVLSWIAAGSPPVYFGFGSLP
VKSPADTVAMISAACTRLDERALICAGTNDLTHVPRSGHVKIVAAMNHAA
IFPACRAVVHHGGAGTTAAGMRAGVPTLVLWMRNEQPLWGAAVKQMKVGS
SQRFSKTTEESLATCLRSILRPHYMTRAREVAKRMTKSSDSAAVAADLLE
NAARGETT
41409859NP_962695.1 hypothetical protein MAP3761c [Mycobacterium avium subsp. paratuberculoMDTVIAMALIAATNPVRLGIALLLISRSRPVLNLLAFWLGAMATAITAGV
GVLTVVHSFAPTLMQSVSALSATPDARHTQIAIGLVILAITALVAVSSSV
RPTRVTSASVDRRAGLPRPNTPSTLARLRGRIRDVLTSDGLSVAFILGLG
SGFPAVEYPIALAAIAASGNSVGVQFSAAVMFTVVMLLVIEIPLVSYSAS
PAQTQAVMQRIHDWVLPRRWQLLAVVVAAEAVWMVAAGLGGA
41409858NP_962694.1 hypothetical protein MAP3760c [Mycobacterium avium subsp. paratuberculoMSLPLDAADERNRYCIQLYHRTAAQADLSGRRVLEVGCGNGGGASYLTRT
MRPASYTGVDLNQAGIAFCRKRHIVPGLDFVRGDAQNLSFPDESFDAVLN
IESSANYTSLSGNVPGRGVNSGGVSVLM
41409857NP_962693.1 hypothetical protein MAP3759c [Mycobacterium avium subsp. paratuberculoMALDQSALLEVLDALRNADAADRIKQAAETIYQALIDAELTAVIGAGPHE
RSASRTNQRNGSRPRTLSTIAGDLELRIPKLRSGSFFPALLERRRRVDQC
LFAVVMEAYLHGTSTRKVDDLVKALGADAGISKSEVSRICADLDTEVGAF
RDRPLSEQHFPYVFLDATYCKARVNHRVVSQAVVIATGVAADGRREVLGF
DVGDSEDGAFWTAFLRSLKTRGLSGVQLVISDAHTGLRSAIEAILIGASW
QRCRVHFLRNVLAQVPKGSAEMVAAAIRTIFAQPDAEHVREQLDTIAGML
GRQLPKVETMLREAADDITAFADFPVLHWKKIWSTNPLERLNKEIKRRTD
VVGVFPNPAALLRLAGSVLVEAHDEWQVAEKRYLSETTLALLHPRSDSAD
QSVAVPAAITA
41409856NP_962692.1 hypothetical protein MAP3758c [Mycobacterium avium subsp. paratuberculoMSVMVGYLECRPLGALAPYVDCGWVRSNTAGGALRVMPDGCVDLFVTAEG
AVMVSGPATTFYDQCAGTEGAMIGLRLRPGAAAAVLGHPVSELRDTQIRV
DSVFGTSASGLAEDVLEANAFRQRVALLAAVLARYVVKIDPVVDQPVAHS
IEMLRVHPARSVSDVASSVGLSERQLRRRFDAAVGFGPKRLGRIFRFQRL
LDLIHAGDHRIRWADLAIEAGYADQSHLISECLALAGAAPTELPGAARPR
HA
41409855NP_962691.1 hypothetical protein MAP3757c [Mycobacterium avium subsp. paratuberculoMAAMAVSATAGIYPFQYTLADDVQGVLSGLNSYDRDAWAAAFSAVAARYQ
ARAEEAEQIGDTSVAHENYLRAYGYYRMARYPTMNSAGKKSAYRKSQEML
LRASRYFDIPIERVEIPFAGRPGEGDRIIAHLRVPKATDRLPVLLVSGGI
DTFKEDMHTDQVLARNVATLAIDIPGVGDAPLAGSEDAERMFTPVLEWIA
GRPELDPAGVGYWGGSTGGYWAAKIAHTHRNSLACVVSQGGCIDHGFDAE
WIEQAQSGEYPFELAETLAYAFGRDTFEQWVDYAPKLSLVRQGILDRPCA
ETLLINGLHDTVFPISDYYLLLEHGSPKSARFFATGHMGYTADTQSIILD
WITHRLQPSRDRQPGGGQ
41409854NP_962690.1 hypothetical protein MAP3756c [Mycobacterium avium subsp. paratuberculoMISSVGVQIQPAGTPNYRTWRAAVIQAECMGADLIFGYDHFHEPVFDKAT
DAGPVLSPHQPEVNHFEGWSALASWGEIINRAQIGLLVTGVGYRNPDLLA
DMARTVDHISNGRLILGLGAGRYEKDYATYGYEFGTVASRMSLFDASLAR
IKYRLAQLKPPPLHPIPILIGSSGEKKTLPRVARHADIWHTFLPIEQFRI
KSQLLDDLAQHNGRDGTAITRAVPWFDDKSADEYVAAGARVLIVQMRPTE
QGYDFSQLIKLLTWPRQAVLRTKLTQPISRKAKADV
41409853NP_962689.1 hypothetical protein MAP3755 [Mycobacterium avium subsp. paratuberculosMDFQFDVSIDGRPIKIVSIVDEHTRECLAGMVERSITGEHLIAELDQLAV
QHGTYPGCCGATMPPELACSAIAGWASGQIGPGSHQRLETRLQPPPPTLG
PGHWCGMARDPIILDQATPPGRQPSCNKRPRSSRMARWWVIWPSVMVKM
41409852NP_962688.1 hypothetical protein MAP3754 [Mycobacterium avium subsp. paratuberculosMATRKRHTPEQIVRKLTAARLRAAGNETAAVCRELGVSEVTYHCWRNQFG
GLKAEDAKRLKDSNARTPPSMGSG
41409851NP_962687.1 hypothetical protein MAP3753 [Mycobacterium avium subsp. paratuberculosMAHPGGAIPDNRLAFTDQMSFLSVRATGQGTVAQCVWIYERTVDFEGLRR
FHRNLDLGLLGRRIERSPLPFGRDRWVSSPPSVDIEVAEGARPRSELSEW
ADERGRLPVNAERGPAWHLGVAHFTDGSTAVSLVASHLVVDGLGFCLAIA
DAVNGTARDLGYPPPRSRHRLRAVVQDAYQSARGTHEVARALFTAVQAGS
RRRSDVARVRAARPMPIHRSNPDDGVMAPAITIYIDPDEWDARAKSLGGT
SNSLFAGVAAKLAEHSGCRSADDGTVAISFPVSDRTEDDMRANALSFVIV
IVDPAQATTDLRGIRGAISQALQTLQENPEELLQVLPLAPLTPKRVMRKL
AHVAYGYTDVGCSAIGELDPAVGRPDGTDADHVFIRGVRQRFTRQNFDRP
RGIFMVSGRIRGRMFITIVAYQLEGRDSKHHLHELVAQTLSEFDLTGTID
41409850NP_962686.1 acyl-CoA synthetase [Mycobacterium avium subsp. paratuberculosis K-10]MFGSSVQDVLRERAGMQPNDAAFTFVDYEHDWAGIAETLTWSQMYRRTLN
VAHELRHCTSSGDRAVILAPQGLDHIAAFLGALEAGLIAVPLAPPAGGAH
DERVHSVLHDTSPSVLLATSSVVGDVAKYAQPRSDGSGPSVIEIDSLDLQ
RSRVTFRRGNRPATAYLQYTSGSTRRPAGVMVSHKNLLANFRQIMSDYFL
DYGKVAPPDTTTVSWLPFYHDLGLILGICAPILAGVRSVFTSPVAFLQRP
ARWMQLLANNSRVFSAAPNFAFDLAARKTTDEDMAGLDLRDVLIIQSGAE
RVQPASMRRFQDRFAKFNLRDTVIRPSYGLAEATVYVATRTPALPPRVVY
FQPEILSSGHAKGCESGSGTALVSYGVPRSQTIRIVDPETSTECPPGTVG
EIWVHGENVSAGYWQRPHETEKTFGARLIGPSAGTPQGPWLRTGDSGFFF
DGELFIIGRMKDLLIVYGRNHSPDDIESTVQAIAPGRCAAVAVPAEGTEK
VVVIVESKKRGGSDEEVMNNLAAVKRELTSAISNSHGLAVADVVLVAPGS
IPITTSGKVRRATCVEQYKQDQFARLDV
41409849NP_962685.1 MmpL4_5 [Mycobacterium avium subsp. paratuberculosis K-10]MSIDHFGQPPKPQTFARAVRRFAVPVVVFWIGLVVGLSVFVPSLDKVAKL
RSVGVSPSEAPSMQSMKRAGKVFHEFDSDSVTMIVLEGDHPLGDNAHHFY
DQIVHMLEQDHKHIQHVQDFWGDPLTAAGSQSSDGKAAYVQVYLAGNQGE
SLANESVAAVRKTVGSVPAPPGIKAYVTGPAALLADQSSAGERGVQKVTM
ITFGVIIVMLLWVYRSIVTVLITLMMVGVELTAARGIIALLSYKNIIGLS
TFAVNLLVLLAIAAGTDYAIFILGRYQEARGVGEDREKAYYTMFHGTAHV
VLGSGLTIAGAMYCLSFTRLPYFQTLGVPCAVGMLVAVFAALTLGPAVLT
VGSRFGLFDPKRRMRTRGWRRVGTAIVRWPGPVLAVSVAVALVGLLALPG
YQTSYDNRPYLPTSTKANIGYDAAERHFPNARMNPELLLVETDHDMRNPA
GMLVLDRIARGVFHLPGVARVQAITRPLGTPIEHTSIPFQISMQNTIQVE
NQEYMKQRMKDMLQQADAMQQTIDTMQRMYNITAQLVATTHHMTGLTHEM
TDITKELRDNIENFDDFFRPIRSYFYWEKHCFDIPACWSLRSVFDTLDGI
DLLSDKLTELSRDLDKLDVLMPQMLAQMPPMIAPMTTMKTMMLTMHSSMS
SLYDQMDVMSQNSTAMGQAFDASKNDDSFYIPPEVFDNPDFKRGLKMFLS
PDGHAARFIISHEGDPATPEGISHVDPIKNAAKEAIKGTPLEGAKIWLAG
TAAVYKDMRDEAKYDLMIAGISAASLILIIMLIITRSLVAAIVIVGTVLL
SLGASFGLSVLVWQDIIGFKLHWMVLAMSVILMLAVGSDYNLLLVSRFKE
EIAAGIKTGIIRSMAGTGAVVTSAGLVFAATMASFVFSDLKVIGQVGTTI
GLGLLFDTLIVRSFMMPSVAALMGRWFWWPQQVRTRPASQMLRPYGPRPA
VRTLLLPENRDVAGSYVRVGKLSFSRPHY
41409848NP_962684.1 MmpS1 [Mycobacterium avium subsp. paratuberculosis K-10]MSEGDRVARIPVAKMVKKLWIVLVIVAVIAVAGLCVSRLRAAFANRDDRP
ISSGAADDIKPFNPKRVVYEVYGPPKTVADINYLDINAQPQKVANVALPW
TLSVITTLPSMSVNVVAQADTDQIGCRIIVNEVVKDERSADGVRAQTFCI
VKSA
41409847NP_962683.1 hypothetical protein MAP3749 [Mycobacterium avium subsp. paratuberculosMGRLAGKVALVTGGGRGQGRSHAVHLADEGADLIVVDIGEDIPSNQYALA
TRADLDDTAKLVEKAGRRVVAAQVDVRDRVGLKALLDEAVTQLGGLHVIV
ANAGICPLGNDIPVQGFVDAFDVDFIGVVNTVHSGLPHLNAGASIIVTGS
VAGLVPQAGGVSGQGGLQGPGGDGYGLAKKVIRDYTRSLALTLGPQQIRV
NAIHPTNVNTEMLHNPAMYQTFRPDLTNPSREDAEVTFPFMQAMPIPYID
PCDVSHAVVYLAADESRYVTGQQLFVDAGASLKLGM
41409846NP_962682.1 IS1110 transposase [Mycobacterium avium subsp. paratuberculosis K-10]MAAGRLWAGVDVGREYHWVCVVDDTGAVVLSRKLVNDEQPIRELVAEIDQ
LAEEVSWTVDLTTVYAALLLTALAAADTPVRYLSGRAVWQASAVYRGGEA
KTDAKDARVIADQSRMRGADLPVLAPDDDLITELRMLTAHRTDLVADRTR
TINRLRQQLVAVCPALERVAALTSDRGWVMLLSRYQRPKAIRNSGVSRLT
KILGDAGVRNAASIADAAVTAAKTQTVRLPGEEVAAHLVAELAQGVIALD
ARITATDADIEGRFRRHPLAEVITSLPGIGFRLGAEFLAAVGDPARIGSA
DQLAAWAGLAPVPSDSGKRTGRLHTPQRYSRRLRPVMYMSALTAIRCDPQ
SRAYYQSKRDEGKQSIQATICPARRRTNVLYALIRDNRTWQPDSPPITES
AA
41409845NP_962681.1 hypothetical protein MAP3747c [Mycobacterium avium subsp. paratuberculoMHTPVVLLTGRGCTGRVAAALRETPGTAVISHTLDGHVVRRRVSMLRAGA
PWDSDWILELGNADPGRTIHDDLLILLRRVHRRQDVDRVVVLLDERTELE
LICYAINHTPVCVGPGYADGPAALDVHISSVVTCVDTDSWLAHAMGDDEL
DDHRSAAQAVVDQAEFADVLVLSKPERRTEAVLRRLAPRSRITCDITSIE
SILRNLHPLARRGADFDPHESLLTGQPPLVSEAGVSLLDFTATRPFHPAR
LHTAIDVLLEGVVRTRGRVWLASQPDTVVWIESAGMELRVGNVGRWLAAM
DASEMAAADADRRIMAAARWDDQHGDRHVAMTILTCGADPGEILRILRWA
LLTDEEFSQPGRWANYADPFGDWRAGPFESVSYGSAGEHPDIIRGHGADD
RIGDTS
41409844NP_962680.1 hypothetical protein MAP3746 [Mycobacterium avium subsp. paratuberculosMTRTPESQQESDYGYVAHKDGYAKRLRRVEGQIRGIAKMIEEDKYCIDVL
TQISAANNALRSVALNLLDEHLDHCVSSALAEGGDEAQAKLSEASAAIAR
LVRS
41409843NP_962679.1 hypothetical protein MAP3745 [Mycobacterium avium subsp. paratuberculosMTVRIGALTEPTPGNRTVVVFPHAGASPRFYASWCRLLPAGVDLYGVTYP
GRDMLLDEPVPETLADLACNCAVELKPIIYSSSSVVVFGHSMGSLVAFET
IRELEQDGVSVTALVASGADAPHLETDQSWHRAADEDLIQHLAELDSRSR
DVFAVPELRRMLLPTVREDFRLVESYRAELHPPVSCPIHVMTGDADPEVT
AHRWAQWAVHTRAPWHVRSFAGDHFYIRTHEDDVVRHLCGILTSAPAATQ
41409842NP_962678.1 hypothetical protein MAP3744 [Mycobacterium avium subsp. paratuberculosMTTRPHRPRAIVVGSTFGAVYAEALAAPESPVELVGLLSTGSRQSADLAS
RLAIPLYTGMNSLPRVDIAFVVVRSGVVGGEGTRVCKELLSRGVHVVQEQ
PVHADEIMSLLHVAAENAVLYTVNDFYSRVAPMRQFICAAKTLDSLARIR
YVHARASLHVVYPLFTILASIVGPLTPARIVMPEQTGGAFVAGRIVLADV
PVDLLIQNELCASEPDNYARLLHTLTVGSDAGELVLDHTHGPTRWHPRPY
PDSWASQSGCPISERVGIDFDPTTATVRNELWPDAVRLAASEFLGSIGRV
RAGVTQRFVRATRLWSEFTSAMGPAAPINPVTSARLSASELVAL
41409841NP_962677.1 hypothetical protein MAP3743 [Mycobacterium avium subsp. paratuberculosMGGAHVRKVLLLGSTGAVGSGCLDVLSRRDDLAIVIAGRDEARLRAVAST
KRSGVEVTRLDIADVPAVTATAAHCDIVVNCAGPSYRFSSDVARAAVGAG
AAYVDPGGDQTLLDSLAAIETTAPVVLQTGVQPGLSGLLLRALALRHPER
IENMHAWCGGLQPLTAAAVHEYLASLESPHSYPASALRGGAVRRVRNEEC
VPAPAQYFPDTASVHPHLDSETIAVAAQLGIGKVWWANVLDGARTIRAIH
LLAAEDRQGCRDKDLREVLAAVKLDLFGRAAYFAIVCAAQSDSVSTTLAV
TCENSYRVSGALAAFAAQRVTRMTAGVHPFWTVDDPWDVLAFLAATVP
41409840NP_962676.1 hypothetical protein MAP3742 [Mycobacterium avium subsp. paratuberculosMRLSAERFEVLSRRAAEHGATVNVAIVTAFSRAIARYGDRDHFLLTLTTM
DRHAFTPAVGQLVGDFTGTSVLEVDVRGQRTFAELLHGVGDRLFDDMDHS
TTGGVNVARLLGQRDDDRGEQTPVVFTSTLGATTRIDSGATSLLHPIQGR
GLSQTPQVLLDCQVAEIDGMLEVNWDTRDQAVPAEVLDRAFADFRHALDL
LSTDASAWHRPLLPAQPPETTPVEGPRTHHEPALIHTGFLRNVLVTPDAV
AIRHGDRATTYAELLAAATAVADTLAATGVRPRDYVGIRLPQGPAQIAAL
LGALLARAAYVPLDVGWPTHRVDQIAAQCSLAALCEPDGEVDRLLADPQT
WSPRAAVVPEPHSEVLAPDDTAYVIFTSGSTGVPKGVMMAHGAVVNTLTD
INDRLAIRASDSVLAVSQHTFDLSVYNIFGVLAAGGTIVFADGNETSNPQ
AWCDAITDHRVTVWNSVPAQMQLLLDHVNGTQTLPSLRNVMLSGDWIPVS
QPPEIAALAPNASMLSLGGATEAAISSICHPLAAQVYQRSVPYGTAMRNQ
SVRVLTHRGEPASPWQIGEIHIGGLGLAQGYLGDPERTASAFVVHPVSGE
RLYRTGDYGRLIHDGVIEFLGRRDNQVKIHGHRIELAEVDSALSALAGVH
AAVSTVVGQGPHDRLLAAVVVADAADDDEKRQRRDIAAAVRCAAADAHRN
STADLDGDKLGHFASTARAVAIESMCAALRTVMDVGERIDFAELAGRLAL
PQRLERLLRRWLDALEEAGMVVMHRGPSIELRGGPELSACSAQWQHVRAL
GAAVDYGDELLDYVGQCVENLSGLLAGTVDPLALLFPEGTLDTATAAYRD
NLVSRYTNGLVIAGVAERARWATPTRPLRVLEVGAGVGGTSVGLVAALAH
HHVRYTFTDVSHFFLGQAAKMFAEHDFIDYRLFDVNQPPAAQGLPPGSFD
VVVCANVLHNAVNVDDTLAMFERLLAPGGSLVFIDATATNHPLMISMEFK
EGLHGFTDARAGTNSAFLSYAQWGDALERSPFGEVWSFPPPEHPLSKLGQ
HVFWCDSASGAHALRPGELTERAHAVLPSYMVPQQVICLRSLPLTTNGKI
DRAALTAELESLRAAARRFGRGGDGVSASLDAMQTRIAEVWVSVLGLPST
EALSPNSDFFALGGDSLLLAQTIGRIRREIDEAAGIAWDDLLRAMVSDPT
LAAAAQAVQGCGPTADSGDYSAELDSPLVYLGAGQGFRSGTEIAVCVHDG
SGGLAPYEQLVSELRSAADGAPELYGLRRVAGDAYSRIAPPELFTTLASR
YGAAITALAPSKVHLVGYCMGGLLATEIAKCLEESGIVVAPVTVVSSYRV
PFDIEDDDILDYCFAQIMGVSPSDLGLRVADDAIRAAFAAVRSRHADLIP
PGALRAVAAPELASALDQSAAPGEQRLKLLAQSGVLGDSWTAESLTELRA
IFVHSLRSVVQGAADPFLGDVHFLRQRGDIHFLPTLKEDMTEFWRGYCLG
ELTITEIDGNHFDCLTGENARSVAGLLLGSWVVRT
41409839NP_962675.1 hypothetical protein MAP3741 [Mycobacterium avium subsp. paratuberculosMTAAELVDHLRGIGVQLWADGENLRYRAPQQVLTADLKAQLAAVKTDVIT
LLAEETTLLRAPQDRFEPFPLTDVQAAYLVGRTSAFQWGGVGCHGYAEFA
VDHTVATPSAEQYREAWRKVADRHDMLRCVVHPEGYQVICPDVPDDGLVI
HQCHTVEDVAGVRAGVTEHLRNRIYPLGEAPMYDLVITMGPDDTVVHLSV
DLLIADFVSISILMTDFQQCLLDPECDLAPVDFSFRDYLLNLARERSSAA
GSARRERDLAYWRDRLDQLPSPLSLPVLPDD
41409838NP_962674.1 hypothetical protein MAP3740 [Mycobacterium avium subsp. paratuberculosMQDNRTVRRPAPKMMSSTPGPPALHDGDRSVPAVFAEWVGRRPDAVALRT
VAATGIDDWTYQRLWDHVREIRDVAFSGLSAGIRIPMALPGGADYVAGML
AALAAGLIPVPVYLPSTREPQRFLARAQHILRDCEPSAVYTCGELVEVLE
RDPILGALPIRTPASTADGLAPHPGGTTADADHGEHVAFLQYSSGSTGKP
KGVVNTHQSILRQAAFAANVWNGDDDMHMVSWLPLYHDMGIFWGVFMPLL
NGGCTTLIPPHDFVRNPRIWLETVSRFRGNWIGGPDFAYRRCIEAFDGTA
LQSLDLSCLRLATNGAEPVRGTTLRDFTAKFRAAGLRDDVMAPQYGLAEA
GLGVTGSQTVRVWVEKSFDADALERGIAVEVAQPNPADGRSRALVSCGDG
AFGWDIQIVDPDRHMTLTDGEVGEIWVGGPGLPDGYWRQPEQTATTFGAR
TADGLGPYLRTGDAGFRYQGELYVCGRYRDLIIVGGRNHFPNDIEKTVEE
AHCGVAPGGACAVQPDAPQANGEWWLVLETGSPVEDLDDLSRILRRRILA
HHETAPERVVWVPCRTLPTTTSGKIRRRETLNRLTAGQLEVVHEVSPRAQ
APDTPAAPDDPPTELAQHLAAMLGVEPYELAPDADLTTLGLTSMMTAQIV
EWSSSQSRRLDFADLYAEPTLRSWQRLFDAAPPVQTGTSSVAASGPWPTT
PLQQAYWVGRGAEQPLGGVGCQTYFELVGARVDAGRLAAALDALTRRHPM
LRATFPDPGRCLITPEAVRLPLAVHDLTDAPVTTRDTHLAEIRRRLRTHR
FDIETGDTWTVELTRLPHGCIVHFAVDLIIADVTSIGTMLRDLAASYRGE
KLPAPSATFADLIQSTSPPPQACADRLPEGPQLPRVQEADISFLRHQHTL
SALATKAIDDACHNHGVTRAAVLLAAYTLVLRRWASQDDFLVNVTTFGRS
PEVSDVVGDFTETHLYRAQLDGQISFVDQAQVTQKGLRTALRAAPAPDLL
ATQLRSGTGHSGIVPVVFTYAADSPLLSAEDANTLGAIDEVVSMTPQVLI
DHQACRLGDDVVLSWDYRAGCFPPGVVDDMFEAYVTLLERLGGHDWSTPA
TPGLSAHSRLARAHRNATTTPAPAGLLYDAFRENAATHPARLALRWRPDD
YRGERHGDVIAQDRSQLTYGELDELARSVARAVAARHAAGSVIGIQLPKG
PSQIVAVLGVMMAGCTYLPVGVDQPAERLSRICARSAMAGLIRTDSDTQD
AGVAVSDITAMIECAPTDPIRIDPHDAAYVIYTSGSTGEPKGVLVSHAAA
LNTIVDVNRRNRIDTHDRLLALSALDFDLSVYDTFGALGCGAQLVTIPEH
ARRDAFHWLSLTTEFGITVWNSVPGLMDMLLIAAGDKAGSLPTLRSVFLS
GDWIPLDLPRRLRRAAPGVRLVAMGGATEAAIWSNEFVVDDVDPDWASIP
YGYPLANQMFRVVDDNGDDQPDYVAGELWIGGAGVALGYHNAPELTSDRF
VHDPTGSRWYRTGDMGCYWRDGTLQFLGRADSQVKIRGHRVECGEIEHAL
RGHPLVAAATVVPIHNCTALGAGIVVTGSGAEQFDDSTPGALRAHLAVRL
PQYMIPKVFVSCPELPLTANGKVDRGKIAARLEAAARAPQPLDTSSTLTV
VERLVAEVWSDVLGAPITGREDNFFAQGGDSLRATEAVARLTRRGVAGAE
VGQLLSHQTLGQFSAACVLADPASEASESAADVGEPVTPGEGFPLTRLQQ
AYTLGAAGLNGSTCAPTYFAVVLAAAPESAGIDLDRFARVVTRCVDEFAM
LRCALDADTTQRVQVDAGPVPVHDLDIQDDPDLLLRRMAAAPFDPHSVPV
IQCFAPSRSPRHVGLLISYLGLDARSLSTVVTTIIAEYQSQPRPRQVDPT
AAVFARFASESAWGENDVDNSVAGPPLLPLHDQRRDPFERVTFARRSFTI
EEQAAATLREHAAHLGVTPTALVFEAFAHALASIGAGQRFAVTVPKSYRP
DYAPADREVLGNFTRLALCEVDYGAVRPGSAEAVAAAQRELWRAVSHDGD
ITGGLAATRTAGGYPVVFTSTLGLTHQDASGLTNVRTLTQTPGVWLDCQT
EDEVAGIRMSWDIATNVVAAESISVAFSRFEEAVRRHAGQAEPPGTAVAP
AVGGSPGPEWASAVIAAALRHCRPEQVLPQYTMLVRRWEALRYVPSGYAA
SDVERAARRLAGIVTGAVSPQTLIGDPQLTPEALLLRDDRMRMALDDLAG
AIFGHARTLGRRLRVVEVGSRTGLITERLTELVGVVVEEYLCLEPNPTLA
GIAAGRRFPAPTRHVDAPDAASGVDVVICCGSLHQLPDAEAVLEAITVSD
DGWLWMVENSEATQATLISAAVLDPGLLASDSKTLRPADRWWRLIADHGW
RPTHMIQDGPGLTLIAHRPDKPGMPTPPAEQRRDGRWSRPAVPASSLPTD
ATVVATLAEIWQRHLAIPTPGVDDDFFLLGGDSLVATRVYADLRAAGFGQ
LAFVDLFNHSTLGELAAHAGPRTGPEVSVAAESTRGGTHDPNRFPLTVVQ
NAYRAGREGALILGGVAAHCYFEFELADFDRPRFDSAARQLVARHAGLRT
TVSPAGTDAASSGEVAVVHTAPIEPVVRDHDDVRAAMRDQIIDLTARPGI
DFGVQTRGDGRTVVGISMDNTMLDGASMMIALSELDHLYRGETVDQLPPL
ETSFAHYVWNHPELLPDADEAVLPRLAASRDYWRARLPSLPPAPKLADMS
LLFEIEEPRFERATATIPAVDWSQVTRSCRAEGVTVASFLLANYARVLSR
WSGTDHFCINVTLFDRDPDVVGIENVVGDFTSLVLLECRVDEPASIWESV
RALQRQLMTDLPHRGADAVWLQRELLRFHGNPTAALFPVVFTSGLGLVDA
SARAAVRFAEPVFAASQTPQTVLDFQVWESAGALKLSWDFVSQAVSPATA
RTQLESLVDGITGVATRSRRIEHKLGEGASNDELLQRVSRICASALGQPR
VEPHDNFFQLGGDSVSATKVVEQIGRELSASATLRLLFANPVIGDFAAKI
ADTDNADEPDLTVEEGML
41409837NP_962673.1 hypothetical protein MAP3739c [Mycobacterium avium subsp. paratuberculoMSIGAQMLDHARSNQTWTTAVAALACFLMTLDITVVNVALPSIQKDLGAS
LEGLQWVVNAYVLAFAALLLTVGSVSDRLGRKRLFLTGVAVFTVASALCV
ASRTESPLIAARALQGIGGALVFGTCLALIADAYTDAEEEQRRKAVGLAM
AAGAAAATLGPLIGGGLVEIGTWQWIFAINVPVGVALAICTALKVREPHA
PHAADNSRVDSVGAVVAIVVLFALNYGLLTGAAKGWGRGDVLAALAIGLA
GGVGFVLHQLRRGSEATLDLTLFRIPTFLAAIVLGFTVRALSFGVFPFLI
LWLAGAHGRSAFDIGLILSALALPLMVCAVLSTSVARAVGVRATMSIAMV
ITAAGLFLATLIRGDGSWTTILPALAVLGVGNGVAMPHLMNLAVDVVPSN
KAGMATGAANTAFPLGTATGVAAFGVVLSSFVHAKVAASGVIPVHSADSV
ASAIVAGVLRFPTQAMTAFATSAFTDALRLIFGIAGCAALVAAGLSGALI
THRPRVAAESPESVTE
41409836NP_962672.1 hypothetical protein MAP3738c [Mycobacterium avium subsp. paratuberculoMSVTPGADPYALSAEFYEVMAIPHWDMKRQVLVSALTARGPVKDHVLDIG
AGTGLSTVTVADTIADVPIHAVEPSAAMRAALVSRILSRPDLIDRVTVHP
VNLEELDLPERLGAVVLFGVIGYMDKQARQHFWAALRPRLTPRAPVIVEV
MALDQPMPVPEMTIAQQRIGVRHNEVRISGQPAGSDAEHWTMRYVVSEGD
KVTREFTAEHTWHTVGLAELAHEAEAHDMTFEQLHPIIGVLHPR
41409835NP_962671.1 hypothetical protein MAP3737 [Mycobacterium avium subsp. paratuberculosMTAPVWMASPPEIHSALLSSGPGPGPLLEAAAAWSSLSAEYASAADELTA
TLAAVQAGPWEGPTTEAYVAAHAPYLAWLDQSSADAAGEAAQHEIAASAY
TVALATMPTLPELATNHATHAALVATNFFGINTIPIALNEADYARMWVQA
ATTMSTYQTVSTSTLAAAPRSSAAPAIVKSEDSSAGDTGDSSGGGGFFGD
LLSAWENFVMNLMDQLFGVDSPPDLASAVAAFLANPSPALFSALLFALAY
EIAFDTLFFSPVALLAAPFLPFVGLAGLAGLAGLAGLAPAPEPVPATVAD
VPAPTSPPNQALPVAGIPSASTPASAPASAPATSATAPASAPAPAPASAG
SPVFGYLVGGGGGGESGPTLTGRSNATAPAGLAAASAAAAKAPTRDQTRS
RRRRRTVMRDHGDEFMDLDMGAPVDSPPGGTFVSGQGAGSLGFAGTVANA
AGARAAGLATLDADGFGSSPKAPMLPGSWHGDATQESQGSGDDEHPTEGN
AGTE
41409834NP_962670.1 hypothetical protein MAP3736c [Mycobacterium avium subsp. paratuberculoMKIIFITDGDPTALRPLMKVIFNNPDVTEVTLVAGCAPWRSASDARLTAD
RMPCPRFGRGGCDALRSWQCSGFHSLHAGTPYARAPPERPEANSAARRSF
QLSGRRHSHRINRRSPRGLALLSVSEGTAPYPLIHPLRGGMLSITIFIIG
SRWLGLSAEGLSMDPNTPSQVGPQSPVFGAARATLIGCALLTALSALAGM
APLIAVVEVSRRLLAGDTAVWAIIAAALVALAVKQLGTFCAGVLTHLADI
QVSFRIRRDLLVKLSKLPLGWFTDRNSGIVKKTVEDDVSGPAPADRPFHR
GTHRGDSSPISRLDLPVCC
41409833NP_962669.1 hypothetical protein MAP3735c [Mycobacterium avium subsp. paratuberculoMALVTLLPVLIGLVMYQRAMASADTKYPEFMQWLARLNSAAVEFVNGIGV
VKAFGTPGVASRRFQEVSRAFAHFFLDWAKSTSVAAVIAETLLSPPSILV
VVAGAGGALTANGKLPLDSFIAFLVFGTVITAGLMTVMMSIHPLVTALGV
ARDIRELLAGPELPTPDEPVGLDPSSAAPVVRLRDVVFTYGETVALSGIN
LELDRNTITALVGPSGSGKSTLAKLLPRFDDPVEGSVELYGVDLRSVDPA
ELYRHVAFVFQDAELLRMSIRDNIRLSRPDADDVAVRDAADRAQILERIE
QLPRGFDSVVGEDAELSGGERQRVCIARAILADRPVLVLDEATASADPEN
EARIQDALNEAASGRTVLVIAHRLNTIRGADHIVVLDDGRIAEQGTHFEL
LESKGLYARLWEHDRRVQSGVAEHMEVGR
41409832NP_962668.1 hypothetical protein MAP3734c [Mycobacterium avium subsp. paratuberculoMSTMIRYLLELLDERGRRHLRVMLALQAAQGILQGLGFLFVVPLMGVLIH
KPVDTHALWCWIVAIAVAVVAHHGLLAWSTSLGYLVGTDVLTSFHTRIGN
HLATLPIGWFRTDRTGPIGRLLSKGTMDVADLPAHLLRHVIVGVAAPATM
IIGSYVLDWRVGLAFTAGALLCALTLRLLMVVIHRNDDQYDHDIGVTASR
IVEYARQQPTLRAYGVLNRPGLGTLEESLVRQQTSQSRLTIRGAWALIGF
FGTVQLVVTAIIALTVALAVSGSLALSTMVGLLIITLRMIDPISQLGDLA
GHVQVNADAIRRVRELLTVPPLPEPTHPGQATGADIELQGVRFAYDGGQP
TIDGIDAVFPQGSLTAVVGPSGAGKSTLLKLIGRFFDVDEGSITIGGCDI
RQLGTAGVSHLTAQVFQDVYLFEGTIADNLRMADPQATDDDLRHVATISR
LDEVVDRLPNGWETRVGEAGSTLSGGEKQRVSIARALLKDAPVVLLDEAT
AALDAANETAVSDAIHELARDRTVIVVAHRLSTVAAADQILVLDGGRITE
RGRHDTLVGAGGTYARFWEERTRARGWQLRQIAPTPELQAPRP
41409831NP_962667.1 hypothetical protein MAP3733c [Mycobacterium avium subsp. paratuberculoMTATSSTTQSSRRIDVRMSARDLINIGVFGALYIATVFAINVFAFINPLV
MLVALAVSMIAGGVPFMLFLTRVRHAGMVTVFAIITAGLLALTGHPPICF
VITVACALVAEVVLWLGRYRSRTMGVLAYAIYAAWYIGPLLPIFYARDEY
FSSPGMAQMGPRYLEEMERLLSPAVLIAFDLSTVVFGLIGGLLGVRLLRK
HFQRAGLA
41409830NP_962666.1 hypothetical protein MAP3732c [Mycobacterium avium subsp. paratuberculoMTRTTTRVTQLDPRTKTVLVLASSIAVMAPGGEVFVPAAVIVGMLLAVAE
QAWVRAAILPSAAGATAAVAYLLPQAIPHPIIGAIGTVAAYLLRLIAVGA
IVIHLVNTTTPSEFTAALRATHIPRAITVSGSVMLRFLPTIVGEARAVSD
AMRLRGIGGTYGMLRHPVCTIEYFTVPLIASSLRVAEDLSATALLRGLGS
AARPTTMYPPRFGKADALIGCIVSALTVTTVLWPVKP
41409829NP_962665.1 hypothetical protein MAP3731c [Mycobacterium avium subsp. paratuberculoMIRIDGVRWQYAGTDAAVLDGVDLHIRRGETVLLCGASGSGKSSVLRLMN
GLIPHFHQGSLDGSVHIDGTSVAELSLERVGRLTGTVLQHPRRQFFTAAV
DTELAFTLENFGTPPEQIRNRVGSVITEYGLAELTGHRLAELSGGQQQQI
ACAAAATHGPPLLLFDEPTANLAADAIERFTATLARLRSLGTTIVIAEHR
LHYLREIADRIVLLRNGRIAAEWSRKQFARLDDAALNAEGLRSNNSPVRN
HIPPACAYGASVAGTPSGTAAPASSPSEVVLRGIRCCFRGHRVLDIEEAR
FPAATVTAITGPNGAGKSTLARVLVGLQRHDGEVSFGGSRISRSRRQRMS
AIVMQDVQRQLFTESVRAELRLGAPPAAAGVASTLLRDLGLEEFADRHPL
SLSGGQQQRLVVAAARLSNRKIMVFDEPSSGVDRRHLRSITNVMRDVAAQ
GVVVILISHDQELLTLAADQELRMRVADTLNARSRRKAAGENACLETLSD
41409828NP_962664.1 hypothetical protein MAP3730 [Mycobacterium avium subsp. paratuberculosMTASPDDTNALAAEWDERYAGLTTEMRDAEPNAVLITEVSKFAPGRALDI
GCGVGAEAIWLASREWDVTALDVSRVALARATARGRQAGVRVNWVRAALE
DAPLRVGGYDLVTAFYPALRHSSGRAAEESLLAAVAPGGTLLVVHHADVD
AEKAKSYGFDPADYLSHDDIATLLDGDWHVRVDRRQPRKTPARPELQHTH
DDVLLARRLR
41409827NP_962663.1 hypothetical protein MAP3729 [Mycobacterium avium subsp. paratuberculosMPLSLRPAAALFGAEIGGIDLRAPLTREQRDELQRLLQRYRVLFFRGQQL
STAHQIEFAEAFGPILIFRSVVPADPQHPGVHNVDGSTVGWHLDASGLIE
PPVASVLRAVEIPDRGGDTVWADGMAAYDGMPDDLKSRLEGLSATHTAPN
QHPLVAHPLVSHHPDIGRRYLNINLAPWVDTRILGMSTSHSSALVEQLRA
HHLRSDYQLRFRWSAGAVVLWDNRGMQHTGIRDYGDDTRRRLQRICIAHF
TEGVTGRA
41409826NP_962662.1 hypothetical protein MAP3728 [Mycobacterium avium subsp. paratuberculosMIRAVLAAVCVATSAAGCGAAHHSPAEPTRTVVDMTGQHVQIPATVTRVA
TNIPLIPATIELLGGIDTVVAAARGSFNALFTTIAPATQQIPRSPPTSLN
AEQLLDLHPQVFFMTDLTPGLLPMLQRLQIPVVQITAFTSPQDLQKAVNL
VAQVLGGAAPARARQYDTYFDAVIQQVHAGAQTDRPTVYYAPGPDPTTTV
GADNIITASIEAAGGRNIAVEHGIGGHQPGAFAFPTITAETLLAWNPDVI
VASNARVADQLATDPTFATLNAVRDHHIYTCPVGIFPWCASSSEAALAPL
FLAKKLDPERFSDLNLANKVANFYIQFYGYSLTGPQVTAILDGAG
41409825NP_962661.1 hypothetical protein MAP3727 [Mycobacterium avium subsp. paratuberculosMDVSSAAIAAEQLSFGYPGDGQRLIAVSLAVQPGQVCCLLGPNGAGKTTL
LRCLLGLLTPQSGTVRVAGDPIDRLSRRQLARRVAYVPQRSNTPFPFSTL
DIAVTGRTPYLRAMTSPSATDRRAAAAVLDRLGIGALADRPYAVLSGGER
RLALLSRAMVQDAPVLILDEPMAALDFGNESRILQVVAELAAAGRAVLMT
THQPWHALHSGDQAVLIADGRLIADGPVEQVVTAAALSELYGVPVRVLTA
TDDATGRPVYACAPVAAGDDR
41409824NP_962660.1 hypothetical protein MAP3726 [Mycobacterium avium subsp. paratuberculosMTLIKRCVRGNGWRTTLLMLLLLTAVAASLMVGRYPVGVGAMAGMLFGRL
PLLDTSFTPVDQTVLTQIRLPRIGCGVLVGAGLAASGAGYQTMFRNPLVS
PDILGVSAGAGFGGALALLLHAPYWQLEAMAFASGLLAAALALIIGRGIG
RDSAILLVLAGMVIASVFGALISVTEYLANPDDTLPAIVFWLMGGLGRQH
LDGLLAPALIIAAAVLVLYALRWPVTVVVSGDEDAHTLGVDTRRTWAAVV
GVYTLITATTVSLAGIVGWAGLLIPHIARALVGPGFGRLLLVSAALGGVF
VVGVDDVARAAASAEIPLGILSALIGAPFFLVVLAKMRRQWT
41409823NP_962659.1 hypothetical protein MAP3725 [Mycobacterium avium subsp. paratuberculosMTAPIWMAFPPEVHSALLSSGPGPGPLLASAGAWNSLAAEYTSAAEELTA
VVEGVQAGAWQGPSAESYVAAHAPYLAWLTQASADSAGAAARHEAAAAAY
TAALAAMPTLGELAANHATHAALQATNFFGINTIPIAVNEADYARMWVQA
ATTMTTYQAVSTAAVAATPQTMPAPQIAKSTAATIPFQRPYPNPTNFSQV
WADLWYDIPYSIETFQGPVDPANWTQLFQFWNVTFANLAGTPAKLAQIFS
NPSVLFSWPTLLWVLDFIAGRIFDILVTLKFLLEQPLLYVVGLGMAVTSL
GAAAGAAGGLVGLAGLASPGPLPTGAEMVPVTAPPPGATPAPTAPLIGGP
ASAPATIPVSSAAAAPTAPAPAPAVAAAGSAAPPPAGPGGFPYLVGGMRV
SSAASASAQSRKPKSAAAAAARAAAAAAAETHHARRRLRVKAKMLGRGYE
YMDLEDDHLSSSAASEHGAGPLGFTGTMRESGAATPAGLTALGGGSFGGG
SKMPMLPTSWVTNGSGEA
41409822NP_962658.1 hypothetical protein MAP3724 [Mycobacterium avium subsp. paratuberculosMAIHQSVQAPIGHVERGATDPPRPQRRRRGRTLGIDEGLMGVALLAGPAN
VIMQLAQPGVGYGVMESRVESGRVDLHPFKRARTTFTYLAVATNGSDAQK
AAFRRAVNKAHAQVYSTPESPVSYNAFDPALQLWVGACLYKGGLDIYRMF
IGELDGEDAERHYREGMALATTLQVPPKMWPADRAAFDRYWEESLAKVHI
DDAVREYLYPIAANRIRGVKLPGPIQRLSEGFALMITTGFLPQRFRDEMR
LPWDATKQRRFDRLIAVLATVNRYLPRFIRQFPFNVLLHDLDRRIKKGRP
LV
41409821NP_962657.1 FadD27 [Mycobacterium avium subsp. paratuberculosis K-10]MSDTSSARPYRGVEAAERLATRRNRLLAAGLDLLGDQRPDISAVTVRGVC
RRAGLAARYFYESFTDKDEFVSCVFDWVVAELAATTQAAVATVPADEQTR
AGIANIVRTITDDARVGRLLFSTQLADPVVVRKRAESSALFAMLSGQHVG
NALQVPANDRIKAAAHFVVGGVGQTISAWLAGDVRLEPDELVDHLAALLD
ELAEPNLYRLTETRAEA
41409820NP_962656.1 hypothetical protein MAP3722 [Mycobacterium avium subsp. paratuberculosMLPLGDRRAAAGARGHRRVARRADPQAAGRRARARMALGDAPADRRRRGG
EPGHHALPHRWRRAVRGPGRRGSGTRRPDPLARRGRSAALASPARGRAPN
RARRARCRPRRRCRGPDAPAGPRRHRVRRPATREAARAAGRARRPHCPAD
GDDLRQRRRLGRARNRLGRHQQRAARRVGGPPRPAGGAGGPRRLGQHRHA
RQRARPKRHARQRGHERRRHAGVRGDHHGPARDPRRHQAGAGSPSRRARR
AVGAAAPRPADPEAGVSAVAQRGHRRRGDRGVVQSRRARPGRQPAGRHGR
RLLRHEVGVPGRDRRDDAPHQRGPGVAVGAGPRPGLHLGPRLRIGPPQFE
RGSATSAFQDAERLLAGRHNGLAHGLPRVRR
41409819NP_962655.1 hypothetical protein MAP3721 [Mycobacterium avium subsp. paratuberculosMVALGNINEWHPPHGPVTMWMAAPAAREAARAARRSDLAPSYQQNQHLWA
SYQGKAMNRQLPRLMIVAWDIPGTCDIAAMTATINAHVRRQDTYHNWFEY
DNGTFVRRVIDDPEAIEFVPVALGHKTADQVRAHALTTTPDTLEWGCFTY
GIVQHADYFTFYASVDHLHIDGLSAALIFLDVHLTYQELAQTGHQPAGLP
EIRSYRDYVARQREKAATLTLSSPEIKDWIEFARDTDGDWPSFPLPLGDT
WSSTRGDLLTVELINAEDTESFDAACVAADARFIGGVLACTGLAEHELTG
KKTYHGFTAKDTRTPGVDSMTVGWFASLIPITVPTAGETFAQAARTAQKS
FDDAQRLADVPVERVLELATPDELGIKLPTQLPMMLSFLDFRKIPLNGLW
AETKFGTYGDSLSHGGVNMWINRQAANTTVTMSFPDNVIARESVLRYIAT
LIQVFARVARPTGDEPVVVAPQVKPDDTFAPAPDTDDHEAA
41409818NP_962654.1 hypothetical protein MAP3720 [Mycobacterium avium subsp. paratuberculosMTDGILTDEQIAALTPGQRRDLISRLERPLGEVIDPDFLDRVRRVRLSLM
IGGSIAMVPWLGYLAMTLPEKYVAHNWPVTWIGFDVLLVAFMLTTAALGY
LRRQLLVLAAFTTGVLLICDAWFDLMTAGPKDVWLSVITALLIEVPLAIF
MIFSAMRILRLTMMRLWLLRPGMRLWELPLFP
41409817NP_962653.1 hypothetical protein MAP3719 [Mycobacterium avium subsp. paratuberculosMARLIEPGTEGSRTMIKPHNTNAEFELGGINHVALVCSDMAKTVDFYSNI
LGMPLIKSLDLPGGAGQHFFFDAGNGDCVAFFWFADAPDRLPGISSPGAI
PGIGDITSAVSTMNHLAFHVPAEKFDAYRQRLKDKGVRVGPVLNHDESPM
QVSATVHPGVYVRSFYFQDPDGITLEFACWVKEFESGDAKAVPKTAADRR
PPVGAGR
41409816NP_962652.1 hypothetical protein MAP3718c [Mycobacterium avium subsp. paratuberculoMAQGGAQVSTAASPADRSGPPAELPTHRGRRTQAAIDLAARTVIARKGVL
AATIADIAAEAGRSAASFYNYYESKEAMVRQWALRFRDEANQRALSVTQH
GLTDRERAYGAAAAHWHTYRNRLAEVISVSQLTMINDDFAQYWAEICSIP
ISFIAESVRRAQAEGRCRDDDPQLIAEAIVAMFNQFCYVQLGSARCGEPD
DEACIQTLANIYYRAIYATEGDR
41409815NP_962651.1 hypothetical protein MAP3717c [Mycobacterium avium subsp. paratuberculoMTRRTGAGVIREFVGLPSPTAGRAGAGGHPCQGLYHRRVGRKPKVAMIAA
HYQIDFSEHYLADYMATRGIGFLGWNTRFRGFESSFLLDHALVDIGVGVR
WLREVQGVDTVVLLGNSGGGSLMAAYQSQAVEPNVTPLEGMRPAAGVTEL
PQADGYVATAAHPGRPEVLTAWMDAAVVDENDPVATDADLDLFNGRNGPP
YTPEFLARYRSAQVARNHAITDWAERELKRVRAAGFSDRPFSVMRTWADP
RMVDPGIEPTKRQPNMCYAGVPAKANRSAHGIAAACTLRNWLGMWSLRVA
QTRAEPHLARVRCPALVINADADTGVFPSDAQRIFDALAGADKTRASVDT
DHYFTTPGARSEQADIVAGWIGKRWR
41409814NP_962650.1 FadE6 [Mycobacterium avium subsp. paratuberculosis K-10]MPIAINPEHQELADSVRALVARIAPSETLHEAMETEVGNPPPYWQAAAEQ
GLQGVHLAESVGGQGFGVLELAIVLAEFGYGAVPGPFVPSAIASALISAH
DPDAKALAGLASGAEIAAYGLNCCALTATRQGSSLVIRGELRAVPAAAQA
SLLVLPVAIDSGEAWVVLRADQLEIEPVKSLDPLRPIADVRANAVEVGDD
VVLTNLSMGTAHALMTTLLSAEAIGVARWATDTASSYAKIREQFGRPIGQ
FQAIKHKCAEMIADTERATAAVWDAARAIDEARENRWDTAGSHVEFAAAV
AATLAPAAAQRCAQDCIQVHGGIGFTWEHDTNVYYRRALMLAASFGRSSD
YPQKVVDTATTTGMRAVDIDLDPETEKLRAEIRAEVAALKEIEREQRKVA
IAEGGWVLPYLPKPWGRAAGPVEQIIIAQEFASGRVKRPQTGIATWIVPS
IVAFGTEEQKQRFLPPTFRGEMIWCQLFSEPGAGSDLAGLSTKATRTDGG
WRITGQKIWTTAAQFSQWGALLARTDPSAPKHSGITYFLLDMKSEGVDVK
PLRELTGNAMFNTVYIDDVFVPDECVLGEVNRGWEVSRNTLTAERVSIGS
SEANFLATLSQFVEFVRDGQFDQVAQHRAGQLIAEGHAAKVLNLRSTLLT
LAGGDAMPSAAISKLLSMRTGQGYAEFAVSSFGTDAAIGDTDQLPGKWGE
YLLASRATTIYGGTSEVQLNIIAERLLGLPRDP
41409813NP_962649.1 hypothetical protein MAP3715 [Mycobacterium avium subsp. paratuberculosMMARVIWAVSLGSTSSWSISAVSTSCPVTRATPSRSAASRCQMSRARWVA
AGRSTVRRVRWVRPAWLAGGALGTRGPPGWRMLVRRSVGAASPEGPAAWV
GARNAPPLGPLWLGLKFTAVSSSVSANQ
41409812NP_962648.1 acyl-CoA synthetase [Mycobacterium avium subsp. paratuberculosis K-10]MPNLLGLPGQATKAVAKVQQYVERGSAELHYLRRIIESGAFRLEPPQNYA
AMAADIYKWGEFGMLPSLNARRTPGRAAVIDEEGELSYAELDRAAHAVAN
GLIAKGVKAGDGVAILARNHRWFLIANYGAARVGARIILLNSEFSGPQIK
EVSEREGAKVIIYDDEYTKAVSKAEPPLGKLRALGTNPDADEPSGSTDET
LAELIEHSSSEPAPKADRHASIIILTSGTTGTPKGANRSTPPTLAPVGGI
LSHVPFKAGEVTSLPSPMFHALGYLHATIAMFLGSTLVLRRKFKPPLVLQ
DIEKYRPTAMVVVPVMLSRILDTLEKMDKKPDLSSLRIVFVSGSQLGAEL
AARALKDIGPVIYNMYGSTEIAFATIAGPKDLERNAATVGPVVKGVKVKI
FDDNGKELPQGEVVRIFVGNTFPFAGYTGGGNKQIIDGLLSSGDVGYFDE
HGLLYVSGRDDEMIVSGGENVFPAEVEDLISGHPDVVEATAIGVEDKEWG
HRLRAFVVKKEGADLDEDTIKHYVRDHLARYKVPREVIFLDELPRNPTGK
ILKRELREMEV
41409811NP_962647.1 hypothetical protein MAP3713c [Mycobacterium avium subsp. paratuberculoMNHMTRPVSLEVAGRRVTITHPDKVVFPRAGGGETTGSAAGPHTKLDLVR
YYLSVADGALRGVAGRPMILKRFVKGITQEAVFQKRAPANRPDWVDVAEL
RYARGTSAAEAVIHDAAGLAWLINLGCVDLNPHPVLADDLDHPDELRVDL
DPMPGVSWRRIVDVALVAREVLEDYGLTPWPKTSGSRGFPIYARIARRWE
FRQVRLAAQTVAREVERRAPEAATSRWWKEEREGVFVDFNQNAKDRTVAS
AYSVRATPDARVSTPLRWDEVAGCRPEAFTIDTVPARLAEIGDPWAGMDD
AVGDLDRLLVLAEELGPPERAPKGAGTRSGGRRRSSMPLIEVARTKTRDE
AMAALDVWRDRHPEAAARLQPADVLVDGMRGPSSIWYRIRINLQHIPEDQ
RPPQEELIADYSPWQGYGGRQKPSWG
41409810NP_962646.1 NarU [Mycobacterium avium subsp. paratuberculosis K-10]MTTTITPVPQPAAAPERHKGRHWIDDWRPEDPEFWETTGKAIARRNLIFS
IFAEHVGFSVWMLWSIVVVHMTAGPHGHPSASGWALTASQALCLVAVPSG
VGAFLRLPYTFAVPVFGGRNWTTISAALLLIPCLLLAWAVSHPGIPFGVL
VAIAATAGFGGGNFASSMANISFFYPEKDKGWALGLNAAGGNIGVAMVQK
VIPPVVIAGGGVALSRAGLFYVPLAVVAAVCAFLFMNNLTEIKADVKPVW
QSLRHADTWIMSLLYIGTFGSFIGYSAAFPTLLKTVFGRGDIALAWAFLG
AAIGSVIRPLGGKLADRVGGARITAASFVMLAVGAAAALWSVKAVNLPAF
FASFMFLFVATGIGNGSTYRMISRIFKIKGELAGGDPDTMVTMRRQAAGA
LGVISAVGAFGGFIVPLAYAWSKSQFGSIEPALRFYVVFFLGLLAVTWYC
YLRKHNAITRVGI
41409809NP_962645.1 hypothetical protein MAP3711c [Mycobacterium avium subsp. paratuberculoMRENRPMPASEAPPGLRERKKIKTRQAIRREAFRLIEQNGYAATTVEQIA
EAADVSPSTFFRYFGSKESLLLADDLDPLILDALKAQPRELSLPQAFRRA
YATVLSQLPDDQLEFESTRQRLMFSIPELKAAMYDEYYRTVTVAAEAIAH
RIGRAADDFEVRVFAGALTGAMMAAFDSAPTTPETIYRALDFMDAGMPLD
41409808NP_962644.1 hypothetical protein MAP3710c [Mycobacterium avium subsp. paratuberculoMRQGWNRRGFLQLAGAAGVAATAGAAGLSAGCSAHQPPPGGAGPGSVTVT
HLFGQTVVKEPPKRVVSAGYTEQDDLLAVGVVPIAVTNWFGDQPFAVWPW
AADKLGGAQPTVLNLDNGIPVDQIAGLKPDLIVAINAGLDADTYQKLSAI
APTVAQSDGDAFFEPWKEQAAAVGQAVFAAEKMKSLVAGVDQKFTDIGKK
NPQWTGKKALLMHGALWQGTVVATMAGWRTDFLNQMGLVIADSIKPFGTD
QRAVIPRDHIKSVLESADVVIWTTQNPDDQKALLADPEVAGSLTTAQNRH
IFTTKDQAGAIAFASPLSYPVIADQLPPQLTKILG
41409807NP_962643.1 hypothetical protein MAP3709c [Mycobacterium avium subsp. paratuberculoMSVTDLSGDLAHHLPTALVGNAVLDYGDRALMVQCGSTAEVLAWAQALRA
AALPGVVDIVPAARTVLVKLDDPGRQRLLRQRLRKMNVTAASTPPAERHA
DVVIDVVYDGPDLAEVAEHTGLTIPQLIDAHTGTPWQVGFSGFAPGFAYL
VDGDPRLRVPRRAEPRTAVPAGSVALAGEFSAIYPRRSPGGWQLIGHTDA
VLWDLQRPNPALLTQGMWVQFRAV
41409806NP_962642.1 hypothetical protein MAP3708c [Mycobacterium avium subsp. paratuberculoMPFLEILRTGPLAVVEDLGRPGLAHLGVSRSGAADRRAHKLANRLVANPD
DRATVEVTFGGFAARVRGGDVDIAVTGADADPTVDGIEFGSNSIQHVRDG
QVIALGTPRAGLRSYLAVRGGICVDPVLGSRSYDVMSAIGPAPLRAGDRL
PIGEHTQDYPELDQAPVAAITGHLMELQVVPGPRDDWLVNPDALVHTIWM
ASDRSDRVGMRLEGRPLQHRYPDRQLPSEGTTRGAIQVPPNGLPVILGPD
HPVTGGYPVVGVVTDEDVDKIAQVRPGQYVRLHWARPRALAGAHAGAASW
PFA
41409805NP_962641.1 NarK3_2 [Mycobacterium avium subsp. paratuberculosis K-10]MGRDHRITDWNPEDAAAWEAGNKRIARRNLLCTIAGDHVAFSIWTLWPVM
ALFMPAAVYGFSAGDKLLLGAVATLVGGCARIPYTLGIAAFGGRKWTTFS
AVVLLIPTVGTIVLLANPGLPLWLFVLCAALTGLGGGNYAASLANVNAFY
PQRLKGAAMAVNAGVANLGVAVIQLVGLLVLATAGHQAPYWVCAVYLVFL
AAVAIAAAMFMDDINHGTQLSTMRSILFERDTHVISLLYIATFGSWIGFS
FAFGQVMQVNFLENGESAKHAALHAAQLAFIGPLLGSVARIYGGRLADRV
GGSRVTLGVLAAMTLAAGLLVIVSTVDDQHAGAHSVSMIGYVVGFMVLFI
LSGMGNGSVFKLIPSVYEARSRGRDTSEDERRQWARAMSGSLIGICSAVG
AFGGVAINLALHQSYLSTGTETSAYWMFMASYVVAAIMTWLVYVRRPVAA
PGVSLPETQAARL
41409804NP_962640.1 bifunctional uroporphyrinogen-III synthetase/response regulator domain-MAPPDSAPLTGYRIAVTSANRAEELCALLRRNGAEVTSAAAINIIALPED
QELHRHTEAVIAQPPDILVAHTGIGFRGWVAAADGWGLAPQLLSALSQAR
IVARGPKATGALRAAGLHEEWSPKSESSREVLRYLLDSGVAGKRIAVQLH
GAADGWDPFPEFINGLRSAGAQVMPIHVYRWKPTPAGGEFDQLVASVARR
QFDAVTFTSAPAGAALLERSRELGIEDQLLQALRSDVHAMCVGPVTAQPL
IRAGVPTSSPERMRLGALARHIAQELPPLRSCTLRAAGHQIEIRGTCVLV
DGAVKSLSGSAMATLRALAARPGDVVARNDLLRVLPGNSNDPHAVDTAVL
RLRTALGDKNIIATVVKRGYRLAIDTPDGSAWH
41409803NP_962639.1 hypothetical protein MAP3705c [Mycobacterium avium subsp. paratuberculoMALILVAHGTRRPGGVAMIEGLAAQVSTLVGGRVEVAFVDVVGPTPSEVL
AAARAAGRPAIVVPAFLSRGYHVRADLPAHVALSGHPNVTVTPALGPSGQ
IARIVGDQLLECGWRPNDSVVLAAAGTSDDKARADLHTAATWLSALTGSR
VTLGFAATGDPPLGEAVARARPHARRNGGRVVVASYLLADGLFQQRLHGC
GADLVSAPLSTHPGLARLIANRFRRALPPVLAATARHASRRTGPHQRAHA
PATRPVP
41409802NP_962638.1 hypothetical protein MAP3704c [Mycobacterium avium subsp. paratuberculoMPRREEPSHGLLDPVAKMLRLPFGTPEFIDRIVTGGVNQVGRRTLRMLIT
TWDAAGGGPFAASAIASTGMAKTAEIVQGMFIGPVFGPLLRILGADKVAV
RASLCASQLVGLGIMRYGIRSEPLHSMSVDAIVDAIGPTMQRYLVGDITR
41409801NP_962637.1 NirD [Mycobacterium avium subsp. paratuberculosis K-10]MSGCCSTTVSQAALFRLDDGTVRAVGNVDPFSGAAVLSRGIVGDRNGCPT
VQSPILKQAFSLEDGICLDDPSVSVPVYPVRITADSYVQVGRDYQPRAA
41409800NP_962636.1 hypothetical protein MAP3702 [Mycobacterium avium subsp. paratuberculosMSADGISRDGCAPRHIIVVGHGMVGHRFVEALRARDTEGRWRITVFAEEA
DAAYDRVGLTSYTESWDRALLALPGNDYQGDPQVRLVLNQRVTEIDRATK
SVVTADGQRHHYDTLVLATGSYAFVPPVPGHELPACHVYRTLDDLDAIRA
DAQRAAQTAHARAGVVIGGGLLGLEAANALRQFGLATHVVEMMPRLMAQQ
IDEAGGALLARMIGDLGISVHVGTGTEAIEPVEGPDGSTTVRVRLSDGQV
IDAGLVIFAAGIRPRDELAVAAGLARAERGGVLTDLSCRTSDPDIYAIGE
VAAIDGRCYGLVGPGYTSAEVVADRLLDGSAEFGEADLSTKLKLLGVDVA
SFGDAMGTTENCLEVAINDAVNRTYAKLVLSDDAKTLLGGVLVGDASSYG
VLRPMVGSELPGDPLALIAPASSGGGTALGVGALPDSAQICSCNNVTKGD
LKCAIADGCADVAALKSCTSAGTSCGSCVPLLKQLLEAEGVEQSKALCEH
FSQSRAELFEIISATEIRTFSGLLERFGRGKGCDICKPVVASILASTGSE
HILEGEQASLQDSNDHFLANIQKNGSYSVVPWVPGGDIKPEHLILIGQIA
QDFGLYTKITGGQRIDMFGARVDQLPAIWKRLVDGGMESGHAYGKALRTV
KSCVGTDWCRYGQQDSVQLAIDLELRYRGLRAPHKIKMGVSGCARECAEA
RSKDVGVIATEKGWNLYVGGNGGMTPKHAQLLASDLDTETLVRYIDRFVM
YYIRTADRLQRTAPWVESLDGGLDHVREVVCEDSLGLAEEFEAAMERHVR
NYKCEWKGVLDDPDKLSRFVSFVNAPDAVDSTVAFTEHAGRKIPVSIGMP
KIRQG
41409799NP_962635.1 Hsp [Mycobacterium avium subsp. paratuberculosis K-10]MSNLALWTRPAWDTDRWLRDFFGPAAAADWNKPATSAFKPAAEIVKDGDD
AIVRVELPGVDVDQDVQVELDRGRLVIRGEHRDEHAEEKDGRTLREIRYG
SFHRSFQLPGHVTDDDITASYDAGVLTVRVTGAYAGNQAKRIAITK
41409798NP_962634.1 hypothetical protein MAP3700c [Mycobacterium avium subsp. paratuberculoMTSTPGTTGTTEFAELHDLIGGLRRCVSSLRARYGDSPAMRRIVIDADRI
LSDVDLLDTDVSELDLARATVQQSGEKVVIPDTQYDSEFWRDVDDEGVGG
HHRS
41409797NP_962633.1 hypothetical protein MAP3699c [Mycobacterium avium subsp. paratuberculoMSAPTANRPASGVFSPTRARIEQRTLRTDRWWMSPLRIDLGFAAFLIYAT
ARAFQQNYFFVGKYHYLTPFYSPCVSKGCGEAGDIWPQFLPDVWWLPYAA
VSLPFLLLFRLTCYYYRGAYYRTVWQSPTACAVAEPRVHYTGETRFPLII
QNTHRYFFYIAFLISVINSYDAIVAFHSDTGPGGFGFGLGNLILLGNVIM
LWVYTLSCHSCRHVTGGRLKHFSKHPVRYWIWTQVSHINTRHKLYAWITL
GTLMLTDFYIALVASGTIPDLRFVG
41409796NP_962632.1 succinate dehydrogenase flavoprotein subunit [Mycobacterium avium subspMVEVERHAYDVVVIGAGGAGLRAVIEARERGLRVAVVCKSLFGKAHTVMA
EGGCAASMGNTNPKDNWKTHFGDTMRGGKFLNNWRMAELHAKEAPDRVWE
LETYGALFDRLKDGKISQRNFGGHTYPRLAHVGDRTGLELIRTMQQKIVS
LQQEDYAELGDYEARIKVFAECTITELLKDGDAIAGAFGYWRESGQFVLF
EAPAVVLATGGIGKSFKVTSNSWEYTGDGHALALRAGASLINMEFVQFHP
TGMVWPPSVKGILVTEGVRGDGGVLKNSEGKRFMFDYIPPVFKGQYAETE
QEADQWLKDNDSARRTPDLLPRDEVARAINSEVKAGRGSPHGGVFLDIAS
RLTPAEINRRLPSMYHQFKELAGVDITKEPMEVGPTCHYVMGGVEVDADT
GAATVPGLFAAGECSGGMHGSNRLGGNSLSDLLVFGRRAGLGAADYVRAL
SSRPTIGESAVEAAAKRALSPFEAPAGGGPGENPYTLQLELQQSMNDLVG
IIRNADEISEALARLDKLRERFKNLHVEGQRRYNPGWNLAIDLRNMLLVS
ECVAKAALQRTESRGGHTRDDHPSMDSSWRKLLLVCEAVAEPGDVEAAVI
PDITITKKEQTPMRPDLLELFDIAELEKYYTDEELAGHPGRTPRTEK
41409795NP_962631.1 fumarate reductase iron-sulfur subunit [Mycobacterium avium subsp. paraMTYNATMRVWRGDDANGALQDFTVEVNEGEVVLDIIHRLQQTQTPDLAVR
WNCKAGKCGSCSAEINGYPRLLCMTRMSTFAEDEVVTVTPLRTFPVIRDL
VTDVSFNYEKAREIPSFAPPKDLQPGEYRMAQEDVQRSQEFRKCIECFLC
QNVCHVVRDHEENKKAFAGPRFLMRIAELEMHPLDTRDRRKDAQEEHGLG
YCNITKCCTEVCPENIKITDNALIPMKERVADRKYDPVVWLGNKLFRR
41409794NP_962630.1 hypothetical protein MAP3696 [Mycobacterium avium subsp. paratuberculosMNSNNKLTASSLREAFGHFPSGVVAIAAEVNGTLEGLAASTFVPVSLDPP
LVSFCVQNTSTTWPKLKDRPMLGISVLGEEHDEAARTLAAKTGDRFAGLE
TVSRPTGAVFIKGTALWLESAVEQLIPAGDHTIVVLRVNEVTVDANVVPI
VFHRSGFRRLGA
41409793NP_962629.1 hypothetical protein MAP3695 [Mycobacterium avium subsp. paratuberculosMCNPSTCGDGGEVSNEMCPVPGVTAVPEVDLRADSDVLRDGLREAAHRVG
FFYLTGHGVPADLVDRVLDAARRFFRLPQADKDAVAMVRSPHFRGYTRLG
GERTRGAVDWREQIDIGPQRPPIGGLDKSDYRWLQGPNQWPAALPELPGL
IEEWDAALSGVARTLLRHWAAALGSPADVFDAAFADAPATLIKIIRYPGR
AAGPQGVGAHRDAGVLTLLLAEPGSRGLQVCRAGPGGDGWIDVPPRHGAF
IVNIGELLEAATRGYLRATEHRVNLAGSTAERISVPYFFNPRLDARIPVL
SLPPELRARAVERWTPSEDPADPIFSVYGRNAWKSRLRSHPDVASAHAFS
AHHGAAD
41409792NP_962628.1 FadE5 [Mycobacterium avium subsp. paratuberculosis K-10]MSHYKSNVRDQEFNLFEVLGVDKALGQGEFSDLDADTAREMLNEISRLAE
GPIADSFVEGDRNPPVFDPKTHSVTLPESFKKSVHAVIEAGWDKVGIDEA
LGGVAMPKALLWALHEHILGANPAVWMYAGGAGFANILYHLGTDEQKKWA
VMAAERGWGSTMVLTEPDAGSDVGAGRTKAVKQDDGSWHIDGVKRFITSA
DSDDLFENIFHLVLARPEGAGPGTKGLSLFFVPKFLFDFETGELGERNGV
FVTNVEHKMGLKVSATCELSFGQHDVPAKGWLVGEVHNGIAQMFEVIEQA
RMMVGTKAIATLSTGYLNALEYAKSRVQGADMTQMTDKTAPRVTITHHPD
VRRSLMTQKAYAEGLRALYLFTSTYQDAAVAEALYGVDAELAVKVNDLML
PVVKGVGSEQAYAKLTESLQTFGGSGFLQDYPIEQYIRDSKIDSLYEGTT
AIQAQDFFFRKIVRDKGVALAHVSEQIQKFVDSESGNGRLKSERELLAKA
LADVQGMATALTGYLMAAQEDVTSLYKVGLGSVRFLMSVGDLIIGWLLQR
QAAVAVAALDAGASGEDRSFYEGKIAVASFFAKNFLPMLTSTREVIETLD
NDIMELDEAAF
41409791NP_962627.1 acetyl-CoA acetyltransferase [Mycobacterium avium subsp. paratuberculosMAPASSEASKPAAQRSAQRRPVAVLGGNRIPFARSDGAYAEASNQDMLTA
ALEGLVDRFGLAGERLGVVVGGAVLKHSRDFNLTRECVLGSQLSSYTPAF
DLQQACGTGLQAAMAAAEGIAAGRYDVAAAGGVDTTSDAPIGLGDNLRRT
LLKLRRAKSNVQRLKLVGTLPATLGVEIPVNSEPRTGLSMGEHQAITAKQ
MGITRVAQDELAAASHRNMAAAYDRGFFDDLVTPFLGLYRDDNLRPDSSP
EKLAKLRPVFGVKAGDATMTAGNSTPLTDGASVALLGTEEWAAAHSLTPL
AYLVDAETAAVDYVNGRDGLLMAPTYAVPRLLARNGLSLQDFDFYEIHEA
FASVVLAHLQAWESEDYCKERLGLDAALGSIDRSKLNVNGSSLAAGHPFA
ATGGRILAQAAKQVAQRKAELKGADKPVRALISICAAGGQGVAAILEA
41409790NP_962626.1 3-ketoacyl-ACP reductase [Mycobacterium avium subsp. paratuberculosis KMAPKVSSDLFSQIVNSGPGSFLAKQLGVPQPETLRRYRPGDPPLAGSLLI
GGEGRVVEPLRAALAKDYDLVGNNLGGRWADRFGGLVFDATGITTPEGLK
GLYEFFTPLLRNLGHCARVVVVGTTPDAAAGPHERIAQRALEGFTRSLGK
ELRNGSTVALVYLSPAAKPAATGLESTMRFILSAKSAYVDGQVFYVGEAD
STPPADWERPLDGKVAIVTGAARGIGATIAEVFARDGARVVAIDVESAAE
TLAETASRVGGTALWLDVTAPDAVDKITEHLREHHGGHADILVNNAGITR
DKLLANMDDARWDAVLAVNLLAPLRLTEGLVGNGSIGEGGRIVGLSSMAG
IAGNRGQTNYATTKAGMIGLTQALAPELYDKGITINAVAPGFIETQMTAA
IPLATREVGRRMNSLLQGGQPVDVAETIAYFASPASNAVTGNVIRVCGQA
MLGA
41409789NP_962625.1 hypothetical protein MAP3691c [Mycobacterium avium subsp. paratuberculoMNQPSGLKNMLRAAAGALPVVSRGSALPTRTVTVEDLPIDRTNVAEYAAV
TGLRYRNHVPLTYPFALTFPALMSLVTGFDFPFAAMGSVHTENHITQYRP
IAVTDTVGVRVHAENLREHRKGLLVDLVTDVSVGNDTAWHQVTTFLHQQR
TSLSDQPKPPPQKQPKLPPPPTVLRITPGLIRRYAVVGGDHNPIHTNPIA
AKLFGFPTVIAHGMFSAAAVLANIEAAIPDAVRYSVRFGKPVVLPATTGL
YIDEHDGGWDIALRNIAKGYPHLTGTVRAL
41409788NP_962624.1 hypothetical protein MAP3690 [Mycobacterium avium subsp. paratuberculosMARMPAPRSDRNALDFFCAVIIVGVLAGIAGVATTLVLRVVQHATYHYSF
GALLAGVAASSPIRRVLGPMVGAALAGLGWWLLRRRTDVPPLAETIARSE
RVPRLAWSIDAVLQVLLVGSGASLGREGAPRQFASALGDFGIGWLRRLSS
RDREILLACAAGAGLGAVYAVPLAGALFAVRILLRTWRLRAVGAAFLSSG
VAVAVGSAVTGDQPNLRWPVEESTYLLTAHGLLLAPVALAVGLVFNRLMA
VARPARPMRTWTLIPALAGAGLVTGVCSHWWPELPGNGRSILTVSLASGM
TLASALAILLLKPVLTALFLRAGGAGGLLTPSLATGAAAGAALVLTINWA
TASQLHVPAVSLAGAAGVLAVTQGSPIWAAIFVWELARPPLWLFLLFLLT
ATAAHGLKVLAQGRTTTHAG
41409787NP_962623.1 hypothetical protein MAP3689 [Mycobacterium avium subsp. paratuberculosMAGGTKRLPRAVREQQMLDAAVQMFSVNGYHETSMDAIAAQAQISKPMLY
LYYGSKEDLFGACLNRELGRFIDAVRADIDFQQSPNDMLRNTIASFMRYI
DANRASWIVMYTQATSSQAFAHMVREGREQIIELVAGLMRAGSRTPRTDR
EHEMMAVALVGAGEAVANRLSTGDIDVDEAAALMIDLFWYGLKGSPEERE
AAAAQPEADRSGAGG
41409786NP_962622.1 LpqI [Mycobacterium avium subsp. paratuberculosis K-10]MALSRPLAAHAAVLAAVSELMIGCAHRAAPPPAHSSTSNTPAAAPAPRVC
VDPPAAPATLNLRDKLAQLLMVGVKNADDARNVVNGYHVGGIFIGSWTDL
TIFRGPLGDIAAKAGPLPLAVSVDEEGGRVSRLKSLIGTSPSPRELAQTQ
TVQQVHDLAADRGKKMRDLGITVDFAPVVDVSDEPDDAVIGNRSFGADPA
KVTEYAGAYAQGLRDAGLLPVLKHFPGHGHGSGDSHTGGVVTPPLDDLQN
DDLVPYRTLVTTPPVGVMVGHLQVPGLTGDVPASLSPEAVQLLRNGVGYK
GPPFTGPVFSDDLSSMAAISDRYGVSEAVLRSLLAGVDVALWVTTDEVPA
VLDRLQKAVASGELPAQRVDESLVRVATMKGRGPACGH
41409785NP_962621.1 hypothetical protein MAP3687c [Mycobacterium avium subsp. paratuberculoMRGGTSDDRFHVGRGQRRGGAVHRGGEHRRHHLGRHQPRRPPRAAGQRPG
TPARALSGGIRRPLLPQALPALVTGAGDSADRRSARLALG
41409784NP_962620.1 hypothetical protein MAP3686c [Mycobacterium avium subsp. paratuberculoMWLVGAIALALTFAQSPGRISPDTKLDLTANPLRFLARATNLWNSELPFG
QAQNQAYGYLFPHGTFFLIGHALGVPGWITQRLWWALLLTVGFWGLLRVA
EALGIGSPGSRVIAAAAFALSPRVLTTLGSISSETLPMMLAPWVLLPTIL
ALRATGPRSVRALAAQAGVAVALMGAVNAIATVAGCLPAVIWWACHRPNR
LWWRYTGWWLVALVLATLWWVVGLVMLRAISPPFLDFIESSGVTTQWSSL
VEMLRGTDSWTPYVAPTATAGAPLVTGSAAVLGTCLVAAAGLAGLAGPTM
PARGRLVTMLLVGVVLMAAGYSGGLGSPAAHAVQAFLDAGGAPLRNVHKL
GSVIRIPIVLGVAQLLGRIPLPGSAPKSLWLSAFAHPERDKRVATAVVVL
TALMVSTSLAWTGRLTPPGTFTAIPPYWQQTADWLTQHNTGSSTPGRVLV
APGAPFATQVWGTSHDEPLQVLGASPWGVRDSIPLTPPQTIRALDSVQRL
FAAGRPSLGLADTLARQGISYVVVRNDLAPDTSRSARPILVHRAVDGSPG
LHKVAQFGAPVGPGTVAGFVADSGLRPRYPAVEVYRVDAGGDAGTPYFVD
TDRMARIDGGPEVLLRLDERRRLLGQPPLGPALLTADARAAGLPLPAGAG
VTVTDTPVARETDYGRVDQHSSAIRAPGDARHTYNRVPDYPVPGADPVLG
AWTGGRITVSSSASDSTAMPDVAPATSPAAAIDGDPATAWVSNSLQSAVG
QWMQIDFDHPVTNAALTLTPSATAVGAQVRRILIETATGSTTLRFDQPGK
PLAAALPYGETPWLRITAAGTDDGSPGVQFGITDLTVTQYDASGFAHPVD
LRHTVRVPGPPPESPITRWELGPELPGRPGCARAPDSVRCAPSMELAPEE
PVTFSRTLTVPAPTSVTPTVWVRPRQGPKLADLITEPNTTVAHGDSDTVD
VLGSAYAATDGDPATAWTAPQRVVQHKTPPTLTLTLPRPTQVAGVRLVPS
RAALPAHPTMVAVNLGDGPQVTAVKPGQAQTIPLKPRVTDTVTISLLDWE
DVIDRNALGFDQLKPPGLAEVAALGADGNPIGPADAGRNRAREVSVGCER
GPVIAVAGRFVHTAIHTTVGALLDDQPVAAVPCERDPIALPAGQQELLIS
PGAQFVVDGAELSTPAAAEAAQPVRVASWRGWGPDRREIAAGPSNTSRIL
VIPESINPGWVARTGSGARLTPIAVNGWQQGWLVPAGDPGVITLSFASNS
LYRAGLAVGLALLPVLALLACWRTRKRGTHDPPARPWRPGVWAAVPALAA
GAVIAGAAGVAVLGAALGLRYALGARRWARLGMAGSAGGLILAGAALSRQ
PWRSVDGYAGHAGYVQLLALISLAALTASVVAVPRRRGGARHE
41409783NP_962619.1 hypothetical protein MAP3685c [Mycobacterium avium subsp. paratuberculoMSWFSAPDYWVGRLVLERGVAVIYLLAFVAAAAQFRALIGEHGMLPIPRF
LAGQSWRRTPSIFHLHYSDRLFAALSWFGAALSAAIVAGAADAVPLWAAM
LMWLTLWVLYLSIVNVGQTWYSFGWESLLLETGFLMIFLGNAEVAPPLLT
LWMARLLLFRVEFGAGLIKMRGDPCWRDLTCLYYHHETQPMPGPLSWFFH
HLPKPLHRIEVAGNHFAQLIVPFGLFAPQPVAGVAAAIIVVTQLWLVASG
NFAWLNWVTILLACSAIDDSSVALLLPKSVLPGHGEPSASPLWFVVVVVA
VTAAVLVMSYWPIRNMLSSRQRMNMSFNSFHLVNTYGAFGSIGRVRREVV
IEGTADEDITDQTVWREYEFKGKPGGVRRLPRQWAPYHLRLDWLMWFAAI
SPGYAQPWLTPFLQRLLENDRPTLRLLRHNPFPDAPPRYVRARLYEYRFT
TPAELRRDRAWWHRTLIGGYVPPLTLSKLTPQDHG
41409782NP_962618.1 hypothetical protein MAP3684 [Mycobacterium avium subsp. paratuberculosMLLTAGRNPYPGRQRGFPRVRCGPLNTRVFEEEIMSHAQPNVVDGAHFDF
VVVGGGTAGNVVAGRLAENPNVSVLVVEAGVGNPWELDGVNTPGTAMELR
HSPYDWDYLAKFVDRGVWQRIDKQETRGKILGGSSAANYFSWIPGCKPTY
DRWAEYGGPEWTWQPLLPYLRKSATYHDDHGTFSPDMKRIGAGGPLPISH
NNIPELQPFRDVVAQAWKSRGLPVTENIYDGEMNGLTHAVSTIYRGVRSG
SYLFVKDRPNITILPEVRSKRLIIDYADRTCKGVTVIDASGTERSFYANR
EVILSQGVFESPKLLMLSGIGPGRELAKHGIPVVVDSRHVGQHLFDHPGV
PFVLRIKEGYAIDDYLRPGAKHDSAVADYQKDHQGPLGSGLLEMIGFPRV
DEYLDRDPIYREAKAANGGLDPFSPEGQPHFELDFVPAFGSAFQWQYPTP
PEGDHITVMVDLVRPAYDGGGEVTLNSTDPFMQPNLNLNYLSNELDIIAL
REGIRLAYDILTKGDGFKDLVISQYPWDMPLHSDELMRTSIQDRVQTSYH
PCGTNRLSKNIDQGVVDPKLKVHGVNKLRVVDASVFPIIPDCRIQNTVYM
VGEKGADAIKADHTDLYK
41409781NP_962617.1 hypothetical protein MAP3683 [Mycobacterium avium subsp. paratuberculosMAENHTTTNAGAPAPSDELSLTVGPDGPLLLQDSYLVEQMAAFNRERVPE
RQPHAKGAGAYGRFEVTADVSEYTKAAFLQPGAVTEVFARFSSGNSGERG
SADTARDNRGFSVKFYTTEGNFDLVGSDVPVFAIRDPMKFPNLIRAGGRR
ADNDLHDHNMVWDFWTSCPETAHLVTLVMGDRGIPRTFRHMNGFGLHAFS
WVNSAGEIHWVKYHFKTDQGIQWLPQEEGRRLAGTHPDCCVRDLYEAIAR
GKYPSWSLQVQLMPFADAKTYRFNPFDVTKVWPHADYPPIEIGTMTLDRN
VTDHHAEVEQAAFAPSNLVPGTGLSPDRLLLGRSFAYPDAHRARIGVNHD
QLPVNAARCAVRSYAKDGRMRFVNTADPVYAPNSAGGPQADPARAGEVHW
AADGQMLRAAYTLRRDDDDWGQAGTLVRRVMDDSQRERLVHNIVGHVSAG
VNEPVLSRVFAYWRHVDADIGRKVEEGVRANLNS
41409780NP_962616.1 hypothetical protein MAP3682 [Mycobacterium avium subsp. paratuberculosMTENFTTTNAGAPAPSDELSLTLGPDGPVLLQDFYLIEQLAAFNRERVPE
RQPHAKGTGAFGRFEVTNDLSAYTKAAVFQPGTKTDVFVRLSGNAGERGS
ADTVRDTRGFSVKFYTTEGNFDLVGLDFPVFVIRDPIKFPQMVRSAKRRA
NNDCRDHNMQWDFWTLSPESAHQVAMIMSDRGIPKTFRHMHGFGLHTFSF
LNAAGEISWVKFHFKSNQGIEWLTQEEGDRLAGTDPDYCIRDLYEAIERG
DHPSWSVKVQIMPFEEAKTYRFNPFDVTKVWPHADYPLIDLGTMTLDRNV
TDHHTEVEQVTFAPHALVPGIGLSPDKLLLGRSFAYADAHRYRVGANHNQ
IPVNAPRCPVRSYSKDGQMRFVNSTDPVYAPNSYGGPKADPDRASVVKWA
VDGGMMVRAPYTLRPDDDDWGQAGALVRDVMDDAERERLVHNIVHHVTDG
VKEPVLSRVVEYWYNIDADIGKRVEDGIRAANLGR
41409779NP_962615.1 hypothetical protein MAP3681 [Mycobacterium avium subsp. paratuberculosMQAEDQVSPREMVRRGLLLDGLRQPVDLNAVDWHVRQRHPGAAPSEVQDA
TLAVIRSLVSDGLVRLGAQVMVGEHLGGVATEGERFVAWDQPLERSMHKI
SHVYLKHYDDPEKWMYAAWMQLTDKGEQLARSFEQADLDSYRKFQ
41409778NP_962614.1 formate dehydrogenase [Mycobacterium avium subsp. paratuberculosis K-10MEEEPVAKCVMVLYPDPVDGYPPKYARDSIPVINSYPDGSSLPTPSKIDF
TPGELLGCVSGALGLRKFFEDGGHELVVTSDKDGPDSEFERELPDADIVI
SQPFWPAYITKERFAKARNLKLALTAGIGSDHVDLAEAQARGVTVAEETW
SNSISVAEHTVMQILALVRNFVPSHQWIRDGGWNIADCVQRSYDVEGMDV
GVIAAGRIGRAVLERMKPFGVNLHYFDVHRLSPEYEKQLGVTYHPDVESL
ARSVDVVSIHSPLIAQTHHMFNEKLLKSMRRGSYIVNTARAEETDHKAIV
AALESGQLAGYAGDVWFPQPPPPDHPWRTMPNHAMTPHISGSSLSAQARY
CAGTREILEDWFAGRPIRSEYLIVEGGKFAGTGAKSYAQ
41409777NP_962613.1 hypothetical protein MAP3679 [Mycobacterium avium subsp. paratuberculosMPDLARRLRRTLWPIAQTTVAAGLAWYLAHDVLDHREPFFAPIAAAVCLW
MTNRVRAELAVEMIIGVALGIGAGTVVLAVFGAGPIGMGAAVMLSLTLAV
LIARSFSTQRSMFVNQSLISAILIMAFPHTGLGVERLYDALIGGGLAVVF
SILLFPKNPLAVLHDASGELLTALHDILAQICCRSADSASPDQGWALSAA
DRLQRCSASLIEARGTAGQLARVCPRRWPLRGAVGAADRQVVHVALFGSS
VLQLTRTLMSVRIRGGPHAEAFRAAVDDLRDADSALAAGHPATAAAHAES
ARRHSAALPAGSPASVAVVIDACIDELQQAIGPRRS
41409776NP_962612.1 hypothetical protein MAP3678 [Mycobacterium avium subsp. paratuberculosMDAMRRVDYVIQYVESLERSVTFYRDVIGLEVRIEGDGYVEFEMPNTKFS
LFERSKLPELIGREGGTAPCGEIGFLVDDVDEEATRLRGLGVEILSGPVD
RPWRERTLHIADPDGNVIEFAQKLR
41409775NP_962611.1 hypothetical protein MAP3677 [Mycobacterium avium subsp. paratuberculosMLRKRRIHRPQGRFHLRRDHEPLPARAVPRFGGRREHRRRHHLAPPLDPS
RGRAMKDFRAPVNGVDGDSASALVAVPKSQGAQTIRPDSVSRLVGALLDD
HAAVVGRVRSVIRSRLPVYRSVADEALEAELEWVLRSAVGGREALHEPQI
AGLAAIGEARAHDGVPVDDMLRAWRIGVEVVVECAREAARRLGVDDARVL
ELVQSALAWSDIAMATSAKAHRRTERALALEAEESDAEFVRGALMGSLPA
AELRMHAELRGLDPGAEYVAVRARLGGDGPHLRLEQSLGFQDPAHSRRGL
CALLDGDLAGFLIEPPRDVEGVVGFGPPRPLTRLSESYRMAARALVTAEA
CGLRGAYDIAALGLRTAVAIDADVGELLRKRYLEPLSVGGSSRELIATVR
TYLACGMHVERTATRLFVHQNTVRYRLARFEELTGASLRDTEVVTEVWWV
LELAAMRL
41409774NP_962610.1 OxyS_2 [Mycobacterium avium subsp. paratuberculosis K-10]MLFRQLEYFVALASERHFARAARACYVSQPALSEAIRKLEQELNVPLVRR
GQKFEGLTPEGERLVLWARRILADHDALKQEVAALQTGLTGELRLGVIPA
ASSIVALLTDPFCAAHPLVRVQLETSLRSAEIVQRLRRFELDAGVLYPDR
QDVADLLVTPLYTEQQVLIAGAELLPDPSETISWSDALTLPMCLLNQGMR
GRRLIDDALAALELTVTPQLETDSVATLLAHVGTGRWASIIPQTWIHSLR
PPAGARILRLENPTVTATVALVTSATEPGSVLTRALVQTARGAGINDVLR
KAAPGYSAG
41409773NP_962609.1 acetolactate synthase [Mycobacterium avium subsp. paratuberculosis K-10MLTRHEQAASFMAEMYGRVTGRAAVVSATLGPGAINMQLGVADATTNSTP
LVAISAQVGHDREFKESHQYVDLVSMFAPITRWAAGIPTARAIPEMVRKA
FKLAESERPAAVYLAVPEHIDADETDYDLGPLPRNVVRPDAPSPRQVERA
AQILRNAKRPVVLAGHGAARADATKALVRFSEEFGIQVANTFHGKGVMPD
DHPNSIGTLGFMRHDYVNFGFDHADAVIAVGYELQEFDPVRINPQADKKI
IHMHRFPAEVDAHYSVDVGIIGDISDSLNALTDALSGHRFEHAADVPGSG
LLTDEFARGQQDSRYPLAPARVVADTRAALGRSDVVLVDTGATKMWMARL
YPTYERNTCLISNGLSTMSFALPGALGVKLAQPESRVLAVVGDGAFLMNS
QEIETAVRERIPLVVLIWEDGGYGLIEWKMDLELGAHYYVKFANPDVVTY
AESFGAKGYRISHADELLPTLRAALDDDGVSLISCPVDYSENLRLTNRLG
ELDETL
41409772NP_962608.1 hypothetical protein MAP3674 [Mycobacterium avium subsp. paratuberculosMLGETSDFQPATIVANGRCRMSKAAELIVKCLENEGVSVVFGLPGEENIR
FV
41409771NP_962607.1 succinic semialdehyde dehydrogenase [Mycobacterium avium subsp. paratubMPIATINPATGETVKTFTPASDAEVDAAIARAYERFLDYRHSTTFAQRAQ
WANATADLLEAEADEVAAMMTLEMGKTLKSAKAEALKCAKGFRYYAQNAE
QLLADEPADAGKVGAARAYIRYQPLGVVLAVMPWNFPLWQAVRFAAPALM
AGNVGILKHASNVPQSALYLADVITRGGFPEGCFQTLLVPSSAVERILRD
PRVAAATLTGSEPAGQSVAAIAGDEIKPTVLELGGSDPFIVMPSADLDEA
VKTAVTARVQNNGQSCIAAKRFIVHTDIYDAFVDKFVEQMKALKVGDPTD
PATDVGPLATESGRDEIAKQVDDAVAAGATLRCGGKPLDGPGWFYPPTVV
TDITKDMALYTEEVFGPVASMYRAADIDEAIEIANATTFGLGSNAWTNDA
AEQQRFIDDIEAGQVFINGMTVSYPELGFGGVKRSGYGRELAGLGIRAFC
NAKTVWIGSSKSGDAGGGSKVE
41409770NP_962606.1 ribonucleotide-diphosphate reductase subunit beta [Mycobacterium avium MNRTRSASMAQGGLNWDSLPLKLFAGGNAKFWNPADIDFSRDRADWERLT
DDERSYATRLCAEFIAGEESVTQDIQPFMAAMRAEGRLGDEMYLTQFAFE
EAKHVQVFRMWLDAVGVTDDLHHFLDDVPSYRTIFYEELPDCLNALTIDP
SPAAQVRASVTYNHMVEGMLALTGYFGWHKICVERGILPGMQELVRRIGD
DERRHMAWGTFTCRRHVAADDANWGVFETRMNELMPLGLRLIEEGFALYD
PMPFDLSVDEFMAYASDKGMRRFGTIASARGRPLAEIDLDYTPVQLEDTF
ADEDARALAAV
41409769NP_962605.1 hypothetical protein MAP3671 [Mycobacterium avium subsp. paratuberculosMPTVTWARVDPARRAAIIEAAESEFGAHGFSRGSLNVIARKAGVAKGSLF
QYFADKRDLYAFIADIGSQRVRGYIEQLIRELDPARPFFEFLTDLLDGWV
AYFADHPHERALHAAATLEVDTEARISVQNVIHRHYLEVLRPLVRDARLR
GDLRADSDTDALLSLLLLIFPHLALAPYMRGLDPVLGLDEPTPEQPALAV
RRLVAVLAAAFSPAPAHFATPRSEEVT
41409768NP_962604.1 hypothetical protein MAP3670 [Mycobacterium avium subsp. paratuberculosMSHRNAPLSETGRLRLARCVVDEGWSLRRAAERFQVSVTTAERWARRYRE
LGEAGMADRSSRPHHSPNRTPTRTERRIIKVRVIRRWGPARIGYLLGIHP
STVHRVLTRYALAKLRWLDRSTGRIIRRMEPAGCGDLVHVDVKKLGKIPA
GGGWRMLGRAIGGHNSNADKSSGVFSKHRNPIRGYHYLHTAIDGYSRLAY
SEVLDDEIKETAAEFWTRANAWFAECGISVRKVLTDNGSCYRSRVFAQAL
GDIEHRRTRPYRPQTNGKVERFHRTLADEWAYARLYRSDTERCEEFTTWL
HTYNHHRGHTALGGQPPASRVPNLSGQYT
41409767NP_962603.1 FadE4 [Mycobacterium avium subsp. paratuberculosis K-10]MLLNPNHLQRRYPDRRSAEIMAATVDFFESRGKARLKSDDHERVWYSDFL
EHIGRERIFASLLTPTRYGAPDCRWDTYRISGFAEILGFYGLNYWYPFQV
TALGLGPIWMSGNDEAKRKAAGLLEAGEVFAFGLSEQTHGADVYQTDMNL
TPAPGGGWTAAGQKYYIGNANVARMVSTFGKFAGGATDSEYVFFAADSRH
ERYRLIKNVVNSQNYVGNFALCDYPVTEADILHRGPEAFHAALNTVNVCK
YNLGWGAVGMCTHAMYEAVTHASNRILYGTVVTDFSHVRRLLIDAYARLV
AMRLVATRACDYMRSASATDRRYLLYSPLTKAKITGEGERVITALWDVIA
AKGVEKDTIFEAMTREIGLLPRLEGTVHINVGLLGKFMPNYLFAPSGELP
VIGRRDDAADDEFLFAQGPTGGLGKVRFGDWRAPFDGFAHLPNVALLRAQ
IDVLAEMLASATPDALQQKDIDFAFAVGQLFATVPYAQLILEEATLSGVD
DALIDEIFGVLVRDFNAYAVELSDKPATTEQQARFAMRMIRRPVHDPARY
DQIWKEQVLPLSGAYQMRP
41409766NP_962602.1 hypothetical protein MAP3668c [Mycobacterium avium subsp. paratuberculoMSELNTARGPIDTAALGVTLMHEHVFIMTTEIAQNYPEAWGDEEQRVADA
IDRLNELKARGVDTIVDLTVIGLGRYIPRIARVAAATELNIVVATGLYTY
NDVPFCFHYLGPGAELGGPEIMTDMFVRDIEQGIADTGIKAGILKCATDA
PGVTPGVERVLRAVAQAHKRTGVPISTHTHAGLRRGLDQQRIFEEEGVDL
SRVVIGHSGDSTDVGYLEELIAAGSYLGMDRFGIDAISPFEDRVNIVAQM
CERGHADKMVLSHDANCYFDALPEELVPQVMPNWHYLHIHNDVIPALKQR
GVTDEQLHTMLVDNPRRIFERQGPYG
41409765NP_962601.1 hypothetical protein MAP3667 [Mycobacterium avium subsp. paratuberculosMPGCTRSPGRAHRQTVVVSDDRRVGGVRSFLPAVEGMRACAAMGVVVTHV
AFQTGHSSGVDGRLFGRFDLAVAVFFALSGFLLWRGHAAAARDLAPRPRT
GHYLRSRVVRIMPAYLVAVVVILTLLPDADHPSPTVWLANLTLTQIYVPL
TLTGGLTQMWSLSVEVGFYLALPVLALLARRLPVTARVPAIAALGALSWA
WGWVPVHPGSGLNPLNWPPAFFSWFAAGMLLAEWVHGGIGRPVRLAQSRA
GRVLLAVVAVVAYLVAASPLAGPEGLVPGTPAQFAVKTAMGSLVAFALIA
PLVLDRMDTPHRVLGTTVMVTLGRWSYGLFIWHLAALAMVFPVLGTFPFT
GRMPAVLVLTLIFGFAIAAVSYALVESPCREALRRWEKRHQPAAPRQLID
AEADAIAP
41409764NP_962600.1 hypothetical protein MAP3666c [Mycobacterium avium subsp. paratuberculoMLRFAACGIIGLGAALLIAALLLTTYTTSRITKVPLDVDATLISDGTGTA
LDSASLSTDHVVVNQNVPLVSQQQISVESPANADVVTLQVGSSLRRTDKQ
KDTGLLLAIVDTVTLNRKTATAVSDDTHTGGAVQKPRTINDENPPTAIPL
RHDGLSYRFPFHTEKKTYPYFDPIAQKPFDVNYDSQEDVNGLTTYKFTQN
VGYNADGKLVAPVAYPSLYADQATDSKFTAPASMWGIQGGDPNEQITMTR
FYAAQRTFWVDPVSGTIVKQTEHAHHYFARDPLKPELTLADYKVTSNEDT
VESQVNAARDERDRLALWSRVLPITFTAVGLIALVGGGLLASFSLRSESA
LTDPGLDRGDQDFFGRSGLEEPVSGAEAETEKLPTQRPDLRSESGPDEPT
EAGPTEAKPPDRE
41409763NP_962599.1 hypothetical protein MAP3665c [Mycobacterium avium subsp. paratuberculoMRWTRPGYALVLALLVVGPLLRPGYLLLRDAVSTPRSYLSDTALGLTAAP
RAAPQDFAVALASHLVDGGVVVKTLLLLGLWLAGWGAARLVALVLPDAGM
PGEFVATTLAIWNPYVAERLLQGHWSLLVGYGCLPWVATAMLGLRTGGAG
FFGLAFFIALAGLTPTGLLLAAAVALACVPVAGAGRRRWVCAAAAIGAAA
AAALPWLVAAVTGAALPSHTPANRLGVEAFAPRAEPGLGTLTSLASLGGI
WNADAVPGSRTTLFAVASAVVLLGVVAVGLPAVARRPAAVPLLVLAAAAV
LIPAGLATAPGLRLLGAVVDAAPGVGVLRDGQKWVALAVPGYALAGAGAV
LTLRRRLFGAAAPALVCCLALILALPDLVWGVGGKVSPVRYPRGWPAVAA
AINARPDAVAVLPAGTMRLFSWSGPAPVLDPLPRWVRADVLSTGDLVISG
TTIAGEGAHARAVQELLLSGPDPAALAAAGVGWLVLEADSAGEVGAAAHT
LGAAAPVYRDDEIALYRIGGHTAGVAADRRAATLIAHLAWLVLLLGSGAG
VLVGAWRRRGVSRAR
41409762NP_962598.1 hypothetical protein MAP3664 [Mycobacterium avium subsp. paratuberculosMSSLRSVLLLCWRDTGHPQGGGSEAYLQRIGAQLAAAGIAVTLRTARYPG
APRRDVVDGVRISRAGGRYSVYIWALLAMAVARLGLGPLRTVRPDVVVDT
QNGLPFLARLIYGRRVVVLVHHCHREQWPVAGPVLGRLGWFVESTLSPRL
NRRNQYVTVSLPSARDLVALGVDGTRIAVVRNGLDEAPAPSLSGPRAAAP
RVVVLSRLVPHKQIEDALEAVARLRPRVPGLHLDIVGDGWWRQRLVEHVQ
RLGIGSAVTFHGHVDDVTKHHVLQGAWVHLLPSRKEGWGLAVVEAAQHRV
PTIGYRSSGGLSDSIVDEVTGILVDTHAELVDRLEQLLADPVLRDQLGAK
AHTRSGEFSWAQSADAMRGVLEAVHAGRTVSGLVSGRG
41409761NP_962597.1 hypothetical protein MAP3663c [Mycobacterium avium subsp. paratuberculoMAVTDIFARRATLARSVRLLSQFRYERSEPARFYGALAADTAAMVDDLWR
AGHGESAAGRTLLDVGGGPGYFAAAFTDAGVRYLGVEPDPGEMHAAGPVV
AADTGTFVRASGMALPFADDSVDICLSSNVAEHVPRPWQLGAEMLRVTRP
GGLAVLSYTVWLGPFGGHEMGLTHYLGGARAAERYARKHGHPAKNNYGSS
LFEVSVADGLAWAASTGAALAAFPRYHPRWAWSLTSVPVLREFLVSNLVL
VLQPQ
41409760NP_962596.1 hypothetical protein MAP3662c [Mycobacterium avium subsp. paratuberculoMSDIQTQAKTEYDKLFIGGKWTEPSTSEVIEVHCPATGEYVGKVPLAAAA
DVDAAVAAARAAFDNGPWPTTPPKERAAVIANALKVMEERKDLFTGLLAA
ETGQPPTSVETMHWMSSIGALNFFAGPAVDQVKWKEVRTGGYGQSIVHRE
PIGVVGAIVAWNVPLFLAVNKLGPALLAGCTVVLKPAAETPLSANALAEA
FAEAGLPEGVLSVVPGGIETGQALTSNTDVDIFSFTGSSAVGREIGRRGA
DMLKPCTLELGGKSAAIVLDDVDLPSALPMLVFSGIMNSGQACVAQTRIL
APRSRYDEIVDAVSTFVQSLPVGLPSDPAAQIGSLISEKQRARVEGYIAK
GIEEGARLVCGGGRPEGLDSGFFVQPTVFADVDNKMTIAQEEIFGPVLSI
IPYDTEEDAIKIANDSVYGLAGSVWTADVQRGIAVSEKIRTGTYAINWYA
FDRCCPFGGYKNSGIGRENGPEGVEHFTQQKSVLMPMGYTLEG
41409759NP_962595.1 hypothetical protein MAP3661c [Mycobacterium avium subsp. paratuberculoMSSTSRATNSPARCPTCGAAPSASAHVTCTGRHCGIRTRPDAGPGLTDRA
DHQAAGPAKRGGTRTKMLASAAEVMRERGAAGVTIDAVLARSGAPRGSVY
YHFPDGRNQILAEALRYSGDSITALIDQAAGRGGRALLREFVEYWERLLT
EGGFTAGCPVVAAAIGCSEDEGPKLSAEAGAILGRWCTALTRAFVNDGFD
DADAASLAVMSIAALEGGIVLSRSTRNAGPLHQVGEQLEFLIKAREFVVR
NKIPGKQPGSR
41409758NP_962594.1 hypothetical protein MAP3660 [Mycobacterium avium subsp. paratuberculosMCDTQVIVVRSADSLDDLRCGGVPMVPVGAERSGELDPSFADGTVMGKRY
VDETGAEVLVTKPGAGSLSIGQTPLQLKEVKPLPASD
41409757NP_962593.1 hypothetical protein MAP3659 [Mycobacterium avium subsp. paratuberculosMSISLLLEMAASSNAERTAVVSQDVRLTTQELSDLADGGAAVVAGSNAKH
LVYVGTGGVLLPVLIFAAARAGVAFTPINYRLSAEGIRALIERLPEPLVV
VDARYRDMVGEAPGGVMDSDDFLAAARAAEPAADAFADPDSVAIVLFTSG
TTSQPKAVELSHNNLTSYITGTVEFGAADETDAALICVPPYHIAGVSAAL
SNLYAGRKMVYLPNFDAREWVRLINAENVTTATVVPTMLDRIVTVLENGD
PDTGAPIELPSLRNLAYGGSKVGLPLVRRALELLPHVGFVNAYGLTETSS
TIAVLTPDDHRAALAATTPEAARRLGSVGQAVAGIELQIRDEAGNVLPPG
ETGELFVRGEQVSGRYTGIGSVLDEDGWFPTRDIAMLDDEGYLFIGGRSD
DTIIRGGENIAPAELEEVLVEHPHVRDVAVVGVEDPQWGQAIVAVVVPAA
GVDPDPEELREFVRKSLRGSRTPDEVVFRDELPTTATGKVLRREIIATLA
GLRAAPAQQ
41409756NP_962592.1 enoyl-CoA hydratase [Mycobacterium avium subsp. paratuberculosis K-10]MRHVSTGNEEAGEPEVLVEQRDRILIITINRPKAKNAVNAAVANGLAAAV
DRLDNEPGLSVGVLTGAGGSFCAGMDLKAFARGELPIVEGRGMGFTERPP
AKPLIAAVEGYALAGGTELALATDLIVASKDAAFGIPEVKRGLVAGGGGL
LRLPQRIPSAIAMELALTGDNLSAERAHALGMVNVLAEPGAALDEAIALA
EKIAANGPLAVAATKRIIVESRGWSPETMFAEQNKLLAPVFSSNDAKEGA
IAFAEKRPPKWTGT
41409755NP_962591.1 hypothetical protein MAP3657 [Mycobacterium avium subsp. paratuberculosMKRLSGWDSVLLYSEAPNVHMHTIKAAVIELDADRRSLDVAAFRQVIAGR
LNKLDPFCYQLVEVPFSFHHPMWRENCEIDLDYHIRPWRVSPPGGRRELD
EAIGQIASTPLDRSRPLWEMYFVEGLANNRIAVVGKIHHALADGVASANL
LARGMDLQPGPEGGPYVCDPPPTTRQLMVSAFADHLRHVGRLPHTIRYTA
QGLGRVRRSARKLSPELTRPFEPPPTFMNHKLTPERRFATATLALADVKE
TGKRLGATINDMVLAMSTGALRTLLLRYDGQAQPLLASVPVSFDFSPERI
SGNRFTGMLVALPVDHDDPLERVAACHQNAISAKESHQLMGPELVSRWAA
YMPPAPTRAFFQWASARDGHNKILNLNISNVPGPRERGRVGGALVTEIYS
VGPLTAGSGLNITVWSYVDQLNISVLTDGATCKDPHEVTEAMVQDFIEIR
RAAGFSEDLTVVEAAMAPA
41409754NP_962590.1 LipC [Mycobacterium avium subsp. paratuberculosis K-10]MWAIARFADRDGGTVPAMAPGMTPYLKWLLRARPADYALAVSLAGASLPV
VGRHLEPLAGLTAMGMWGARHAPEVISAATRDMFAPGGGDARRRDRESTQ
QVSLAALRGLVSAAELESQWPVAQRTPPIWDGVRRHRHLYRRAVHYGHHP
AQVLDVWRRKDLPAQPAPVLIFVPGGAWVHGKSMGQGSALMSRLAEQGWV
CLAIDYRVAPHHRWPRHIVDVKTAIAWARANVDKFGGDRNFVAIAGCSAG
GHLSALAGLTPDDPQYRGMLPEGADTSVDAVVGIYGRYDWEDRSTPERVR
FVDFLERVVVRKSIARHPEVFRDASPIARVHRNAPPFLVIHGSKDSVIPV
EQARSFVERLRAVSHSTVGYLELPGAGHGYDLIDGERAGAAAHVCSLFLD
QVHRSKTRIGAKEVI
41409753NP_962589.1 LipW [Mycobacterium avium subsp. paratuberculosis K-10]MPNNDVHPDLQRFARFAPRRLVGPRTLPLMRVALAWRGRLGKPVRDVEVI
TLGSGVGVRLFRPAGAAETTPALLWIHGGGYVLGTAQQDDQLCSRFSRRL
GITVASVDYRLAPEHRYPAPLEDCYTALTWLAGLPSVDRYGIAIGGASAG
GGLAAALALLARDRAEVSPAFQLLTYPMLDDRSSDTAPSPNYRLWDNRSN
RFGWAAYLGDADPHVAVPARRDDLSGLPPAWIGVGTHDLFHDEDLAYAER
LRAAGVPCQVETIPGAFHGFDLILPKVQVSQRFFDSQCNSLRAALTPAG
41409752NP_962588.1 hypothetical protein MAP3654 [Mycobacterium avium subsp. paratuberculosMGARIEEVAPADDGLAARAGEGVLYAGGGTVLPGLHDHHVHLRSAASALD
SFFVGPPGVSTRAELTRLLANATPGPDGWIRAVGYHDSVAGALDRTALDA
IVRDVPVRIQHRSGALWILNSEALGRIGLAEHPDGRLRSADRGWSQALAH
RETDLAELSRRITATGVTGVTDATPDLDDDDRAALAAAHARGEFRPRPSF
LSPGKKILHDDRLDLDALTEWVAGQHDTGQPVAVHCVTAAQLVVAIAALR
AAGTHPRDRIEHAAVVPDDNLADLAELGVTVVTQPNFVAERGDQYLAEVP
ADEHDQLWRLASLRDARVPVALSTDMPFGHGDPWTAMRAAVHRTTPSGVV
LGTRECVSARTALTMFLGQADQPDRVRSVQPGEPGDLCVLNEPPHTALAE
LDAGMVAATIIGGELVYFAM
41409751NP_962587.1 hypothetical protein MAP3653 [Mycobacterium avium subsp. paratuberculosMSRTPASTAMSTAASTAPSTMGDVSAAATDWGGSGLAYLTGLPNGPADFS
RAPVLSRAHQVAAAIGARLGVDADAAVLLSGRAALLGLRRAGQVSPGGAT
RLLAARDGYCALTLSRADDLAAVPALLQVDDVAGDPWPALRCWAAGRATA
EIVERAALLDIPAAALGEARPAAEHIQPTAPGGAPRSPRGLLVADLSSMW
AGPLCGQLLARAGATVVKVESPRRPDGTRAGNRAFFDWMNHGKLCYGIDF
DRDADQLRELLTVSDIVIEGSRPAALRRRGLGPADIAPRPGRIWLQITAF
DDDRPGFGDDAAVGGGLVGTSAAGPVFCGDAIADPLTGLQAALAVAESLG
RGGGELIRLSMAGVAAGYAALGTEPPTSDAPVSPPAPPPPSGPASALGAD
NAAVRHLVSQRRCLSC
41409750NP_962586.1 hypothetical protein MAP3652 [Mycobacterium avium subsp. paratuberculosMTSDGYARIREGGPYFDDLSVGQVFDWAPSVTLSSGLAAAHQAILGDRLR
LALDADLCAAVTGLPAPLAHPGLVCDVAIGQSTLVTQRVKANLFYRGLVF
HRFPVIGDSLYTRTEVVGLRANSPKPGRAPTGMAALRMITIDQADQLVLD
FYRCGMLPASPEFTAEAGSVPHDDLSGIGADVPGPAHDPTAQWDGAVFRT
EVPGPHFDRALAGSVLHSTGDVVSSAPELARLTLNIAATHHDSRVGGRRL
VYGGHTIGLALAQAARLLPNLVTVLGWRSCDHTGPVHEGDTLYSELHIES
ARPTEHGGVLGLRSLVYAVSDTPDEPDRAVLDWRFDALQF
41409749NP_962585.1 FadE3_2 [Mycobacterium avium subsp. paratuberculosis K-10]MGANSRVFAQQVDVRRESVRWAQVNDEEDMLVATVRAFIDREVKPTVREV
EHADAYPEAWIEQMKRIGIYGLAVPEEYGGSPVSMPCYVRVTEQLARGWM
SLAGAMGGHTVVAKLLTLFGTEDQKRAYLPRMASGEIRATMALTEPGGGS
DLQNMSTTALPDPDSDGLVVNGAKTWISNARRSGLIALLCKTDPKATPRH
KGISILLVEHGPGLTVSRDLPKLGYKGVESCELSFGNFRAPATAVLGGVA
GQGFSQMMKGLETGRIQVAARALGVATAALEDALAYAQQRESFGQPIWQH
QSVGNYLADMATKLTAARQLTRYAAERYDSGERCDMEAGMAKLFASEVAM
EIALNAVRIHGGYGYSQEYDVERYFRDAPLMIVGEGTNEIQRNVIARQLV
TRGGI
41409748NP_962584.1 hypothetical protein MAP3650 [Mycobacterium avium subsp. paratuberculosMLRVVDLSSAPQDGPASPPGVIVAVGSADQIARSEFWLEAATFTLTEDAC
TDRRAVTVDSVSTSLDELTARCRRWPHASAICDDVLRAVDPTAPAARGLV
TESLAYSTLQAGPEFVRWLDERGPARMPEIADPVLARRDGDVLRIAFNRP
QRHNAFSTDARAALLEALAVAQLDPSVTGIVLSGNGPSFCSGGDLAEFGT
FADPASAHLARTRHSPALVLDALTARFGRACRAEVHGRVLGSGLEMSAFC
GWVSARDDAVFGLPELALGLIPGAGGTVSITRRIGRWRTAYLVLSGRTVG
AATALSWGLVDEVEAATASS
41409747NP_962583.1 acyl-CoA synthetase [Mycobacterium avium subsp. paratuberculosis K-10]MQIREYLGAGKPAVILYPSGTVVTFDDLEARANRLAHRFRKAGLREGDTV
AILMENNEHIHAVMWAARRSGLYYVPINTHLTAAEAAYIVDNSSARAIVG
SAALRDTCARIGEHLPGGLPDLLLMADGDLDGWEHYPECVAGEPDTPIDD
ELEGDLLQYSSGTTGRPKGIKRELPHVHPAEAPGMMSALVGFWMTPESIY
LSPAPLYHTAPSVWSMSAQAGGITTVVMEKFDAEGCLDAIQRHRVTHGQF
VPAMFTRMLKLPEAVRHSHDLSSLQRVMHAAAPCPVEIKKQMIDWWGPII
DEYYASSEAIGSTLISAEEWLAHPGSVGKPMACEIHILDENGNELPPGQA
GEIYFSGGYSFEYLNDEAKTAASRDKHGWVTVGDVGYVDEEGYLYLTDRR
HHMIISGGVNIYPQEAENLLVTHPKVLDAAVFGVPDDEMGQRVMAAVQTV
DPGDATDEFGAELLSWLRDRLAHYKCPRAIAFEEQLPRTDTGKLFKNGLI
EKYSV
41409746NP_962582.1 hypothetical protein MAP3648c [Mycobacterium avium subsp. paratuberculoMTAEQVSQPPASGSSRFAVYDYVDGMERLVHAVQELSLARSLPDIQRIVR
SSARELTGCDGATFVLRDNDRCYYADEDAIAPLWKGSRFPMTSCISGWAM
LNRDAAVIPDIYRDPRIPHTLYRPTFVKSLVMVPIRKLDPIGAIGNYWAE
PHQPSEHEVRLLQALADSTSMAM
41409745NP_962581.1 hypothetical protein MAP3647c [Mycobacterium avium subsp. paratuberculoMEQRVRDRTAALERANEEIRRLSVTDELTGLNNRRGFYLLAGQKLSGSHR
LGHACVLAFLDVDGLKQVNDEQGHDAGDMLIKDVAEVLRSIRRESDILAR
IGGDEFCVMVTESDQDSAPLRERLAEAFAAFNATGDRPYRLSASVGLVRA
PVFDTASVDELLARADELMYVEKKARRTAG
41409744NP_962580.1 phosphoenolpyruvate carboxykinase [Mycobacterium avium subsp. paratuberMTSATIPGLDTAPTNHQGLLSWVQEVAELTQPDRVVFADGSDEEFNRLAA
ELVEAGTLKKLNEKKHPNSYLALSDPSDVARVESRTYICTEEESGAGPTN
NWMDPTEMRSIMTDLYRGCMRGRTMWVVPFCMGPLGVEDPKLGVEITDSE
YVVISMKVMTRMGKAALEKMGDDGFFVKALHSVGAPLEPGQKDVPWPCND
TKYITHFPETREIWSYGSGYGGNALLGKKCYSLRIASAMAHDEGWLAEHM
LILKLISPENKAYYFAAAFPSACGKTNLAMLQPTIPGWRAETLGDDIAWM
RFGKDGRLYAVNPEFGFFGVAPGTNWKSNPNAMRTIEAGNTVFTNVALTD
DNDVWWEGLEGQPEHLIDWKGNDWYAGKTETPAAHPNSRYCTPMSQCPIL
APEWDDPQGVPISGILFGARRKTTVPLVTQARDWQHGVFMGATMGSEQTA
AAEGKVGTVRRDPMAMLPFLGYHVGDYFQHWIDLGKNSDESKLPKVFFVN
WFRRGDDGGFLWPGFGENSRVLKWIVDRIEHKAGGQDTPIGIVPKAEDLD
LDGLDVSVDDVAKALAVNPDEWREELPQIEEWFEFVGEKLPTGVRDEFEA
LKQRLSEAG
41409743NP_962579.1 hypothetical protein MAP3645 [Mycobacterium avium subsp. paratuberculosMSGDNPAAAVDALVAAVSPGLDPPAVHRSDAVLVTGPWMAGVTAVAAALQ
ERLPQHKFVESTDLGPGEVPTAVVFVVSAAAHLTPSDCALLDAATEHTDA
VVGVVSKIDVHRGWREVLAANRDTLAAHAPRYARVPWVGAAALPDVGEPD
VDDLAKTVAAQLDDADLARRNRLRAWESRLRTVARRFDREVEAPGRRARV
EALREERSTALQQRRQAKTERSITLRGQIQQARVALSHSARNRCASVRTE
LQEHAAGLSRGKLSGFEAHTRDRLAEVVAEVNDGTDTQLADTAQAVGVAV
DLPALEQLPAVEVSPPPLKSRRQETWLMILFGVGFGLGVALTLSRLMSGL
ASRLSPALAVAAAVVCVLISVALTFLVINIRGLLRDRALLDRWAGDATAS
LRSVVEELVATRVLVAESVLSKALLAQDEAENAAVSASVSAIDTELREHA
LAAARAAAARDREMPAVTAALEAVRAELGEPGIQPGGSPAEDAGGAKTEK
PASRSEDGDRP
41409742NP_962578.1 hypothetical protein MAP3644 [Mycobacterium avium subsp. paratuberculosMRGQGHQIFVDELARFAAAEADPRVTAIAQRAAAPLRVVVRGRRGVGRRT
LARALDRAGRATGIAVTTDAADVVVHVTAEVAKPEDTQAISTARAAGHPV
LAVLSKADLVGSLSGRGGDGPIAAARARCADLSALIGVPIRPAIGLLAVA
ALDDLGDDLWAALRTLAADPAACLDGSITGFLGAGVDVPAAARERLLDTL
DLFGTALAIAAIRRGAGPAQLRTLLRRISGVDAVLAEIGALGAEVRYRRV
LGAVAELEALAVGGAALGERISGFLSRDDTVVARMAAALDMAGDMAGEVA
GETAPGDPSGHLARAVRWQRYSRASGSDLHRACGADIARGSLRLWSQACA
TLPGERPVEREDPA
41409741NP_962577.1 tRNA (guanine-N(7))-methyltransferase [Mycobacterium avium subsp. paratMGHHGQMHAQHGVTMPADSPIGQPDRSEQRYFPATAFRTRRSTLSDAQRQ
TWDRRWPELGLSVGPAEDPDRPGPPLDTDAWFGRKAPVVLEIGCGNGTST
LAMAKEEPGVDVIAVEVYRRGLAQLLCAIDRDNVTNIRLIRGNALDVLQR
LIAPASLTGVRVFFPDPWPKARHHKRRFLQPGTVGLIADRLLPGGVLHVA
TDHAGYAEHIADVGAGEPRLRPANPDSPLPISVARPTTKYETKAQDAGSA
VTEFIWLRR
41409740NP_962576.1 hypothetical protein MAP3642c [Mycobacterium avium subsp. paratuberculoMSLTEATAAGAEPVAPPAVLSGDALGGFPPPGGRVLLVWDAPNLDMGLGS
ILGRRPTALERPRFDALGRWLLARTAEVSAERPGVVVEPEATVFTNIAPG
SAEVVRPWVDALRNVGFAVFAKPKIDEDSDVDRDMLAHIELRRTEGLAAL
VVASADGQAFRQPLEEIARSGVSVAVIGFREHASWALASDTLDFVDLEDI
SGVFREPLPRIGLDSLPDQGAWLQPFRPLSALLTARV
41409739NP_962575.1 MmpL3 [Mycobacterium avium subsp. paratuberculosis K-10]MFAWWGRTVYRYRYIVIGVTVALCLLGGVFGISLGKHVTQSGFYDDASQS
VKASVLGDQTYGRDRTSHVVATFTTPDGKTVDDAGWRDKVVAELNKFKAD
HPDQVVGWAGWLAAPDSTNPVIKGMVSEDKKHTFVSIPLKGDDDDTILNN
YKAIAPDMQKLNGGAVQLAGLEPIANALTGTIATDQRRMEVLAVPMVAVV
LFLVFGGAVAAGLPAIVGGLSIAGSLGILRLVAVFGPVHYFAQPVVSLIG
LGIAIDYGLFVVSRFREEIAEGYDTEAAVRRTVMTAGRTVTFSAVLIIAS
SASLLVLPQGFVHSLTYAIFAAVGLAALLSITFLPACLGILGRHVDALGV
RTAFRVPFLRNWKYSRAYLNWLADRLQKTKTREEVEAGFWGKLVNWVMRK
PLAFAIPIAVGMILLVIPLGNLSFGGMSEKYLPPNNPVRLAQEHFDKQFP
GYRTEQLTVVIQSDNHSKVTDQQVADIRNRISGIGGFTDKTWQERPCPTI
AGNPCVPGPNGTTVPKDGSVRVIQNGLANRNDAAKKIAELRAVNPPKGLN
LYVGGTPALEQDSIHSLFDKAPLMLVLLLGATLLLMFLAFGSVVLPIKAV
LMSALTLGSTMGILTWIFVDGHLSGVLNFTPTPLMVVVIALVVAVGFGLA
TDYEVFLVSRMVEARERGMSTAEAIRIGTATTGRLITAAAMVLAVVASSF
VFSDLVLMKYLAFGLMAALLLDATVVRMFLVPSVMKLLGDDCWWAPRWAR
RLQNKIGLGEIDLPDERKRPTLNGRPARPPVAASLVAAAPRPPHDPTHPA
APEPSRPARPAPAEPRPAQEPAASTTRIPARPNQPTEAQTTRFAAPGAPG
RQRPPEPRPATPQRPPAQAAPPSGDQTRAIPVPGNRPDDGDSDADAAEPT
TALPKMRAEGSGGSESDAAGDQANARGQGENGDPARQRRRAGGGLSAQDL
LRREGRL
41409738NP_962574.1 hypothetical protein MAP3640 [Mycobacterium avium subsp. paratuberculosMSANVDDASVEPIVRKTAAWAWRLLVILAAALALFWVLAKLEVIVVPVLV
ALLLSALLVPVVDWLDRHGLPRGGAVALVLLGGFAILGGILAFVVLQFID
GLPGLTEQVTQSIESTRRWLINGPAHLRSEQIDSAGNAAIEALHNNQAKL
TSGALSTAATVTELVTAAVLVLFTLIFFLYGGRNIWRYVVQIVPAHARDR
VHEAGSAGYGSLIGYVRATFLVALTDAAGVGAGLAIMGIPLALPLASLVF
LGAFIPLVGAVVAGFLAVVVALLAKGIVYALITLGLLVAVNQIEAHLLQP
LVMGRAVSIHPLAVVLAISTGGVLAGIVGALLAVPTVAFLNNAFQVLLAP
NPSAEAVKQEEESDEQNTILQAEPDKPENGSG
41409737NP_962573.1 hypothetical protein MAP3639c [Mycobacterium avium subsp. paratuberculoMPHDAPAHNLDLPREQTPRGRYWWVRWVILGVVAIVLAVEVSLGWDQLAK
AWMSMYEANWWWLLASVVAAAASMHSFAQIQRTLLKSAGVHVKQLRSEAA
FYAANSLSTTLPGGPVLSATFLFRQQRLWGASTVVASWQLVMSGVLQAVG
LALLGLGGAFLLGAKNNPFSLLFTLGGFVALLLLAQAVASRPELIEGIGS
RVLAWVNSVRGRPAETGLDKWRETLMQLESVSLGRRDLSVAFGWSMFNWI
ADVACLGFAAYAAGDHASVAGLTVAYAAARAVGTIPLMPGGLLVVEAVLV
PGLVSSGMSLPSAISAMLIYRLISWLLIAAVGWVVFFFVFRTENIADSDD
EPITGPLPVLPTPGGPPDPTDTALQGPLPPDRNPADPNPDKDV
41409736NP_962572.1 hypothetical protein MAP3638 [Mycobacterium avium subsp. paratuberculosMTSASAGRRRRIFAGLIAAALPGAAVAVLAGPPATGANDPCAASEVARTI
GSVSKSMGDYLDAHPETNQAMTSMLQQQAGPQSVNGLKSYFDANPKVAGD
MTSIAQPLTSLSLQCKLPISIPQALGMVQQAQGAAGGLPALPGNPAGASP
LGGAAGPAGTPPAVPQPAGPLSGPPRGNTVG
41409735NP_962571.1 MmpL11 [Mycobacterium avium subsp. paratuberculosis K-10]MMRLSRSLRKYRWLVFAGWLLALVPAVYLALTQSGNLTGGGFDVAGSQSL
AVHDQLEDLYHDQGGSSLALVAAPRADASYQDMNDAVAQLRRIAAEVPGT
TEIPNPTQRPPQPDRPYVLSVRLDSRNTSDVAKQLRTKVGIKGDQPGQTA
NGRVRLYVIGQGALSAAAAANTKHDIAAAEKWNLPVILIVLLAVFGSLAA
AAIPLALGICTVVVTMGLVYLLSAYTTMSVFVTSTVSMFGIALAVDYSLF
ILMRFREELRSGRQPREAVDAAMATSGLAVVLSGMTVIASLTGIYVINTP
ALKSMATGAILAVAVAMLTSTTLTPAALATFGRAAAKRSALLHWSRRPES
TQSKFWNRWIGWVMRRPWMSALAASLVLLVMAAPAASMVLGNSLLRQFDS
SHEIRAGVGAAAQALGPGALGPIRVLINFPDGGAASPEHSHTVGAVRQRM
AQAPNIVSVSPPQFAEDNGSALLSAVLSVDPEDMKARETVGWMRAELPKV
PEAGTARVDVGGPTALIKDFDDRVSATEPLVLGFVALIAFVMLLVSIHSV
FLALKGVLMTLLSVAAAYGSLVMVFQWGWLRDLGFAQISSIDSTVPPLVL
AMTFGLSMDYEIFLLTRIRERFLHSGNTRDAVAYGVSTSARTITSAALIM
SAVFVGFAFAGMPLVAEIGVACAVAIAVDATVVRLVMVPALMAMFAQWNW
WLPPWLSRVLPSVDFDRPLPEVDLGDVVVIPDDISALTAPSADLRMVLKS
AAKLKHLAPDAICVTDPLAFTGCGRTTAAGADPARGLGPGQIPHQVALRE
EKVGVAAGPGEKTGSNGHTNGSAGAKKPAARNGRNGIAKAIAGADRPVHP
VTLWRGRLSVALDALQTDPDSGTDRPRFRRRSPVETTNVQLPTGDRLLVP
TGAETLRLKGYLLMCRNSRRDYADFADMVDALEPETAAVVLAGMDRYYCC
ESSRRQWIATQLVRRLADPDPCDYPDDQGPDADAPADWEQIRQRCLAVAV
AMLEEAR
41409734NP_962570.1 hypothetical protein MAP3636 [Mycobacterium avium subsp. paratuberculosMTGEWQPSACILCECNCGIVVQVEDRRLARIRGDKAHPASQGYTCNKALR
LDHYQNSRARLTSPLRRRPDGSYEEIDWDTAIVEIAEGFKRIRDSYGGDK
IFYYGGGGQGNHLGGAYSGAFLKALGSRYRSNALAQEKTGESWIDGQLYG
GHTRGEFEHAEVAVFVGKNPWMSQSFPRARVVLNEIAKDPARSMIVIDPV
VTDTAKMADFHLRVRPGTDAWCLAALAAVLVQENLCDEAFLAEHVRGADG
VRRALRDVAVCECAAHCGVDEELLRTAARRIGTADSVAVFEDLGVQQAPN
STLCSYLNKLLWILTGNFAKRGGQHLHSSFAPLFGQFSGRTPVTGAPIIS
GLVPSNVVPEEILTDHPDRFRAMIVESSNPAHSLANSAACREAFASLELM
VVIDVAMTETARLAHYVLPAASQFEKPEATFFNLEFPRNTFQLRRPLLTP
LPGTLPEPEIWARLVRALGVVTEADLRPLHDAARRGRHAYTEAFLTAVST
NPTVAQLLPFVLYETLGPTLPDGLRGAAALWGLAQKTALTYREAVRRAGH
ADGNALFDAILDNPSGVTFTVHDYADDFTLIGHPDHKIALEIPAMLQELA
KLSSGPPRLTTEEFPIVLSVGERRAYTANDIFRDPSWRKRDAEGALRVSV
EDAQALGLADGCRARISTAAGSAEATVEISETMLAGHAALPNGFGLDYIG
DDGRTVVPGVAPNAQPHVAGHLGALVGLQVGAGTLEYLPQRLGDAIGPGA
VEHLFDLARGAPVGVALQRAGDALPGGDVTALQSRTDGGGRPEFHRLVEV
RQRGGRAAAAVALVPRGRPVRRRSRASVGCQRHLASSSIATATARQRCLI
CSQSAGASASGPWSSG
41409733NP_962569.1 hypothetical protein MAP3635 [Mycobacterium avium subsp. paratuberculosMRSPREKMVVSAALLIRERGAHATAISDVLEHSGAPRGSAYHYFPGGRTQ
LLCEAVDFAGEYVAAVIAGAESGSRLLDTLIDTYREQLRDSDFRAGCPVV
AVAVEAGEQSDAERPVIERAAAAFDRWTDLIAQRFVADGIRRRRAAELAV
LATSALEGAIVLARARRDPAPLDVVHRQLRDLLAAELAGETAAGRKSRHD
R
41409732NP_962568.1 hypothetical protein MAP3634 [Mycobacterium avium subsp. paratuberculosMSGGMPMSGWTRGTLFAALNAAVVSVVGLALVLSAGPALADPDPAPADPG
AVAAPPGPPAPPDPLAPPPPPDPLAPPPPAAPPAPWLPPAAQPAAAPAAG
QDPTPFTGTPPFGPPTFVPKTGSTVGVAQPIIINFPGRVDDAGAAISAVH
VSSVPPVPGKFYWMTPTQLRWRPLSFWPAHTAVTVDAGGTVTNFQTGDTL
VATADDATHQLTVTRNGTVEKTFPMSMGMTAGNHQTPNGTYYVQDKKASV
VMDSSTYGVPVNSTYGYKVTVEDAVRFDNVGDYVHSAPWSVDDQGKRDVS
HGCINISPANAKWFFDNFGPGDPIIVKNSSGGDYKKNDGSADWMN
41409731NP_962567.1 hypothetical protein MAP3633 [Mycobacterium avium subsp. paratuberculosMTVMTAETANAAARTWTPRIAAQLAILAAAAFTYVTAEILPVGALPAIAR
NLQVSLVLVGTLLSWYALVAALTTIPLVRWTAHLPRRRVLVASLTCLTAS
QLISALAPNFAVLAAGRVLCAITHGLLWSVIAPIATRLVPPSHAGRATMS
IYVGTSLALVVGSPLTAALSLMWGWRLAVVCVTVAAAVVTVAARLMLPEM
VLTEHQLAHVGPRSRHHRNGRLITVSLLAMVAVTGHFVSYTFIVEIIRNV
VGVRGPTLAWVLAAYGLAGLLSVPLVARPLDHRPKSAVILCMTGLTAAFA
VLTALAFGGPTGATTALIGTAAIVLWGAMATAVSPMMQSAAMRNGADDPD
GASGLYVTAFQVGIMAGSLLGGLLYERSVILMLSASGVLMAVALVGIAAN
RRMLDVAPTSSRDS
41409730NP_962566.1 hypothetical protein MAP3632 [Mycobacterium avium subsp. paratuberculosMTNEHGYSQQKDNYAKRLRRIEGQVRGIARMIEEDKYCIDVLTQISAVNS
ALRSVALNLLDEHLGHCVTRAVAGGGDDADEKLAEASAAIARLVRS
41409729NP_962565.1 dihydroxy-acid dehydratase [Mycobacterium avium subsp. paratuberculosisMPTTDSARAADIKQPDIKPRSRDVTDGLEKAAARGMLRAVGMGDEDFAKP
QIGVASSWNEITPCNLSLDRLAKAVKEGVFAAGGYPLEFGTISVSDGISM
GHEGMHFSLVSREVIADSVETVMQAERLDGSVLLAGCDKSLPGMLMAAAR
LDLASVFLYAGSILPGVAKLSDGSEREVTIIDAFEAVGACARGLMPREDV
DAIERAICPGEGACGGMYTANTMASAAEALGMSLPGSAAPPATDRRRDGF
ARRSGQAVVELLRRGITARDILTKEAFENAIAVVMAFGGSTNAVLHLLAI
AHEADVALSLDDFSRIGSKVPHLADVKPFGRHVMTDVDHIGGVPVMMKAL
LDAGLLNGDCLTVTGATVAQNLAAIAPPDPDGKVLRALSDPLHPTGGITI
LRGSLAPEGAVVKSAGFDSDVFEGTARVFDGERAALDALEDGTITKGDAV
VIRYEGPKGGPGMREMLAITGAIKGAGLGKDVLLLTDGRFSGGTTGLCVG
HIAPEAVDAGPIAFLRDGDRIRLDVANRVLDVLVDPAEFDSRRTGFTPPP
PRYKTGVLAKYVKLVGSAAIGAVCG
41409728NP_962564.1 hypothetical protein MAP3630 [Mycobacterium avium subsp. paratuberculosMSTVHSSIDHHPDLLALRARYERVAESMSAHFTFGLALLAGLYVAASPWI
VGFSATASLATSDLIAGIAAAFLAYGFATTLDRAHGMTWTLPVLGAWVIV
STWILPGVVLTAGMTWSNVVAGALLTFLGLNATYFGMRTRASAG
41409727NP_962563.1 hypothetical protein MAP3629c [Mycobacterium avium subsp. paratuberculoMIKITPARRPPATKTGAGPAPQPALAKPVRRLRRNVAGHGHRRPVAARCS
GRAGRDGRRAGRCAAGGRGRRGGWPGHAGHHHPRPARSVDPAGA
41409726NP_962562.1 hypothetical protein MAP3628c [Mycobacterium avium subsp. paratuberculoMLAFGENRGLVAHLRLAGAFVFVMVGTVAQARAAIAWGADGLIAQGREAG
GHLVGTTAALDFLPHALAAAGGRPVFLAGGIATAADSRAALDAGADGVIA
GTRFLLTHESDASRGYQQRVLQADNTIETNLFGLSWPLRHRVVPNAATRR
WCGADGKARALPAALNAASRPLSALGYFDAGALLRLQSPRRPLFTPLAPV
AGVPDSLLDSAALYAGETASRIGELTSARQAVADLTPR
41409725NP_962561.1 hypothetical protein MAP3627 [Mycobacterium avium subsp. paratuberculosMTEKPTPKDVDAFLDSTVVGGDPSVIDALEASSAAGLPPIAVSVQQGKFL
SLLATAMGARRILELGTLGGFSTIWLARGAGPQGRVVTLEYEPKHAEVAR
ANLQRAGLADRVEVIVGAALDTLPSVTGPFDLVFIDADKENYPAYLDWAV
RLARPGAVIVADNVIRQGQILKPEADAQARAVRQTLQAMGEHPRLDTAVI
QTVGAKHWDGFAFAVVR
41409724NP_962560.1 hypothetical protein MAP3626c [Mycobacterium avium subsp. paratuberculoMSHMATYESGTLLTCGHEGCGCRVRIEVPCHCSGAGEEYRCTCGDALTPV
K
41409723NP_962559.1 BglS [Mycobacterium avium subsp. paratuberculosis K-10]MTDDERFSLLVAVMGAGDMWPVRDERIPADVPMSAGYVPGVPRLGVPPLL
MSDAGLGVTNPGYRPGDTATALPAGMALAATFDPALARAAGELIGREARS
RGFNVQLAGAMNLARDPRNGRNFEYLSEDPLLTAAMVAESVAGIQQQGVI
STVKHYSLNCNETNRHFLDAVIDPDAHRESDLLAFELAIERAHPGAVMTA
YNKVNGVYAAANSVLLNDVLKDAWAYRGWVMSDWGATPGWECALGGLDQE
CGAQIDALLWQAESFGAPLRDAYADGRLPKDRLSDMVRRILRSIFAVGVD
RSDREPAPDLNAHNDIALRIARQGIVLLTNRGLLPLRPDSPARIAVIGGY
AQLGVPAGFGSSTVVPAGGYAAVVPIGGTGLEAGLRNLYLLPSSPLQELR
RLLPENTIDFDPGISPAEAVAAAQRADIAIVFAVRAEGEGFDLADLSLPS
GQDELIGAVAAANPNTVVVLQTGNPVTMAWLGAVNAVVQAWYPGQAGATA
IAEVLTGRVNPGGRLPITFPVDLHQTPRPQLPGAGLPWGTPSTIDYVEGA
DVGYRWFAAKGHVPMFAFGHGLSYTRFEHRDLVVRGGDTITAGFTVVNTG
DRAGADVPQLYLTAMPGKPCLRLLGFERVELGPGESRHVTIDADPRLLAH
YDGSIRSWRIAAGSHTVALGISATTLRSTATVELTARAFGR
41409722NP_962558.1 hypothetical protein MAP3624 [Mycobacterium avium subsp. paratuberculosMSPGDSPPRDSQRSRVYAAEEFVRTLFDRAAEHGSPAVEFFGTRLTLPPE
GRFGSVPSVQRYVDQVLALPAVRQRWPDVPPLRVRPRRAATAAHYENRDG
AGVIAVPDRDTAEWALRELVVLHEVAHHLCRAGPPHGPEFVATICELTEL
VMGPEVGHVLRVVYAKEGVR
41409721NP_962557.1 hypothetical protein MAP3623 [Mycobacterium avium subsp. paratuberculosMSDDKMLARIAALLRQAEGTDNSHEADAFMSAAQRLATAASIDLAVARSH
SAQRSAAQAPTQRTITIGAAGSKGLRTYVQLFVLIAAANDVRCDVASNST
FVYAYGFAEDIDASHALYASLVVQMVRASDAYLASGAHRPTPTITARLNF
QLAFGARVGQRLAEARDQARQEATKDRRRAPGTAIALRDKEIELVDFYRS
ASKARGTWQASRASAGYSSAARRAGDRAGRRARLGSSPELPGARSALSG
41409720NP_962556.1 hypothetical protein MAP3622 [Mycobacterium avium subsp. paratuberculosMNRTERSFDGVGGVRIVYDVWTPEVAPRAVLVLSHGFGEHARRYDHVARR
FGAAGLVTYALDHRGHGRSGGKRVLVRDIHEYTTDFDTLVGIATREHHGL
KCIVVGHSMGGGIVFAYGVERPDNYDLMVLSGPAVAAQDQVSPLLALAAK
VLGVIVPGLPAQELDADAVSRDPEVVAAYRNDPLVYHGKVPAGVGRALLQ
VGETMPQRAPALTAPLLVVHGSDDRLIPVAGSRRLVECVGSADVELKVYP
GLYHEVFNEPEREQVLDDVVGWITARL
41409719NP_962555.1 RNA polymerase factor sigma-70 [Mycobacterium avium subsp. paratuberculMRVPHHYRQRNGCGSAPRLQTLRTLMRVSLLAQTPEGDSVVGADFTAHAE
PYRRELLAHCYRMTGSLHDAEDLVQETLLRAWKAYDRFEGKSSVRTWLHR
IATNTCLSALEGRQRRPLPVGLGAPSADPTAELVERREVPWLEPLPALTD
DPADPSVIVGSRESVRLAFVAALQYLSPRQRAVLLLRDVLGWRAAEVAEA
IGTTTAAVNSLLQRARAQLDAVGPSADDQLAQPDSAETQDLLARYIAAFE
SYDIDRLVELFTAEAIWEMPPYTGWYQGARTIVTLIHQQCPAEGAGDMRL
LPLIANGQPAAAMYMRAGDVHLPFQLHVLDVRGDRVSHVVAFLDDSLFAK
FGLPAALGPRQEGVRA
41409718NP_962554.1 hypothetical protein MAP3620c [Mycobacterium avium subsp. paratuberculoMTSSTVGVTPVPGNPRLLLSAYDLATVGYVAEEFFVSATASRYGPAGELG
ADGCWEVIRCGAADFTTRVVVLTPADPARFNGTVLVEWLNVSGGIDAAAV
WMMAHREILRAGYAYVAVSAQRVGVEGGESLLGADMSLKSQDPQRYAALH
HPGDAFSYDIFTQIGGLLTTGGHTAMLRGLPARHVIALGESQSAMFLTTY
INAVDPLAGVFDGFLVHSRFGPAAPLDGTSIFTESTEPQAVTFRPELRVP
VLTLITETDVFGGPREGYYFARQPDNPRLRVWEIAGAAHADNYTIQVAFI
DSGSAPLEDIVSGYAPTNMLMGQQLPHYINFGPQHHYVVQAALAALNTWV
TAGQPAPGAEPLQVREGPAPQPVLDGNGLARGGLRTPWVDVPIARTSGLG
GQESVMSAIFGSGEPFDAATLERLYPGGRTEYLERFTVALDAAIGAGFIL
PADRAEILRLAAATFPG
41409717NP_962553.1 hypothetical protein MAP3619 [Mycobacterium avium subsp. paratuberculosMYKVGVWGPGSMGVIALRGVIDHPQLELVDLVVHSDAKAGRDAGELCGVA
PVGVVATQDPAAMLAGDADVVVYAAGANLRPLEAVEDMVSLLRAGKNVVS
CSVVPLVFPDAVDSAFSEPLRAAALEGQVSFFTTGIDSGFANDVLPLVLT
GVSRVIESVRVTEMFNYATYPDASAVYEILGFGQPPDYPAFAAQPGIFTF
GWGPVLHQLAAGLGVEIDHIEESNERIPAPESFDTPTGHIAAGTIAAMRS
TLTGYVGEKPTFVLDHVTRMRDDLAPDWPQPRIAITPKDLGYGLASGRGL
YRVEIEGSPSMRCEFEMAEDHDHDLGARIAGSSRMVNAIPAVCAAPPGLL
SALDLPLITGAGLVRPVLGPPPDSRLF
41409716NP_962552.1 hypothetical protein MAP3618c [Mycobacterium avium subsp. paratuberculoMAESIGETPRRSGVKSPPTARVMDVLAAVADSPGGRTSAELAKGCAISSS
TCALVLAELERRAWVTRRDDRRYVLGSGLFGLVHGLREQFPLLDRGRDAL
RLLRERLGAGCSMSKIGARHLTTVDSVGHGTDGEHAVGQRFPIDPPFGLV
AMAWRDDDAVQAWLRRVTPRLTRTEIAQHQRVLADIRARGYGAWRFDDTH
RSLHNRLAEALASLEPTAQVARRLTTLMTMVTLRSITDVLETELPTTEFV
VLPIFGHDGQPEYQIEIHLGHSAGLTLPELDDALEQARRLLTAPVR
41409715NP_962551.1 hypothetical protein MAP3617c [Mycobacterium avium subsp. paratuberculoMSAGFEIRRAATRAVTTTPWLTSRHSFSFGDHYDPDNTHFGLLLVNNDDI
VSPGTGFDTHPHRDMEIVTWVLAGALAHQDSTGNRGVVYPGLAQRMSAGR
GILHSERNDSPSVPVHFVQMWVIPDEAGIDPSYQQHEIDDTALGGGMVTI
ASGIRGHDAAIGLHNRNAALHGARLPAAAAVDLPAAPYLHVFLARGRADV
EGVGELHPGDAVRFTDTDGRRVTGLEPSELLLWEMHARLGG
41409714NP_962550.1 hypothetical protein MAP3616c [Mycobacterium avium subsp. paratuberculoMARSHPQHAAPNPNRNIKAVRTVRFWAAPLVITLALMSALCALYLGGILN
PTTNLRHFPIAVVNEDAGPGGAQIVDRLATGLDRNKFDIRVLSRDEAKHQ
LDTGRVYGSLLIPPSFSSKLRDFATSAVSPARPDKPSITVSTNPRAGTLG
ASIAGQTLNSAMGTANGIAAQRVMAEVTAQTGGAPLPGATQAGLSSPIEI
QSVVYNPLPNGTGNGLSAFYYALLLLLAGFTGSIVVSTLVDALLGYVPAE
FGPVYRFAEQVRISRFQTLLLKWAMMLLLGLLTSAVYLAIADGLGMPIDL
SWELWAYGVFAIAAVGITSSSLLSVLGTAGMLVSMLVFVIFGLPSAGATV
PLEATPPLFRWLAEFEPMHQVFLGTRSLLYFGGRGDAGLSQALTMTSAGL
VIGLLLGGIVTHVYDRKGFHRIPGAVEFAIAQDHQAQHQARRGKSTQQPD
SPAEPETPTEPESPDEPESPSAQT
41409713NP_962549.1 LprO [Mycobacterium avium subsp. paratuberculosis K-10]MAERAIVLTRRASFRRLAACCTALSACLTLAVTSGQPLARAADGRDLLAN
AISSTRGSYLVYNFGPGHPAPMLNAGGSWYEMNNGGHLMIIKNAAGRLSP
HLLVDTHQGDQARCENNPGARTAEGLWQASELYAPLQAWQRMGQPTIAIN
ANFFDVRPQKGGSWRQTGCSSPLGAFVDNTNGRGRANQAVTGTVAYPGKQ
GLSGGGESWSALTTMILPSGGAPYVVWPKTKSDYDAATPVVADLLNKNEK
FVAVSGIGLLAPGNTGQLHDGGPSAARTAIGYARQKDEMYIFEGGSYTPD
NMQDLFRGLGSDNAVLLDGGGSSAIVLRRDTGGMWAGAGSPRGSCDTRQV
LCDSHERALPSWLAFN
41409712NP_962548.1 hypothetical protein MAP3614 [Mycobacterium avium subsp. paratuberculosMLTFATGLADAISILVLGHVFVANMTGNVIFLGFWLAPRTSIDLTAVVVA
LPTFACTTILSGRLARHFGERVRAWISTVLATEIVLLVGLSVLAGSGILG
YQQDSKLLMIAILAVTFGLQHSSARQFGIQELSTTVLTSTIVSLGLDSRL
AGGTGERQRLRIGVVATMCAGAFLGATMSRYVVAPVFVVAAAVIAASLLI
FRFGPPAAKPAAAEAN
41409711NP_962547.1 hypothetical protein MAP3613 [Mycobacterium avium subsp. paratuberculosMEDQQPPAGDLTAEENPAAADQNEATVAAAGDDRENGDAATESEAAETSD
AQPADGAEDTQSAETVATAGAAPAAGRRTKRLAGKAWAVAAMVAALLFVG
SAGFAGAMVQPYLADRAVAATKLKVARTAANAITTLWTYTPENMDTLADR
ASAYLSGDFEAQYRKFVDAIVAPNKQAKITNHTDVTGAAVESLDDTNAVV
IVYTNTTSTSPLTKNVPSLKYLSYRLFMKRAKSRWLVTRMTTITSLDLTP
KV
41409710NP_962546.1 hypothetical protein MAP3612 [Mycobacterium avium subsp. paratuberculosMSPRRKFAPGERPLLVARPVRPPRGWLLPLAGTAAALLMVTAVTLCALML
VSHESRERAASKDREVLSYVSGFMTQFTSIDPFHANDYVNRILAQATGDF
AKQYEKNANEILLQVARAEPATGTVLDAGLERWNDDGSANVMVATAITTK
SPDEKQVLENTNRWAATATQEGNQWKISSLQQVI
41409709NP_962545.1 hypothetical protein MAP3611 [Mycobacterium avium subsp. paratuberculosMTVLVEQTATTGTPEPVREALAPWHSRVGAFAIDVAPGAAVIATMALVSF
TVPARGVWWWVGVCMLGVVTLLALVNRLLLPVITGWSLGRALAGIAVTRR
TDAAPGPWRLLLRDLAHLLDTASIVGWLWPLWDSRRRTFADMLAGTEVRR
LAPEQVPPHISRWAAAAVLGAAAVCLGGAAMSYGVVYSADRAADQTRAQI
ATQGPKIVAQMLTYDPKSLHDDFARAQSLATDRYRRQLQTQQDVVQKGNP
VINEYWVTNSSIESASRDRATMLLFMQGRRGAAPEVRYISATVRVSFAKV
GENTWRVDDLTVLTKPKPPGGAK
41409708NP_962544.1 hypothetical protein MAP3610 [Mycobacterium avium subsp. paratuberculosMSPQDKDEDSTAPASTDEQTGSQGAPGVAGESAPDAADDAAVAAVPRGPS
RLGRGWLAAIAAVLVLCAAGIGAGGYLALRYHHESQVIARNNAAALKAAV
DCVEATQAPDTNAMTASEQKIIDCGTDAYRSQALLYTSMLVQAYQSANIH
VQVSDVRAAVERNNPDGSIDILVALRVKVASDQSQNESGYRLRVKMALAE
GQYKISKLDQVTK
41409707NP_962543.1 hypothetical protein MAP3609 [Mycobacterium avium subsp. paratuberculosMLTPFVRRQLVAFGILTVISLLVLGIYYLQIPSLVGIGRYTLKAELPASG
GLYPTANVTYRGITIGKVTDVEPTEHGAEATMSIDSHYKIPIDAVANVHS
VSAVGEQYLDLVSSGNPGKYLSSGQTITKGTVPAEIGPALDTANRGLAVL
PKEKIGQLLDETAQSVGGLGPNLQRLVDATQAIVGDFKNQITDVNDIIEH
SGPVIDSQVKSGDAIERWARNLNRLGAQSAQEDSHLKSLLRQAAPTADQV
NDVFNDVRESLPQTLANLEVVIDLLKRYHTGVEQVLVFLPQGASIAQTVA
APFPNMAALDLALSINQPPPCLTGFIPASEWRSPADTSLQPLPTGTYCKI
PMDTPANSVRGSRNIPCTDIPGKRAATPRECRDPKPYVPAGTNPWYGDPN
QILTCPAPAARCDQPVKPGMVIPAPSVDNGLNPAPSDRVAGTPPPVSDPL
SRPGSGTVQCNGQQPNPCVYKPSGPPTAVYSPQSGELVGPDGVKYSVENS
TRTGDDGWKEMLAPAG
41409706NP_962542.1 LprK [Mycobacterium avium subsp. paratuberculosis K-10]MGALRVIRRRSWQGLTLLVAAMVLTSCGWKGISNVSIPGGPGSGPNSYNI
YVQVPDTLAINGNSKVMVADVFVGSIKAIQLKNWIATLTLGINKNVKLPK
NATAKIGQTSLLGSQHVELAAPPNPSPELLKDGDTIPLKNSSSYPTTEQT
LASLSLILRGGGIPNLEVLQNEVYNIFNGRGEAIRALLGKLDTFTNQLNQ
QRDDITHAIDSTNRLLTYVGGRADVVDRLLTDVPPLIKHFADTKQLLINA
VDSVGRLSQAADQYLSEARGPLHTDLQALQCPLKELGKASPYLIGALKLI
LTQPFDIDTVPKIFRGDYINISLTLDLTYSAVDNAFLTGTGLSGALRALE
QSYGRDPETMIPDVRYTPNPNDAPGGPLVERGDRNC
41409705NP_962541.1 hypothetical protein MAP3607 [Mycobacterium avium subsp. paratuberculosMSTIFDIRNIRLPKLSRTSVILGSLVIVLALVVGYVGWRLYEKLTNNTVV
AYFPAANALYPGDKVQIMGLRVGAIDKIEPSGDKMKVTFHYQNKYRVPAN
ASAVILNPTLVASRAIQLEPPYKGGPVLADNAVIPEERTQVPVEWDQLRN
SITNIISKLGPTAEQPKGPFGEVIESFADGLAGKGKQFNTTLTNLSRALT
ALNEGRGDFFAVVRSLALFVNALHQDDQQFVALNQNLADFTTRLAHSDGD
LANAIEQFDSLLTTVRPWLDKNRGVLTYDVKNLETATNALLQPDPLNGLE
TALHVLPTAAANINQIYHPSHGSVVAIPSITNFANPMQFICSAIQAGSRL
GYQESAELCAQYLAPILDAIKFNYPPFGLNLFSTAETLPKEVAYSEPRLQ
PPNGYKDTTVPGIWVPDTPTSHRNTQPGWIVAPGMQGQQVGPITAGLMTP
DSLEELMGGPNIAPVQSNLQTPPGPPNAYDENPILPPMGLNAPVPIPPPP
PGPGVAPGPVAPTPAPVSAPAPNAGGPAAPADFGGGQ
41409704NP_962540.1 hypothetical protein MAP3606 [Mycobacterium avium subsp. paratuberculosMRTLEPPNRVRIGLMGIVVTVLVIGVGQSFTSVPMLFAKPSYYGQFTDSG
GINTGDKVRIAGMDVGKVEGLKIDGDHIVVKFSIGTNTIGTESRLAIKTD
TILGKKILDVEARGSQQLRPGSTLPLGQSTTPYQIYDAFFDVTKAAQGWD
IETVKQSLHVLSQTIDQTYPHLSSALDGVAKFSDTIGKRDEQVKHLLAQA
NQVASVLGDRSDQIDRLLVNTKTLLAAFNERGQAINALLGNIAAFSEQVK
GLINDNPNLNHVLEQLRTVSDILVQRKDDLANGLTEVGKFLPSLNEAIAS
GPFFKVVLHNLALYQISQPWVDAAFKKRGIDPEDFWRSAGLPAYRFPDPN
GTRFPNGAPPPAPPVLEGTPDHPGPAVPPGSPCSYTPAADGLPRPDNPLP
CAGAVTGPFGGPGFPAPVDVMTSPPNPAGLPPTPGIPIAGRPGDAPPDVP
GTPVPLPTQAPPGARTENLAPAGPVPPPSTFAPGAAAGSAGTPRAGQPVA
GAVHQPRRDRRQRRSGGR
41409703NP_962539.1 hypothetical protein MAP3605 [Mycobacterium avium subsp. paratuberculosMKITGTLVRLSIFSVVLLIFTVMIIVVFGQMRFDRTNGYSAEFSNISGLR
AGQFVRASGVEVGKVSSVQLVDGGKRARVEFNVDRSVPLYQSTTAQIRYL
DLIGNRYLELKRGQGEGADKVLPPGGFIPLSRTQPALDLDALIGGFKPLF
RALDPQKVNTIATALVTVFQGQGGTINDILDQTAQLTSQLGERDQAIGEV
IKNLNTVLDTTVRHRQQFDQTINNLEVLITGLKDHGDQLAGGTAHISNAA
GTVADLLAEDRSLLHKTLNYLDAVQQPLIDQQDQLQDYLKKVPTALNMIG
RAIGSYGDFVNFYACDITLKINGLQAGGPVRTVRLFQQPTGRCTPQ
41409702NP_962538.1 Mce1_2 [Mycobacterium avium subsp. paratuberculosis K-10]MARPVQTNAPRTPPYKLAGLAILVVGALALALIYGQFRGNFTPKTSLTML
ASRAGLVMDPGSKVTYNGVEIGRVGTISETVRDGKPAAKFTLEVYPRYLK
LIPSNVNADIKATTVFGGKYVSLTTPANPSPQKITPHTIIDARSVTTEIN
TLFQTITSIAEKVDPVKLNLTLSAAAQSLSGLGEKFGQSVVNANALLDDV
NPRMPQARKDIQGLAALGDTYADASPDLFDFLNNAVITSRTINAQQKDLD
QALLSAAGFGNTGADLFNKGGPYLARGAHDLVPTAQLLDTYSPEIYCLMR
NEHDALPATGAAEGGFNGYSLNMNTEALSGLGLIANPVSAVPVIASMVGG
IVGVVGGAPNPYIYPENLPRVNARGGPGGAPGCWQPITHDLWPAPELVID
SGNSLAPYNHLDTGSPYAIEYVWGRQVGDNTINP
41409701NP_962537.1 hypothetical protein MAP3603 [Mycobacterium avium subsp. paratuberculosMGVALAHIPHALSHYRKETLRLIAQIGMGTGAMAVIGGTVAIVGFVTLSG
SSLVAIQGFASLGNIGVEAFTGFFAALINVRIAAPVVTGIAMAATVGAGA
TAELGAMRISEEIDALEVMGIKSISFLATTRIMAGLVVIIPLYALAMIMS
FLSPQITTTVLYGQSNGTYEHYFRTFLRPDDVFWSFLEAIIITAVVMITH
CFYGYNAGGGPVGVGEAVGRSMRFSLVSVQVVVLAAALALYGVNPNFALT
V
41409700NP_962536.1 hypothetical protein MAP3602 [Mycobacterium avium subsp. paratuberculosMTSTSTSRRGPYLVGYLRDQLETPLTLVGGFFRMCVLTGKALFRWPFQWR
EFVLQCWFIMRVAFLPTIMVSIPLTVLLIFTLNVLLAQFGAADLSGAGAA
IGAVTQLGPLTTVLVVAGAGSTAICADLGARTIREEIDAMEVLGIDPIHR
LVVPRVIAATLVATLLNGLVITVGLVGGYLFGVYLQNVSGGAYLATLTTI
TGLPEVVIATVKAAVFGLIAGLVGCFRGLTVRGGSKGLGTAVNETVVLCV
VALYAVNVVLTTIGVRFGTGH
41409699NP_962535.1 acyl-CoA synthetase [Mycobacterium avium subsp. paratuberculosis K-10]MMVLMLNRPEFMESVLAINMLGAIAVPLNFRLTAAEIAFLVQDCQARVVI
TEAVLAPVATGVRDIESLLDTVVVAGGSSDDTVLGYEDLIDETGAAHQPV
DIPNDAAALIMYTSGTTGRPKGAVLTHTNLTGQTMTGLYTNGADINNDVG
FIGVPFFHIAGIGNMLTGLLLGIPTVIYPLGAFEPGQLLDVLAAEKVTGI
FLVPAQWQAVCAEQRARPRDLKLRVISWGAAPAPDALLREMSAMFPGTQI
LAAFGQTEMSPVTCMLLGEDAIRKRGSVGKVIPTVAARVVDENMNDVPVG
EVGEIVYRAPTLMSGYWNNPEATAEAFAGGWFHSGDLVRMDEDGYVWVVD
RKKDMIISGGENIYCAEVENVLASHPDIVEVAVIGRAHEKWGEVPIAVAA
VANDNLALEDLDEFLTERLARYKHPKALEIVDALPRNPAGKVLKTELRIR
YGGG
41409698NP_962534.1 hypothetical protein MAP3600 [Mycobacterium avium subsp. paratuberculosMTAQLAHHPTQANEQPYLSRRQNWVNQLERHALMQPNATALRFLGKGLTW
GELHGRVRALADALSRRGSASATG
41409697NP_962533.1 hypothetical protein MAP3599c [Mycobacterium avium subsp. paratuberculoMLCGSHYGVDGLLTSPRRHRSKRKPRPAKPLKALASPVNAPMSMQPRSRR
RPLRRAQLSDEVAGHLRAAIMSGALRPGTFIRLDETAAELGVSVTPVREA
LLKLRGEGMVQLEPHRGHVVLPLTRQDIEDIFWLQATIAKELAAAATDHI
TDTEIDELDRINDALAAAVGSGDAETIAGLEFGFHRVFNQASGRIKLAWF
LLNAARYMPVLVYAADPQWGRAAVDNHRQLIAALRRRDTAAVIEHTVWQF
TDAAARLTEMRDRTGTPSNRG
41409696NP_962532.1 hypothetical protein MAP3598 [Mycobacterium avium subsp. paratuberculosMPRYASRMPVLSKTVEVNTDAAAIMAIVADFERYPEWSDGVTGCWVLARY
DDGRPSQLRLDAAYQGFEGVYIQAVYYPGPNQIQTVMQQGELFKKQEQLF
SVVEMGASSLLTVDIDVEPSMPVPAPMVKSMLNNVLDHLADNLKQRAEQL
AAN
41409695NP_962531.1 hypothetical protein MAP3597 [Mycobacterium avium subsp. paratuberculosMASAPVVPPAPEGLTSNDFPVLWPVGTRWADNDMFGHLNNAVYYQLFDTA
INAWINTSTGLDPLTTPALGIVAESGCRYLSELHFPEGLQVGLAVTRLGR
SSVTYRLGVFRSAAPGSAEPITALGHWVHVYVDRDTRKPVPIPDPIRTLL
AGAAVGDAAPK
41409694NP_962530.1 AdhE [Mycobacterium avium subsp. paratuberculosis K-10]MLQRIGAPRPYARSRPITITDVELAPPGRDEVLVRIEAAGICHSDLSVVD
GNRVRPVPMLLGHEAAGIVERVGPGVADLAVGARVVLVFLPRCGRCAACA
TEGLTPCEPGSAANGAGTLLGGDIRLSRAGRPVYHHLGVSGFATHAVVNR
ASAVEVPPDVPAEVAALLGCAVLTGGGAVFNVGRPAPGQTVAVVGLGGVG
MAALLTALTYDGVPVVAVDQLPEKLAAARRLGAHQAYTPQQAVEARVKAA
VVIEAVGHPAALQTAIDLTAPGGRTITVGLPPPDARITLSPLGFVAEGRS
LIGSYLGSAVPSRDIPRFVELWRAGRLPVESLVSSTIRLEDINEAMDHLA
DGTAVRQLIRFDA
41409693NP_962529.1 hypothetical protein MAP3595 [Mycobacterium avium subsp. paratuberculosMTALDGAERLDPALRAVATTRTDFSPAAIELTRAPFNERRRLAAAQTDTA
GVRIVDDDANGVGVRIYRGGPEPAPAVIYCHAGGFALGNLDTDHRQCVEL
ARRGRCTVVSVDYRLAPEHPYPAALQDAGTVLRWVHAEAAALGVDPARLA
VAGSSAGAALAACLAHPDGSLPAVVFQLLHQPVLDDRATGSKARFRTSPA
FDGEAAELMWRYYLGPTVGSAAAVPARRPELAGLPPALITCAEIDPFRDE
AIDYARRLLDAGVCTELHVFARACHGFDSLLPDWPGSQRLFALQGEVLSA
ALHRD
41409692NP_962528.1 hypothetical protein MAP3594 [Mycobacterium avium subsp. paratuberculosMSELSIGIIGAGPGGLALGILLSQAGFGDFTIFDREDGVGGTWRINTYPG
LACDVKSHLYSYSFDLNAHWSRLWSGQPEILDYFQRCADKYGLGPHLRLG
TEIRSAHWDADTQRWRLTTASGHRHHFDVVVSAVGLFTRPLLPELVEEEP
FTGTVMHSARWDHSIPLHGKRIAVLGTGSTASQLIPELAKVAERVYSVQR
SPTWILPKPDRPYTQWERWAFAHLPLAKKLYRTRLWLRSESNISVIEHGS
EKTGQFTNIALGLLEASVPDEELRRKLTPDHPMGCKRLVFSSDYLPALTR
PNVEVLTSPARSLRRRSLVTEDGTEREVDLVVCATGYAAADYLGELDVTG
ERGVTLREVWRDGAYAYLGMAVPGFPNFFMLYGPNTNVGSNSVIFVLEAQ
ARYIVRALKYLRRHRRRYIAVRPAALADFVAKIDRWMVGTVWTTQCSNYF
RAPNGRVVTQWPRSARAFWSMTRRFRPADYRFQAPAMRVPAPASEADAR
41409691NP_962527.1 hypothetical protein MAP3593 [Mycobacterium avium subsp. paratuberculosMTGGSAQPPRVALVTGAAGGQGRAIAERLRGNGYAVAACDRRIDELAATV
AASGDDRLIAVELDVTSEQQWRSAVERVVDRFGALSALVNCAGVLHRTPL
PQETADAFENAWRVNCFGAFLGMRAALERLRGTPGASIVNICSTGAIHPF
PQHCAYGSSKWALRGLTQTAAAELAPAGIRVNAVFPGPIATPMLDQATQT
RLAAAASFGRIGQPREVADAVAFLVSAEASFITGAELIVDGGQCLQIR
41409690NP_962526.1 hypothetical protein MAP3592 [Mycobacterium avium subsp. paratuberculosMLRRIEHLPIGTVVRLPNADAAPIGRVADAGADAVIIAMIESPDQAAAAV
AATRYPPAGVRSFGPLRASLGHDPAAHESRVSVFAMIETAAALSGITQIC
AVDGLTGIYVGPADLAISLGAGVIGATRQPEVLDAIVHIHKAATKAGLVT
GIHAGDGSTGHAMAQLGFDMITLAAEAQALRRGAAEHLREATQ
41409689NP_962525.1 hypothetical protein MAP3591 [Mycobacterium avium subsp. paratuberculosMWCYRIVAPYRFEPTTIDDKTPECLADGQVLLRFSAAGVCGSDLPAFRGA
RGRLPGDDGRSGPEKDGFPIHEIAGEVIASRHPAHRPGDRVVGWASGFDG
LMERVVSDGDGLAPYDPALSPAQAVELQPLACVLYACEQLGELAGKHVAI
IGQGSIGLLFSYVAKAAGARRVTGVDPIDRRDVARAFGVDDPVRATSDRW
VSQLDPADRADVVIETVGHQVATLAHAIDAAAPGGTVFYFGVADDDTYPI
SMRTMLRNNLTLKSGVTLDRRRMLELAGKFAAEHPWLLGAYLTHTFGVDE
VQDAFELACRPVADRIKIAIAG
41409688NP_962524.1 hypothetical protein MAP3590 [Mycobacterium avium subsp. paratuberculosMDFAYDPFDAEVMANPLPYYRILRDHHPVYYMPQWDTFALSRFDDIWRVL
EVNNGTFVASEGTLPPASVLAQHNDGPVDDPPLHPLPFHAMFDADLYGEI
RRTHSRPFRPRAVTDLEGRIRTLANERLDELLARGSFDLTQEYGGVVVAT
IVCELLGIPTDLAPQVLAAVNAGSLAEPGVGVDTGQARPNYFEFLLPAVQ
RRRADPSGPPLEVVDGLLGYQLPDGSALDDLEVATQMLCIFIGGTETVPK
IVAHGLWELSRHPDQLAAVRADPQHNIPVAREEMIRYCAPAQWFARTVRK
PFDIHGQTPNPGQRVITLLASANRDEREYPDPDDFVWDRPIRRSLAFGRG
QHFCIGYHLARLEVAVLLQEWLRRVPDYAIRADAATRLPSSFQWGWNKIP
VEV
41409687NP_962523.1 hypothetical protein MAP3589 [Mycobacterium avium subsp. paratuberculosMKKYYRHTLLYLHETISLGSGRSDRFTEVFTDTYRPMMDQLGARLFAIWE
STPYNGHWPQVTIIWEVDGFADYARIGAAQARGGSHEAAAGKWSAFLADI
GASGEGRIMYPGPSNKTLAQLREANFTAPLVIQEIMQTKPGRQDDYIREL
ERLYVPWSERTGKRWLGSFTTTFRYNEVIHYWALDGGWDCFANHYPSWKE
SPPAEIVTWMSVAPALRDGWEDSILQALPPSPLQ
41409686NP_962522.1 hypothetical protein MAP3588 [Mycobacterium avium subsp. paratuberculosMQSAGGWLYDRAMAGWEVTVLLPHGCNTRSLRILGVRAADLDSGLAGLGQ
GAAGLAVSADAFTADARVRDTVLESLHNRLTAVALWGDGWPLGVSRATTR
TQHLLSGAARRFKGYALAAEGISDGGIAPAESLLCDVCSAADSELVRLD
41409685NP_962521.1 hypothetical protein MAP3587 [Mycobacterium avium subsp. paratuberculosMAGPVEGVTVVELGVWVAGPAAGGILADWGADVIKIEPPTGDPARMFGRM
LGCDLGLNPPFEMDNRSKRSVVLDLSSEPDRRAAFELLSGADVFLTNVRP
GALQRLGLDFASVSAANPRLVYGLITGYGASGPDADRAAFDVAAFWSRAG
VAHLLTRPGDTPPFQRGGMGDHSAGMTMAAAVCAALLARERTGAGQLVTT
SLYRQGAYTVSFDLNTYLMSGQPIAIGQRESMGNPCMNNYAASDGRRFWI
VGLEPERHWPALCRAVGRPEWRDDPRFADARARAANSVALIAALDEIFAT
RPLDEWAQIFANEPDFFWSPVNSLEDVVADEQFHAAGGIVYVPDGADDQA
AVPMVATPADFHGTPWAPRSAAPELGQHTAEVLAELKARRGS
41409684NP_962520.1 hypothetical protein MAP3586c [Mycobacterium avium subsp. paratuberculoMRAMGGRPMSLVAGRGPLSSDPAGRFSPPIPAEVVYVEPHPRRVQAVKDG
RSVIDTERALMVHRRGRPLSYVFPADEVAGLPGEPEPEAPGFVHVPWDAV
DTWWEEGRKLVHYPPNPYHRVDCRGTRRRLRVRVGGTTLVDTDHTTIVFE
TALPPRLYVDPAHVRTDLLRRSETTSYCNYKGFATYWSLVDGDRVVDDVG
WCYPDPPPESLPIKGFLSFDETRVELLAELPVSARS
41409683NP_962519.1 hypothetical protein MAP3585 [Mycobacterium avium subsp. paratuberculosMDFSRVELSAQDAAFQQSTRAFLAEHVTEEVRRRDRETGENFSEPVHVAL
GEAGYLESDWKLESEGGFDPVRRRIFQLEIGRAHTPWFHWGTTAVVARLV
KQFGAPELADAILPGVLSGKIRLCLGYTEPEGGSDVATCKTRAVRDGSGW
IINGSKMFTSNAQNAEYVFLLTNTDPQRPKHKNLTMFLVPLDSPGIEIQG
IRTVDGDRTNIVYYSDVRVDDLYRIGEVNGGWTVMRFALDAEHGLTDPQD
HGLQNISMLSEHGHLMAEAADRVAAILARPDAAGRRPIDDESVKYRLGRG
MARIEAAMSTPGMYGRVALIQTMREVSQELMDLLGTASALPTDTPGSPDD
GAIEFIFRHAVPAGIYGGTMEVFRNMIAQHELGLGRPSYGR
41409682NP_962518.1 hypothetical protein MAP3584 [Mycobacterium avium subsp. paratuberculosMHSHPYNRELVSGDGIAKVAAATEAAGIHGFGFTDHPAPSQRWLEAGGHD
ALDPFVALGFAAATTSTLRLIPNIVVLPYRNPFVVAKSGATLDLLSGGRF
TLAVGVGYLKREFAALGVSYDERAELFEEALRVIRAVWTGDDISFEGRHF
SARGITAHPRPVSSPHPPIWIGGNTAAARQRVADYGDGWCPFPAPPQLAR
TAGTAVIDSVAKLADGIADLRRRCDAAQRDWSTIDITFTNFEGGSPADDE
FNADAYLDGLDKLAKLGVTWVSVHLPGDSMAHALETLDRFRTLVVDAA
41409681NP_962517.1 hypothetical protein MAP3583 [Mycobacterium avium subsp. paratuberculosMESELSKVSQESTDWTVQGLLDLFEVRPDGQDRFTADTAGDIGAGGDERQ
VVEGTQVLAQAIVAVAKRFADKSVRSAHAVFSRAVAVGPPIELVLDVVAE
GRSTATAVVAVHQNGRRCLSITVLADVPTGDVIRHQLPRPDVAGPADANP
SPMPMVGRELRLVDVVDVNSPDEVGPPELYAWLHYDPIPTRDDLAKALLA
YFTGHLGISTTMRAHPGIGTAQAHLTVSTAPMSISVAFHEPVRWDGWLLY
SHESTQVGAGMSYVRGTVHTEQGELLASFAQEALIRPLRTSDTAIDSRAR
F
41409680NP_962516.1 hypothetical protein MAP3582c [Mycobacterium avium subsp. paratuberculoMGIVTTSSETAFTQSAETVYDFVTNPQNWTKTYPGSAHIGKRPELPLRVG
DTWEEAGPDGDRIFSWQLAAAVRPSLFVFTSIGRLGHDRDGNGGLPGRIT
VCYRFTRPGHDITLFSRTMTIEADKDAPLPDQLFVQANPARIDAYHEAVA
RELAALD
41409679NP_962515.1 hypothetical protein MAP3581c [Mycobacterium avium subsp. paratuberculoMTLCRCFVKRKVCRRHERMIPEPLVNGFCFGEGPRWFEGLLWFSDMLGEA
VHTTTMGGALTTLPLPGHCPSGLGFRPDGSLLIASTRDRRVLRYDGETVV
TVAELADIAPADLGDMVVDRAGRAYIGCQAFTGGAIIRLDPDDRATVVAD
DLDFPNGMAITPDGATLIVAESTGRRLSAFAIDDDGALSGRRVFADGLDG
PPDGIALDADGGVWAAMTLAHQFERIVAGGAVSDRIDIGDRVAIACALGG
PQRRTLFLLSSTDAYPQRLVGTRLSRLDAVTVTTPGAGLP
41409678NP_962514.1 hypothetical protein MAP3580c [Mycobacterium avium subsp. paratuberculoMTMTDAYYELIDSNASGERFRATDLARGTWSATIQHGGPVSALLTRALER
CEQRDDTRLSRVVIDLLGGVPVEGDLWVRAEVQRPGKQIELLGAQMLAPG
PDGAPRPVARASGWRLQHQDTGSLAHAAAPLPRPRAEAYDRNLKARDWDR
NYVHSLQWLWLTEPLSEGPGESWISPTVDLVKGESMTRLQRLFAVADCAN
GIGSKLDITKWTFLNTDLAVHVFRVPDGDWIGIRAETSYGPDGIGTTIGT
LFDEQGAVGAIQQSVLVRRRPGRA
41409677NP_962513.1 hypothetical protein MAP3579c [Mycobacterium avium subsp. paratuberculoMSHPVRATAIADTDTSTRQRILAATAEVLGRNGKTKLSLSDVATQAGVSR
PTLYRWFASKEELLSAFSAYERQIFESGLVKATAGLKGVDKLDAVLRFIV
DYQHSYSGVRMVDVEPEHTIAQFSWVIPQMREGLQRHLPGPNAAVKAATV
IRIAISHYIVRSDDADQFLAQLRHAVGIKAPTD
41409676NP_962512.1 hypothetical protein MAP3578 [Mycobacterium avium subsp. paratuberculosMLRALADTVGSTHVVTDPDVLAARSVDHTGRYRGRASALVRPGSAEQLAE
VLRVCRDAGAHVTVQGGRTSLVAGTVPEHDDVLLSTERLHRIADVDTVER
RIEVGAGATLAAVQQAASAANLVFGVDLAARDSATVGGMASTNAGGLHTV
RYGNMGEQVLGIQVALPDGALLRRRSRVRRDNTGYDLPALFVGAEGTLGV
ITELDLRLHPTPTHTVTAICGFADLDAVVAAGRTFRDVDGIAALELIDGR
VAALTREHRGVPAPVDADWLLLVELAADHDQTERLAGLLDDAPLSGEPAV
GVDAVARQRLWQVREALAEVLGVYGPPLKVDVSLPLSSISEFERAAIDLV
HTHAPDALPVLFGHIGEGNLHLNVLHCAADREHALYEPMMDLIAASGGNV
SSEHGVGSRKRPYLGMSREPADIAAMRTVKAALDPTGYLNAAVLFD
41409675NP_962511.1 FabG3_2 [Mycobacterium avium subsp. paratuberculosis K-10]MGRVDGKVALISGGARGMGAEHARLLAAEGAKVVIGDILDDEGKAVADEI
GDSVRYVHLDVTQPDQWDAAVETAVGEFGKLNVLVNNAGTVALGPLKSFD
LAKWQKVIDVNLTGTFLGMRVAVEPMIAAGGGSIINISSIEGLRGAPMVH
PYVASKWGVRGLAKSAALELAPHNIRVNSVHPGFIRTPMTKHLPDDMVTV
PLGRPAESREVSTFVLFLASDESSYATGSEFVMDGGLVTDVPHKQF
41409674NP_962510.1 hypothetical protein MAP3576 [Mycobacterium avium subsp. paratuberculosMAIRVAHVGTGNVGGLALAELITNPRYELTGVCVSTPEKVGKDAGELCGV
GLDTGVVTGVAAVGDLDAVIAAKPECVVYCAMGDTRLPEAMADVMRILAA
GINVVGSSPGLLQYPWGVMPEKYIARVEDAARQGNSSIFISGVDPGFAND
LIPLALAGTCQRVEQVRCMEIHDYASYNGAEVMGYMGFGRPLDEIPMLLQ
PGVLSIAWGTAIRQLAAGLGIEVDEITESYQREPAPEDFDIAVGRVAKGT
LAVLQFEIRGMVNGHPAIVIEHVTRLRPDLRPDLPQPAAGDGSYRVEITG
EPSYAVDIVPSSRKGDHNHAAIAGAAGRIVNAIPAVIAAPPGIRTTLDLP
LVTGKGLYAPSTLVTT
41409673NP_962509.1 hypothetical protein MAP3575 [Mycobacterium avium subsp. paratuberculosMPADSSTPNGQTRREELLAVATKLFAARGYHGTRMDDVADVIGLNKATVY
HYYASKSLILYDIYQQAAERTLAAVHDDPSMTAREALYQYTVRLLDQIAA
NPEGAAVYFQEQPYITEWFTKEQVAAVREKETQVYEHVHGLIDRGIASGE
FYECDSHVLALGYIGMTLGAYRWLRPSGRRSAKEIAAEFSTALLRGLIRD
EEIRTTSPLGP
41409672NP_962508.1 hypothetical protein MAP3574 [Mycobacterium avium subsp. paratuberculosMNYLVIGLYIVSFALFIYGLMGLTGPKTAVRGNLIAAVGMAIAVAATLIK
IRHTDQWVLIIAGLVVGVVLGVPPARYTKMTAMPQLVAFFNGVGGGTVAL
IALSEFIETSGFSAFQHGESPTVHIVVVSLFAAIIGSISFWGSIIAFGKL
QEIISGAPIGFGKAQQPINLLLLAGAVAAAVVIGLHAHPGSGGVSLWWMI
GLLAAAGVLGLMVVLPIGGADMPVVISLLNAMTGLSAAAAGLALNNTAMI
VAGMIVGASGSILTNLMAKAMNRSIPAIVAGGFGGGGVAPGGGDGGDKHV
KSTSAADAAIQMAYANQVIVVPGYGLAVAQAQHAVKDMAALLEEKGVPVK
YAIHPVAGRMPGHMNVLLAEAEVDYDAMKDMDDINDEFARTDVAIVIGAN
DVTNPAARNEASSPIYGMPILNVDKAKSVIVLKRSMNSGFAGIDNPLFYA
EGTTMLFGDAKKSVTEVAEELKAL
41409671NP_962507.1 PntAB [Mycobacterium avium subsp. paratuberculosis K-10]MYDELLANLAILVLSGFVGFAVISKVPNTLHTPLMSGTNAIHGIVVLGAL
VVFGSVEHPSLAMQIILFVAVVFGTLNVIGGFIVTDRMLGMFKSKKPAKA
DEAAK
41409670NP_962506.1 PntAA [Mycobacterium avium subsp. paratuberculosis K-10]MTNAQANAVKVGVVAESGADERRVALVPKAVASLVGSGLAVVVESGAGER
ALLPDALYTEAGADIGDAWAADIVVKVAPPTADEVAKLHSGQTLIGFLAP
RNADNSIGALKQAGVQAFALEAIPRISRAQAMDALSSQGNVAGYKAVLLA
ASESTRFFPMLTTAAGTVKPASVLVLGVGVAGLQALATAKRLGARTSGYD
VRPEVADQVRSVGAQWLDLGIDAAGEGGYARELTEEERAQQQKALEEAIA
GFDVVITTALVPGRPAPRLVTAAAVESMKPGSVVVDLAGETGGNCELTEP
GKTVVKHDVTIAAPLNLPATMPEHASELYSKNITALLDLLIKDGKLAPDF
DDEVVAAACVTRESA
41409669NP_962505.1 hypothetical protein MAP3571 [Mycobacterium avium subsp. paratuberculosMQKVQAAEDAWNTRDPDHVSLAYTPDSRWRNRDEYIVGRDQIVAFLTRKW
QRELGYSLRKSLWDFHDNRIAVRFQYECRDRSGQWYRSYGNELWEFTESG
LMARREASINDVPIDESQRRYFGPRPASEHGREIPLW
41409668NP_962504.1 FadE2 [Mycobacterium avium subsp. paratuberculosis K-10]MDFAMSAKASDYHKRLTDFMTEHVFAAEAEYDKYRHEAGPHDHTVPPVVE
QLKVKAKQQGLWNLFLPAESGLTNLEYAPLAEITGWSLEIAPEALNCAAP
DTGNMETLHLFATEEQRKQWLEPLLAGEIRSAFSMTEPAVASSDARNIET
SIVRDGGDYVINGRKWWTSGAADPRCKILIVMGRTNPDAASHQQQSMVLV
PMDTPGVTVVRSTPVFGWQDQHGHCEIVYDNVRVPVTNLLGEEGSGFAIA
QARLGPGRIHHCMRALGGAERALALMVNRAQKRVAFGRPLAEQGVVRESI
AKSRNEIDQARLLCEKAAWTIDQHGNKAAHLLVSQIKAVAPKVACDVIDR
AIQVHGAAGVSDDTVLARLYGWHRAMRIFDGPDEVHMRTIARAELGREKS
ALAAAVTAHA
41409667NP_962503.1 hypothetical protein MAP3569c [Mycobacterium avium subsp. paratuberculoMPEALRELSGAWNFRDVADGAPMLRPGRLFRSGELSGLDDEGRATLRRLG
ITDVADLRAAREVARRGPGRVPDGVEVHLLPFPDLGEHEAGTDDQAPHEH
AFQRLLTGDGGRAVGGVRRRGRHPLHDRRIPAIPNA
41409666NP_962502.1 hypothetical protein MAP3568c [Mycobacterium avium subsp. paratuberculoMIDEYRQFPTRNGAQRALHRVISLLGAGRAVLTHCFAGKDRTGFVVATVL
EAIGVDRDVIVADFLRSNDAAPALRAQISAMIAQRQDTELTPEVVTWTEA
RLSDGVLGVREEYLAAARQTIDEKFGSLQAYLRDAGVGEADVQRLRAALL
A
41409665NP_962501.1 hypothetical protein MAP3567 [Mycobacterium avium subsp. paratuberculosMPGVQDRVIVVTGAGGGLGREYALTLAREGASVVVNDLGGARDGTGAGHN
MADQVVKEIKDAGGRAVANYDSVAEPAGAENIIKTALDEFGAVHGVVSNA
GILRDGTFHKMLFENWDAVLKVHLYGGYNVIRAAWPHFREQSYGRVVVAT
STSGLFGNFGQTNYGAAKLGLVGLINSLALEGAKYNIHANAIAPIAATRM
TEDILPKEVLAKLTPEYVAPVVAYLCTEENPNSASVFVVGGGKVQRVALF
QNAGVTYDKPPTVQDVAARWDEITDLSAAKQADFKLG
41409664NP_962500.1 hypothetical protein MAP3566 [Mycobacterium avium subsp. paratuberculosMSGRRAARLCSGRTMMTTESVASKTTTSANGTASADIAGTVARLRQTFAT
GRTRDVEWRKRQLLQLQKLMEENEAAIAAALAEDLDRGPFEAYIADIATT
AGEAKYAAKRVRKWTRRRYQLLELPQLPGRGWVEYEPYGTVLIIGAWNYP
FYLTLGPAVGAIAAGNAVILKPSEIAAASSRVMAELVPKYLDNDAIAVIE
GDGATSQELIAQGLDRVMFTGGTEIGRKVYEGAAPHLTPCTLELGGKSPV
IVAADADVEVAAKRIAWMKLLNAGQTCVAPDYVLADAKIRDELVDKIGAA
ITKFTADKPEGMRVVNQRQFDRISSYLSGSDGKVTVGGACDPSTLRIQPA
VVVDPDPDGPLMRNEIFGPVLPVITVQNLDEAIRFVNSRPKPLSAYLFTK
TRETRERVIKEVPAGGMLINHLAFQVSTAKLPFGGVGASGMGAYHGRYGF
EEFSHRKSVLTKPTRPDLSSFIYPPYTERAFKMARKMF
41409663NP_962499.1 hypothetical protein MAP3565 [Mycobacterium avium subsp. paratuberculosMGSAGTGHPRRWVLLKGRLVASVASAFVMAVTGVGWTGYHTALGRIIISH
ALPNGAMSLGDNQNILLMGLDSRLDQNGRPLPPEIYDALHAGDESSGGYN
ANVLIIVHLSDGDGPVTAVSIPRDDYAELPGCPGSVCAGKIKQAYGLAYQ
QSLNAQAAGNSGAGATDLAAREQTAREAGRKAEIGAVTDFLGISVDHFVE
VTLGAFFQIAKAVEPITVCLAGDTRDSYSGADFHQGVQRIDAAEAMAFVR
QRRDENDGSFTDFDRTRRQQAFLVSLVEAARSGGALSSVSGLRKLLQVAR
DNVAVDAGLDLMQFAARASQLAGRPLSLYTLPISGFGKDPNGSDINLVDL
PTIRRIVNERFMSDAPAALDAAVPGSQPPPAPAEPAVLDVVNATTHDGLA
AALEEALAGRGFTRGSATTAPTQAEDSSIEYGPGAEAAARLLADQLHLPA
TAQSAVAPGTVRLTVGTAFPAADYLAHPGASGSGQVSTVSATGTGDHAPA
PTDLSQMTATSVPCVK
41409662NP_962498.1 hypothetical protein MAP3564 [Mycobacterium avium subsp. paratuberculosMSSLRTHDDTWDIKSSVGTTAVMVAAARAVETEQPDPLIRDPYAKLLVTN
SGAGVLWEAMLDPDIAARVEALDEESAAHLHHMRGYQAVRTHFFDTYFAD
AVAAGIRQIVILASGLDSRAYRLDWPAGTTVYEIDQPQVLAYKSTTLAEN
GVTPSADRREVAVDLRQDWPAALRAAGFDPTQRTAWLAEGLLMYLPAEAQ
DRLFTLIGELSPAGSRVAAETAPNHADERRQQMRERFKKVADEIGFEQTV
DVGELMYRDDHRADVTEWLNAHGWRATAEHSTAAMRRLGRWIENVPLADD
KDAFSDFVVAERR
41409661NP_962497.1 hypothetical protein MAP3563 [Mycobacterium avium subsp. paratuberculosMTDLDSSLPPSVRTAGDSWTITELVGATALGVAAARAAETAGPDPLIRDE
FAGLLVSSASPAWARLADPELSWLDDDPHGKRAHRVGIDYQAVRTHYFDE
YFDGALRAGIRQVVILAAGLDSRAYRLNWPAGTTVYEIDQPKVLEYKTET
LQRHGATPAAVRRPVPVDLRDDWPAALTAAGFQAARPTAWLAEGLLPYLP
SDAQDRLFEMVTALSAAGSQVAVEVFGMNSRSNAQRWLRMRERLGLDVNV
AALTYHEPDRSDAAAWLARHGWRVHSVDNRDEMARLGRPVPEDLSDEAVR
STLLRAHLGGSTG
41409660NP_962496.1 hypothetical protein MAP3562 [Mycobacterium avium subsp. paratuberculosMRMLPRGNRRPGRPPAAKADETRQRIIQAARLVFSERGYDGATFQAIAAR
ADLTRPAINHYFASKRALYQEVMDETNEFVIGVGIKEADRETTLVGRLTA
FISAAVKANAENPAGSAFIFGGVLESQRHPEWNTAENDSVRIAREFLIRV
VNDAIEHGEVAADIDASALVETLLVVMCGVGLYAGYVETYQEMLAVTGML
RQLLEGALWRPGS
41409659NP_962495.1 hypothetical protein MAP3561 [Mycobacterium avium subsp. paratuberculosMPAVTANTLTLPRVGGPGPADTERPVRSITTGPRGYEGEGFPVVRAFAGV
STAALDPFVHMDQLGEVDYQPGEPRGTDWHPHRGFETVTYLLDGKFAHQD
SYGGGGLITDGATQWMTAGSGILHIETPPAELVDSGGLFHGIQLWVNLPR
KDKFTPPRYQAIEGGDVALLASDDGGALLRIIAGEVDGHHGPGVTHTPIT
LAHATIANGARLNLPWRRDFNALVYVLSGDGYVGPVAHPIRPGQLAVLGQ
GDRITVGAREVQDSGPDRGAIDVLLLGGRPIREPVFHYGPFVMNTRTELI
EALQDYQAGKFGSIPPNALMPHRRDGTL
41409658NP_962494.1 hypothetical protein MAP3560 [Mycobacterium avium subsp. paratuberculosMSEFTIPGLTDKQAARLTELLQKQLSTYNDLHLTLKHIHWNVVGPNFIGV
HEMIDPQVEAVRGFADDVAERIAALGASPQGTPGAIIKDRSWDDYSVGRD
TVQAHLAALDLVYNGVIEDIRQYIDETDELDQVTQDLLIGQAAQLEKFQW
FVRAHLESAGGQLAHKGKSTERAAAQSARGKS
41409657NP_962493.1 hypothetical protein MAP3559 [Mycobacterium avium subsp. paratuberculosMTWHAVHGQSGQIGEHRVKSSARTVVFPGAVSFGHTLAPLRRGLGDPCFL
APGDGSIWRTSLLPSGPVTARISRAGTNAVQCVAWGAGAAQFVDMLPAML
GSEDDASDFVPRHPTVAAAQRRVPHLRLGRTGLVLEALIPAIIEQRVPGA
DAFRSWRVLVSKYGTPAPGPAPERMRVPPSAQAWRSIPSWEFHRANVDPR
RAQTVVTCARRAASLERLVSRPAAQARAALTSLPGVGEWTAAETAQRAFG
DADAVSVGDYHIPKMVGWTLLGRPVDDAGMLELLEPMRPHRQRVVRLLEA
SGLAREPRRGPRLPVQQIHSL
41409656NP_962492.1 hypothetical protein MAP3558c [Mycobacterium avium subsp. paratuberculoMTPFDDPQGELAWMFLQSTTEGGDLDEGFALLSDDFSYWTLYTRAACDKD
TLRRAIERRKQDLELTIDLVRCVNEGETVVVEAQAAGTTSAGVEYDSPFV
CIFDTRDGLIVSMRVYSDTRAVDNAMPGWIGY
41409655NP_962491.1 hypothetical protein MAP3557 [Mycobacterium avium subsp. paratuberculosMAHPEIKEPSAGHPITIEPTRGRVQVRVNGELIADSSAALELREATLPAV
QYIPFTDVAQDRLTRTDTSTYCPFKGEASYYSVTTSAGDTVDDVIWTYEQ
PYPAVAAIAGHAAFYPDKAEISISTD
41409654NP_962490.1 hypothetical protein MAP3556 [Mycobacterium avium subsp. paratuberculosMSGKPKLVIGANGFLGSHVTRQLVADGAQVRAMVRAGANTRGIDDLSLTR
FHGDVFDTAVLSEAMDGVDDVYYCVVDTRAWLRDTSPLFRTNVEGLRNVL
DVAVTQPELRKFIFTSTYATVGRRRGHVATEDDVIGTRGLSDYVKSRVQA
ENLVMRYVAEAGLPAVAMCVSTTYGSGDWGRTPHGAFIAGAVFGKLPFTM
EGIQLEVVGVTDAAKAMVLAADRGRVGERYLISERMIALKEVVRIAADEA
GVPPPRRSISVPTLYALGALGDLRARLTGKDAELSLASVRMMRAEAPVDH
SKAVRELGWQPRPVEESIREAARFWAAMRNAKGKSVTPR
41409653NP_962489.1 hypothetical protein MAP3555 [Mycobacterium avium subsp. paratuberculosMSSPQFSRSELVDAFANFEATVDAAAQSHDWDAWVEHYTPDVEYVEHAAG
TMHGRDEVRQWIKRTMTTYPGSHMVAFPSLWSVVDEERGRIICELDNPMK
DPGDGSVITATNISIITYAGDGLWSRQEDVYNPLRFLRAAMKWCRKAQAL
GTLDDAAAQWMRQNGGAQ
41409652NP_962488.1 methionine sulfoxide reductase A [Mycobacterium avium subsp. paratubercMTNTQKAILAGGCFWGMQELIRKQPGVVSTRVGYTGGDVPNATYRNHGTH
AEAVEIIYDPAVTDYRQILEFFFQIHDPTTKDRQGNDRGPSYRSAIFYTD
DEQKRIALDTIADVEASGLWPGKVVTEVSPAGDFWEAEPEHQDYLQRYPN
GYTCHYIRPGWKLPRRATSGS
41409651NP_962487.1 hypothetical protein MAP3553 [Mycobacterium avium subsp. paratuberculosMHERSSHRPAGRGPPASRGPSPKLLQGIGFAVSRRTMMRRLSRRYGNVFT
LRLPMWGPVVMVSDPQLAKQIFTTTPDELGNIQPNLSRLFGSGSVFGLEG
DDHRRRRRLLAPPFHGKSMKNYESIIEEETLRETAGWPEGESFPTLPPMM
RITLNAILRAVFGAEGAELDELRRLIPPWVTLGSRLAALPKPQRYPRFGP
WGQLDRWRRHYDGVIERLIAAEQADPNFAERTDVLALLLRSTYDDGAAMS
HKEIGDELLTLLAAGHETTASTLAWAFERISRHPELLARLVEEADNGGNE
LRQATILEVQRARTVIDFAGRHVYPDVYRLGEWVIPRGYSIIVGIAQIHD
NPDVFPDPRRFDPQRFIDNKPSALSWIPFGGGTRRCVGAAFANMEMDVVL
RTVLRHFTIETTDAPDEPWHCRGVAFTPKHGGRIVVHRR
41409650NP_962486.1 hypothetical protein MAP3552c [Mycobacterium avium subsp. paratuberculoMTATDGEPDLGEIDPFRLRLLDGLATSIGERGYRASTVADVVRCARTSKR
TFYDHFAGKEECFLELLAVDIEKLGAKIAASVDPEADWHVQIRQAVEAYV
GYIEARPAITLSWIRELPSLGAAARPVQRRGLQLLTSLLIDLSASPGFRR
AQLPPLTAPLAVILLGGLRELTALAVEDGKPVRGIVEPAVDASVALLGPR
H
41409649NP_962485.1 hypothetical protein MAP3551c [Mycobacterium avium subsp. paratuberculoMRLSTRNQLRGTITEVELGTVMAVVKVTLDGGDQVVTSSVTRDAATDLGL
EVGKPATVFIKSTEVTIGVD
41409648NP_962484.1 EphF [Mycobacterium avium subsp. paratuberculosis K-10]MVTMPELDGVEHRYVDLGDDVTIHVADAGPASGPAVMLVHGFPQNWWEWR
ALIGPLAADGYRVLCPDLRGAGWSSAPRSSYRKDEMADDLAGVLDRLGVR
SVDLVAHDWGGPVAFIMMLRHPEKVTGFFGVNTSAPFVKRSLSTIRNVWR
FWYQIPISLPVIGPRVISTPDSRFVRLLGSWVGGGYTLPEEDVRLYLECM
RQPGHAEAGSRWYRSFQTREMLSWMRGEYDGARVHVPVRWLSGTEDPVLT
PDLLDGYAERIDDFQLELVDGVGHWIVDQRPDLVLDRVRAFLRRET
41409647NP_962483.1 hypothetical protein MAP3549 [Mycobacterium avium subsp. paratuberculosMAAMAPQCPLDADALHAQASADTGLHDFGPDDYRERLAVYLTALREIDGL
HAAGTVNFYGQLLQILKNRLLLTDLLKRHPEIHDIELHSPVVIAGLPRTG
TTHLHNLLAAPPTFRTMPYWESVEPFPMPNEVGVQPDPRRTRMDVAVGVI
NTVMPHFALMHEMTTDHVHEEIQLLANDVSTMLLETLAEVPRWRAYYQAH
DQTPHYEYLATQLRAMQFLRGGRRWLLKSPQHLEQVPVLDRVFPDSIVVF
THRDPVPVALSMIAMITYSARMHRSPVPVRQIAESWIDRLGQMLAALVRD
RDVIGPDRSIDIRFDDFMADELGVAERVYALADEPFTDDARAAVADYLAG
HRRGRLGNVETSFEMFGLDEESLRERFAPYVERFLA
41409646NP_962482.1 hypothetical protein MAP3548c [Mycobacterium avium subsp. paratuberculoMSRICWPSALNCGSARSSRRTVTPTYVTLSFVMVVDFGRPRDPRIDAAVL
RATVELLAETGYPGLLVSAIAQRAGTSKPAIYRRWPSKAHLVHEAVFPVG
ADTAIPDTGSTADDLREMVRRTMVFLTTPAARAALPGLIGEMAADPSLHS
ALLERFAGAIGGGLADWLAAAAARGEARPDVTAAELAETIAGVTLVALLT
RPTELDDAWVDRTTRLLLKGISA
41409645NP_962481.1 hypothetical protein MAP3547c [Mycobacterium avium subsp. paratuberculoMTHESTAAWRELLAALGELDRSFLEGDRAVSDDRHIADGYRMLATTLGVA
FDTYLFPEPDRPQFVAVNTPFRRDRRWGGDNTDAYYFICPVDPKRRYRIS
GNKGDSVYFSVTAYNEPSLGAWSDRVVAIVRDSDLDVDADGNFSFEFPPT
PDAAVLMTRDYQADPLTGRPVTWRIEALDEPAPIRHGDAETAARLRAVAT
WLRTMFAIVPLAVGNRVDDQHALGHETAHAANAFADPYQVPDANFGWSAR
DACYSYGSFVLDDDEALVITHRPPSCRFWNMVVWNQFMATYGAAEGPDAR
CSINGHSAVANSDGTVTIVLSRDRTPHPNSVTTLGYPRGNLAFRWFLADG
VPARPEVELVKAADAPTAVR
41409644NP_962480.1 DesA3_2 [Mycobacterium avium subsp. paratuberculosis K-10]MTHNKITLTPEQAEEFGRELDALKERVMADLGEKDADYIRRVIKAQRALE
VGGRALLFLPPAWLLGTTMLGLSKILDNMEIGHNVMHGQYDWMRDPAISG
RSFEWDTACPADQWRHSHNYMHHTHTNIVGMDRDIGYGILRMSEDQPWQP
YFLGNPLYAFLLMVLFQYGVALHELETERIRSGEIRLADKREVLREIWQK
TRRQTLKDYVAFPLLAGPFAPFVFTGNLAANLIRNVWSYMIIFCGHFPDG
TQEFTVEETQDESRGMWYFRQILGSANLTGGKLFHLLSGNLSHQIEHHLF
PDMPARRYAEIAPEVQAICQRYGVAYNRGPLLRQFGTVVRKIVKLSFPDA
WVPGAAKPADREPVAA
41409643NP_962479.1 hypothetical protein MAP3545 [Mycobacterium avium subsp. paratuberculosMFTQTVQASGRVLARTVRQRVLGSELLDLLTGPHGVDRYTELVAPTWTLG
EARAKVTDVRRTTPRSVTLTLEPNDTFLSSHTVTAGQYVNLTVEIDGRRH
TRCYSPANREGTATLELTIGRHDGGLVSNHLYDHARRGMVVGLAGVGGDF
VLPTPRPRRVLFVSGGSGITPVMAMVRTLVSQRHRGEIAFIHYAPTPAEA
CYREELAALPSVRVLHGYTRSAGGDLSGRFGPDHLAAAMPAPDAVFVCGP
TSLVDAVREHCDNVYTESFTPPVLEAPADPSGGRVTFSDSGVDVVDDGRS
LLEQAEAAGLSPQNGCRMGICHTCTRRKTAGTVRNLVTGAVSTAPDEDVQ
ICVSVPVGDVDLSL
41409642NP_962478.1 hypothetical protein MAP3544c [Mycobacterium avium subsp. paratuberculoMNIRTPLLRPGRAVKGLLPVCGRVHIVNSRTPSSRVRGSGRERSRESQSR
EERKEATRRAIIAAALKLLQDRSFSSLSLREVTREVGIVPAAFYRHFESM
ESLGLVLIDESFRSLRDTLRDARAGKLDPNRVIESSVEILVASVADRREH
WRLIARERNSGLSVLRYAIRTEIRLITSELATDLARFPGLHEWTTEDLNV
LATLFVNAMIVIAEAIEDSQSAEAREDIRRLAVKQLRMIATGIAGWHSTP
41409641NP_962477.1 hypothetical protein MAP3543 [Mycobacterium avium subsp. paratuberculosMSDNPRGDELVDPADLPEEGGPGDTLNASEGTDSDEVRNDDGDIVVDPPE
GWSEADRFGVTAGEEREGESLDDRLAAEEPDVPDAIEPVDDLPRRAHRGQ
VDGTPEDGDSLYDVVDE
41409640NP_962476.1 hypothetical protein MAP3542 [Mycobacterium avium subsp. paratuberculosMTPQVRPADRADIRALSATLARAFYDDPVMVWLFPDRRKRIARLSRVFAT
MTRHHHLAGGGVEVACAGAGIGAAALWDPPHRWRETPRAQLAMTPTYLRV
FGLRSMRGRAVQELMKSVHPEEPHWYLAVIGSDPGVRGQGFGQALMRSRL
DRCDAEHCPAYLESTKPENVPYYQRFGFTVTREIVLPDGGPSMWAMWRPP
R
41409639NP_962475.1 hypothetical protein MAP3541c [Mycobacterium avium subsp. paratuberculoMCVRPAVAGMPTGVTGISRRTLGRLAVGAGVLASAVQACAKPGAGHGRSG
APPAPAGKGVGFVLSHEQFRTDRLVAQAQAAERAGFTHVWASDHIQPWQD
NEGHSMFPWLTLALVGSSTSHVSFGTGVTCPTYRYHPATVAQAFASLAIL
NPGRVFLGVGTGERLNEQATTNGYGNYTERHERLAEAIALIRQLWSGSRI
SFSGRYFQTNSLKLYDVPATPPPIFVAAGGPKSAKLAGQFGDGWITQSGD
VTNPKLLAAFGAGAQAAGRDVATLGKRAEMFAVVGDDAVAARAATLWRFT
AGAVDQPDPVDIQRAAESNPTDKVLGGWTVGTDAGRHVEAAQRVLDAGAV
PFLHFPQDDPMVAIDFYRDNVLPKLR
41409638NP_962474.1 hypothetical protein MAP3540c [Mycobacterium avium subsp. paratuberculoMDAVDPDSRHQLAVRMAELVRGMAAPRRLDQVLAEVTAAAVEVIPGADIA
GVLLVRKGGEFETLADTDSLAARLDVLQHDFGEGPCAQAALQETIVRSDD
LRREPRWPRYAPAAVQLGVLSSLSFKLYTADRTAGALNLFSHRPDAWDTE
AETIGSVFAAHAAAAILAGSRAEQLYSAVSTRDRIGQAKGIIMERFGVDD
VRAFDLLRRLSQESQVKLVEIAQQIIDTRGQGA
41409637NP_962473.1 FadE1_3 [Mycobacterium avium subsp. paratuberculosis K-10]MASSTSPARRGAGEWLATVWDFETDPEYQAKLDWVEKFMAEELEPLDLVA
LDPYDKKNAEMMAILRPLQQQVKDQGLWAAHLRPELGGQGFGQVKLALLN
EILGRSRWAPSVFGCQAPDSGNAEILALFGTDEQKARYLQPLLDGEITSC
YSMTEPQGGSDPGQFVTAATRDGDYWVINGEKWFSTNAKHASFFIVMAVT
NPEARTYDKMSLFIVPAETPGIEIVRNVGVGAESSSRASHGYVRYTDVRV
PADHVLGGEGQAFMIAQTRLGGGRIHHAMRTIALARSAFDMMCERAVSRK
TRHGRLADFQMTQEKIADSWIQIEQFRLLVLRTAWLIDKHHDYQKVRRDI
AAVKVAMPQVLHDVAQRALHLHGALGVSDEMPFVKMLVAAESLGIADGAT
ELHKMTVARRTLREYEPVSTPFPSAHIPTRRAEAQARLAERLEHAVAEF
41409636NP_962472.1 hypothetical protein MAP3538 [Mycobacterium avium subsp. paratuberculosMRTFESVADLAAAAGETLGHSDWVTITQEDVNLFADATGDHQWIHVDPER
AASGPFGTTIAHGFMTLALLPRLQHQIYTVNGIKLAINYGLNKVRFPAPV
PVGSRVRAQSSLVGVDDLGNGAVQATVSTTVEIDGSAKPACVAESIVRYI
S
41409635NP_962471.1 BpoC_1 [Mycobacterium avium subsp. paratuberculosis K-10]MPDVIAHHGLLKDTRLHVDDTGGPGRPVLLMHPWPLSGQSWSAQVPVLHA
AGYRVVTYDRRGFGRSDKPLTGYSYSQLTQDLHTLVESLDLRDLTLVGSS
MGGGEVARYLSTYGPERVRSVVFASSVTPYLLQTTDNPDGPLTMKDAARA
TASFVKDQDAFYDHQMTEFFSANGQLRVSRATRAEALRLCKQAGKEASLA
CMAAWANTDFRPDLTRVSVPALIIHGEGDESVPLAGSARRTHRAIPGSRL
CVIADGPHGCHISHAQEFNAALLDFLAA
41409634NP_962470.1 hypothetical protein MAP3536 [Mycobacterium avium subsp. paratuberculosMTSKLSTTLHTSFPDAVDRITKALADQGFGVLTTIDVKATLKQKLGADME
DYLILGACNPALAHRALGIDRQIGQLLPCNVVVRSDPAEGDAVLVEAMDP
QLMVKVTGEAGALQEVADQATAKLQAAISALAG
41409633NP_962469.1 hypothetical protein MAP3535 [Mycobacterium avium subsp. paratuberculosMAIDSGRTRKADAARHDPGDIDVVLTRLRRAHGQLGGVIAMIEQGRSCKD
VVTQLAAVSKALDRAGFKIIASGLRDCITRTEQQPPLSIDELEKLFLSLA
41409632NP_962468.1 hypothetical protein MAP3534c [Mycobacterium avium subsp. paratuberculoMVYAAALVRVTAPGTHNGRVRLLLIADTHIPGRARDLPAQVWDEVAGADV
VIHAGDWTAPEFFDELDGRAARLVACWGNNDGPALRARLPERADVTLAGV
RFTVVHETGAAAGREARMSRRYPDSQVLVFGHSHIPWDTTTRTGLRLLNP
GSPTDRRRQPFCTYLTACAADGAVSDVVLHRLTK
41409631NP_962467.1 hypothetical protein MAP3533c [Mycobacterium avium subsp. paratuberculoMAGRAAARDLGQRRGRRARPGAQHRLDPGHQAGVGRIPAARRRGHRPPGV
PAAAHRVRAADRRRVPGRPAGIAVRGGRRTRRRPNRGSDKRIGGPRHDDP
KTAGAATMTGPLPVAIDAKHLTYRYGQFTAVDDVTLQVRPGETMGLLGPN
GAGKTTMVRMLTTLAPVQQGELHIFGLDARRRTTDIRANIGYVPQQLSVE
PALTGRQNVAWFARLYGVPGAERAQRVDQALAAMDLLDVADRLASAYSGG
MIRRLEVAQALVNRPSLLVLDEPTVGLDPIARDGVWEHVQKMQARFAMTV
LLTTHYMEEADALCDRVALMHRGALRAVGAPDELKARISRVSPHATLEDV
FRHYAASDLGGDDAAHPRPSGSIRQVRSSRKVARRVG
41409630NP_962466.1 hypothetical protein MAP3532c [Mycobacterium avium subsp. paratuberculoMSVDNAAAATLVRAPRGWQRVGALSSRIGAFAIVEMQKLQHDRTELVTRM
VQPALWLLVFGTTFSHLHMINTGSVSYLAFLAPGIIAQSALFISIFYGIQ
IIWDRDAGVLAKFMVTPAPASALVTGKAFAAGVRSLAQVVGVLALAYLMR
IGLTVNPLRILAAMGIVMLGAAFFACLSMTLAGLVRNRDRLMGIGQAITM
PLFFASNALYPVELMPTWLHVLSKINPLSYEVNALRAEQDQPAQLRGQRA
AGAADRHTLQPGRHRGAGGGGGDRNPHGLNTSAPPGRLGLLVPLAHAPSR
RKIAARFRESIVTRP
41409629NP_962465.1 FbpC2 [Mycobacterium avium subsp. paratuberculosis K-10]MSFIEKVRKLRGAAATMPRRLAIAAVGASLLSGVAVAAGGSPVAGAFSKP
GLPVEYLEVPSPSMGRNIKVQFQGGGPHAVYLLDGLRAQDDYNGWDINTP
AFEEFYQSGLSVIMPVGGQSSFYSNWYQPSSGNGQNYTYKWETFLTQEMP
LWMQSNKQVSPAGNAAVGLSMSGGSALILAAYYPQQFPYAASLSGFLNPS
EGWWPTLIGLAMNDSGGYNANSMWGPSTDPAWKRNDPMVQIPRLVANNTR
IWVYCGNGTPSDLGGDNVPAKFLEGLTLRTNEQFQNNYAAAGGRNGVFNF
PANGTHSWPYWNQQLMAMKPDMQQVLLSGNITAAPAQPAQPAQPAQPAQP
AT
41409628NP_962464.1 hypothetical protein MAP3530 [Mycobacterium avium subsp. paratuberculosMPSEINNSETRLSWVLAVLAGVLGATAFTHSAGYFVTFMTGNAQRAMLGY
FRGDVVLSVTAGVLIVCFVAGVVIASVCRRHFWVDHPHGPTVLTTFSLVA
ATLVDVIDEGWEENLLDFAPIMLVTFGIGALNTSFVKDGEVSVPLSYVTG
TLVKMGQGIERHIAGGTAADWLGYFLLFASFVVGATVGGFISLFVNGTSM
LVAATVMCALTTGYTYFHSDRRALLDEA
41409627NP_962463.1 hypothetical protein MAP3529 [Mycobacterium avium subsp. paratuberculosMTEPAKLPWSDWLPQQRWYAGRNRRLTGAEPSVIVGLRDDLDLVLVDADY
ADGSRDRYQVLVRWDAAPVSEYSTVATIGAADDRTGFDALYDDEAPQFLL
SLIDSSAVRSASGAEVRFAKEPDAQLPLEAMAHVSDAEQSNTSVIFDRDA
IFKVFRRVSSGINPDIELNRVLGRAGNPHVARLLGTYEMAGADGTPETAW
PLGMVTEFAANAAEGWAMATASVRDLFAEGDLYAHEVGGDFAGESYRLGE
AVASVHATLAETLGTSQAAFPVDNVLARLSSTAALVPELTEYAATIEERF
AKLATETITVQRVHGDLHLGQVLRTPESWLLIDFEGEPGQPLEERRAPDS
PLRDVAGVLRSFEYAAYGPLVEQGAQNTDKQLAARAREWVERNRTAFCDG
YAAASGIDPRDSAPLLAAYELDKAVYEAGYEARHRPGWLPIPLRSIARLT
TA
41409626NP_962462.1 hypothetical protein MAP3528 [Mycobacterium avium subsp. paratuberculosMNDAREAVEHHPEEGSHVQDGVVEHPEAEDFDNAAALPTDPTWFKHAVFY
EVLVRAFFDANADGAGDLRGLLAQLDYLQWLGIDCIWLPPFYDSPLRDGG
YDIRDFYKVLPEFGTVEDFVALLNAAHERGIRVITDLVMNHTSESHPWFQ
ESRHDPDGPYGDFYVWSDTSDRYADARIIFVDTEESNWTFDPVRRQFYWH
RFFSHQPDLNYDNPAVQEAMIDVIRFWLGLGIDGFRLDAVPYLFEREGTN
CENLPETHAFLKRVRKVVDDEFPGRVLLAEANQWPADVVEYFGDPSTGGD
ECHMAFHFPLMPRIFMAVRRESRFPISEILAQTPQIPEMAQWGIFLRNHD
ELTLEMVTDEERDYMYAEYAKDPRMKANVGIRRRLAPLLDNDRNQIELFT
ALLLSLPGSPVLYYGDEIGMGDVIWLGDRDGVRTPMQWTPDRNAGFSKAN
PGRLYLPPSQDPVYGYQAVNVEAQRDTSTSLLNFTRTMLAVRRRHEAFAI
GTFEELGGSNPSVLAFVRQVSNDGDTVLCVNNLSRFPQPIELNLQHWSGC
IPVELTGHVEFPRIGHLPYLLTLPGHGFYWFQLTACEEDT
41409625NP_962461.1 PepA [Mycobacterium avium subsp. paratuberculosis K-10]MSKSHHHRSVWWSWLVGVLTVVGLGLGLGSGVGLAPASAAPSGLALDRFA
DRPLAPIDPSAMVGQVGPQVVNIDTKFGYNNAVGAGTGIVIDPNGVVLTN
NHVISGATEISAFDVGNGQTYAVDVVGYDRTQDIAVLQLRGAAGLPTATI
GGEATVGEPIVALGNVGGQGGTPNAVAGKVVALNQSVSATDTLTGAQENL
GGLIQADAPIKPGDSGGPMVNSAGQVIGVDTAATDSYKMSGGQGFAIPIG
RAMAVANQIRSGAGSNTVHIGPTAFLGLGVTDNNGNGARVQRVVNTGPAA
AAGIAPGDVITGVDTVPINGATSMTEVLVPHHPGDTIAVHFRSVDGGERT
ANITLAEGPPA
41409624NP_962460.1 hypothetical protein MAP3526c [Mycobacterium avium subsp. paratuberculoMGEFDARARFGRASVARLATVSPGGQPHLVPVVFALAQGPDADHDADPDV
VYTAVDAKPKTTRRLRRLANIDANPQVSLLADHYADDWTRLWWVRADGLA
TIHRDGPALDTGYRLLRAKYPQYQSVPLDGPVIAIAVRRWSGWAP
41409623NP_962459.1 elongation factor G [Mycobacterium avium subsp. paratuberculosis K-10]MADKTTTSQGAGNAPTAKSPGEIRNVVLVGPSGGGKTTLVEALLVAAGVL
NRPGSVADGSTVCDYDEAEIRQQRSVGVAVASLSHDGVKVNLVDTPGYAD
FVGELRAGLRAADCALFVIAANEGVDEPTKLLWQECNQVGMPRAVVITKL
DHARANYAEALAAAQNAFGDKVLPLYLPTGLPACTGLIGLLSQQRYAYAD
GKRAVRPPDPADAAQIEAARGTLIEGIIEESEDESLMERYLGGESIDETV
LIADLERAVARGSFFPVIPVCSSTGVGTLELLEVATRGFPSPMEHPLPEV
FTQVGAPRAGLACDPDGPLLAEVVKTTSDPYVGRVSLVRVFSGTIRPDAT
VHVSGHFASFFGTGNGNGHAHPDHDEDERIGVLSFPLGKQQRPASAVVAG
DICAIGKLSRAETGDTLSDKSEPLVLKPWTMPEPLLPVAIAAHAKTDEDK
LSVGLGRLAAEDPTLRIEQNQETHQIVLWCMGESHAGVVLDALANRYGVT
VDTVELRLPLRETFAGKAKGHGRHVKQSGGHGQYAVCDIEVEPLPEGSGF
EFVDKVVGGAVPRQFIPSVEKGVRAQMEKGVHAGYPVVDIRVTLLDGKAH
SVDSSDFAFQMAGALALREAAAATKVVLLEPIDEISVLVPDDFVGAVMGD
LSGRRGRVLGTDTAGHERTVVKAEVPQVELTRYAIDLRSLAHGAASFTRS
FARYEPMPESAAARVATAAV
41409622NP_962458.1 acyl-CoA synthetase [Mycobacterium avium subsp. paratuberculosis K-10]MAMTSEATPSATAAGPRLADLVEAAAQRAPRAPALLVASERNPIAYADLV
RLVDDLAARLRAAGLGPGDRVGLRAGSNPEFVVALLAASRADLVVAPLDP
ALPAADQLSRSRAVGARAVLVDRLGEGQTAPESAPCWPVTVTVGPDDGAP
TVDLTVTAAPTHDVTAPQGLRDDDAMIMFTGGTTGAPKMVPWTRHNIAAS
IRSIVAGYGLGPRDATVAVMPLYHGHGLLAALLATLASGGAVLLPARGKF
SAHTFWDDIAAVGATWYTAVPTIHQILLERARTEAPRGTHALRFIRSCSA
PLTAETAQALQDTFGAPVVCAFGMTEATHQVSTTAIDGAGHSENPGATPG
LVGRSTGPDIRIAGPDGQSLPADTVGEVWLRGATVVRGYLGDPAITAANF
TDGWLHTGDLGTLSAAGDLVIRGRIKELINRGGEKISPERVEGVLAGHPD
VLEAAVFGRPDQLYGETVAAVIVTRGSAAPTADELASFCRERLAPFEVPA
EFRRAAELPHTAKGSLDRRAVAEQFGESA
41409621NP_962457.1 oxalyl-CoA decarboxylase [Mycobacterium avium subsp. paratuberculosis KMAGQYPHPHGRSRHMSATSASAGPAPESARLIDGFHLVVQALRANDVATI
YGIVGIPITDLARVAQASGIRYLGFRQEASAGNAAAAAGFLTRRPGVCLT
TSGPGFLNALPALANATTNCFPMIQISGSSDRALVDLRRGDYQDLDQLDA
ARPFAKAAYRINRVDDIGRGVARAVRTAVSGRPGGVYLDIPGDVLGQAMD
ASAAAGTLWRVVDPAPRQLPAPEAVDRALDVLADARRPLIVLGKGAAYAQ
ADNEIRRFVESTGIPFLPMSMAKGLLPDAHPQSVAAARSLAIGRADAVLL
VGARLNWLLGHGESPQWSAGVKFVQVDIEPSEFDSNQQIAAPLAGDIGSV
MSALCDALAARPITVPARWTEELAERRAHNDAKMRERLAEDPHPMRFYNA
LGAIRAVLQDNRDVYVVNEGANALDLARNVVDMELPRHRLDTGTWGVMGI
GMGFAIGAAVETGRPVVAIEGDSAFGFSGMEIETICRYRLPVTVVILNNG
GVYRGDEAPHGDDPAPTVLSARARHELIAEAFGGKGYHVSTAAELRAALT
EAIGSGGPSLIDCELDPTAGVESGHLANRNPASAASPAAVSAGA
41409620NP_962456.1 OxyS_1 [Mycobacterium avium subsp. paratuberculosis K-10]MRVLFRQLEYFVAVASERHFARAAEKCFVSQPALSAAIAKLEKELNVTLI
NRGHSFEGLTPEGERLVVWARRILAEHDAFKAEVDAVRSGVTGTLRLGTV
PTASTTASLLLSAFCSAHPLVKVQILSRLSAGELYRRLREFELDAAIAHT
APDDIPDVNLVPLYRERYVLLAPADLLASGAATMTWVQAAQLPLALLTPD
MRDRQIIDRAFADHGITLHPQVETDSVASLFAQASAGSWASIVPHTWLWA
SPLGAGIRAVELVDPVLTADVVLATKSHGPGSPIARALAASAGRLQLNDF
FDAQLLGVTRRR
41409619NP_962455.1 hypothetical protein MAP3521 [Mycobacterium avium subsp. paratuberculosMLSADHRFQQTMTVRLGRRGRVPITGWVQSRRGVGMAGEDHYTRPCADSA
ALVLIDVQRDFYADDAPMRVEGTSAALGAMAELARPFRRRELPIVHVVRL
YRADGSNADPVRRRFIEDGARVAVPGSPGSQIAPELLPKAVELDHQLLLS
GGFQQIGPAEHVMYKPRWGAFYGTKLVQHLRESGTDTLVFAGCNFPNCPR
TSIYEASERDFRIVLVADAISGLYDRGAQECRAIGVAVRDTAQTLDWLGG
41409618NP_962454.1 hypothetical protein MAP3520c [Mycobacterium avium subsp. paratuberculoMRRAGRYLFVMVAITVMALVAPVGRGGASVPLPQPVPGIASILPANGAVV
GVAHPIVVTFTAPAADRAAVERSIHVVSPAGVRGHFEWADDNTVVRFVPN
RYWPAHGHVSVGVQALTTGFDTGDALLGVASISKHTFTVSRNGEVLRTMP
ASMGKPSRPTPIGNFTALEKQRSVVMDSRTIGIPLSSPEGYKITAQYAVR
VTWSGVYVHSAPWSVDSQGYANVSHGYINLSPDNAAWYFNEVNVGDPIQV
VA
41409617NP_962453.1 hypothetical protein MAP3519 [Mycobacterium avium subsp. paratuberculosMGEGSCVQAARIGIAGCAAVVIAAAGCGGGGKGSSPGSGSPTPPSSSGAV
TGPPPGQPSDYGYLLIKPSDVGGGLSAPQSPMLNPNNAPGAAQLFANADS
SRRLWDTIVIAADAPAATAELAATKSSYAGKVNGDWRPVAVGANGTTISG
GSSDNTQAMTVLLFTEGRALVTLEFDSAPNDPIDPAVAVDIARKQDAAIR
TGLPG
41409616NP_962452.1 hypothetical protein MAP3518c [Mycobacterium avium subsp. paratuberculoMPNSRPVGSAAARLCWRRRAFDGEGNGMTAAAARAVRFDRYGGREVLYVA
DIEMPAPGPGEVVVEVRAAGINPGEAAIRVGALHERFPATFPSGEGSDLA
GVVTAVGPGVTEFAVGDEVLGFSLRRSSHATHTAVPVGQLIRKPPELSWE
VAGSLYVVGVTAYAAVRAVAPQPGETVAVSAAAGGVGSLVTQLLVLRRAR
VLGIAGPGNADWLRAHGVVPIAYGDGLADRLREAAPDGIDAFIDLFGPQY
VQLAVDLGVPPERIDTIISFEKAAEVGAKTEGSAEASTPEVLAEMADLIV
SGALEFDIAATYPLDRVADAFAELEQRHTHGKIVLLPTDSQ
41409615NP_962451.1 hypothetical protein MAP3517 [Mycobacterium avium subsp. paratuberculosMTSMHTRGRRTPGAAVQSSAVSDAAHVGDIVGAFGRIRRDGGGADGAAGG
RWRRLRTLAVITGPGLIVMVGDNDAGGVATYAQAGQNYGMGLLWTLVLLI
PVLYVNQEMVLRLGAVARVGHARLIFERFGRFWGAFSVGDLLILNALTIV
TEFIGVALALGFLGCPKIVAVPAAAALLFAVVAGGSFRRWERLMFLLIAV
NVLIFPMVMLVHPAPKATVAGLIPQFPGGLNSTVLLLVVAIVGTTVAPWQ
LFFQQSNVVDKRITARWIPYGRADLVIGIVVVMVGATALMAVTAFGLAGT
AAAGHFTDAGAVAAGLSAHLGRTVGVLFAIILLDASLIGANAVGLATSYA
VGDAMGKRHSLHWKITEAPLFYGGYAVLLAVSAAVSFSPDHILGLVTQGV
QALAGVLLPSATVFLVLLCNDRAVLGPWVNTVRQNIAAWTIVWCLVLLSL
ALTATTFFPDLSTGTIEAGLAAGAVLGVVAGAVMIVVGRRQRDLAEAEAI
VRTLGGGLDPEQVDELDDASSLTRAERRAVRRQDRENWQTPSLALLDRPA
MSPMRRAGLFTLRGYLVVAVVFVIIKLVQAGVVGPAGSL
41409614NP_962450.1 hypothetical protein MAP3516 [Mycobacterium avium subsp. paratuberculosMAFVVTHRFPTVSRRRGWSMLRAGRLLANKFHQRTAMTPQERANLYVSRM
PIAVITASLGGHPSGSADQHR
41409613NP_962449.1 hypothetical protein MAP3515c [Mycobacterium avium subsp. paratuberculoMYSESKNQMSLLRERRGTFDQPMTAQQRADAMSEFYIPVTPEAGRLLYSL
VRATRPATVVEFGMSFGISAVHLAAAVRDNGSGRVVTTELSETKIAAAKK
TFAETGLDDVITILQGDALTTLADLPGPVDFVLLDGWKDLYLPVLELLEP
RLSPGVLVVADNTSAADTQPYLDRVRNPDNGYVSFNFQVRDSDSMEISCR
TSG
41409612NP_962448.1 hypothetical protein MAP3514 [Mycobacterium avium subsp. paratuberculosMTADTEPGGSHPAPARGTRPRWVAPVRRVGRLAIWDRPERRSGIPALDGL
RAIAVALVLIGHGGIPGVSGGFIGVDVFFVLSGFLITSLLLDELGRTGRI
ELTGFWIRRARRLLPALVLMVLTVAAARQLLPERSLTGLRDDAIAAFLWM
ANWRFVAQKTDYFTQGAPPSPLQHTWSLGVEEQYYFVWPLLLIAVALALA
ARARRRCTRATVGGVRFSAFVIATVGALASASVAIAMATDGTRDRIYFGT
DTRAQALLVGAAAAALLVSDWPSMNRGWCLLRTRWARRVARILPVLGLAG
LAAATHCASGASGEFRHGLLIGVAIAAVAVIAPVAVEQRGVVARVLALPP
LVWLGTISYGVYLWHWPIFLALNGERTGWAGMLLFAARCAATVAVAAASW
WLLEQPIRRWRPARVPLLPLAAATVASAAAVTLLVVPVGTGPGLREAGLP
PGVSAVAAVSPSPPGNSRPRDPNRPFTVSVFGDSIGWTWMHYLPPTPGFA
FLDHTVIGCSLVRGTPYRYIGETLEQRPECDGWPIRWSRQVSQDQPDVAL
LIIGRWETVDRVNEGQWTHIGDPTFDAYLNGELERALNIVGSTGVRVVVA
TVPYSRGGEKPDGRLYPEDQPDRVNLWNTMLRKTVAHHPNVAILDLNKKL
CPDGVYTAKVDGIKVRSDGVHLTPEGVKWLTPWLEESLR
41409611NP_962447.1 hypothetical protein MAP3513 [Mycobacterium avium subsp. paratuberculosMREYLKFYIDGQWVDPVRPNTFDVENPATEQVCGKISLGSAADVDVAVGA
ARRAFGRWSQSSREDRLDLLQAILAEYQKRADDLAAAVTEEIGAPPSLAA
GPQVFLGIGHLTTAIEVLKNFPFTEQRGATLIAREPIGVCGLITPWNWPI
NQVAVKVYPALATGCTVVLKPSEVAPFSSYIFAEILAAAGVPAGVFNLVN
GDGPGVGAALASHPDIDLVSFTGSTRAGVEVARNAAPTVKRVTQELGGKS
PNIVLDDGGFADAVRAGVANMMPNSGQSCNAPSRMLVPASRMAEAISIAR
EVAEQVQVGDPDDATAIGPVASRAQFEKVQRLIQQGIDEGATVVAGGPGR
PAGLDQGYYVKPTVFADVTNDMTIAREEIFGPVLCILGYDDLDHAVRLAN
DTDYGLAGYVSGADLDTAREVAGKIRAGWVTINHAFDLNAPFGGYKRSGN
GREWSDFGFHEYLEVKSILGYAPAQGDQ
41409610NP_962446.1 hypothetical protein MAP3512 [Mycobacterium avium subsp. paratuberculosMGVPVYQRILDLFQAEGVNTLFGIPDPNFVRMFLEAESRGWSVVSPHHEL
SAGFMAEAASRMTGKPGLCIGTLGPGMANIAGAIQCALVENSPVIFLGGQ
RARVTERRVRRGRIQFVRQEPLFAPSVKYSASIEYADQTDEIIHEALRRA
MSGTPGPAYIEYPSHVILSELDVPDPLPPHRYRLVNQTAGEREVAEAVRL
IRAAESPILLVGHGVHTSRTGAAVRELAELMACPVIQTSGGTSFIDGLQD
RTFAYGFSPAAVEAVVTSDLCLALGTELGEPSHYGRTRHWAQNDATRKWI
LVEQDPAAIGVNRPIDVPLVGDLRGVVPQLVAALRDTPRKPSPDLDRWIE
QDAAELAQLAENAPTGRTPIHPARFVVEATRAFPDDGIMVRDGGATVIFG
WTYSQAKPRDVIWNQNFGHLGTGLPYAVGASIAEGGKRPVMLLTSDSAFL
FHIAELETAARQGLPLVCVVGVDHQWGLEVGVYKRTFSQPSPQPGVHWSK
DVRLDKVAEGFGCHGEYVEKEDEIGPAIQRSYASGKPAVVHVCIDPKANS
EEMPKYDEFRTWYAEGTQ
41409609NP_962445.1 hypothetical protein MAP3511 [Mycobacterium avium subsp. paratuberculosMASPSGPMAGVRVIDLTAMVMGPYCTQIMADMGADVIKVEPPQGDNTRYI
SVGPAPGMSGVFVNVNRGKRSVVLDLQTDAGARALRGLVETADVFIHSMR
AKAIAKLGFGYDDVAAINPAVVYTNCYGYGRRGPDRDRPAYDDTIQADYV
GTIMADKIAGLTALYATTMALFHRERTGQGQEVEVAMFETMASFMLVEHA
NGALFDPPLGPAVYPRTVAPNRRPYRTSDGYIAALIYNDKHWNAFMNAVR
PPWASELYATLEQRAAQIDTVYGLVAETMKERSTAEWLKLFGELEIPAAP
LNSPGALFDDPHLNAVGMFQTVDTPHGPVRFPGVPTWFSQTPGRVAGPAP
ELGAHTDEVLAEIGASRRKSSRNAVPEADFASAREGKEL
41409608NP_962444.1 hypothetical protein MAP3510 [Mycobacterium avium subsp. paratuberculosMSETLAPPLRFDDRVAVVTGAGRGLGRAYAHLLAARGAKVVVNDVGGALD
GAGVDTGPAAQVVDEITAAGGDAVACTESVATPEGGRAIIETALARYGRL
DVLVHNAGNVRRASLKQMSYEDFDAVLDVHLRGAFHVLRPAFPVMCRAGY
GRIVLTSSIGGLYGNQGVANYAAAKAGVIGLSNVAALEGAAEGVRCNVIV
PAALTRMADGIDTSAYPPMGAELVAPVVGWLAHESCSVSGELFIALAGRV
ARAVIAESPGVCRPGWTVEDVGEHLDAIRYVEAPLIFPVVPDGHAEHIRY
SFELAQRANEQGALHG
41409607NP_962443.1 hypothetical protein MAP3509 [Mycobacterium avium subsp. paratuberculosMDTQQDGCGPTETPDDIDIDALRQKYAHEREKRLRKEGSKQYIELEDDFS
GYYEVDPYTPVTPREPIREDIDVAVLGGGFAGLLSAAHLKKAGVDDVRII
ELGGDFGGVWYWNRYPGIQCDNESYCYIPLLEELDFMPSKKFADGAEIYQ
HCRNIGKHFGLYDSAIFSTQVHDLRWDEQIKRWRVSTNRGDDIRARFVVL
ASGPFHRPKLPGIPGIKTFGGHSFHSSRWDYDYTGGDSGGNLHKLADKRV
GVVGTGATGIQIVPFLARYAQHLYVFQRTPSTVDARNNTPTDPEWVKTLR
PGWQRERQRNFHAWTFEGMAPGQPDLVCDFWTELGRNTAARVLALDDPAS
LTPEQFMAIREEEDYKIMERLRRRIDTLIDDPATAEALKPYYRFLCKRPC
SNDDYLPSFNRPNVTLVDVSASKGVERATEKGLVANGVEYELDCIIYASG
FEITTEISRRYSIETIAGRDGLSLFDYWRDGYKTLHGMTSRGFPNQFYTG
FTQVGISANIAANYELQGEHIAYIIAEALKRGAATVEPSDEAQQQWCTTI
RETAVDNSAFDAQCTPGYYNNEGGGGGEGIRSHLGEPYGPGFYAFEDLLR
AWRDKGDLEGLVLGS
41409606NP_962442.1 hypothetical protein MAP3508 [Mycobacterium avium subsp. paratuberculosMMTDVAKDANSAVAEELSTPMTIGVEAYISEDYARAERDKLWRKVWQQVG
RVEELPEVGSYLTYDILDDSIIVVRTGANEFRAHHNVCMHRGRRLIDTPE
GAKNALGRTRKSFVCGFHGWTYGLDGACTHIREQQDWRQALTPDNTHLRP
VRVDTWGGWLWINMDPDCEPLADYLFPAAKILEPFGLENMRYKWRKWLYF
DCNWKVALEAFNETYHVYTTHPEFNKFGEFKGWAKAQGRHSNIGYDAPED
MEATKSKIRLGIGADPRVSTAEMQVYTMEETNATTTQTLVNAAKRLVDEL
PEGTPADKVLEHWLASARRDDEARGVIWPTIPPDILGQAGTAWQIFPNFQ
IGQGLTSALCYGARPHPSYNPDKCIFEVSVFELYPKGEEPQTEWEYTPVG
DPRWRSVLPQDFSNMAAVQQGMKSLGFPGTKPNPYRERSTVNLHYQLSRY
MGTGAPRELSDKEHPLA
41409605NP_962441.1 hypothetical protein MAP3507 [Mycobacterium avium subsp. paratuberculosMDDDLLRLEGRVVVVSGAGGGGIGTTVTAMAARAGATVIAVSRSKENLDE
HIAPLAARGLAVLPVAADASTDEGIAAVIDQARRADGRLYGLVNVAGGAE
PSTWMPSTRVSRTDWRKIFADNLETAFFMSQAVAAELLARRLPGSIVSIS
SISGMNTAPFHIAYGTAKSAIAAMTRTMALELAQSAIRVNAVAPGVTETA
ASRTYVADDPDRDRRAIAMGRRGRPEEQAGAILFLLSELSSYVTGQTLLV
DGGLDLRWSHLGADNTSLFLHDESFRATIRRM
41409604NP_962440.1 hypothetical protein MAP3506c [Mycobacterium avium subsp. paratuberculoMIASSPTADGRIPARMSISRAISTQPSRYATPGSPVPAIDVAPGWRLDRV
TAPSRLFGANGLRTGPDGRIYIAQVTGSQISALDHHTGELETASPKGGDI
VAPDDVAFDAAGNLYATEVMDGRVSVRDTGGRTRVLRDDVPSANGITFHR
GRLFIGECREGGRLLEFDLAGGPPRVLLDNVPSPNAMEVGPDGLLYFPVM
GANEIWRVDPDGGEPQCVATGLGVPDSVKFDARGHIVSTQVASGQVLRID
PRSGEQRVLAQLNPGLDNCTFVGDRLFVSNFTGEITEISPDGTTRSVLPG
GLNWPLDLAVGHDGRLYVADGTYFYAALPDGALHTVGMLFSPGYPGFLRG
VAASGPDEFVVTTSGGQISRYRPEASESEVLADGFDQLYGIAPGPAGVVV
AELGTGRVLSLQRSGAVEVLAAGLREPVGVAIGHDGAALVAEAGAGRVVR
VDGSKVDTVMADLQRPQGILLHGGVLYVVDAGAKELIAFDPADKTRRTIA
SGLPVGPPPGVNPKPLKGMPPFSGPQGPFAGITAAADGTLYVSADGEGSV
LALRPTRDGH
41409603NP_962439.1 hypothetical protein MAP3505c [Mycobacterium avium subsp. paratuberculoMPQTISGDHRYLQIARALRKEIVDGVYPVGSQLPTEHQLCERFAVSRYTI
REALRRLREDNLVASRPRAGTRVVPRPASSSYAQDAMSIDDLLAFAAGAQ
LTIESNAMVTIDDELAARTGLEPGTQWLSVRGYRQADGASVPICRTEYYI
NRSFAAVGRLLQRHAGPIFPLIEDLFGVSVAQLHQEIAAVLLSPELADGL
GAEAGTAALQMRRTYTTSDGEVAQVTINTHLSPNFRYAMTMRRVTGQAG
41409602NP_962438.1 hypothetical protein MAP3504c [Mycobacterium avium subsp. paratuberculoMRSTLADAARAAAQRTPERIALVDNEVRLNCATLYAQAGELAAALLARIP
AGSVVSFMLPNWHEAAVIYLAATLAGMVVNPILPSLRDHDLRFILEDACA
AMVFVPHRYGGHDYPAMLDRVTAAMSAAPQVVVLRGPATGRTGRHTPYRC
MLGGPPGGLPALDPDAVRMILYTSGTTSRPKGVLHTHNSIHALICQIRDH
WAIDPGDTFLVPSPLAHIGGSIYAFECPLLLGTTAVLMDRWDPARAVALM
TAHRCTHMAGATPFLQQLLSAAANARTRLPDLKVFICGGASVSPSLIRRA
AAYFDRAVVTRVYGCTEVPVATVGAPRPQEADYAADTDGRPGIAEIKLAA
HPAAPTGDGEICVRGPQMLRGYRHPEDDAESFDAAGFFRTGDLGRWALAD
SAGRYLVVTGRAKDVIIRSGENISAKEVEDLLADHPGIAEIAVVGLPDER
TGERACAVIVPTPGASPDVAGLLALLVSKGVAKFKAPEQVVLWDALPKND
AGKVLKHRIRAALSKDG
41409601NP_962437.1 hypothetical protein MAP3503c [Mycobacterium avium subsp. paratuberculoMADMQVAIVTGASSGIGLGCATRLAGTGMAVLGTGRDPKRLAELETAIGD
PDRVATVAVDLTDDDAPRRIVDRALQRWGHIDFLINNAGVGSPKPLHETD
DDTLDYFLNLMLRAPFRLAREVLPHLPPGSAIINVTSTFAVVGGLRGGAY
SAAKGGLTALTTHIACQYGASGIRCNAVAPGVTVTPMVEKRLQDPRFRKI
NTEMTPHQRLGSVDDIAATVAFLCSPGGSFINGQTIVVDGGWSSTKYLSE
YALTSEWIAP
41409600NP_962436.1 AdhD [Mycobacterium avium subsp. paratuberculosis K-10]MKCRAAVIRGVGRDWEIAEIELDPPRSGEVLVRMAVAGICHSDDHLFTGD
VVPTPEVVAASGQPAPDWFPLLGGHEGAGVVAEVGPNVTSVRPGDHVALS
FIPACGSCRFCVNGQSYICDIGASLFQREMPTDGTCRRHLGAENLLAYGQ
LGTFAEYAVLSERSVIKIDEAIPFHAASLVSCGVSTGWGSATVSAGTEPG
DTVVVIGAGGVGMNALQGARAVGAKYVVAVDPVAAKRDSAKIFGATHTAA
SARDAIPLVREITAGLMADRVVVCPGVVHVDLIPLALALLRKGGVCVLTG
ITPFTEPPVPLVLQEMTLSAKQLRGALYGGMNPRTSVPMLLSLYQAGDLK
LDELVTRHYRLDEINEAFADLREGRNIRGVIDFASR
41409599NP_962435.1 hypothetical protein MAP3501 [Mycobacterium avium subsp. paratuberculosMSQPDALPMSWWVVGSEHTLSQQVPAPPAAVRDFYVDLDNLRLVHPLIVA
VQTLFRGQTPDGYLHRYRVTDRIPLGPLALRINYRAQLLVRADGVVLTEA
DQSPGVRLRGTVSFAPAAAGTRITERIRIAAPRPLAPMTVRQAVKAHTAM
LAGIRSHFANPVER
41409598NP_962434.1 hypothetical protein MAP3500c [Mycobacterium avium subsp. paratuberculoMRPVGSSLHCFPPRPAPRAALPQYFFLSGWPTVRSVESPDPAGTGVVERY
LQCLAAHDWDGLAGTIADDGLTREGPFRDVIEGKAEYLDYLRRVLTELPG
HRLEVQRVSHVDAGRCYVELTEAFDIDGATRRWPECILFERGGDGLISHI
SVFFKQGR
41409597NP_962433.1 hypothetical protein MAP3499c [Mycobacterium avium subsp. paratuberculoMVPVENLHSGDPITDCGQRYIVLESKTLNDCVVLELESRVDHQLQVIEKS
FPTGYHVGRANHRVL
41409596NP_962432.1 CtpI [Mycobacterium avium subsp. paratuberculosis K-10]MKIPGVSSVVAGVAGGAAQVVRAGVSTAAGAAGALQTLASPVAELAGPVI
QSMAQTTGRAIGLDGSADGAPAIVPPVRWHSGRRVHLDLDPLLPFPRWHE
YAPAVEEPVRRIPGVAKAHVEGSLGRLVVELADDADDAAVLDEVRSTVAS
VAADISWSKAEAAPPSAPFADPGNPLAILVPLTAAALDLVAMGAAVTGWV
TRLPAAPQTTRAAAALINHQPRMVSILEARLGRVGTDIALAATTAAAHGL
TQSFGTPLLDLTQRTLQISEAAAHRRVWRDREPQLASPDRPQAPVVPVIS
SAKSEVPRHSWAAAAAGEASHVVVGGTIDAAMDKAKGSMAGPVESYVDSA
ANGSLIAAVSALVAGGGTEDVAAAIEAGVPRAAHMGRQAFAAVLGRGLAN
SGQLVLDPGALRRLDRVKVVVIDGAALRGDHRAVLRVRGEAPGWDDDRVY
EVADALLHGEEAPEPDPDELPATGARLRWVPSQGPSAMPAQGLESADLIV
DGDRVGRVDVGWEVDPYAIPLFQTAHRTGARVVLRHVAGTEDLTASVGAT
HPPGTPLLNVVRELRADRGPVLLITALHRDFASTDTLAALAIADVGVALD
DPRAATAWTADIITGTDLADAVRILSAIPVARSASESAVHLAQGGTTLAG
LLLVTGEQEKGASPVSFRRWLNPVNAAAATALVAGTFSATRVLRLPDPTP
QPLTAWHALDPEIVYSRLAGGARPLAVETEPSWRRRLDDLSYSPALAPLR
APLQNVLRLASATRTELADPLTPILAVGAAASAIVGSNIDALLVAGVMTV
NAITGGAQRLRAESAAAELFAEQDQMVRRVVVPAVATTRRRLEAARHATR
TATVSAKSLRPGDVIDLAAPEVVPADARLLEAEDLEVDESLLTGESLPVD
KQVEPVAVNDPDRASMLFEGSTIVAGHARAIVVATGVGTAAHRAISAVAD
VETAAGVQARLRELTSKVLPLTLAGGAAVSTLALLRRASLRQAVADGVAI
AVAAVPEGLPLVATLSQLSAAQRLTARGALVRAPRTIEALGRVDTVCFDK
TGTLTENRLRVVCAVPDDVNPHDPFPELTAPQSAELVRAAARASARPQEG
QGHAHATDEAILTAASSLNGQRDSDWSMIAEVPFESSRGFAAAIGTVGNA
NGNPSDTPVLILKGAPEVILPRCRFADPEADQQRAEAVVRGLAEQGLRVL
AVAQRGWKHDTDDDDTDADAVDAAAHNLELLGYVGLADTARASARPLIEA
LLDAERDVVLITGDHPITARAIARQLGLPADARVVTGAELAGLDEDACAK
LVADVQVFARVSPEQKVQIVAALQRCGRVTAMVGDGANDAAAIRMADVGI
GVSGRGSSAARGAADIVLTDQDLSVLLDALVEGRSMWAGVRDAVTILVGG
NVGEVLFTIIGTAFGAGRAPVGTRQLLLVNLLTDMFPALAVAVTSQYVEP
DEAEYPSAADAEAARREHRRAVLTGPTPSLDAPLMRQIVTRGAVTAAGAT
AAWAIGRWTPGTERRTATMGLTALVTTQLAQTLLTRRHSPLVVATALGSA
GVLVGIVQTPVLSQFFGCTPLGPVAWTGVLGSTAGATAISALAPNWLAKQ
VAALEPGQQDA
41409595NP_962431.1 acyl-CoA synthetase [Mycobacterium avium subsp. paratuberculosis K-10]MSAERVAPTAARALVRSGLLNPPSPRAVLRLLREASRGGTNPYTLLAVTA
ARWPGRTAIIDDDGALSYRELQRATESLARRLIRDGVAPGRAVGVMCRNG
RGFVTAVFAVALLGADVVPISTEFRSDALAVALRAHHISTVVADNEFAER
IAGADDAVAVIDPATAGAEESGGRPAVAAPGRIVLLTSGTTGKPKGVPRA
PQLRSAVGVWVTILDRTRLRTGSRISVAMPMFHGLGLGMLMLTIALGGTV
LTHRHFDAEAALAQASLHRADAFTAVPVVLARILELPPRVRARNPLPQLR
VVMSSGDRLDPTLGQRFMDTYGNILYNGYGSTEVGIGALATPADLRDAPE
TVGKPVAGCPVRILDRNNRPVGPRVTGRIFVGGELAGTRYTDGGGKTVVD
GMTSTGDMGYLDNAGRLFIVGREDDMIISGGENVYPRAVENALAAHPAVA
DNAVIGVPDERFGHRLAAFVVLHPGSGVDAAQLRDYLKDRVSRFEQPRDI
NIVSSIPRNPTGKVLRKELPG
41409594NP_962430.1 hypothetical protein MAP3496 [Mycobacterium avium subsp. paratuberculosMVQAARTNAAAKVNAIAQALDKVLNTVADRVANPARVSDPDRLRGAVGGR
TVLVTGASYGIGEATARRLAAAGATVLVVARSEERLGELTAAINAGGGRA
VAYPTDLTDESAVSALTKQITEEHGPLDVVVSNAGKSLRRSLHHQYDRPH
DFQRTIDVNYLGPVRLLLGLLPAMRDNGRGHVVNVSSVGVRVVPGPQWGA
YQASKGAFDRWLRSVAPELHADGVHVSTVYFALVRTRMIAPTPVLGRLPG
LSPDQAADVIAKAVIERPRTLEPPWVLPAELASVLLAGPADRAARLWHRR
FFSDAEEAGRER
41409593NP_962429.1 hypothetical protein MAP3495c [Mycobacterium avium subsp. paratuberculoMSAGHNGDMLARHVIRSLGSALVMAASGVAASAVSGSVIPTAAAQCPDVQ
VVFARGTGEAPGVGPTGQAFVDALHQRVGGRSFDVYPVNYPATDQWDTGI
DGIRDAGAHVVSMAHDCPNTKMVLGGYSQGAAVMGFVTSPAVPDGIDPAT
VPKPLTPDVANHVSSVVLFGMPNVRAMNFLGEPPVVIGPLFQDKTLKVCA
TEDPVCSDGMNFAAHDTYADDGAMIDKGVSFASSHLGLGGPGAASVASGH
GNFGE
41409592NP_962428.1 hypothetical protein MAP3494 [Mycobacterium avium subsp. paratuberculosMTDENPCSAGDLLYLDALGPDGDYRTRNTETVTSTAGVAVARLSLVPPLY
VSRTLGAQRKAAPLPPADRRAALSRAAEVFTDGVIAGLDFEAYAGLAARI
SGLPVAITRAAARGVADGLAGAFDAVASARPAGAVPDWREPRVRGGGALW
VRRGEVFAVHAAGNGPGVHGLWPQALALGYRVAVRPSRREPLTGHRLVTA
LRQAGFRPHDAVYLPTDHAGADEIIASADLAMVYGGQRVVDKYAADPAVI
VNGPGRSKIVITAEQDWRECLDVVVDSVARHGGMACVNATAVLYEGDPAP
LAAAVAERLAAIEPLPADDERAMLPTLPLPRARTLANYLAAKAAGATTLL
GADQVVADLGGGQAALRPAVHVLTEPDPELLNLELPFPCVWVTGWSREGG
RAAALAPLRRSLVVTAITGDDTLIDALVAEPTIGSVYRGCPTWSTAPGVP
HDGYLADALMRTKGFIGD
41409591NP_962427.1 hypothetical protein MAP3493 [Mycobacterium avium subsp. paratuberculosMTGIDFSLLDVPRAAPVDDPEAYLRAVIAWHFGADTGSPFWLRTARTLSF
DPLTDVHTFDDLRRFPNLVNELRHVAVGDLIPRGYPAQDRPLIFESGGTT
GAPKRTVQMPDWVAQVVDWQTEDFAAGGFRRGEGFLCMMPSGPHGVGYFS
RLVSQRLSAVFHAVDIDPRWVKKLAARDAAADVAGYVEHVVEQAVFVLQT
QDVANLHTTGPLLAAMARDDRVVELVDAKIGYLLLSGAHVDADTLDLLRG
IFPRTTITMAFGSTMVLSQAVTRTDGDTFVFDPRTPYVVFWVVDPDTGER
VRYGQPGQVVMHHLSRTMFIPNNLERDLAVRRPGPAGELSDSLSEVRPVQ
SFEGEAVIEGVY
41409590NP_962426.1 hypothetical protein MAP3492 [Mycobacterium avium subsp. paratuberculosMIADESFPVDPWHVRETQLNLNLLAQSESLFTLSNGHIGLRGNLDEGEPY
GLPGTYLNSFYEIRPLPYAEAGYGYPEAGQTLVDVTNGKIIRLLVEDEPF
DVRYGELLSHERTLDLRAGTLTRSAYWRSPAGKEVKVVSTRLVSLAQRGV
AAIEYVVQAVGDFVRVTVQSELVTNEDQPQTSGDPRVSAILENPLEEVDH
ENTDTGALLMHRTRSSALMMAAGMDHEVEVPGRVEVSTDSRADLARTTVI
CGLRAGQKLRIVKYLAYGWSSMRSRPALRDQVAAALHSARYTGWPGLLES
QRKYLDNFWDCADVEVEGDPESQQAVRFGLFHLLQASARAERRAIAAKGL
TGTGYDGHAFWDTEGYVLPVLTYTAPHTVADALRWRASTLDLAKERAAEL
GLEGAAFPWRTIRGQECSAYWPAGTAAWHINADIAMAFERYRIVTGDDDL
EAECGLPVLVETARLWLSLGHHDRHGVWHLDGVTGPDEYTAVVRDNVFTN
LMAAHNLRVAAEACNRHPDGAKALGVTTEETAAWRDAADAVKIPYDSGLG
VHQQCEGFTTFAEWDFEHNTTYPLLLHEAYVRLYPAQVIKQADLVLAMHW
QSHAFTPEQKARNVDYYEPRMVRDSSLSACTQAVMCAEVGHLELAHDYAY
EAALIDLRDLHHNTRDGLHMASLAGAWTALVSGFGGLRDDEGVLSLDPQL
PDGISRLRFRLRWRDFRVTVDVNHADVTYTLRDGPGGELTIQHAGAELEL
STQSPTTVAVRPRKPLLPPPQQPPGREPTHRRAVSRSSPGQ
41409589NP_962425.1 hypothetical protein MAP3491 [Mycobacterium avium subsp. paratuberculosMVEWIPPDPNHRKRVPVLGLPEKVHACLFDLDGVLTDTASVHTKAWKAMF
DAYLADRAKRTGETFVPFDPAADYRKYVDGKKREDGVRSFLQSRGIHLPD
GSPDDAEDAETIYGLGNRKNDMFQKVLKQDGVKVFDGSRRYLEAASAAGL
GIAVVSSSANTRNVLEVTGLDRYVQQRVDGITLREEHLAGKPAPDSFLRG
AQLLDVPAGAAAVFEDALSGVAAGRAGNFGFVVGVDRVGQAEDLRRNGAD
VVVSDLAELLAS
41409588NP_962424.1 hypothetical protein MAP3490 [Mycobacterium avium subsp. paratuberculosMTTVPAMTAPIWMASPPEVHSALLSSGPGPASMFAAAAAWSALGAEYASA
AEELSGLLASAQAGAWQGPSAASYVAAHGPYLAWLTRASAHSAAAAAQHE
TAGTAYTAALAAMPTLPELAANHAVHGALVATNFFGINTIPIAVNEADYA
RMWVQAAGTMATYQAVSTAAVAAVPQPDPAPSILKSTAAHDHDDHEHGDD
HDHDHGFDSPLNQFVAQILRLFGIDWDPVEGTLNGLPYEAYTSPADPLWW
VVRALELFSDFQQFGALLQENPAAAFQFITELVLLDWPTHLAQLASWLPT
QPQLLLVPALVAAAPFGALAGFAGVAGQPPLPAPVAEPATPSAAAPTGLP
ATAGATPIAASAAASGPAPAPTPAPTAATVSSPAPPAPPAPGAAPFAPPY
AVPPPGAGFGSKARASVDTRAKSKSPQPDSNAVGAGAAVREAAHARRRQR
SRRRGDEFMDMNVGVDPDWDEPATTASPRGAGNLGFAGTAPRETVAAAGL
TQLAGDEFGGGAGMPLLPGSWAPPDPRDSGV
41409587NP_962423.1 bifunctional GMP synthase/glutamine amidotransferase protein [MycobacteMAESPPTEVPEPPARPVLVVDFGAQYAQLIARRVREARVFSEVIPHTATI
EEIKARQPRALVLSGGPSSVYEPGAPQLDPAVFDLGVPVFGICYGFQAMA
QALGGTVAHTGTSEYGRTELKVLGGELHSGLPGVQPVWMSHGDAVTAAPD
GFEVVASSPGAVVAAFENRARRLAGVQYHPEVMHTPHGQQVLSRFLHDFA
GLGADWTAANIAGVLVEQVRAQIGDGHAICGLSGGVDSAVAAALVQRAIG
DRLTCVFVDHGLLRAGERAQVQRDFVAATGANLVTVDAADTFLQALAGVT
NPEGKRKIIGRQFIRAFEGAVRDVLGDKPVEFLVQGTLYPDVVESGGGSG
TANIKSHHNVGGLPGDLKFTLVEPLRLLFKDEVRAVGRELGLPEEIVARQ
PFPGPGLGIRIVGEVTATRLDTLRRADSIAREELTAAGLDSLIWQCPVVL
LGEVRSVGVQGDNRTYGHPIVLRPVTSEDAMTADWTRVPYEVLERISTRI
TNEVPEVNRVVLDITSKPPGTIEWE
41409586NP_962422.1 hypothetical protein MAP3488c [Mycobacterium avium subsp. paratuberculoMHDGAASTGFLPARPGIATRGKKSTIRPTGTECIRLPLTFLDGCRRVGVY
SPVNRTCIRNLRATSGDRRLVMTAAFASSRHEETRAERLESLRRRMAEMS
GRMSGAASGAAAPADLLGAESLLAMPRWLAESVWVPRGSVAVLSGARSLL
LSMVAAVTAAGGNAAIVGQPDIGLLAAAEMGADLSRLAVIPDPGTDPVEV
AAVLVDGMDLVVLGLGGRRVPPTRARAVVARARSKGCTLLVTGGDWQGAP
TRLAARVCGYEVTPAQWGKPAPGFGRISGVRLQVSGMCAGRRVAAQARAG
41409585NP_962421.1 hypothetical protein MAP3487c [Mycobacterium avium subsp. paratuberculoMVTPSGSRVLAIWCMDWPAVAAAAAAELPATAPVAVTLANRVIACSSAAR
AAGVRRGLRRREAAARCPQLHVSTADADRDARFFEAVIAAVDDLVPRAEV
LRPGLLVLPVRGAARYFGSEEAAAERLVDAVAVSSVAGAECQVGIADRLS
TAVLAARAGRIVEPGGDAKFLSVLSVRQLATEPSLSGPGREELTDLLWRM
GIRTIGQFAALARGDVASRFGADGVAAHRLARGEPERPPSGREPPAELEA
VLDCDPPIDRVDAAAFAGRSLAGTLHQALMAAGVGCTRLAIHAATGSGEE
RHRVWRCAEPLTEDATADRVRWQLDGWLSNRTARDRPTAPVTLLRLRAVE
VVSAEALQLPLWGGLGEEDRLRARRALVRVQGLLGPEAVQVPVRSGGRGP
AERITLIPLGDEPVPQADPDLPWPGRLPEPSPAVLLDDPVELLDAQGNPI
RVSSRGLFSADPARLVVHGRGERLCWWGGPWPVDERWWDDRGQGGGRTAR
AQVLLESERALLLCYRQRRWYLEGSYE
41409584NP_962420.1 hypothetical protein MAP3486 [Mycobacterium avium subsp. paratuberculosMAFAEYQNELYDQSLHGNQPQYPIRFEELEAKASAAMTPKVLGYVAGGAG
DEHTQRANCEAFKRWGLYPRMGIAPEQRDMSVELFGTRFPSPIFMAPIGV
IGVCDPDGHGDLACVRASIRTGVPFFVGTLSADPMEDLADELGDTPAFFQ
LYTPPDRKMAASLVHRAEAASFSGIAVTLDTWVTGWRPRDLSGGNYPQVP
SGCLANYTSDPVFRAGLSRGEDPTEAAVRKLPIFGGPFRWEDLEWLRSRT
SLPLMAKGICHPDDVRRAKDIGVDAVYCSNHGGRQANGGLPCLDCLPGVV
EAADGLPVLFDSGVRSGADIVKALALGATAVGIGRPYAYGLALGGVDGIV
HVLRSLLAEADLIMAVDGYPSLKDLTPDALRRVEHVAPQRYS
41409583NP_962419.1 3-oxoacyl-ACP synthase II [Mycobacterium avium subsp. paratuberculosis MTELVTGETLPNVVVTGIAMTTALATDAETTWKLLLDSQSGIRKLEDSFV
EEFDLPVRIGGHLLEDFDDGLTRAERHRMGYLQMMSTVLGRRVWENAGSP
EVDSNRLMVSIGTGLGSSEEMVFSYDDMRARGMKGVSPLAVSKYMPDGAA
VAVGLERHAKAGVITPVSACASGSEGIAQAWRNIVFGEADIAICGGVETK
IEAVAIAAFAQMRIVMSTKNDDPVGACRPFDRDRTGFVFGEAGALMVIET
EEHAKARGANILARIMGASITSDGYHMVAPDPNGERAGHAMSRAIQLAGL
TPGDIDHVNAHATGTSVGDVAESKAINNALGPHGGNAAVYAPKAALGHSV
GAVGAVESILTVLALRDQVVPPTLNLENLDPEIDLDVVAGKPRPGNYQYA
INNSFGFGGHNVAIAFGRY
41409582NP_962418.1 IunH [Mycobacterium avium subsp. paratuberculosis K-10]MTPVFVDVDTGVDDALALMYLFASPDADVVGIASTGGNVAVEQVCENNLG
LLQLCGLTGIPVSKGSGQTLTGPMRLPSKVHGPRGLGYAELPPSDHRVTD
HDSATAWVCAAHAHPGELIGVATGPLTNLALALRAEPALPTLLRRLVIMG
GSYDHRGNTTAVAEWNISVDPEAAAEVLAGWGGADVGRERLPILCGLDLT
RKVAMTPGHLTRLATAADSSTRPLSADDEPGTRSAAANPLIRVIEDAMRF
YLEAYHDLGHGYQAHMHDPLAAAVALDPTLVATRPATVEIELTGTLTRAM
TVTDWSGRREPNALIGIDVDSAAFFDRFIERVGPFARRVGGGR
41409581NP_962417.1 hypothetical protein MAP3483 [Mycobacterium avium subsp. paratuberculosMVGSAGRTDIDPVGAAAELVAATGAAVLPALSVTRSLGVGREEWTRFARD
PLLHKVIRLLSRIAAALDEVGEWNVQVHPFRIRSAPQECGAGGQPTPDGR
RLLTATLAEPGTLLVSDDRRTLHQVSPIRPLEGDGPARRDVLVITFASGR
P
41409580NP_962416.1 short chain dehydrogenase [Mycobacterium avium subsp. paratuberculosis MRYVVTGGTGFIGRRVVTRLLQTRPEAQVWVLVRRQSLGRFERLSARGDT
PWGDRVKPLVGELPALELSDETLAELGHVDHLVHCAAIYDITAGEAEQRA
ANVDGTRAVIELAQRLGATLHHVSSIAVAGDFPGEYTEDDFDVGQQLPTP
YHQTKFEAELLVRSAPGLRHRIYRPAVVVGDSRTGEMDKVDRPYYFFGVL
AKLAVLPRFTPMLLPDTGRTNLVPVDYVADALVALMHADGLDGQTFHLTA
PKTVGLRGIYRGVAKAAGLPPLRGSLPGAVAAPVLKVRGRARVVRDMAAT
QLGIPAQVFDLVDLAPTFVSEKTRNALAGTGIEVPEFAGYAPRLWRYWAE
HLDPDRARRDDPRGPLYGRHVIVTGASSGIGRASAIAIAQRGATVFALAR
NGAALDALVDEIRANGGAAHAFTCDVTDSASVEHTVKDILGRFDHVDYLV
NNAGRSIRRSVVNSTDRLHDYERVMAVNYFGAVRMVLALLPHWRERRFGH
VVNVSSAGVQARNPKYSSYLPTKAALDAFADVVGSEVLSDHITFTNIHMP
LVRTPMIVPSHRLNPVRAISPERAAAMVVRGLVEKPARIDTPLGTLAEAG
NYFAPRTSRRVLHQLYLGYPDSAAARGVATEPRPAERTERTAPRKPRRPV
RAVTRGLRTPRPVRRLVRLVPGVHW
41409579NP_962415.1 LpqD [Mycobacterium avium subsp. paratuberculosis K-10]MPKRSMIRKVSVALAVLTATVTVAACGGSPQARSITVTFVRHAQSEANAS
GTIDTEVPGPGLSPEGKGQAEQVAHQLGRKDYDSVYASTMTRAQQTAAPL
AAELGKQVEVLPGIQEINAGWYNGKSESMAKSTYLVAPANWLKGDVSDSI
PGSISGKEFNDQFTAAVNKIYNSGHRNPVVFSHANSIMVWTLMNTRNAKD
SLMNTHPLPNTGRVVINGNPITGWTLVDWDGIRDFRS
41409578NP_962414.1 hypothetical protein MAP3480 [Mycobacterium avium subsp. paratuberculosMTVTEVVVAQPVWAGVDAGKADHYCMVINDDAQRLLSQRVANDEAALLEL
IAAVTTLADGGEVTWAIDLNAGGAALLIALLIAAGQRLLYIPGRTVHHAA
GSYRGEGKTDAKDAAIIADQARMRHDLQPLRAGDDIAVELRILTSRRSDL
VADRTRAINRMRAQLLEYFPALERAFDYNKSRAALILLTGYQTPDALRSA
GGARVAAFLRKRKARNADTVAATALQAANAQHSIVPGQQLAATVVARLAK
EVMALDTEIGDTDAMIEERFRRHRHAEIILSMPGFGVILGAEFLAATGGD
MAAFASADRLAGVAGLAPVPRDSGRISGNLKRPRRYDRRLLRACYLSALV
SIRTDPSSRTYYDRKRTEGKRHTQAVLALARRRLNVLWAMLRDHAVYHPA
TTTAAA
41409577NP_962413.1 hypothetical protein MAP3479c [Mycobacterium avium subsp. paratuberculoMAIDPSAVGAVTEPLLFEWTDRDTLLYALGVGAGVDDLAFTTENSHGIDQ
QVLPTYAVICCPAFGAAGLVGKFNWAMLLHGSQSIRLHAPLPPAGKLSVV
SEVADIQDKGEGKNAILVLRGRGTEPDSGQLIAETLTTLVIRGEGGFGGM
PGQRPIAPEFPDREPDARIALPTREDQALIYRLSGDRNPLHSDPWFAREL
AGFPKPILHGLCTYGVSGRALVAELGGGVAANITSIASRFTSPVFPGETL
TTLIWRTEPGKAVFRTEASNPDGSNTRVVLDDGAVEYA
41409576NP_962412.1 OtsB2 [Mycobacterium avium subsp. paratuberculosis K-10]MGESGPVVIDPRRHDAVLFGVGDALGSALASQLGQIGVGTAAFAADGPAA
AADRLRVRPGRCVVVAGDPAAVEAARTAGFALVIGLAPVGRDGDGLRGAG
ADAVVAELEQITVRTGDRRMSQLPDASQALTGGADGLAGRHPAVFFDFDG
TLSDIVDDPDAARPVAGATAALTRLAARCPVAVLSGRDLADVTKRVGVLG
IWYAGSHGFELTAPDGSHHQNDDAAAAIPVLAQAAGRLRDELGAIPGVVV
EHKRFGVAVHYRNAARDRVGEVAAAVRAAGRHDALRVTTGREVIELRPDL
DWDKGKTLHWVIEHLRRSGSGALTPVYLGDDITDEDAFDAVRGGPVQGVP
ILVRHNDDGDRATAALFALDSPARAAEFTERLADQLERGEG
41409575NP_962411.1 hypothetical protein MAP3477 [Mycobacterium avium subsp. paratuberculosMAQTLDTAFLKAHDPDQHASLAIGAVAIVDGTVPDPAQLEHLVAERILPI
ARCTQLLRAHPLNREWVDCPDFDLARHLRRVAIAGTGDEAELSQVIGQAL
RRPLHPGRPPWECWVIEGLRGNRWAMLMKTHHGLLDGNPAARLITRLCDD
ADADMFANNAAAQPVSPSTGWLDALSRVSSLTGGLLGALRLAGRAEAVAP
VRRYATVRVPIADVDRVCRKFGVSANDVALAAVTEGFRTVLLDRGEQPRA
DSLRTLVPLPVRSAVLSHLPVEHDDPVRRLQTVHARCNPAAGTQPAGIVE
SAIGLLPNMVRGNLIQLLSRLPQRGGAQLRRRTGFRHHRRAGRRVRRHAA
GRRRRAGHGAAGGPRRRFRAAVRRPAAPPRGPPAAGPGAARAPVGARARA
SLTGSGRDRAAVRRFSSWANRGRW
41409574NP_962410.1 error-prone DNA polymerase [Mycobacterium avium subsp. paratuberculosisMGWFNGPPSWAEMERVLDSKPRRAGESAAPEPDGPLSRGRATYRPPDEGR
AARSSVPYAELHAHSAFSFLDGASTPEEMVEEAARLDLRALALTDHDGLY
GAVRFAEAAAELDVRTVFGAELSLGPSARTEAPDPPGPHLLVLARGPEGY
RRLSRQLAAAHLAGGEKGKPRYDLDALTEAAGGHWHILTGCRKGHVRQAL
SDGGPDAAARALADLVDRFGAARVSIELTRHGQPLDDERNAALAALAPRF
GVGVVATTGAHFAGPSRRRLAMAMGAIRARESLDSAAGWLAPLGGSHLRS
GAEMARLFAWRPQAVTAAAELGEQCAFGLALIAPRLPPFDVPDGHTEDSW
LRQLTMTGARDRYGSPEHAPRAYAQIEHELKVIAQLQFPGYFLVVHDIAR
FCRENNILCQGRGSAANSAVCYALGVTAVDPVANELLFERFLSPARDGPP
DIDMDIESDQREKVIQYVYDRYGRDYAAQVANVITYRGKIAVRDMARALG
YSQGQQDAWSKQISSWSGPADSPDVEGIPPQVIDLANQVRNLPRHLGIHS
GGMVICDRPIADVCPVEWARMENRSVLQWDKDDCAAIGLVKFDLLGLGML
SALHYAIDLVAEHKGIEVDLARLDLSEPAVYEMLARADSVGVFQVESRAQ
MATLPRLKPRVFYDLVVEVALIRPGPIQGGSVHPYIRRRNGVDPVLYDHP
SMEPALRKTLGVPLFQEQLMQLAVDCAGFSAAEADQLRRAMGSKRSTERM
RRLRSRFYDGMRALHGAPDEVIDRTYEKLEAFANFGFPESHALSFASLVF
YSSWFKLHHPAAFCAALLRAQPMGFYSPQSLVADARRHGVTVHGPDVNAS
LAHATLENAGTEVRLGLGAVRHIGDDLAEKLVQERKANGPFTSLLDLTAR
LQLSVQQTEALATAGAFGCFGMSRREALWAAGAAATQRPDRLPGVGSSSH
IPALPGMSELELAAADVWATGISPDSYPTQFLRDDLDAMGVVPAARLGSV
PDGDRVLIAGAVTHRQRPGTAQGVTFLNLEDETGMVNVLCTPGVWARHRK
LANTAPALLVRGQVQNASGAITVVAERLGRITLAVGSRSRDFR
41409573NP_962409.1 hypothetical protein MAP3475c [Mycobacterium avium subsp. paratuberculoMTLNLSVDEVLTTTRSVRKRLDFDKPVPREVLMECLELALQAPTGSNAQG
WQWVFVEDADKKKTIADIYLANARAYLSLPAAEYPEGDTRGERMPKVKDS
AVYLAEHMHEAPVLLIPCLEGRVENAPLGLSASFWASLFPAAWSFCLALR
SRGLGTCWTTLHLINDGEKQAAELLGIPHDRYSQGGLFPIAYTKGTDFRP
AKRLPAQQVTHWDSW
41409572NP_962408.1 hypothetical protein MAP3474 [Mycobacterium avium subsp. paratuberculosMFKLMFVSPRIAPNTGNAIRTAAATGCELHLVEPIGFDLSEPKLRRAGLD
YHDLASVTVHASLAAAWDALTPARVVAFTSHAPASFAELRYRPGDVLMFG
PEPTGLDAATLADPHVTTQVRIPMLAGRRSLNLSNAAAIAVYEAWRQHGY
AGAT
41409571NP_962407.1 hypothetical protein MAP3473c [Mycobacterium avium subsp. paratuberculoMVEQSIWMQKVAADPGHSHWYIERFRAMARAGDDLAGEARFVDAKAPRGA
RILDAGCGPGRLGSYLAAAGHQVVGVDVDPALIEAAEHDHPGPRWLVGDL
AELDLPARGITDPFDVIVSAGNVMTFLAPSTRVLVLSRLRAHLAADGRAA
IGFGAYREYEFTDFLNDAADAGFAPDLLLSSWDLRPFTEDSEFLVAVLRP
A
41409570NP_962406.1 hypothetical protein MAP3472c [Mycobacterium avium subsp. paratuberculoMFSRPAEPAAAEAPGPAPLGGDAVPAKRPPAWSLSNWPVRWKVLAIVLVP
LMLATVFGVLRIHGAMANAAGLRLAAARADVVPAITKYMSALDVALLAGS
AGRDAEGAKKNYEARKNELQTRLGDTDVTDDVRAGVNNLLDAGQMLVNKV
AEGSLGLRERVTFYAPILLTAENVINASVRVDDERIRAQAQGLSRAVGAR
GQMTMQKILVTRGAELPEPQLRTSMATLAGTEPSTLFGMSEVLGAGSPEA
KTLQQQMVSRMAIMSDPASVLVDNPDLLRSIQTTDDIADQVIKNTTASVT
KSVHAQAAERRNSAILDTALVLAAIVIALAVVLLVARALVRPLRTLRDGA
LKVAHTDLEEEIAHVKAGGAEPIPAPLPVYTTEEIGQVAHAVDELHTQAL
LLAGDEARLRLLVNDMFETMSRRSRSLVDQQLALIDRLERNEDNPERLDN
LFRLDHLAARLRRNSANLLVLAGAKLARDQRDPVPLATVINAAVSEVEDY
RRVEIAGLPECSLLGAAAGGAIHLFAELIDNALRYSPPTTSARVSASRGG
DGGVVVRIADSGLGMNDADRRIANMRLQAGGDANPDPHPENARHLGLFVV
GRIAAWHGMRVGLRGPAANESGSGTTAEVYLPPTVLAGRVVAEPSGPRHI
RAVSSPSAKLASAIAAPAEEGGRHDGTQQPAARGTRNAGDASTPPVTLLP
RRNPGSSGIADVAAVPAPPAEPQPRRQRRELATPWWEASPAPRPAPERAP
EPAPEPQQPAPRPARAASDTSAFFAARPRTETPPEAPPKPPPKPKPKPEA
SIPPAASTGPADDDVIYRRMLSEMLGDPHDLVNSPDLDWQSVWDRGWTLA
AAAEDKPVESHTTDHGLPVRTPGARLVPGGAHGAAAEPDDEPGLNGRSPA
PRRPQHAAVTRDPEAVRASFSSHFGGVRTGRSHARESSEGPDQQ
41409569NP_962405.1 hypothetical protein MAP3471c [Mycobacterium avium subsp. paratuberculoMTAPDNSWSAAPDRSLDWLVTKFAREVPGVAHALLVSVDGLPVAASEHLP
RERADQLAAVASGLASLATGAAQLFEGGQVLQSVVEMSNGYLLLMQVGDG
SHLAALAAASCDIGQIGYEMAVLVERVGGVVQSTRRSSVS
41409568NP_962404.1 hypothetical protein MAP3470c [Mycobacterium avium subsp. paratuberculoMDTPETWPTSRSGNLVRPYTLTSGRTDTTVDLPVEALIQTLQAGLTHRWP
PGDARGRIVRLCLDSPSVAEISARLDLPLGVARVLVGDLVLSGYLRVHKT
LSERSTRDERHELIGRTLRGLRAL
41409567NP_962403.1 hypothetical protein MAP3469c [Mycobacterium avium subsp. paratuberculoMAYAHSDVQLDSGDHASTKIVIAGGFGAGKTTFVGAVSEIMPLRTEAMLT
DASTGVDALEATPDKRTTTVAMDFGRITLADDLVLYLFGTPGQRRFWFMW
DDLVRGAIGAVVLVDCRRLQDSFAAVDFFEHRNLPFLVAVNEFDGAPRYP
VEEVREALTLPPHIPVITVDARDRRSATDALIAVSEYALASLSAN
41409566NP_962402.1 hypothetical protein MAP3468c [Mycobacterium avium subsp. paratuberculoMTAWVDREFERHDFTDEDLVGLSTERVVFTECNFSGANLAESRHRASAFR
NCTFRRTSLWHSTFEQCTMLGSVFEQCRLRPVTFDEVDFTLAVLGGNDLR
GGAADPALWTTASLAGARVDVDQAVAFALARGLRLDG
41409565NP_962401.1 hypothetical protein MAP3467c [Mycobacterium avium subsp. paratuberculoMSWGFGDDCWVQGRSDDQRELLDAESVAGHLLKADSMFAFLAAHRSQLFP
EEMFADLFPSQRGRPSVPAEVMASVITLQALHGFSDNETVDAVTFDLRWK
AACGLPITAGAFHSTTLTYWRRRLAASDRPNRIFEAVKTVVAETGVLAGK
TRRALDSTVLDDAVATQDTVTQLIAAIRRVRREVPGAAAVIEAHCSAHDY
DDPGKPAIAWEDKAARDRLVDGLVGDAHRVLGYLPDQELAPRAAEAVALL
ALIAGQDVEPVEGSDGTDGHWRIAQQVSGDRVISTVDADTRHAHKTVHRR
QDGFKAHLAVEPDTGIITDCALTKASGADNHEAVVGLSLLEGEHTPGAGP
GRFGVWHRGRPGGTGRRRPCRGDQTATATLAGSGWLHQRRFPHRFRRPHR
DLPGWTRNADPSQWRSHLRKILSLMPVGVPVHDRHARTQTHPSYPRAIIA
RCSRRGPRPRLASRIPPTPAHGGTLNGLAHSRQPQGPLPRNRQKQPLAAP
PRRSTEPTSAAHHGPDPHRHHLGHRLTRPHTKALPQPPTAATLNNGGAIS
FLSTHRV
41409564NP_962400.1 hypothetical protein MAP3466 [Mycobacterium avium subsp. paratuberculosMGVMTRSAQPVLTARSDRSEGSFAAGRDVVVGSDLRADLRVAHPLIARAH
VLLRFEQGRWRAVDNNTLNGVYVDGRRVPAVDIQDGQTINIGKPDGPRIT
FEIGQHTGAVGLLPPPPRQPKPPGQPPTRSFRRRDTQRSAVPPDAATRGV
PQPGPPPRTQTGRTGGSGEFPTTWVSVPGPDADRRPAPGRAAWIGRALNN
DIVIHDVLASRHHAFFTPTPTGAEIRDANSSNGTFVNGVRVGAAALSDGD
VVTIGNVDLVFTGGMLVRRQEAATRAGGLEVREVNFGVDGKQLLERISLV
ARPGTLTALIGGSGAGKTTLSRLIAGYATPTSGSVTFEGHDIHTEYASLR
TRIGMVPQDDVVHRQLTVSQALGYAAELRLPPDTSKSDRAQVVAQVLDEL
GLTEHADTRVDRLSGGQRKRASVALELLTGPSLLILDEPTSGLDPALDRQ
VMTMLRQLADAGRVVLVVTHSLTYLDVCDQVLLMAPGGKTAFLGPPGQIG
PAMGTTNWAHIFAKVGADPDEANRRFLAQNRPPPPARTEAPAELGAPAQT
SKRRQFFTIARRQVRLVIADRAYFLFLAVLPFVMGALSLTVPGSAGFGYA
DPAGESAGEAGTILTLLTMAAAFMGTALTIRDLIGERPIFRREQAVGLSS
TAYLLAKIVVFCVFAVAQAAVATAIVVLGKGPPTRPAVLLGNATFELFVA
VAATCVAAAMLGLLLSALARSHEQIMPLLVVSLMMQMVLCGGMVPVTHRV
FLDQLSWLVPSRWGYAAQAATVDLWTVSPGPQSPRDSRFQHIATAWLFDM
AMLAVLSVGYAALVRWRIRLRR
41409563NP_962399.1 hypothetical protein MAP3465 [Mycobacterium avium subsp. paratuberculosMAMSAPAPPALTVHHEGSERTFAAGHDVVVGRDLRADMRITHPLISRAHL
LLRYDQGKWLAIDNGSLNGTFVNGRRVPVVEIHDGCAINIGNPDGPLLTF
DVGRHQGMAGRPPRTESMGIPVAAHPPAPAAWSAQLAPPVAAPPPPAGRT
PNWAAPPRRPQPAPRPGPPGQTMYGGRPPGGYPPAAPPPPPVAPAPAAPH
TQMAPAASKPPEVANLATKMFQALMPSRSGAIQKPAGSQTIGRATDNDIV
IQDVLASRHHAFLIQTPLGTEIRDAHSVNGTFVNGVRVGSAVLTEGDVVT
IGNVDLVFTRDGLIRRTEAATRSGGLEVNSVCYTVDHGKQLLDHISLTAR
PGTLTAIIGGSGAGKTTLSRLIVGYTTPTSGTVTFEGHNIHTEYASMRSR
IGMVPQDDVVHRQLTVNQALGYAAELRLPPDTSKEERARVVAQVLEELDM
TQHAETRVDKLSGGQRKRASVALELLTQPSLLLLDEPTSGLDPALDRQVM
LMLRQLADAGRVVLMVTHSVSYLDVCDQILLIAPGGKTAFCGPPDQVEPA
LGTRNWADIFAKVGADPDEANRRFKERNQQSSQPPTPQSPADLGEPPQTD
LWRQLSTIARRQVRLVVSDRGYTIFLAVLPFLIGALSLTVKGPHPGLGPA
DPLGPAPTQPQYIMVLLNIGAVFMGTALTIRDLIGERAIFRREQAVGLST
TAYLLAKIAVFCVFATAQAAIATIIVRLGKGAPTAHPQFFGNSTFSLFVT
VAGTCIASAMLGLLLSALAQSNEQIMPLLVVSIMSQLVFSSGMIPVYQRI
GLEQLAWLTPARWGYAAGASSIDFPSLVKVKQIPTNDPIWQHSKHIFVFD
MAMLALLSIGYTGFVRWHIRLKR
41409562NP_962398.1 hypothetical protein MAP3464 [Mycobacterium avium subsp. paratuberculosMPTPPDVFSPAKLGPITLRNRIIKSATFEARTPDALVTDDLIEYHRLPAV
GGVGMTTVAYCAVSPGGRTEGNGIWMRPEAVPGFRRLTDAIHAEGAAVSA
QIGHAGPVANARSNKAQALAPVRFFNPIGMRFAKKATRDDIDEVIAAHAN
AARLAIEAGFDAVEIHLGHNYLASSFLSPLINRRNDEFGGSLQNRAKVAR
GMVMAVRRAVEKEGTPIAVTAKLNMADGVRGGISTEESLTTAKWLESDGG
LDAIELTAGSSLVNPMYLFRGDAPLKEFAGAFKPPLRWGMRMTGKKFLRE
YPYRDAYLLRDAKLFRAELKMPLILLGGITNRETMDLAMAEGFEFVAMAR
ALLAEPDLINRIAADGAAHRVHSACTHCNQCMPTIYSRTHCVVTGAPDRH
TSAAT
41409561NP_962397.1 hypothetical protein MAP3463c [Mycobacterium avium subsp. paratuberculoMGAITLDGKATRDEIFVDLKQRVAALTAAGRTPGLGTILVGDDPGSQAYV
RGKHADCAKVGITSIRRDLPADISTAALNDTIDELNANPECTGYIVQLPL
PKQLDENAALERVDPDKDADGLHPTNLGRLVLNNPAPLPCTPRGIVHLLR
RYDAEIAGAHVVVIGRGVTVGRPLGLLLTRRSENATVTLCHTGTRDLPAL
TRQADIIVAAVGVPHLLTADMVRPGAAVLDVGVSRVDGKLAGDVHPDVWE
VAGHVSPNPGGVGPLTRAFLLTNVVELAERE
41409560NP_962396.1 hypothetical protein MAP3462c [Mycobacterium avium subsp. paratuberculoMTARTLMRAQWPILLVGLIFAVALALVGANFWRRGSLLLGIGVGVAALLR
LVLSEERAGLLVVRGKGIDFVTTAMVGAAMVYIAWTIDPLGTG
41409559NP_962395.1 hypothetical protein MAP3461 [Mycobacterium avium subsp. paratuberculosMRTFIPPCRKRDSDGSEFVGRDSSAVGALQADGEAGVKALARTHQWIWVL
RHQPFTIRLLAAAAGLLTVASAFAAPAGAEGNGDDFIDALNHAGIDFGEP
GNAMAVGESVCPMLSQPGGNFAAVASSVAGRGMSPTMARMFTTIAIQTYC
PQEMANIASGNLSGAMPQVPGMPGQLPAMAGQIPGMAGQTGQLPTMPGQL
PSF
41409558NP_962394.1 hypothetical protein MAP3460c [Mycobacterium avium subsp. paratuberculoMGCSSREEIVKVFDALDAAVDRLGELSFDALTPRECLSLLQRCETVRRRL
PVPEHPLINALARDASPAELGGRLSHAIAEATLISRAEAARRVHTAADLG
PRVGLTGEPLPPLLAATAARQREGSLGLEQVAVIRKFCHQLPGWIDQATR
ERAEADLAREGTRYRPEQLAALAGTLADCLNPDGLYRDEDRARRRSLTLG
NQHADGMSELRGWLSPELRATLEAVLAKLAAPGMCNPLDESPCVEGTPSQ
HAIDGDARSAAQRNHDGLLAGLRALLASGNLGQHNGLPASIIVTTTLADL
ETAAGRRLTGGGTLLPMSDVIRLSRHAHHYLAIFDQGKALALYHTKRLAS
PAQRIVLYAKDRGCTAPGCTIPGYYSEVHHCTDYATCHTTDINDLTFACG
PHHRLLQPGAWTTHKNAKGETEWIPPPHLDRNQPRTNTFHHPEKLLQGED
DDGEVDGDEPD
41409557NP_962393.1 hypothetical protein MAP3459 [Mycobacterium avium subsp. paratuberculosMTRSRHDRSLSFGSAAAAYERGRPSYPPEAIDWLLPVGARQVLDLGAGTG
KLTTRLVERGLDVVAVDPIPDMLEVLRSSLPETRALLGTAEEIPLEDNSV
DVVLVAQAWHWVDPERAIPEVARVLRPGGRLGLVWNTRDERLGWVRELGR
IIGSDGDGRTHVTLPEPFTDLAHHEVEWTNYLTPQALIDLVASRSYCITS
PTEVRTRTLDQVRHLLATHPALANSTGLALPYVTRCTRATLAG
41409556NP_962392.1 homoserine O-acetyltransferase [Mycobacterium avium subsp. paratuberculMTIPDVPTQTLPDEGEIGFVHIGSLTTEAGAVIDDVHIAVQRWGELSPTR
DNVVVVLHALTGDSHVTGPAGPGHPTGGWWDEMVGPGAPIDTDRWCAVAT
NVLGGCRGSTGPSSRTRDGKPWGSRFPRISIRDQVEADIAALAALGIDEV
AAVVGGSMGGARALEWIVGHPSRVRAGLLLAVGARATADQIGTQCTQIAA
IKSDPNWQGGDYHDTGRTPDAGLAIARRFAHLTYRGEVELDTRFGNDAQL
DEDPANSGRYAVQSYLEYQGVKLVERFDAGSYVVLTEALNSHDVGRARGG
VRKALRSCPVPVVVGGITSDRLYPLRLQQELAEQLPGCAELQVVDSICGH
DGFLVESEAVGEMIRKTLLLAGSQSAGPGGAGPGSRKGTTRR
41409555NP_962391.1 O-acetylhomoserine aminocarboxypropyltransferase [Mycobacterium avium sMSSENTDHDTDPSAHWSFETKQVHAGQHPDSATNARALPIYQTTSYTFDD
TTHAAALFGLEVPGNIYTRIGNPTTDVVEQRIAALEGGVAALFLSSGQAA
ETFAILNLASAGDHIVSSPRLYGGTYNLFHYSLAKLGIEVSFVEDPDDLD
SWQAAVRPNTKAFFAETISNPQIDILDIPGVSGVAHANGVPLIVDNTIAT
PYLIQPFAHGADIVVHSATKYLGGHGSAIAGVIVDGGTFDWTQGRFPGFT
TPDPSYHGVVFAELGPPAYALKARVQLLRDLGSAAAPFNAFLVAQGIETL
SLRMERHVANAQRVAEFLASHDGVLSVNYAGLPGSPWHERAKKLAPKGTG
AVLSFELAGGVEAGKAFVNALKLHSHVANIGDVRSLVIHPASTTHAQLSP
AEQLSTGVSPGLVRLAVGIEGIDDILADLELGFAAAAKFGANADTSGADP
HAVAAF
41409554NP_962390.1 Icd2 [Mycobacterium avium subsp. paratuberculosis K-10]MSAEKPTVIYTLTDEAPLLATYAFLPIVRAFAEPAGIEIKTSDISVAARI
LAEFPEHLTEEQRVPDNLAELGRLTKLADTNIIKLPNISASVPQLIAAVK
ELQGKGYKIPDFPQSPKTDEDREIRERYAKCLGSAVNPVLRQGNSDRRAP
KAVKEYARKHPHHMAEWSPASRTHVATMKHGDFYHGEKSMTLDRARNVKM
ELETKSGKTIVLKPMVSLRTGDIIDSMFMSKKALVEFYEQQMQDAYETGV
MFSLHVKATMMKVSHPIVFGHAVKVFYKEAFAKHQALFDELGVDVNNGLV
DLYSKIESLPASLHDEIIRDLHACHEHRPELAMVDSAKGITNFHSPSDVI
VDASMPAMIRAGGKMYGADGRQKDTKAVNPESTFSRIYQEIINFCKTHGA
FDPATMGTVPNVGLMAQQAEEYGSHDKTFEIPEDGVANIVDLDTGEVLLT
QNVETGDIWRMPIVRDEPIRDWVKLAVTRARNSGMTAVFWLDTERPHEVE
LRKKVKEYLKEHDTEGLHIQIMPQVWAMRYTLERAMRGQDTIAVTGNILR
DYLTDLFPILELGTSAKMLSIVPLMSGGGMYETGAGGSAPKHVHQLVEEN
HLRWDSLGEFLALGACFEDIGIKTGNQRAKLLGKTLDAAIGKLLENNKSP
SRKTGELDNRGSQFYLALYWAQELAAQNDDDELRRHFAALAASLGENEQR
IVEELAEVQGRPVDIGGYYQPDSEKTTAVMRPSKTFNEALAASQR
41409553NP_962389.1 isocitrate dehydrogenase [Mycobacterium avium subsp. paratuberculosis KMSNPANTSKIKVKGRVVELDGDEMTRVIWKMIKENLILPYLDIDLDYYDL
GIEHRDRTDDQVTIDAAYAIKKHGVGVKCATITPDEARVREFNLKRMWLS
PNGTIRNILGGTIFREPIVISNVPRLVPGWTKPIVIGRHAFGDQYRSTNF
KVDKPGTVAITFTPADGSEPIVHEMVSIPEDGGVVMGMYNFRESIRDFAR
ASFKYGLNAKWPVYLSTKNTILKAYDGMFKDEFQRIYDEEFKEQFEAEGL
TYEHRLIDDMVAACLKWEGGYVWACKNYDGDVQSDAIAQGYGSLGLMTSV
LMTADGKTVEAEAAHGTVTRHFRQYQAGKPTSTNPIASIFAWTRGLAHRG
KLDDTPEVVEFAQTLERVVVSTVESGKMTKDLAILIGPDQKWQQSEEFLN
SIAENLRRELTN
41409552NP_962388.1 hypothetical protein MAP3454 [Mycobacterium avium subsp. paratuberculosMTTRAPIHLGPKDGSGEPVVLLHGFLMSQTVWHPVAPRLADTGRYEVFAP
TMAGHNGGPYAGTWLLSSSVLADHVERQLDRLGWDSAHLVGNSLGGWVAF
ELERRGRARSVTGIGAAGGWTRWSPVKFEVIGKFIGGMPLLLLARLLGQR
ILQLPLSRRLATLPLSATPSGVSDRQLSGVIEDAAHCPAYFQLLVKSLLQ
PGLLELAQTAVPVQLVLCEKDRVVPPSRFSRHFTDHLPPETRITRLDGVG
HVPMFEAPERVTTVLTDFIDDCVARSQRQQPPAS
41409551NP_962387.1 tryptophanyl-tRNA synthetase [Mycobacterium avium subsp. paratuberculosMSTATGSRRIFSGVQPTSDSLHLGNALGAISQWVTLQDDWGDDWDAFFCV
VDLHAITIAQDPAALRRRTLVTAAQYLALGIDPARSTVFVQSHVPAHTQL
AWVLGCFTGFGQASRMTQFKDKSLRQGADSTTVGLFTYPVLQAADVLAYD
TGLVPVGEDQRQHLELARDVAQRFNARFPDTFVVPEMLIPKVTAKIYDLA
DPTSKMSKSASTDAGLINLLDDPALSAKKIRSAVTDSEREIRFDTDAKPG
VSNLLSIQSAVSGVDIDKLVQGYAGRGYGDLKKDTADAVVEFVTPIKARV
DELMADPAELEAVLAAGAQRAQDVAGKTVERVYDRLGFLPRRG
41409550NP_962386.1 hypothetical protein MAP3452c [Mycobacterium avium subsp. paratuberculoMSEPAEAGFLDRLRARHGWLDHLIRAYQRFDDRNGGFFAAGLTYYTIFAL
FPLLMVGFAVFGFVLARRPQLLSSIDDHIRSQVNGALGNQLQELMNSAID
ARTSVGVIGLATAVWAGLGWISHLRQALTEMWWDTQIESPGFVRNKLSDL
LAMVGTFAVIVATVGLTTVGHAAPMAALLKWLGIPQFVVFDWLFWIFSIL
IATLVSWLLFTWMIARLPREKVSFVDSMRAGLIAAIGFEVFKQVASIYLR
TVLRSPAGAAFGPVLGLMVFAYITAYLVLFCTAWAATASTDPRDRPVAPP
APAIIAPRVHLDEGLNTRQTLTAMGLGAVAALAFDRLTRRRR
41409549NP_962385.1 SugE [Mycobacterium avium subsp. paratuberculosis K-10]MPSATDTGRGAPYPASDKTAPWRCAMAWLILIASGVLEAVWATALSRSEG
FSRLGPSLVFFVALAFSMTGLAVAMRSLPVGTSYAVWVGVGAALTVTYAA
LVGDEPASPVKLVLIAGIVACVAGLKLLG
41409548NP_962384.1 hypothetical protein MAP3450 [Mycobacterium avium subsp. paratuberculosMGLIAAGTMVASGRVRRPGWVETSGGHIAACGTGPPPRPADREFPDGTLV
PGFVDMHVHGGGGASYTEPDGIAKAAAFHLRHGTTTTMASLVTGSPAELL
GGVRALAEATRDRTVAGIHLEGPWLSRARCGAHDARRMRDPDPHEIDAVL
DAGGGAIRMVTLAPELPGADAAIRRFADAGVVVAVGHTNADYRQTRHAIA
LGATVGTHLFNAMPPLHHREPGPALALLRDPRVTVELIADGVHVHPDVVH
AVIDAAGPERVALVTDALAAAGRPDGAFRLGPVHIDVVAGGRAGARDDDD
RGQHRHHGPALSHRGRVRRRPRRRARGRGADDVHDAGARAGARSGGQPAG
RP
41409547NP_962383.1 SugI [Mycobacterium avium subsp. paratuberculosis K-10]MARGSRRGLLVGLTAASVGVIYGYDLSIIAGAQLFVTEDFGLSTRQQELL
TTMAVIGQIGGALFAGVLANAIGRQRSVLLILSGYAVFALLAAFSVGLPM
LLTARLLLGLTIGVTVVVVPVYVAESAPTAVRGALLTAYQLAIVSGLIVG
YLSGYLLADTHSWRWMLGLACVPAVLLLPLVFRMPDTARWYLLKGRVDDA
RRALLRVEPVARVDDELAEIDRAVSEEAASLPAMLAEMVRSPYRRATVFV
VVLGFLIQITGINAIIYYSPRIFEAMGFTGNFALLALPALVQVAGLVAVG
TALLLVDRVGRRPILLCGTAMMIVADVVLVAVFGRGPGGVIAGFAGVLLF
IFGYTMGFGSLGWVYASESFPSRLRSIGSSTMLTSNLVANAIVAAVFLTL
LHSLGGAGTFAVFAVLAVVAFAFVHRYAPETKGRQLEDIRHFWENGGRWD
41409546NP_962382.1 hypothetical protein MAP3448 [Mycobacterium avium subsp. paratuberculosMSGTASPLGRAEPGAEPNAAPANCPYKVNTPPAVDSSEVPTAGDPPMPLA
VPAKPVGGDALGSCGIVAAPNTPPLPGDVSAEAWLVADLDSGAVIAAKDP
HGRHRPASIIKVLVAMAAINTLNLNKAVPGTADDAAAEGTKVGVEEGGVF
TVNQLLHGLLMHSGNDAAHALAMQLGGMQQALEKINVLAAKLGGQDTRVA
TPSGLDAPGMSTSAYDIGLFYRYAWQNPTFADIVATRTFDFPGHGDHPGY
ELENDNQLLYKYPGALGGKTGYTDDAGQTFVGAANHDGRRLVAVLLHGTR
QPIAPWEQAAHLLDYGFATPQGTQVGSLIAPDPSLAPAKRDGAADRLAGN
AAAAGMISSADALPVRVGVAVIGTIVVFTLIMMARSMNRRPQHS
41409545NP_962381.1 hypothetical protein MAP3447 [Mycobacterium avium subsp. paratuberculosMHFARHGPDITPPIITRGHGVTIYDDRGNSYLDGLSGLFTVQVGHGRAEL
AEAAARQAGTLAFFPLWGYATPPAIELAERLAGYAPGDLNRVFFTTGGTE
AVETAWKLAKQYFKLTGKPGKHKVISRAVAYHGTTQGALAITGLPRYKAP
FEPVTPGGFRVPNTNFYRAPEAFANDPKGFGLWAADRIAEAIEFEGPDTV
AAVFVEPVQNAGGSIPPPPGYFERVREICDRYDVLLVSDEVICAFGRIGS
MFACADFGYVPDMITCAKGMTSGYSPIGAMIASERLFEPFDDGDTMFPHG
YTFGGHPVSAAVGLVNLDIFEREGLNDRVRTLAPTFRATLEKLYDLPIVG
DVRGEGFFYGVELVKDRATKQTFTDSERRALLGRVGAALFEAGLYCRTDD
RGDSVIQLAPPLISGQAEFDTIEAALRGVLSDECRRL
41409544NP_962380.1 RNA polymerase sigma factor SigJ [Mycobacterium avium subsp. paratubercMPGEVQPEVLMSVAYRLTGTVADAEDIVQDAWLRRHGQDGAITDLRAWLT
TVVSRLGLDRLRSATHRRETYTGNWLPEPVVTGLGPHSGADPLAAVVAGE
DARFAAMVVLERLSPDQRVAFVLHDGFAVPFSEVAEVLGTSEAAARQLAS
RARKVVSAQPPPEPDPSHDEVVGQLMAAMAAGNLEAVVALLHPDVMFTGD
SNGKAPTAVQVIHGADKVVRFMLGLARRYGPGFYSAYQLGLVNGELGIYT
AGLPGGDGYREMCPRIMAMTVRERKVCALWDIANPDKFTGSPLGR
41409543NP_962379.1 hypothetical protein MAP3445 [Mycobacterium avium subsp. paratuberculosMPASVSFCPRASRQRGSRRRASRQRDARAAARRFQAPSHIAGLPRLIGMT
QKTRIEPLPPQRAGLLTRAMYRIAKRRYGQVPEPFAVAAHHRRLMVASAV
HETLVDRASKTLPASVRELAVYWTARQIGCSWCVDFGSMLQRLDGLDIQR
LTEIDDYATSPAFTDDERAAIAYAAAITTDPHTVTDEQVDDLRARFGDAG
TFELTYQIGLENMRARVNAALGITEQGFNSGDACRIPWATGDTETSDPAA
NR
41409542NP_962378.1 succinate dehydrogenase iron-sulfur subunit [Mycobacterium avium subsp.MSVEPDVETLEPPLPPVPDEAVMVTVKIARFNPDQPDAYAETGGWQSFRV
PCLPSDRMLNLLIYIKSYLDGTLTFRRSCAHGVCGSDAMRINGVNRLACK
VLMRDLLPEPKKGKPGKPLTITVEPIRGLPVEKDLVVDMEPFFDAYRAVK
PYLITTGNPPTRERIQSPADRARYDDTTKCILCAACTTSCPVFWHEGSYY
GPAAIVNAHRFIFDSRDEGAAERLDILNEVDGVWRCRTTFNCTDACPRGI
EVTKAIQEVKRAIMFSR
41409541NP_962377.1 succinate dehydrogenase flavoprotein subunit [Mycobacterium avium subspMIQQHRYDVVIVGAGGAGMRAAVEAGPRVRTAVLTKLYPTRSHTGAAQGG
MCAALANVEEDNWEWHTFDTVKGGDYLADQDAVEIMCKEAIDAVLDLEKM
GMPFNRTPEGRIDQRRFGGHTRDHGKAPVRRACYAADRTGHMILQTLYQN
CVRHDVQFFNEFYALDLVLTQTPSGPVASGVVAYELATGDIHVFHAKAVV
LATGGSGRMYKTTSNAHTLTGDGIGIVFRKGLPLEDMEFHQFHPTGLAGL
GILISEAVRGEGGRLLNGEGERFMERYAPTIVDLAPRDIVARSMVLEVLE
GRGAGPHKDYVYIDVRHLGEDVLESKLPDITEFARTYLGVDPVHELVPVY
PTCHYVMGGIPTTVTGQVLRDNTSTVPGLYAAGECACVSVHGANRLGTNS
LLDINVFGRRAGIAAANYARGHDFVDMPPDPAAMVVRWVADILSEHGNER
VADIRGTLQQSMDNNAAVFRTEETLKQALTDIHACKERYSRIRIHDKGKR
FNSDLLEAIELGFLLELAEVTVVGALNRKESRGGHAREDYPNRDDVNYMR
HTMAYKQGTDLLSDIALDFKPVVQTRYEPKERKY
41409540NP_962376.1 SdhD [Mycobacterium avium subsp. paratuberculosis K-10]MSTPDLQLGPGQIAPVKQRFYDRPASLDNPRSPRRRAGIPNFEKFAWLFM
RFSGVALFVLAIGHLFIMLMWDDGVYRIDFNYVAQRWASPFWQLWDLALL
WLAQLHGGNGLRTIIDDYSRKDSTRFWLNSLLLLSMGFTLVLGTYVLLTF
DPNISG
41409539NP_962375.1 hypothetical protein MAP3441 [Mycobacterium avium subsp. paratuberculosMRGDTGVTTQPTTADPATPVSAPARKRRPPRTLYRGDPGMWSWVLHRISG
ATIFFFLFVHVLDAAMLRVSPQTYNAVIHDYQMPIVGVMEYGLIAAVLFH
GLNGIRVILIDFWSEGPRHQRLMFWIVGVVFLLLMVPAGVVTVIHMLGHF
R
41409538NP_962374.1 cytidine deaminase [Mycobacterium avium subsp. paratuberculosis K-10]MPDIDWNALRDKAIDVSAGAYAPYSRFRVGAAGLVDDGRVVTGCNVENIS
YGLGLCAECAVVCALYASGGGRLVALACVDGRGSVLTPCGRCRQVLAEHG
GPELLIDHPGGPRRLGELLPDAFGPDQLAAGRD
41409537NP_962373.1 thymidine phosphorylase [Mycobacterium avium subsp. paratuberculosis K-MRPGFDAPTVIRTKRDGGRLSDAAIDWVIDAYTGGLVAEEQMAALLMAIL
LRGMDGGETAAWTSAMLASGDRLDFSDLGVPTVDKHSTGGVGDKITLPLV
PVVAACGAAVPQASGRGLGHTGGTLDKLDAIAGFSAQLPSRRVREQLREV
GAAIFAAGDLAPADAKLYALRDITATVESLPLIASSVMSKKLAEGAGALV
LDVKVGSGALVKTEEQCRDLAHTMVGLGAAHGVPTRALLTDMNRPLGATV
GNALEVAEALEVLAGGGPADVVELTLRLAAEMLALAGVGDRDPADTLRDG
TAMDRFRRLVAAQGGDLSVPLPIGRHSETVTAPRGGTMGDIDAMAVGLAA
WRLGAGRSRPGERVQAGAGLRIHRHPGEPVAAGEPLFTLYTDTPERFGAA
LAELDGGWSVGDGAPAPRPLIIDRIVT
41409536NP_962372.1 adenosine deaminase [Mycobacterium avium subsp. paratuberculosis K-10]MTAPLELEQIRKAPKALLHDHLDGGLRPSTVLDIAGQTGYDGLPATDVEE
LATWFRTRSHSGSLERYLEPFSHTVAVMQTPEALHRVAYECVEDLAEDSV
VYAEIRFAPELHINRGMSFDEIVDAVLAGFADGEKACAAAGRPIVVRLLV
TAMRHAAVSREIAELAIRWRDKGVVGFDIAGAEAGNPPTRHLEAFDYMRD
HNARFTIHAGEAFGLPSIHEAIAFCGADRLGHGVRIVDDIDVLADGPDKG
KVRLGRLANILRDKRIPLELCPSSNVQTGAVKSIADHPFDLLARTRFRVT
VNTDNRLMSDTYMSREMHRLVQAFGYGWSDLERFTINAMKSAFIPFDERL
AIIDEVIKPRYAVLIG
41409535NP_962371.1 hypothetical protein MAP3437c [Mycobacterium avium subsp. paratuberculoMPSLKLTVIRLIRHSRVRKHRSNCRAGKRDSLRRGYAPCHHQVSSMSTSL
SSPLCSFSSRATNTTRVTTAIRALAPTNAGVNRNVNRAASLGDRVMDHRS
TVLAPSSTPTQPANARPGRRLHTGADEWAPRPRPPTSAAVSRIAVLYACP
IQPRRRLLHEILRFGGKTDELIGFARALSVQTATLPGMSSHSPVSAAALA
SRLRMIMGDRKLSRTRLSHETGISRPSLSSKLDGKVEFTYSELLTIAQAV
DVPLDKLLAGDDDERPFRLSDLRPRPDRPL
41409534NP_962370.1 hypothetical protein MAP3436c [Mycobacterium avium subsp. paratuberculoMSIIATATLVIALAALWSIRLAWHIPFERAAVLALAFMCAQLVLALGPVD
GWLSPLLHDMTGVWNLEDLIGHLLYVYGLFSIMYLVADHCDMTPGQLRWF
VRNRLELPSVVICAVMIAVFVAGDIGETCVPDVVATEHTPWLRVYWFVMI
AALAYIIVSTGRILLILRQHPRSRHAATAYLVALGITGACCVVFIIGIPW
LQWLLVRCEVVGYAVAASYSWRNKVAYFRGR
41409533NP_962369.1 hypothetical protein MAP3435c [Mycobacterium avium subsp. paratuberculoMKLPLLGPVSVTGFQNPWFFLALLAVLLVIGLYVVQQFARRRRVLRFANM
EVLERVAPPHPSRWRHVPTILLATSLVLLTTAMAGPTSDVRIPLNRAVVM
LVIDVSESMASTDVPPNRLAAAKEAGKQFADQLTPAINLGLVEFAANATL
LVPPTTNRAAVKAGIDSLQPAPKTATGEGIFTALQAIATVGSVMGGGEGP
PPARIVLESDGAENVPLDPNAPQGAFTAARAAKAEGVQISTISFGTPYGT
VDYEGATIPVPVDDQTLQKICEITDGQAFHADSLDSLKNVYSTLQRQIGY
ETVKGDASMAWMLLGAVVLAGAVLAGLLLNRRLPA
41409532NP_962368.1 hypothetical protein MAP3434 [Mycobacterium avium subsp. paratuberculosMGVVSLPGIGPLPLYGFQRPGMLLFGLVPLALLALYLVVQARRRRRLHRY
TDAPVAQSPWRHLPIAVSLLSLVLLTIALATPTHDMRIPRNRAVIMLVID
MSQSMRATDVEPNRLKAAEQAASQFASQLTPGINLGLVGFAGTPYLLVPP
TPQHQATIDALKKLDFADSTATGEAIFTALHAISATAVAGGDTPPPARIV
LLSDGGENKPSNPSDPHDGVYTAARLAKDEGVPISTITFGTKGGEIEMDG
QKVAVPVSTDQMKMVAKLSGGQSYTATNLGELQKSYNAIENEIGYRTVPG
PGSAGWLRLGVLTALIATALALLINRRLPT
41409531NP_962367.1 hypothetical protein MAP3433 [Mycobacterium avium subsp. paratuberculosMAADLVPIRLSLSAGDRYTVWAPRWRDSGDEWEAFLGKDEDLYVFSSVAD
LVAFVRSDEDNDLTDHPAWTRLRTAHAHKFEPAKDKQFDLVAVEELVSEK
PTEESVTALAGVLAIVSSIGSVCELAAVSKFFNGNPALGTVSGGIEHFTG
KAGAKRWHAIAEIIARGWDDVLGAIDDIATTPEVDEALSAKAEDELAEER
DDEETDEADEAAEAPADATEPDEEALEADEADGEPDDDADETETRAAGDT
VVLGGDKDFWLQVGIDPIRIITGSGTFYTLRCYLDDQPIFLGRNGRISVF
TSERALARYLADEHDHDLADLSTYDDIRTAATDGSLEVEITDDNIYVLSG
LADDLADGPDAVDRDQLELAVEVLRDIGDYSEDSTVDKALEPGRPLGKLV
AAVLEPGSVAKPSPPYAAAVREWEKLEQFVDGRLRRG
41409530NP_962366.1 hypothetical protein MAP3432 [Mycobacterium avium subsp. paratuberculosMSRENRSRRRLIGGAYRSLRLLGAVAAVALAASPLTPRTSLAAAAIPQPS
HIVIVVEENRSESGIIGNKSAPFITALAASGANMTQSFAETHPSEPNYLA
LFAGNTFGVTKDLCPVNAGAAPNLGSELLAAGYTFVGYAEGLPSPGSPVC
SAGKYARKHVPWANFTNVPAASSLPFSAFPMGNYASLPTVSFVIPNNDNN
MHDGSIAQADSWLNRQLSGYANWALANNSLLIVTFDEDDNSNVGASRNQI
PTVFYGAHVRPGNYAEQINHYNVLATLEQMYGLPKTGYAAGAAPITDIWG
41409529NP_962365.1 uracil phosphoribosyltransferase [Mycobacterium avium subsp. paratubercMDVCVIDHPLAAARLTVLRDERTDTAGFRAALRDLTLMLVYEASRDAPRK
SVRIRTPVAAAAGTRLVNPPLLVPVLRAGLGMVDPAQAALPEAEVGFVGV
ARDEQTHRPVPYLAALPDKLAGRPVMVLDPMLATGGSMAHTLGLLQRRGA
TDITVLCVVAAPEGLAAVGETAPDARVFTAAVDKGLNKAAYIVPGLGDAG
DRQFGPNLFTSSAPSRPEAPAGRGRAAAKTPGRRSARSESPSSTSPSARS
RKAAPPA
41409528NP_962364.1 PmmB [Mycobacterium avium subsp. paratuberculosis K-10]MTPEEWIAHDPDPRTAAELAACGAAELAARFARPLRFGTAGLRGPVRAGP
DAMNVAVVSRASWALAQVLKRRGPAGARVIVGRDARHGSAVFATVAAEVL
AAQGFSVLLLPGPAPTPVVAFAVRHTGAAAGVQITASHNPPTDNGYKVYD
GGGIQIVSPTDHQIEAAMADAPPADEIRRTPVPPAHTDLVQRYIERAAGV
RRGTGSVRVALTALHGVGGTVAVDALHRAGFGRIHTVASQFAPDPDFPTV
VFPNPEEPGATDALLTLAADVDADVAIALDPDADRCAVGIPDASGWRMLS
GDETGWLLGDYLLSQPQRADRPVVASTVVSSRMLSAIAARHGAVHVETLT
GFKWLARADAEVPGGTLVYAYEEAIGHCVDPAAVRDKDGISAAVLVCDLV
AGLIARGGSVSGRLDELARRHGVHDVAAVSRRVGTDGAAELMRRLRTSPP
ETLAGFGVALTDITDALIFTGGDDDTSVRLVVRPSGTEPKVKCYLEIRCA
PSDDLASSRRRARALRELLVATVRSW
41409527NP_962363.1 purine nucleoside phosphorylase [Mycobacterium avium subsp. paratubercuMAETPSNPGELARQAAAVIGERTGVAEHDVAIVLGSGWSPAVAALGTPTA
VLPQAELPGFRPPTAVGHTGELVSMRIGEHRVLVLVGRIHAYEGHDLCHV
VHPVRAACAAGVRAVVLTNAAGGLRPDLAVGEPVLISDHLNLTGRSPLVG
PQFVDLTDAYSPRLRELARQADPTLAEGVYAGLPGPHYETPAEIRMLRTL
GADLVGMSTVHETIAARAAGAEVLGVSLVTNLAAGISGEPLSHTEVLAAG
AASATRMGALLALILCQLPRF
41409526NP_962362.1 hypothetical protein MAP3428c [Mycobacterium avium subsp. paratuberculoMSGGCARIWRMNLRGWPVVGPAIGTVVAVALSVVAITCGPAPRAAADGCP
DVQLIFARGTAEPPGLGAVGDALFAALQPALGNRNVDAYAVNYPASYNFL
TTADGANDARDHIAEMVDRCPSTRLVLGGFSQGAAAVSMLAGVPPVGQRI
GNFGSAPPLDPGLASKIAAVAVFGNPGNRFNTPLSTTGAFAGRAIDLCSD
GDPVCVVGGRDRDAHHVYEDPPYPAQAAGFIAGRV
41409525NP_962361.1 AmiB [Mycobacterium avium subsp. paratuberculosis K-10]MPPVGSDSPLDSVEDVVRRRGADLVELSHAIHAEPELAFAEHRSCAKAQA
LVAERGFEITAAAGGLDTAFRADFGSGQLTIGVCAEYDALPEIGHACGHN
IIAASAVGTALALVEVADDLGLRVALVGTPAEEAGGGKALLLKAGVFDDI
SAAVMLHPGPADIAAARSLALSEAIVRYRGKESHAAVAPHLGVNALDAVT
VAQVAVGLLRQQLAPGQLVHGIVTDGGQAVNVIPGHASLQYAMRAVESDS
LRELEGRMYACFAAGAMAAGCEYEIDNPAPAYDELKPDAWLANIFREEMC
RLGRQPVAPEYEAALPMGSTDMGNVTQALPGIHPVVGVESGGAMVHQRAF
ADAAAGPSADRAVIEGAIMLARTVVALAQTPAERDRVLAAHERRRGGAHP
41409524NP_962360.1 AmiA [Mycobacterium avium subsp. paratuberculosis K-10]MSLADAATSWLAAHNQDLIEWRRHIHRYPELGRQEYATTQFVAERLAEAG
LNPKVLPGGTGLTCDLGPEHEPRIALRADMDALPMAERTGAPYASTMPNV
AHACGHDAHTAILLGTALVLASVPELPVGVRLIFQAAEELMPGGAIDAIA
AGAITGVSRIFALHCDPRLEVGQIAVRHGPITSAADQIEITLYSPGGHTS
RPHLTADLVYGLGTLITGLPGVLSRRIEPRNGTVLVWGAVNAGVAANAIP
QTGVLAGTVRTASRQTWVGLEEVIRETVSGLLAPLGIEHTLQYRRGVPPV
VNEDVSTRILTHAIEALGPDALADTRQSGGGEDFSWYLEEIPGAMARLGV
WPGVGPQLDLHQPTFNLDERALAIGVRVMANIVEQSALFQVF
41409523NP_962359.1 hypothetical protein MAP3425 [Mycobacterium avium subsp. paratuberculosMPLYAAYGSNMDPEQMLKRAPHSPMAGTGWLHGWRLTFGGEDIGWEGALA
TVVEDPGSKVFVVLYDMTPADEKNLDRWEGSEFGVHKKIRCRVDRISSDT
TTDPVLAWLYVLDAWEGGLPSARYLGVMADAAEIAGAPADYVHDLRTRPA
RNIGP
41409522NP_962358.1 flavoprotein disulfide reductase [Mycobacterium avium subsp. paratubercMARLLLPPRCGGHRRRARLGVVVTRIVILGGGPAGYEAALVAASSHPDST
HVTVIDSEGIGGAAVLDDCVPSKTFIASTWLRTELRRAPRLGFEIDIDDA
KISLPQIHARVKQLATEQSADITEQLLGVGVHVVAGRGELIDPTPGLARH
RIKATAPDGSSSEYEADVVLIATGASPRILPSAQPDGERILTWRQLYNLD
ALPDHLIVVGSGVTGAEFVHAYTELGVPVTVVASRDRVLPYEDADAALVL
EEAFSERGVQLVKNARAQSVTRTPDGVLVTLTDGRTVAGSHALMTIGSVP
NTAGLGLERVGIELGRGGYLTVDRVSRTSVPGIYAAGDCTGLLPLASVAA
MQGRIAMYHALGEGVSPIRLRTVAATVFTRPEIAAVGVPQTMIDDGSVSA
RTIMLPLRTNARAKMSGLRQGFVKVFCRKSTGVVIGGVVVAPIASELILP
IAVAVQNRITVNELAQTLAVYPSLSGSITEAARRLMAHDDLD
41409521NP_962357.1 GlpD2 [Mycobacterium avium subsp. paratuberculosis K-10]MSDPIHALGEPGSPASALGPRQRAAAWDRLGAEQFDVVVIGGGVVGSGCA
LDAATRGLKVALVEARDFASGTSSRSSKMFHGGLRYLEQLEFGLVREALY
ERELSLTTLAPHLVKPMPFLFPLTNRLWERPYIAAGIFLYDRLGGAKSVP
AQKHLTRAGALRLCPGLKRSALIGGIRYYDTIVDDARHTLTVARTAAHYG
VVVRNSTQVVALLREGDRVTGVRVRDSEDGSVTEVRGHVVVNATGVWTDE
IQALSKQRGRFQVRASKGVHVVVPRDRIVSDVAIILRTEKSVMFVIPWGS
HWIIGTTDTDWDLDLAHPAATKADIDYILSTVNTVLAIPLTHADIDGVYA
GLRPLLAGESEETSKLSREHAVAVPAPGLVAIAGGKYTTYRVMAADAIDA
AAQFIPARVAPSITEKVSLLGADGYCALINQAEHVAQLRGLHPYRVRHLL
DRYGSLIGDVLALAADRPDLLNPITEAPGYLRVEALYAVTAEGALHLEDI
LARRMRISIEYSHRGVDCAREVADVVAPVLGWTAGDVEREVANYTARVQA
EILSQAQPDDVSADELRASAPEARAEILEPVPLN
41409520NP_962356.1 hypothetical protein MAP3422c [Mycobacterium avium subsp. paratuberculoMRPAPLPVRDGLGPARVRLRGGPVLAELTARFGAAARAKVLAAEVVTADG
AVVDEATVLPAGASVYLYRELPDEVVVPFDLPVLHRDDDIVVVDKPHFLA
TMPRGRHVAQTALVRLRRELGLPELSPAHRLDRLTAGVLLFTARREVRGA
YQTLFSRGLVDKTYLARAAVDPALVFPRVLAGRIVKHRGRMQAVCEPGPP
NALTEVELLSPDGLYRLRPRTGRTHQLRLQMASLGIPIIGDPLYPNIIDV
PADDFSTPLQLLAQRIEFDDPRTGARRVFVNRRTLDDPGP
41409519NP_962355.1 hypothetical protein MAP3421c [Mycobacterium avium subsp. paratuberculoMRDQPAGALDDPGVHRRPRGHRAVGRHRRRAQRAPGHHLGAARAQLPGVA
ADHGGLGAGLPALAGGARARPRCPLPRRLAAALEAEPAARRLPRRGRRRG
GRRDRRPLRRGALPLRHQDRPDAALNGDPPGHGTR
41409518NP_962354.1 hypothetical protein MAP3420c [Mycobacterium avium subsp. paratuberculoMMDLFAPPEVTSTLIHTGPGAGSLIEAAAAWQRVAVELENSVSSYASTLS
SLIESWDGPSAMAMLQSVQPYLLWLRETAQQSAQLANSAEAAATAFGTVR
STVVHPSVVSANRTRLAQLLATNRFGTNTAAIAETENEYQTMWANNSAAL
SRYQAASSQATSPLTQFNSPLAVTDPGGTANQQAAVMKASVDSSGSSVGS
VLNDLNMPGGFDPNAGWFNYFSTWGNQFISSGFPINLLGVWAQLATAQGV
ASVGGDIGSGLSEGLGATTASLANAIKGIGAGAVAPSGAMGVGVSLGKLT
APPAVVGLLPGTQTGVQLASAASPLPAAESGFPLMPMMVPPPTTSAGTGW
RKRKQQKYEDVAYGREVKGKVMPRNPSAG
41409517NP_962353.1 hypothetical protein MAP3419c [Mycobacterium avium subsp. paratuberculoMDFGILPPEVTSALIHAGPGAWSWIEAAGVWQQLSMELEQSASSYTAELA
ALSTTWQGPSALAMTRALEPYVDWLRITAQQCQEIATSVQTATAAFELTH
WTVVHPSLVAANRARLAMLLATNFFGINYPAIAETEAEYHAMWVNNSAAM
YRYAATSATAVRLPRFTEPPQVANPSGVSTQAAMVPATNAADSGTQTGVA
GTLQAASTAFFDPNTGWFKYWSTWGNQFLAASGFPINLIGVLAQLQTASG
FQSLGADVAGGLAEGTAALSAAEVRLVSAVGAAGSSLAPRAALGVGISLG
NLTMPPATVGMLGSQAPVQLASAASPLATGAGQPPMLPMTPMRPGGNGTR
RRNGRDYDDIEYGAELPGTVMQRPPSAG
41409516NP_962352.1 hypothetical protein MAP3418 [Mycobacterium avium subsp. paratuberculosMIRQPVPPRHASIRPSPASSKQRHFCSTGVSQMTSTQIRKRARPRSLVVA
GLLPLAGLLGVITTPAHATSADDAFLAALKAKGINYESPDAAVNSGHTVC
HELDMGQTPEQVANNVLSSSTLDSYHAGYFVGVSIKAYCPKYAAAAAGS
41409515NP_962351.1 LpqC [Mycobacterium avium subsp. paratuberculosis K-10]MAYARWLWLAVLAVCVVGCGVRHVSAASARDISGTFRSGGMDRTYMLHVP
AGDPVGLVLSLHGGGGTGIAQRGLTGFDAVADAHNLLVVYPDGYEKSWAD
GRGASPADRHHVDDVAFLVGLVTKLQNDYRVAPGHVFVTGMSNGGFMSNR
LACDRADVFAAVAPVAGTLGVGVACNPSRPVSVWAAHGTADPLVPFKGGA
VRGRGGLSHAVSAEAMVDKWRKADGCQGDPSMELLPDARDGTVVHRFDST
SCAASTEVVFYRIDKGGHTWPGGKQYLPAAVIGPTTHTLDGSEAIAEFFL
AHARD
41409514NP_962350.1 hypothetical protein MAP3416 [Mycobacterium avium subsp. paratuberculosMPEGDTVWHTAAVLREHLLGETLTRCDIRVPRFATVDLTGQVVDEILSRG
KHLFIRVGAASIHSHLKMEGSWRVGPRVRVDHRARIVLETGAATAVGVDL
GVLQILDRDRDGEAVAHLGPDLLGEDWDPARAAANLAARPQRPIAEALLD
QRVLAGIGNVYCNELCFVSGHLPTTPVSAVADPRRLVSRARDMLWLNRFR
WNRCTTGDTRNGRQLWVYGRAGQPCRRCGTPIEFDDSGDRVTYWCPSCQR
41409513NP_962349.1 hypothetical protein MAP3415 [Mycobacterium avium subsp. paratuberculosMSTPAEPRPSRPSDPLGRFSAITREWFTSTFAAPTTAQAQAWSAIADGHN
TLVIAPTGSGKTLAAFLWALDSLAGQSERAPGTRVLYVSPLKALAVDVER
NLRTPLAGLTRIAERAGLPAPDISVGVRSGDTPPAVRRQLINRPPDVLIT
TPESLFLMLTSAARETLAGVQTVIVDEIHAIAGGKRGAHLALSLERLDAL
REGRPAQRIGLSATVRPPEELARFLSGTAPGARTTVVAPPSAKTVELSVQ
VPVPDMANLANNTIWPDVENRLVDLIEAHGSTIVFANSRRLAERLTARLN
EIHAERSGVELSATANPKVAGGAPAHIMASGQTYGVEPILARAHHGSVSK
EQRALVEEDLKRGLLKAVVATSSLELGIDMGAVDLVIQVEAPPSVASGLQ
RIGRAGHQVGEVSRGVLFPKHRTDLIGCAVTAQRMLAGQIETMRVPANPL
DILAQQTVAAAALEPLDADRWFETVRRAAPFATLPRSIYEATLDLLSGKY
PSTEFAELRPRLVYDRDTGTLTARPGAQRLAVTSGGAIPDRGLFTVYLAS
EAEKPSRVGELEEEMVYESRPGDVISLAATSWRITEITHDRVLVIPAPGQ
PARLPFWRGDGVGRPAELGAALGAFTGELAGLSREEFDSRCAALGFDAYA
VDNLYGLFDEQRTAAGVVPTDTTLLVERFRDELGDWRVILHSPYGLGVNG
PLALAVGRRLRERYGIDEKPTASDDGVVVRLPDTVSDFASDGGDTPPGAE
LFVFDADEIDPIVTAEVGGSALFASRFRECAARALLLPRRHPGRRSPLWQ
QRQRAAQLLEVARKYPDFPVVLETVRECLQDVYDVPALVALMAGIAQRRV
RVLEVETQRPSPFAASLLFGYVGAFMYEGDSPLAERRAAALSLDSTLLAE
LLGRVELRELLDPEVVAATARALQHLAPERAARDAEAVADLLRLLGPLTE
DEVVARAGGADAVEVRGWLEGLRAARRAVPVSFAGRSWWVAIEDIGRLRD
GLGIAVPLGVPAAFTEEVADPLGELLGRYARTHTPFSTAEAAARFGLGLR
VTADVLGRLADPSTSQGRLVRGDFVAARPSEPGGVLGAEQWCDADVLRIL
RRRSLAALRAQVEPVSTAAYGRFLPAWHRVGAAESSRAPGHSGLDGLMSV
IEQLAGVRLPASALEPLVLAPRVRDYSPALLDELLATGEVTWSGAGSISG
SDGWIALHPSESAPLTLQGPADIELGEAHRAILDVLAGGGGYFFRQLATD
GVSDAELKAAVWELVWAGWITGDTFAPVRALLGGGGTRRRSAPAHRAQRP
PRLSRYSVAHPQARPADPTVAGRWSLLPPPEPDSTVRAHFQAELLLGRHG
VLTRGAVAAEGVAGGFATLYKVLSTFEDAGRCQRGYFIESLGGAQFAVAS
TVDRLRGFADGVDPQRPEYRAIVLAAADPANPYGAALPWPASSADGARPG
RKAGALVVLVDGELAWFLERGGRSLLTFTDDPAAQHAAAAALAGLVSARR
VAAILVERIDGVPALAPRGDGAAGNDALTALADAGFARTPRGMRLR
41409512NP_962348.1 hypothetical protein MAP3414 [Mycobacterium avium subsp. paratuberculosMATARRRLSPEDRRAELLALGAEVFGKRPYDEVRIDEIAERAGVSRALMY
HYFPDKRAFFAAVVKDEADRLYENTNMDDVTGLTMYEEIRVGVLAYMAYH
EQNPEAAWAAYVGLGRSDPVLLGVEDDAKNRQMEHIMSRINQLLAEVPAT
REPDVERHLRVILHGWLAFTFEICRQRIIDPTTDADKLADACAHALLDAI
GRVPEIPEELGEAMANSRL
41409511NP_962347.1 AldB [Mycobacterium avium subsp. paratuberculosis K-10]MTLPTAAELRARAADALRSLGAHVELGAPDAHGLPASTPITGEVLFTVAP
TTSDQAEHTITQATQAFSEWRRTPAPVRGALVARLGELLRAHRDELAALV
TLEVGKITSEAAGEVQEMIDICQFAVGLSRQLYGRTIASERPGHRLSETW
HPLGVVGVITAFNFPVAVWAWNAALALVCGDTVVWKPSELTPLTALATQA
LIARAAADVGAPPGVSAVVLGDRELGELLVDDERVALVSATGSVRMGRAV
GPRVAARFGRVLLELGGNNAAVVTPSADLDLAVRAVVFAAAGTAGQRCTT
LRRLIVHRSVADEVVARVVSALRRLPIGDPFEPGTLVGPLIHETAYRDMV
GALESARADGGEVIDGDRRHPFAVEHPSSYYVAPAVVRMPAQTPIVATET
FAPILYVLTYDRLDDAIALNNAVPQGLSSAIFTTDLREAERFLDESDCGI
ANVNIGTSGAEIGGAFGGEKQTGGGRESGSDSWKAYMRQSTNTVNYSGAL
PLAQGVEFG
41409510NP_962346.1 hypothetical protein MAP3412 [Mycobacterium avium subsp. paratuberculosMSRPKWLPTWRLRAMFAAGLSAMYAAEVPGYATLVQVCTRVNADHVARHP
DAQRWGSLRRVTAERHGAIRVGSPAELRAVADLFAAFGMAPVGYYDLRRA
ASPIPVVCTAFRPVDGNELSLNPFRMFTSMLATRDRRYFDRDLRARVDNF
LAHRQLFDPALLARARSIAAAGGCADDAARPFVAAAVASFALSGKPIERS
WYDELSRVSAVAADIAGVCSTHLNHLTPRVLDIDELYRRMTGRGIAMIDA
IQGPPATGGPAVLLRQTSFRALAEPRRFRGDDGRITEGTVRVRFGEVEAR
GVALTPRGRRRYDAAMAADDPAAVWANYFPATDAQMAAEGLGYYCGGDPS
APIVYEDFLPASAAGIFRSNLDAETPGAAQAAPAVDDSGYDQDWLAGALG
REIHDPYPLYEALAQEAPR
41409509NP_962345.1 hypothetical protein MAP3411c [Mycobacterium avium subsp. paratuberculoMSETLDDVDRILVRELVADGRATLAELAASARLSVSAVQSRVRRLEARGV
ITGYSARIEPEAVGHRLSAFVAITPLDPSQPDDAPARLQHIEEIESCHSV
AGEESYVLLVRVESARALEDLLQRIRTAANVRTRSTIILNTFYDNRVYVP
41409508NP_962344.1 L-lysine aminotransferase [Mycobacterium avium subsp. paratuberculosis MTAALERLARARSCTGPDRVHEVLSRSILTDGFDFVLDLDRSRGSVLYDA
RDGRRYLDMFTFFASSALGMNHPALARDAEFRAELAAAALNKPSNSDVYS
VPMARFVETFVRVLGDPALPHLFFVDGGALAVENALKVAFDWKSRHNERR
GVDPALGTRVLHLRGAFHGRSGHTLSLTNTKPVTVARFPRFDWPRIDAPH
LRCGADIDALEAESLRQARAAFAAHPHDIACFIAEPIQGEGGDRHFRPEF
FAAMRRLCDEHDALLIFDEVQTGCGLTGTAWAYHQFGVQPDVVAFGKKTQ
VCGIMAGRRVDEVADNVFAVSSRLNSTWGGNLADMVRARRILEVIEADEL
FEHAARQGAYLLRGLHDLAREFPGLVLDVRGRGLMCAFSLPTTADRDELI
GRLWRGGVIVLPTGDDGVRFRPALTVSRGEIDAAIGAVRDALPTLG
41409507NP_962343.1 hypothetical protein MAP3409c [Mycobacterium avium subsp. paratuberculoMQKADERSGGDRLGQEDREVHAAIRFAVLCAAGAVGFLLIAAVWVSTCPT
GGVDTVACGPPQRTLLAFGGPLIALAGGIWAFVRTYRVWKARGTWWGWHG
AGWFLLTVMALMVAMGVAPIAGPVLAL
41409506NP_962342.1 hypothetical protein MAP3408c [Mycobacterium avium subsp. paratuberculoMGDTFHDPVDHLRTTRPLAGESLIDVLHWPGYLLVVAGVVGACGSLAAFA
TGHHHEGMTAGVTAVIAAVLGLVWLAVEHRRIRRIADRWYAEHPEVHRQW
PAS
41409505NP_962341.1 hypothetical protein MAP3407c [Mycobacterium avium subsp. paratuberculoMTNRLERTVHGGLQSSSSVSRPLPGDHMKDAGLHADKRPRGHRAVELHVA
ARLENLAMLRTLVGAIGTFEDLDFDAVADLRLAVDEVCTRLIRSATPDAT
LIVVVDPQDDQLVVEASAACDTHDVVAPGSFSWHVLTSLADDVQTFHDGR
EPNEAGSVFGITLTARRAASSR
41409504NP_962340.1 RNA polymerase sigma factor SigF [Mycobacterium avium subsp. paratubercMTARAAGGSVSRPNEYADVPDMFRELATAEPDSMEFQRQRDKIVERCLPL
ADHIARRFEGRGEPRDDLVQVARVGLVNAVVRFDVDAGSDFVSFAVPTIM
GEVRRHFRDNSWSVKVPRRLKELHLRLGTATADLSQRLGRAPTATELAAE
LEMDREEVVEGLVAGSSYNTLSIDSGGGSEEEEVRAIADTLGDVDTGLDR
IEDQESLRPLLEALPERERTVLVLRFFESMTQTQIAERVGISQMHVSRLL
AKSLTRLRDQLQ
41409503NP_962339.1 hypothetical protein MAP3405 [Mycobacterium avium subsp. paratuberculosMESAMSVAQSWQQSRTAQFTARWGLTGTLITVDGELDAANADQLAAYVQQ
SVNRSRRVILDLRGLNFIGTAGFSALHRINVICSAAQTSWAMAPSPAVAR
LLRLCDPDGTLPVTTPKAEPLLEPRRANDDESPGPLLQLVTKPR
41409502NP_962338.1 AccA3 [Mycobacterium avium subsp. paratuberculosis K-10]MPICQTGGAVASHASSRISKVLVANRGEIAVRVIRAARDAGLSSVAVYAE
PDADAPHVRLADEAFALGGQTSAESYLDFGKLLDAAAKSGANAIHPGYGF
LSENADFAQAVIDAGLIWIGPSPQSIRDLGDKVTARHIAARAQAPLVPGT
PDPVKDADEVVAFAKEYGVPIAIKAAFGGGGKGMKVARTIEEIPELYESA
VREAVAAFGRGECFVERYLDKPRHVEAQVIADQHGNVVVAGTRDCSLQRR
FQKLVEEAPAPFLSDAQRKEIHESAKRICKEAHYYGAGTVEYLVGQDGLI
SFLEVNTRLQVEHPVTEETAGIDLVLQQFKIANGDKLDITEDPEPRGHAI
EFRINGEDAGRNFLPAPGPVTRYDIPTGPGVRLDSGVEAGSVIGGQFDSM
LSKLIVYGADRQQALARARRALDEFHVEGLATVIPFHRAVVRDPAFIGDD
NGFAVHTRWIETEWNNTVEPFTGGEPLDDEDARPRQKAVVEVGGRRLEVS
LPGDLALSNGGSADPAGVIRKKPKPRKRGGHGGATASGDAVTAPMQGTVV
KVAVEEGQEVSAGDLVVVLEAMKMENPVTAHKDGVITGLAVEAGAAITQG
TVLAEIK
41409501NP_962337.1 hypothetical protein MAP3403 [Mycobacterium avium subsp. paratuberculosMSIPAPLAEVVSDFAEVQGQDKLALLLEFANELPPLPPELEEAAMEPVPE
CQTPLFMHVDASDRNRVRLHFSAPAESPTTRGFAAILATGLDRQPAADIL
AVPEDFYDDLGLAALISPLRLRGLSAMLARIKRRLRESPG
41409500NP_962336.1 hypothetical protein MAP3402 [Mycobacterium avium subsp. paratuberculosMPLPPDPHPSLQEYAHPERLVTADWLSANLGAPGLVIVESDEDVLLYDVG
HIPGAVKIDWHTDLNDPRVRDYIDGARFAELMDRKGISRDDTVVIYGDKS
NWWAAYALWVFTLFGHPDVRLLNGGRDLWLAERRETTLDVPTKTSTGYPV
VTRNDAPIRAFKDDVLAILGSQPLIDVRSPDEYTGKRTHMPEYPEEGVLR
GGHIPTARSIPWAKAVDESGRFRSRAELEELYGFLRPDDKTVVYCRIGER
SSHTWFVLTHLLGKPGVRNYDGSWTEWGNTVRTPIVAGEEPGQAPAGV
41409499NP_962335.1 Maf-like protein [Mycobacterium avium subsp. paratuberculosis K-10]MTRLVLASASAGRLKVLRQAGVDPLVVVSGVDEDAVIAALGPDASPSAVV
CALATAKADRVAGALQAGVAADCVVVGCDSMLFIDGGLCGKPGSADAALR
QWRRIGGRSGGLYTGHCLLRLRDGDITHREVESACTTVHFASPVEADLRA
YVAGGEPLAVAGGFTLDGLGGWFVDGIDGDPSNVIGVSLPLLRTLLTRVG
LSVSALWAAD
41409498NP_962334.1 hypothetical protein MAP3400 [Mycobacterium avium subsp. paratuberculosMSSATSDENGSAATEAAPHEPHIQILKGEPTVEEVAALVTVLGCVGGAPE
PEQPEKTRWGLPVDRLRFAMSNYQRLTMQQMTHLRR
41409497NP_962333.1 AccD5 [Mycobacterium avium subsp. paratuberculosis K-10]MTSVTDHTAEPAAEHSIDIHTTAGKLAELHKRREESLHPVGEEAVEKVHA
KGKLTARERILALLDEDSFVELDALARHRSKNFGLENNRPLGDGVITGYG
TIDGRDVCIFSQDATVFGGSLGEVYGEKIVKVQELAIKTGRPLIGINDGA
GARIQEGVVSLGLYSRIFRNNILASGVIPQISLIMGAAAGGHVYSPALTD
FVVMVDQTSQMFITGPDVIKTVTGEDVTMEELGGAHTHMAKSGTLHYVAS
GEQDAFDWVRDLLSYLPPNNATDPPRYAEPHPAGAIEDNLTDEDLELDTL
IPDSPNQPYDMHEVITRILDDDEFLEIQGGYAQNIVVGFGRIDGRPVGIV
ANQPTQFAGCLDINASEKAARFVRTCDCFNIPIIMLVDVPGFLPGTGQEY
NGIIRRGAKLLYAYGEATVPKITVITRKAYGGAYCVMGSKDMGCDVNIAW
PSAQIAVMGASGAVGFVYRKQLAEAAKKGEDVDALRLQLQQEYEDTLVNP
YVAAERGYVDAVIPPSHTRGYIATALRLLERKIAHLPPKKHGNIPL
41409496NP_962332.1 3-ketosteroid-delta-1-dehydrogenase [Mycobacterium avium subsp. paratubMDRGVRRAGGGIRCRRRHRRLHRGARGPRGAARRGDVEFGGTTAYSGGGG
VWFPCNPVLIRAGTDDTIEDALTYYHAVVGDRTPRELQETYVRGGAPLIE
YLEADPHLAFVPLPWPDYYGKAPKARLDGQRHIAAKPLPVAAAPEFRTLI
RGPLDTDRLGAEPPSDYYLGGRALIARFLRAIGEFPTATLRRDTALVELV
RSDGRVVGAVVETGGERRAVRARRGVLLAAGGFEANPDLRRAYGVPGQAR
DTMGGPGSRGLALQAGIAVGADTDLLDQAWWSPGLTHPDGRSAFALWFTG
GIFVNQSGDRFVNESMAYDRAGRQILAQLRDGSLRLPYWMIYDDKEGAVP
PVKATNVSLVETEKYVAAGLWHTADNLPELAAKIGVPAQRLTATVLRFNG
FAAAGVDEDFGRGDEAFDRAFSAGASPLVPIDTPPYHAAAFGVSDLGTKG
GLRTDTAARVLDTAGRPIPGLYAAGNTMAAPSGTTYPGGGNPIGTSMLFS
HLAVLDMRDRRP
41409495NP_962331.1 biotin--protein ligase [Mycobacterium avium subsp. paratuberculosis K-1MSSRLGPVTDRDRLRAPLDAAALRAELIGTGLGWRRLDVVEQTGSTNADL
LARAAAGDDVAGAVLIAEHQTAGRGRHGRGWSATPRAQVTMSVGVSVVDV
PAAGWGWLPLATGVAVVDTVAPLLQPAGVAVGLKWPNDVLAGPAGTPGKL
AGILAEVSKPVVVIGLGLNVTQSADEIDGPGATSLLDLGVAAPDRTALVS
GLLRELGRRIVSWQAARGADWALAADYRARSLTIGTRVRADLPGGKHVEG
TASGIDDQGRLCLDSGGQTVVVAAGDVVHLR
41409494NP_962330.1 hypothetical protein MAP3396c [Mycobacterium avium subsp. paratuberculoMGYPDNVLAAGEHVIVHRHPHWKRLIGPVLVLVLGTGLAAFGSGYLDSTH
FEQLAKNIIHGVIWGIWLVIVGWLTLWPFFGWLTTHFVVTNRRVMFRHGV
ATRTGIDIPLARINSVEFRDRITERMLRTGTLIIESASQDPLEFHDIPRL
REVHALLYHEVFDTLGSEESPS
41409493NP_962329.1 hypothetical protein MAP3395 [Mycobacterium avium subsp. paratuberculosMSFAEATIARLPRLLQPYLLRHHELIKFAIVGGTTFVIDSAIFYTLKLTI
LEPKPVTAKVIAGIVAVIASYVLNREWSFRNRGGRERHHEALLFFAFSGV
GVLLSMAPLWFSSYVLQLRQPTVSLTVENVADFISAYIIGNLLQMAFRFW
AFRRWVFPDQFARDPDKALESALTAGGIAEIFEDAFEDDGGNVTLLRAWR
NRAGRLTQLGDSSEPRVSKTS
41409492NP_962328.1 phosphoribosylaminoimidazole carboxylase ATPase subunit [Mycobacterium MAVPSTRPPGAASAKAAPRAVPRAVPVVAMVGGGQLARMTHQAAIALGQS
LRVLATAADESAALVASDVVIGSHTDLEDLRRLAAGADVLTFDHEHVPGE
LLDKLVAEGVNVAPPPQALVHAQDKLVMRRRLESLGVPVPRYAEINSLDE
LDAFARRVGGPVVVKAVRGGYDGRGVRMARDPVHAREIAAAFLADGVPVL
AEEQVSLRRELSALVARSPFGQGAAWPVVETVQRDGICVQVIAPAPGLGE
DLAADAQRLALRLAGELGVVGVLAVELFETTDGALLVNELAMRPHNSGHW
TMDGSRTGQFEQHLRAVLDYPLGDTDALAPVTVMANVLGARERPRMSVDE
RLHHLFARMPDARVHLYGKAERPGRKVGHINFLGDFPAADTAGLAALRRR
AELAAHWLSHGQWTDGWDPHEQERHQ
41409491NP_962327.1 phosphoribosylaminoimidazole carboxylase catalytic subunit [MycobacteriMSVTEAPRVAVIMGSDSDWSVMADAAAALAEFDVPAEVRVVSAHRTPGVM
FDYARDAAGRGIEVIIAGAGGAAHLPGMVASATPLPVIGVPVPLGRLDGL
DSLLSIVQMPAGVPVATVSIGGARNAGLLAVRILGASDPGLRARIVEFQT
QLADSVRAKDEALQRLHGKVTGQ
41409490NP_962326.1 FadE25_4 [Mycobacterium avium subsp. paratuberculosis K-10]MAGWAGNPDFDLFQLPEEHQELRAAIRALAEKEIAPHAADVDENSRFPQE
ALEALNAAGFNAVHVPEEYGGQGADSVAACIVIEEVARVDTSASLIPAVN
KLGTMGLILRGSDELKKQVLPSIADGSAMASYALSEREAGSDAASMRTRA
RADGDDWILNGAKCWITNGGKSSWYTVMAVTDPDKGANGISSFMVHKDDE
GFTVGPKEKKLGIKGSPTTELYFENCRIPGDRIIGEPGTGFKTALATLDH
TRPTIGAQAVGIAQGALDAAIAYTKERKQFGRPVSDNQGVQFMLADMAMK
VESARLMVYHAAARAERGESHLGFISAASKCLASDVAMEVTTDAVQLFGG
YGYTQDFPVERMMRDAKITQIYEGTNQIQRVVMSRALLR
41409489NP_962325.1 hypothetical protein MAP3391c [Mycobacterium avium subsp. paratuberculoMIPAQAAVTPAAQRQSLKPLSVLLVEDDRGDAVLVEELVTDAVTDIRVVW
AQSMAHAERELESTRPDCVLLDLHLPDPSGIDALNRIAKLDATVPIVVLT
GLNDEYFGASAVAAGAQDYLVKGRVEPEMLRRALLYAIERKRAELIAADL
HATQLRARENALLERGLLPSPLLLDDPGVDIVARYRPSREDALLCGDFYD
VVQTPDRVVHVLIGDVAGHGPHEAALGGGAADRVPSTHPGRRARRRTDAP
AGAGAALRTHRHRDLRDRAQPGDLAAAARGQRHPRRPSGDAAAGRRHRGM
GRTAGRAGARAARRRLAAPPAAAARGARPAVAHRRALRGVFGAGDPTARR
GRPARPGPLAGRSLRPGVRRRPDRRRPATGPAARRPHR
41409488NP_962324.1 hypothetical protein MAP3390c [Mycobacterium avium subsp. paratuberculoMTAPRPLRLTQLTVRGWLALVLWIMGTTVLVGAVLLHRTDQVSRQVADGV
GPARVAAARLQAALRDQETGLRGYLIAADRQFLAPYYDGQRTEQAAADEI
RRLVGGNAGNTELIADLDAVESAAADWRTNYAEPVIASVTPRAPAVVSAP
TADLGKAKFDHLRALFETQNMHLAQAAASATAELHEINGWRDWVLGAMVL
AILGTGLFLGLFSRAAITRPIAQLAASCRRITEGNFVETIVAPKRPKDIR
DMAIDVENMRKRMVEELDMSRSAQEQLDEQAAELRRSNTELEQFAYVASH
DLQEPLRKVASFCQLLERRYGDQLDERGLEYIGFAVDGAKRMQALINDLL
TFSRVGRLGTTEAEVQLDATLDAGLANLAAAVEETGAEIVRPAELPRIVG
DPMLLTMLWQNLIGNAIKFRHKDRRPRVVIECAPGEGTHDGEWLLSVSDN
GIGIPEEFSDKVFVIFQRLHGREVYAGTGVGLALVKKIVEHHGGTVRIDT
SYTDGTRFEFSLPMPGPVDETDAVALEGAQQ
41409487NP_962323.1 hypothetical protein MAP3389c [Mycobacterium avium subsp. paratuberculoMTTAGRAIDILLVEDDPGDELITREAFEHNKLNNRLHVAHDGEEGLNYLY
RRGEFADAPRPDLILLDLNLPKYDGRQLLEKIKSDPDLAQIPVVVLTTSS
AEEDILKSYKLHANAYVTKPVDLDQFMKAVRQIDEFFVQVVRLPSA
41409486NP_962322.1 hypothetical protein MAP3388c [Mycobacterium avium subsp. paratuberculoMVAPAVGGGRSCVSFARSGAVLSLLAAAALTLTGCGGDSKSSSGSGAHVD
CGGKKVLKDSGSTAQQNAIEQFVYAYVRACPGYTLDYNANGSGAGVTQFL
NNQTDLAGSDIPLDRTTGQTDRAAARCNSPAWDLPTVFGPIAVTYHLTGV
SGLKLDGPTVAKIFNGAITKWDDPALKAVNPGLNLPSTPIAVIFRSDKSG
TTANFQKYLDGASNGAWGKGTSEMFTGGVGQGASGNNGTSALLQNTEGSI
TYNEWSFAVGKQLSMASIITSAGPDAVPITKESVEKTIAGATFQGQGNDL
VLDTSSFYRPTQQGAYPIVLATYEIVCSKYPDAATGSAVKAFMQAAIGPG
QDGLDQYGSIPLPGSFTAKLSSAVNAIS
41409485NP_962321.1 PknD [Mycobacterium avium subsp. paratuberculosis K-10]MSDNGPAAQVGSWFGPYRLVRLLRQGGMGEVYEAEDTRKHRLVALKLISQ
QFSGNPEFSARLQREADIAGRLTEPHVVPIHDYGEIDGRFFVEMRLVDGI
DLGSLLHREGPLAPPRAIAIIRQVAAALDAAHAAGVTHRDVTPGNILVTP
SDFAYLADFGIARAASDPGLTQVGTAIGTYYYMAPERFTDDEVTNSVDIY
SLACVLTECLTGVPPYRADTVERLVAAHLTKTAPPLSQLRPGAFPPALDR
VIAKGMAKRPEDRYRTAGEFAAAAHEALTTSEQRKAATILRDGQIAALGA
GAAEQRSTHWPDSFAPSPSAETVVGPSPARAGAPSSGLIRAAPTGSGRVY
APGPDFGRPAAPTDNKRKQWIIVGAVALVALVAFVVAVVGYLSTASSGPA
KQAGGQSVLPFNGIDFRLSPGGVTLDGTGNVYVTSEGMYGRVVKLAAGSG
ATTVLPFNGLYQPQGLAVDGAGTVYVADFNNRVLSMAAGSNSQKELPFSG
LNYPEGVAVDSQGGVYVADRGNSRVLKLAAGSQNQTVLPFTGLNNPDGVA
VDPAGNVYVADTDNNRVVKLDAASNTQSELPFHDLSVPWGIAVDNGGTVY
VTEHDKNDVMKYPPGATSGTVLPFTALNTPLAVAVDRDQSVYVADRGDDR
VVKLVQ
41409484NP_962320.1 hypothetical protein MAP3386 [Mycobacterium avium subsp. paratuberculosMPHETPNGKPPKPLDGFRVLDFTQNIAGPMAGQVLADLGAEVIKIEAPIG
EAARHITAVLPGRPPLATLFLPHNRGKKSVLADLRDDEAKQRILRLVDTA
DVVLEGFRPGVMERMGLGPEELQGRNPRLVYARLSAYGGNGPEGSRPGVD
LMVAAESGMTTGMPTPTGKPQIIPFQLVDAASGHVLAQAVLAALLNRERH
GVADVVRVAMYDVAVSLQASQLTIHLNKPNADHKPSDSASKPKRRKGVGF
ATQPSDAFKAADGYLVISAYVPKHWDKLCEVIGRPDLRDDERFADQRSRA
LNYPELTEELEKALAAKTADEWVRLLQDAGLMACHAYTWKQVVGTPLFAE
NELALQVGEGADAVTVIRTPARYSSFEAASAGWATDPPPALGQHTEEYLG
APQTAS
41409483NP_962319.1 hypothetical protein MAP3385 [Mycobacterium avium subsp. paratuberculosMARTDDDTWDLATSVGATATMVAAGRARATRDGLIDDPFAEPLVRAVGVD
FFTRWAAGELDAADVDVPGAAWGMQRMTDMLTARTRYIDAFFAEAGAAGI
RQVVILASGLDARAYRLPWPAGTTVFEIDQPRVLEFKAATIAQLGAEPTA
PVRAVAVDLRHDWPSALRQAGFDVGRPAAWAAEGLLGFLPPQAQDRLLDN
VTALSADGSQLVAEVFANTGASGDALNAAGEKWRRHGLDVALDDLGFPGE
RNDPASYLQQLGWQPVRTPLNQMLANNGLPLQSTEPGAPFAQNYYCTAVL
NKAG
41409482NP_962318.1 CtpC [Mycobacterium avium subsp. paratuberculosis K-10]MNLASVRAIGDEGLTKDPALQVMSDAAGRMRVSVGWVRADSRRAVAVEEA
VAKCDGVRVVHAYPRTGSVVIWYSPRRCDRSAVLAAIGEAAHVTAELIPA
RAPHSSEIRNADVLRMVIGGAALALLGVRRYVFARPPLLGPSGRLFATGV
TVFTGYPFLRGALRSLRSGRAGTDALVSAATVASLVLRENVVALTVLWLL
NIGEYLQDLTLRRTRRAISELLRGSQDTAWIRLEHNEIQVATDTLQIGDE
VVVHDHVAIPVDGEVIDGEAIVDQSAITGENLPVSVVVGMPVHAGSVVVR
GRLVVRARAVGNQTTIGRIITRVEEAQHDRAPIQTVGENFSRRFVPTSFI
VSAITLAVTGDVRRAMTMLLIACPCAVGLATPTAISAAIGNGARRGILIK
GGSHLEQAGQVDAIVFDKTGTLTVGRPVVTNIVAMHKDWEPEQVLAYAAS
SEIHSRHPLAEAVIRSTEERHITIPPHEECEVLVGLGMRTWADGRTLLLG
SPSLLQAEKVKVSKKAKEWVDKLRRQAETPLLLAVDGTLVGLISLRDEVR
PEAAGVLKKLRANGIRRIVMLTGDHPDIAAVVADELGIDEWRAEVMPEDK
LAAVRDLQEEGFVVGMVGDGINDAPALAAADIGIAMGLAGTDVAVETADV
ALSNDDLHRLLDVRDLGSRAVDVIRENYGMSIAVNAAGLIIGAGGALSPV
LAAILHNASSVAVVANSSRLIRYRLN
41409481NP_962317.1 hypothetical protein MAP3383 [Mycobacterium avium subsp. paratuberculosMAVYGLLAKAAGTVVTGLVGVTAYEVVRKAVAKAPLHETAVKGAELGLRG
TRKAEEAAESARLKLADVMAEARERIGEETPTPSIADTHDHEH
41409480NP_962316.1 hypothetical protein MAP3382 [Mycobacterium avium subsp. paratuberculosMLRADPVGPRITYYDDATGERIELSGVTLANWAAKTGNLLRDELGAGPAS
RVAILLPAHWQTAAVLFGVWWIGAEAVLAGPADLALCTPPRLDEADATGA
GEVAVLSLDPFGRPVSDLPIGVTDYATAVRVHGDQIVPEPRPGPALDGRS
VDQVLQQCRSSAAARGLTAADRVLSSASWPDPDALVDGLLAILAVGGSLV
QVANADPAVQQRRIESEKVTRVL
41409479NP_962315.1 hypothetical protein MAP3381 [Mycobacterium avium subsp. paratuberculosMPVQRVVRVIATALTLAVVLGTGIAWSNVRSFEDGIFHMSAPSLGKGGDD
GAIDILLVGLDSRTDAHGNPLSQQELETLRAGDEEATNTDTIILIRIPNN
GKSATAISIPRDSYVAAPGLGKTKINGVYGQTREAKRASLVKAGDSAEDA
AAQGTEAGREALIKTVADLTGVTVDHYAEIGLLGFALITDALGGVDVCLK
EPVFEPLSGADFPAGPQRLSGPEALSFVRQRHELPRGDLDRVVRQQVVMA
SLAHRVISGQTLSSPATVKRLEAAVQRSVVISAGWDVMDFVQQMQKLAGG
NVAFATIPVLDGAGWSDDGMQSVVRVDPHQVADWVGSLLHDQEQGKTEEI
AYTPAKTTASVVNDTDINGLAAAVSDVLSAKGFATGTVGNNDGGHVKTSQ
VRAAKSDDLGAKEVSKELGGLPVVADSSLAPGAVRVVLANDYSGPGSGLS
GTESIMPAKVSTAGAVSTNDKAPAPSPILTAGSDKPECIN
41409478NP_962314.1 RmlD [Mycobacterium avium subsp. paratuberculosis K-10]MSGRIVIAGAGGQLGGYLSALAAGQGRDVVALTSAQWDITDPAAAEHIVR
PGDVVINCAAYTDVDGAESDEAGAFAVNEAGPGHIARACARAGARLLHVS
TDYVFGGESPAGAPDRPRPYEPGDPVAPQGVYARSKVAGERAVLAALPDP
AQGVVVRTAWVYTGGTGKDFVAVMRRLAAGEGPVQVVDDQIGSPTYVGDL
AAALLQIVDDRVPGPVLHAANEGAVSRFEQARAVFEECGADPARVRPVGT
EHFPRPAPRPTYSALGSRESAAAGLRPLRPWRPALVAALTNAGSPAAADR
PLPSTRD
41409477NP_962313.1 WbbL [Mycobacterium avium subsp. paratuberculosis K-10]MVTVTYSPGPHLERFLASLSLATEREVCVLLADNGSTDGTPQAAVERYPN
VRLFHTGANLGYGTAVNRAVAQLDRGGEWVIVANPDVQWGPGSIDALLDA
AARWPRAGALGPLVRDPDGSVYPSARHLPSLVRGGMHAVVGPFWKNNPWS
TAYRQERLEPSERPVGWLSGSCLLVRRSAFERVGGFDERYFMYMEDVDLG
DRLGKAGWLSVYVPSAEVLHHKGHSTGADPASHLAAHHRSTYMFLADRYS
GWMRAPLRWALRASLAVRARLMVRSALRESGRRVEGRH
41409476NP_962312.1 RmlA2 [Mycobacterium avium subsp. paratuberculosis K-10]MGTPEVDVVILVGGKGTRLRPLTLSAPKPMLPTAGLPFLTHLLSRIAAAG
IEHVILSTSYQAAVFEAEFGDGSKLGLQIEYVTEERPLGTGGGIANVAGQ
LRHDTVMVFNGDVLSGADLGQMLDFHAAQQADVTLHLVRVSDPRAFGCVT
TEDGRVTAFLEKTQDPPTDQINAGCYVFARRVIDRIPRGREVSVEREVFP
ALLSDPDVKVCGYVDATYWRDMGTPEDFVRGSADLVRGIAPSPALHGHRG
EQLVHDGAAVSPGAVLIGGTVVGRGAEIGPGVRLDGAVIFDGVKVEAGSV
IERSIVGFGARIGPRALIRDGVIGDGADIGARCELLRGARVWPGVSIPDG
GIRYSSDV
41409475NP_962311.1 hypothetical protein MAP3377 [Mycobacterium avium subsp. paratuberculosMRDSVLALLTQWDPPDAAQDSLRHAVLAFVHARPDACRRECEPGHVTAST
LVLDHTGDRVLLTLHRRLGRWVQLGGHCDDDAGIVAAALREATEESGIDG
LRMAPGLAAVHVHPVTCSLGLPTRHLDLQFVAHAPAGARIAISDESEDLR
WWPVDGLPAGTDHALAYLVAQATRASR
41409474NP_962310.1 hypothetical protein MAP3376 [Mycobacterium avium subsp. paratuberculosMTTFAGKAAASADKVRGGYYTPAPVARFLAHWVRRAGPRIVEPSCGDGAI
LRELARLSDRVHGVELIPHEAAKARRFAPVSAESLFSWLATAEDGGWDGV
AGNPPYIRFGNWASPQRDPALALLRREGLRPTRLTNAWVPFVVAGTVLVR
DGGRVGLVLPAELLQVGYAAQLREFLLSRFRDITLLTFERLVFDGVLQEV
VLFCGVVGTGPARIRTVTLAGADALADIDVERLASAPALLHEHEKWTKYF
LDPAAIELLRALKASATLTRLGALAEVDVGIVTGRNAFFTFTDEQVTALG
LRRHCVPLVSRSAQLSGLIYDTDCRASDLAARQRGWLLNAPREPADPALT
AHIRAGEAAGVHRGYKCSIRTPWWSTPSLWQPDLFLLRQIHAAPRLTVNA
AGPTSTDTVHRVRVGPGVDPAALAAVFHNSVTFAFAEIMGRSYGGGVLEL
EPREAEQLPLPRPECADADLVGDVDLLLKAGELDKALDVVDRRVLIDALG
VPPRAVADCRAAWACLRDRRKRRASR
41409473NP_962309.1 F420-0--gamma-glutamyl ligase [Mycobacterium avium subsp. paratuberculoMSPAGEHGTAAPIEILPVAGLPEFRPGDDLGAAVAKAAPWLRDGDVVVVT
SKAVSKCEGRLVPAPADPEERDRLRRKLVDEEAVRVLARKGRTLITENRH
GLVQAAAGVDGSNVGRDELALLPLDPDASAAALRARLRELLGVEVAVLVT
DTMGRAWRNGQTDAAVGAAGLAVLHGYSGAVDQHGNELLVTEVAIADEIA
AAADLVKGKLTAMPVAVVRGLSVTDDGSTARQLLRPGTEDLFWLGTAEAI
ELGRRQAQLLRRSVRRFSAEPVPAELVREAVAEALTAPAPHHTRPVRFVW
LQTPAVRTRLLDAMKDKWRADLAGDGRPAESIERRVARGQILYDAPEVVI
PMLVPDGAHSYPDAARTDAEHTMFTVAVGAAVQALLVGLAVRGLGSCWIG
STIFAADLVRTELGLPADWEPLGAIAIGYAAEPAGPRGPADPGDLLIRK
41409472NP_962308.1 LPPG:FO 2-phospho-L-lactate transferase [Mycobacterium avium subsp. parMLCEAQVKVTVLVGGVGGARFLLGVQQLFGLGQFRAQRHTHGRPDTAAGS
HELTAIVNIGDDAWIHGLRVCPDLDTCMYTLGGGVDPERGWGHRDETWHA
KEELARYGVQPDWFGLGDRDIGTHLVRTQMLNAGYPLTQITAALCDRWQP
GARLLPVSDDRCETHVVITDPDDGSRRAIHFQEWWVRYRAQVPTHSFAFV
GAEKAAATTETIAAIADADVILIAPSNPVVSVGAILAVPGVRGALRAAGA
PIVGYSPIIGGKPLRGMADACLSVIGVESTAEAVGRHYGARRGTGILDCW
LVSQDDHADIEGVAVRAVPLMMTDPAATAEMVSAGLQLAGVTP
41409471NP_962307.1 hypothetical protein MAP3373 [Mycobacterium avium subsp. paratuberculosMVPTVLMYRQFEQVIESRSATPESAGQPGNDTDVIRHGLTCRVKHFGAFP
YHLVIEFRRFCCFAPSACRSHRSQFPTSFPTSGVQPQL
41409470NP_962306.1 WhiB2 [Mycobacterium avium subsp. paratuberculosis K-10]MSYENLRGAMAGTPHTPIDSAPARPVRPHLTVVPDAPVAFEPEPLPAPVA
DQWQDRALCAQTDPEAFFPEKGGSTREAKKICLGCEVRHECLEYALEHDE
RFGIWGGLSERERRRLKRGII
41409469NP_962305.1 hypothetical protein MAP3371 [Mycobacterium avium subsp. paratuberculosMRGPLLPPTVPGWRSRAERFDMAVLEAYEPIERDWQDRLADLDVAVDEIP
RISAKDPDSVQWPPEVIADGPIPLARLIPAGVDIRGNATRARIVLFRKPI
ERRAKDTVELGELLHEILVAQVAIYLDVEPSVIDPTIDDD
41409468NP_962304.1 hypothetical protein MAP3370c [Mycobacterium avium subsp. paratuberculoMRVSGASAAFAHDSLSSVNVPRRCCRPGCPHYAVATLTFVYSDSTAVVGP
LATAREPHSWDLCVNHAGRITAPRGWDLVRHAGPLPTHPDEDDLVALADA
VREGGSAERTLPYAGAAVPRNGFGDPHLHPGGAQATAPSSSLIAPPEQRS
GRRRGHLRVLPDPSD
41409467NP_962303.1 phosphomannomutase/phosphoglucomutase [Mycobacterium avium subsp. paratMSRPAATVHRVVKAYDVRGLVGEELDQPLVADLGAAFAKVMRAEGAGQVV
IGHDMRDSSPTLAAAFAAGVTGQGLDVVRIGLASTDQLYFASGLLDCPGA
MFTASHNPAAYNGIKLCRAGARPVGADSGLRTIADDVIAGVEDYDGPPGS
VGDRDVLADYGRFLRSLVDTSGLRPLRVAVDAGNGMAGLTTPAVLGPIES
ITLAPLYFELDGSFPHHEANPLDPANLVDLQAYVRETGADIGLAFDGDAD
RCFVVDERGNPVSPSTVTSLVAARELGREIGATIIHNVITSRAVPELVSE
RGGTPLRSRVGHSYIKALMADTGAIFGGEHSAHYYFRDFWGADSGMLAAL
YVLAALGEQDRPLSELTADYQRYESSGEINFTVADAGQCTEAVLRSFGTR
IHSLDHVDGVTVDLGDGSWFNLRSSNTEPLLRLNVEGRTAEDVAAVVAQI
SAEIAAITAGTTTEADAGAAP
41409466NP_962302.1 hypothetical protein MAP3368c [Mycobacterium avium subsp. paratuberculoMNATRAIDLEDTEGLLSADRDGLLRAASSAGAQVRAIATAVEEGALEPLR
VEDRPRSVIWVAGRGTAETAGVMLSATLGGVASQPFALAGEAPPWVGPLD
VLVVAGDDPGDPALVAAAATGVRRGARVVVVAPYEGPLRDSTAGRAAVLA
PRLWVPDEFGLCRYLAAGLAVVHAVDPRPSVDLGLLADELDAEALRNSAG
RELFTNPAKLLAARIADRQVALAGDSAATLALARHGSSVLLRVANQVTPA
TGLADAVVAMRAAVPRALEDPDAALFHDEQIDGPLPPRLRVLAVVLAAEQ
TVVAARTAGLDDVYLLAAEDVPDGPGGSAGSGVSPALGGPGRTEQQLAVL
AVRLEMAAVYMRLVRG
41409465NP_962301.1 hypothetical protein MAP3367c [Mycobacterium avium subsp. paratuberculoMELLRGALRTYAWGSRTAIAEFTERPVPAAHPEAELWFGAHPGDPAWLET
DNGEITLLDALRADPEGQLGPGSRARFGDVLPFLVKVLAADEPLSLQAHP
SAEQAAEGYLREERLGIPLNSPVRNYRDTSHKPELLVALYPFEALAGFRP
ASRTVELLRALAVSDLDPFIELLGDQSDADGLRALFTTWITAPQPDIDVL
VPAVLDGAIAYLSSGATEFAAEAKTVLELGERYPGDAGVLAALLLNRVSL
APGEAIFVSAGNLHTYLRGFAVEVMANSDNVLRGGLTPKHVDVPELLRVL
DFAPTTEDQLRPRVRREGFGRIYETPTDEFAVALLELEDEYVGHEVDATC
SHDGPQILLCIQGCTTVHGKSGSLRLKRGMAAWVAADDAPIRLVAHEPTK
LFRATVGL
41409464NP_962300.1 hypothetical protein MAP3366 [Mycobacterium avium subsp. paratuberculosMPDGKANAREHALVIGGSIAGLCAARVLSESYSAVTVCERDELPAAPASR
ATVPQDRHLHLLMARGAIEFEKLFPGLLDDMTAAGVPRLHNRPECIHLGA
AGHVLGTGQTLRDEFTAYVPSRPQLEWQLRKRVHAIGNVTVLRRSVAQPR
FDPARARVTGVWLDPVAGGSAEFVAADLVVDAAGRGTRLPVWLSQWGFQR
PPEEVIDIGINYATQHFHIPDGLIAQKVVVAGASHDEPLGLGMLCYEDRV
WVLTTFGVADAKPPRTFPEMLTLARRLLPAHFGDALARAEPLGDPAFHAF
PASRWRRYDKLDRVPAGIVALGDAVASFNPTFGQGMTMTALQAGHLRRAL
RCPDDRLAAALYRATARTTFPVWTMNAIGDVTFHHATTKRPAPWWWRPSG
ALFDQFLGAAETEPVLAEWFLRRFSLLDSLYLIPPPRIVGRAVGHNMRLW
LGQRRRAGRPGTATARPSP
41409463NP_962299.1 hypothetical protein MAP3365c [Mycobacterium avium subsp. paratuberculoMASRWRTKSVEQSIADTDEPDTRLRKDLTWWDLVVFGVAVVIGAGIFTVT
ASTTGDITGPAIWVSFVIAAGTCALAALCYAEFASTLPVAGSAYTFSYAT
FGEFLAWIIGWNLLLELAIGAAVVAKGWSSYLGTVFGFSGGTVKFGAAQL
DWGALVIVGGVATLIALGTKLSSRFSAVITGIKVSVVVFVVVVGVFYIKR
ANYSPFIPKPEAGGQAKGIDQSVLSLLTGAHTSHYGWYGVLAGASIVFFA
FIGFDIVATMAEETKHPQRDVPRGILASLGIVTLLYVAVAVVLSGMVSYT
QLKTMPGRGQANLATAFTANGIHWASKIISIGALAGLTTVVMVLMLGQCR
VLFAMARDGLLPRALAKTGSRGTPVRITVLVALVVAVTASVFPITKLEEM
VNVGTLFAFVLVSAGVMVLRRTRPDLERGFKAPWVPVLPIASIGACVWLM
LNLTALTWVRFGIWLVVGTAIYAGYGYWHSVQGRRDAGEPDRSDALAADP
NSPVP
41409462NP_962298.1 hypothetical protein MAP3364c [Mycobacterium avium subsp. paratuberculoMALQTDTFCLDRRRRRRYCQPPTWCDSRGGFQMTTVDLQQPSDPAAWRDK
KRRLWLMGLIAPTALFVMLPLVWALNRLGWHAAAQVPLWIGPILLYVLLP
ILDLRFGPDGQNPPDEVMERLENDKYYRYCTYVYIPFQYLSVILGAYLFT
ATDLSWLGFHGGLGWAGKLGLALSVGVLGGVGINTAHEMGHKKDSLERWL
SKITLAQTCYGHFYIEHNRGHHVRVATPEDPASARFGETFWEFLPRSVFG
SLRSALRLEAQRLRRLGKNPWNPLTYPSNDVLNAWAMSIVLWGVLIAVFG
PGLIPFVVIQAVFGFSLLEAVNYLEHYGLLRRKIDSPSGKARYERCTPEH
SWNSDHVVTNLFLYHLQRHSDHHANPTRRYQTLRSLDGSPNLPSGYASMI
SLTYFPPLWRKVMDHRVLAHYGGDITRVNVSPRRRAKLLARYPAVTA
41409461NP_962297.1 hypothetical protein MAP3363c [Mycobacterium avium subsp. paratuberculoMRIRVRRGQGLAGGRHRPGHPLGRHPGGLELPGLRRGEKRLRDGGSGAAL
IGLKPDAQTRYCRGCEADAVRRGVARPAARLGAGCDAGSAGDPGLVGHHA
VRRGPGRRHQPSDHLQRVRLPARPGAGVRAAPSRPPGRHHPRGPGRPRRQ
HLRVVPGRLPQVLRRRGGRPAGDLAAHRRRQARPVAADHHRQRGHHHPRV
GAAGLGADAHLGVHHRRGRRGAGPRHRAAGAELRVDAARGRPRRGRRSGP
VDDAVRRAARRRQRRVSVPWPRRGADPRLQWRKNIPKLITQ
41409460NP_962296.1 S-adenosyl-L-homocysteine hydrolase [Mycobacterium avium subsp. paratubMTTTENALTPDVRNGIEFKVADLSLADYGRRDIELSEQEMPGLMSLRREY
HDVQPLKGARISGSLHMTVQTAVLIETLVALGAEVRWASCNIFSTQDHAA
AAVVVGPHGTPEEPRGVPVFAWKGETLEEYWWAAEQALTWPPLADGTEAP
ANMILDDGGDATMLVLRGAQYEKAGVVPPDDEDDSAEHRVFLNLLRARFE
TDKTKWTKISESIKGVTEETTTGVLRLYQFAAAGDLAFPAINVNDSVTKS
KFDNKYGCRHSLIDGINRGTDVLIGGKNVLVCGYGDVGKGSVESLAGQGA
RVTVTEIDPINALQALMEGYNVKRVEDVIGEADIVITATGNKDIITLEHM
KAMKDKAILGNIGHFDNEIQIARLEKSGAIKTNIRPQVDLWTFPDTGKSI
IVLSEGRLLNLGNATGHPSFVMSNSFSNQVIAQIELWTKNDEYDNEVYRL
PKHLDEKVARIHVEALGGELTKLTKEQAEYIGVDVDGPYKADHYRY
41409459NP_962295.1 thymidylate kinase [Mycobacterium avium subsp. paratuberculosis K-10]MLIAIEGVDGAGKRTLAEGLRKAFEAAGQSVATLAFPRYGRSVTADIAAE
ALHGEHGDLASSVYAMAMLFALDRAAAVGDIEGLRRDHDVVIMDRYVASN
AAYTAARLHQDADGPAVAWVHTLEYGRLKLPAPDRQVLLAVSAELAAERA
RSRAESDPGRARDSYERDDGLQQRTGAVYAQLAAAGWGGAWRVVDADVDP
ARLAADLAAG
41409458NP_962294.1 hypothetical protein MAP3360c [Mycobacterium avium subsp. paratuberculoMDSMRQRILVVDDDASLAEMLTIVLRGEGFDTAVIGDGTQALTAVRELRP
DLVLLDLMLPGMNGIDVCRVLRADSGVPIVMLTAKTDTVDVVLGLESGAD
DYIMKPFKPKELVARVRARLRRNDDEPAEMLSIADVEIDVPAHKVTRNGE
QISLTPLEFDLLVALARKPRQVFTRDVLLEQVWGYRHPADTRLVNVHVQR
LRAKVEKDPENPTVVLTVRGVGYKAGPP
41409457NP_962293.1 hypothetical protein MAP3359c [Mycobacterium avium subsp. paratuberculoMWGSRRRTRSRWGRSGPMTRGMGAVSRAVGTAWRRSLQLRVVALTLGLSL
AVILALGFVLTSQVTNRVLDVKVKAAIEQIERARTTVGGIVNGEEARSLD
SSLQLARNTLTSKTDSASGAGTAGTFDAVLMVPGDGPRAATTAGPVDQVP
ASLRGFVKAGQASYQYATVHTDGFSGPALIVGSPASSQVANLELYLIFPL
KNEQATIQLVRGTMITGGAVLLVLLAGIALLVSRQVVVPVRSASRIAERF
AEGHLSERMPVRGEDDMARLAMSFNDMAESLSRQITQLEEFGNLQRRFTS
DVSHELRTPLTTVRMAADLIYDHSADLDPTLARSTELMVNELDRFESLLN
DLLEISRHDAGVAELSVEAVDLRSTVQSALSNVGHLAEDAGIELQVELPA
EEVIAEVDTRRVERILRNLIANAIDHAEHKPVKIRMAADEDTVAVTVRDY
GVGLRPGEEKLVFSRFWRADPSRVRRSGGTGLGLAISIEDARLHQGRLEA
WGEPGVGSCFRLTLPLVRGHKVTTSPLPMKPIPQPSPSGGQSPSTGPQHA
KDRARQREHAERSL
41409456NP_962292.1 lipoprotein LpqB [Mycobacterium avium subsp. paratuberculosis K-10]MGRKLLGLLMLAVLLAGCAGVPSSSAPQAIGTVERPAPSNLPKPTPGMDP
DVLLREFLKATADPANRHLAARQFLTQSASNAWDDAGSALLIDHVVFVET
RAAERVSATMRADILGSLSDMGVFETAEGVLPDPGPIELVKTSGGWRIDR
LPNGVFLDWQQFQATYKRNTLYFADPTGKTVVPDPRYVAVPDHDQLATEL
VSKLIAGPRPEMAHTVRNLLAPPLRLRGPVTRADGGKSGIGRGYGGARID
LEKLSTTDPHSRQLVAAQIIWTLARADIRGPYVINADGAPLDDRFRDGWT
TSDVAATDPGVADGAGAGLHALVNGSLVSLDGQHTVVVPGAFGRMGDQTG
AALSRNGRQVASVVTLHRGAPDMAASLWIGDLGAEAVQSADGHSLSRPTW
SLDDVVWVVVDGNNVLRAIQEPASGQPARLPVDSVAVATRFPGPITDLQL
SRDSTRAAMVIGGQVILASVEQTQAGQYALTYPRRLGFGLGNSVVSLSWR
TGDDIVVTRTDSSHPVSYVNLDGVNSDAPPHGVQMPVTTVVANPSTAYVA
GPQGVLQYSPSADGQQGWSEVPGLTVPGAAPVLPG
41409455NP_962291.1 hypothetical protein MAP3357c [Mycobacterium avium subsp. paratuberculoMSWGFGDDCWVQGRSDDQRELLDAESVAGHLLKADSMFAFLAAHRSQLFP
EEMFADLFPSQRGRPSVPAEVMASVITLQALHGFSDNETVDAVTFDLRWK
AACGLPITAGAFHSTTLTYWRRRLAASDRPNRIFEAVKTVVAETGVLAGK
TRRALDSTVLDDAVATQDTVTQLIAAIRRVRREVPGAAAVIEAHCSAHDY
DDPGKPAIAWEDKAARDRLVDGLVGDAHRVLGYLPDQELAPRAAEAVALL
ALIAGQDVEPVEGSDGTDGHWRIAQQVSGDRVISTVDADTRHAHKTVHRR
QDGFKAHLAVEPDTGIITDCALTKASGADNHEAVVGLSLLEGEHTPGAGP
GRFGVWHRGRPGGTGRRRPCRGDQTATATLAGSGWLHQRRFPHRFRRPHR
DLPGWTRNADPSQWRSHLRKILSLMPVGVPVHDRHARTQTHPSYPRAIIA
RCSRRGPRPRLASRIPPTPAHGGTLNGLAHSRQPQGPLPRNRQKQPLAAP
PRRSTEPTSAAHHGPDPHRHHLGHRLTRPHTKALPQPPTAATLNNGGAIS
FLSTHRV
41409454NP_962290.1 hypothetical protein MAP3356c [Mycobacterium avium subsp. paratuberculoMLDLFLPAECGGCAAPATRWCPACAAELVVKPDEPHVVNPRVDPGVPVFA
LGRYANTRRRALLALKEHGRADLVAPLAGALAVAVHRLLCWGIVATPLTV
VPAPTRRSAARRRGGDPVTRLARAAVARHPDIAVASVLRIRALTRDSVGL
GTAERERNIAGRVVLRGRPAPLPGADVLVVDDVVTTGATARESVRVLHAA
GARVAAVLAIAAA
41409453NP_962289.1 hypothetical protein MAP3355c [Mycobacterium avium subsp. paratuberculoMSRLSVDSGQILDQSSPSTDGQGQPTATAEVVFKGRNVEIPDHYRLYVSQ
KLARLERFDRSIYLFDVELKHAPNRRQRKSCQRVEITARGRGPVSRAEAC
ADSFYAAFESAVDKLENRLRRVKDRRKVHYGDKTPVSLAAATAVPPHAPL
PSEPQPAADHDGVEPDTELDREPGRIVRTKEHPAIPMTVDDALYEMELVG
RDFFLFQDKQTERPCVVYRRHAYDYGLIRLA
41409452NP_962288.1 preprotein translocase subunit SecA [Mycobacterium avium subsp. paratubMLSKLLRLGEGRMLKRLKRVADYVNTLSDEVEKLTDAELRAKTDEFKKRH
ADGESLDDLLPEAFAVAREAAWRVLDQRPFDVQVMGAAALHFGNVAEMKT
GEGKTLTSVLPAYLNGIGGKGVHVVTVNDYLAKRDSEWMGRVHRFLGLDV
GVILAQMTPDERRVAYNADITYGTNNEFGFDYLRDNMAHSLDDLVQRGHN
FAIVDEVDSILIDEARTPLIISGPADGASNWYLEFARLAPLMEKDVHYEV
DLRKRTVGVHELGVEFVEDQLGIDNLYEAANSPLVSYLNNALKAKELFHR
DKDYIVRDGEVLIVDEFTGRVLYGRRYNEGMHQAIEAKEHVEIKAENQTL
ATITLQNYFRLYDKLSGMTGTAQTEAAELHEIYKLGVVPIPTNKPMIRTD
QSDLIYKTEEAKYIAVVDDVVERYQKGQPVLIGTTSVERSEYLSRQFQKR
RIPHNVLNAKYHEQEAGIVAVAGRRGGVTVATHMAGRGTDIVLGGNVDFL
TDQRLRERGLDPVETPDEYEAAWHEELPKVKAEAAAEAKEVIEAGGLYVL
GTERHESRRIDNQLRGRSGRQGDPGESRFYLSLGDELMRRFNGAALEAML
NRLNLPDDVPIEAKMVTRAIKSAQTQVEQQNFEVRKNVLKYDEVMNQQRK
VIYAERRRILEGENLKEQALEMVRDVVTAYVNGATAEGYAEDWDLDALWT
ALKTLYPVGIDYATLTRRDADGGFDDLTREELLEALLKDAERAYATREAE
LEEIAGEGAMRQLERNVLLNVIDRKWREHLYEMDYLKEGIGLRAMAQRDP
LVEYQREGYDMFMAMLDGMKEESVGFLFNVTVEAVPAPQVAPVQTPEGLA
ELGAPAEQGGTATAARDEAPTQLRAKGIDNEAPAMTYSGPSEDGSAQVQR
NGGDAKTPAGVPAGASRRERRAAARQQGRGAKPPKSVKRR
41409451NP_962287.1 hypothetical protein MAP3353c [Mycobacterium avium subsp. paratuberculoMRGGGVGAHHACMTTTRTPLDAATAVLDDPALPAGDDERFVGFGVMGLPF
GSGHYLALRQFPATSFSPGYRSVWHRDRDGVWTFYATTPGPQSCARYFGA
ATARDAVQCDIDVAWVTPWSLLVEIPGLLAWRIELRATVATRLMSALGAR
LPQRAWTSRAVLAVLGRAAGPLLRAGRVRLCGTVPNGQRFMLAPAQVWAV
HHSRAVLDGADLGPVGPLRRQARLAGFRPPQRGVFAVGGGHFENFDPGRH
HAAPRTVAIG
41409450NP_962286.1 hypothetical protein MAP3352c [Mycobacterium avium subsp. paratuberculoMMLMAQAVLPTRAELLAALSVAIDLGLGQPAEHMLRAALIATRLCDRLGL
SRQQRDCVYYTTLVMWIGCHADSHEYARWFGDDIAVRHDSYLVDWSGIPY
LRFLASNVGRGQPLAHRLSVMATLFANARGHISRLIHSHCASAALLADRI
GLGPNVQAALAYTFERYDGGGLPTGARGEDIPIQMRIAQLADMVEVHHRS
YGVAGAVAMVGARRGGQFDPGIADVFLRDADAILAGPQTGDAWAAALREA
PDRHRVDEQSLDAALVALGDFVDLKCPFTLGHSRAVARLAGQAARAAGLD
ADAVALTRRAGHVHDLGRIGVSNQIWSRPGPLSGSQFERVRLHPYLTVRI
LDQVPGLRRLAEVAGNHHECLDGSGYPRGLAGPALGMPDRILAAAVCYQS
GREPRPYREQLSEAEAARRLRGRVRCGELDPVAAEAVLHAAGQPVGPRPN
PRPDGLTPREIEVLGHVARGASNKEIAAALVISEKTARNHVERTYAKIGV
SNRIGASMYALQHGLVPAAPLHS
41409449NP_962285.1 hypothetical protein MAP3351c [Mycobacterium avium subsp. paratuberculoMKRYLVVGYGAAAYLLFLGAFLYLVAFLGNFWVPRTVDHGLSSPIGEAVV
VNLVLLGLFGVQHSVMARPGFKAWWTRLVPATIERSTYVVLSSAVLVLLY
WQWRTMPAVIWEVTAPAGRLVLWTLFWLGWVIALAATFMVSHFDLFGLRQ
VYLAWRGKPYSHIGFHARMLYRMVLHPLMLGFVIAFWAAPTMTAGHLLFS
IAMTGYILLAVHLEEHDLVQALGDQYRDYRHRVPMLVPLGHRPRRHPTQP
AGLP
41409448NP_962284.1 hypothetical protein MAP3350c [Mycobacterium avium subsp. paratuberculoMDVKEVLLPGVGLRYEFTDHKGDRVGIIARRSGDFDVVVYAREDPDEARP
VLHLSNEEAEAVAQILGAPRIAERFTELAKEVPGLETGQVHILAGSPFVD
HPLGDTRARTRTGASIVAIVRDDEVLASPGPSEMLHARDVLIVIGTEDGI
AGVEKIIDKG
41409447NP_962283.1 hypothetical protein MAP3349c [Mycobacterium avium subsp. paratuberculoMQISGTLLLQLGALLATLAVLGAAARRFALSPIPVYLLAGLALGKGGLLP
LATGGQFITTSAPIGVVLLLLTLGCEFSLAEFSSSMRHHLPSAAVDVVLN
AAPGAIAGWLLGLDGVAILCLAGVTYISSSGVVARLLEDLHRLGNRETPA
VLSVLVLEDFAMAAYLPLFAVLASGGGWLHAVVGMVVAVSALVAAFAASY
RWGHHVQRLVEHPDSEQLMLRVLGITLIVAAMAESLHASAAVGAFLVGLT
LTGETATRTRQVLAPLRDLFAAIFFLAIGYSVDPHELIPMLPAALILAAA
TAATKVATGIFAARHDGVARRGQLRAGTALIARGEFSLIIIGLAGSSLPA
VAALATSYVFIMAIAGPVLARYTGPRPAAPAT
41409446NP_962282.1 hypothetical protein MAP3348 [Mycobacterium avium subsp. paratuberculosMNTGPVANPSDAFTVVPVVDYEPQTQDVPRALAQCRPSARAPLRRGSGHA
SPRACGGPPGRAAAPPSGAVMSAQLREAAVFADAALRRVLEVIDRRRPAA
QLNPLLAPSLVDSVVAVGRSLTGPAPGAAVLRRMRLQPAGHGDPQTAAEV
FGCYSRGNRMHAIACRVEQVPGAGGTRWMVVALHIG
41409445NP_962281.1 hypothetical protein MAP3347c [Mycobacterium avium subsp. paratuberculoMVSRLSPADASFYRLENTATPMYVGSLAILRRPRAGLSYETLLHTIEQRL
PQIPRYRQKVREVPVGTARPVWIDDGDFDITYHVRRSALPSPGSDEQLHE
LIARLAARPLDKTRPLWEMYLVEGLSKNRLALYTKSHQALINGMTALEIN
HVIADRTKRPPAFPEDIWVPERDPGNTRLVLGAIGEWLVGPSAQLQAVGS
AIGGLVTNYGELVDAGRRVFDFVRNVARGTAPSSPLNATVSRHRRFTVAS
GSLEDYRTVRARYDCDVNDVVLAVIAGALGSWLMSRGVAVSPTATVRAMA
PLSVYADGDLDVSGPGQAISQVMPFLVDLPVGEPNAVVRLSQIAHATESN
PTAAHLVDARTIVTLSGFAPPTLHAMGIRVATSFPSFSKRTFNLLITNAP
GAQSQMYVAGTKLLETYSVPPLLHNQALAIGVTSYNGMLYYGINADREAM
SDVDLLPALLNQALEELVEAARS
41409444NP_962280.1 PvdS [Mycobacterium avium subsp. paratuberculosis K-10]MGLSFVAVSSAKNDGVPLKAGKKKSARAAVKIPDAVYEAELFRLQTELVK
LQEWVRHSGARLVVVFEGRDAAGKGGAIKRITENLSPRVARVAALPVPTD
RERGQWYYQRYIAHLPSKGEIVLFDRSWDNRAGIEKVMGFCTPQEYVLFL
RQTPIFEQMLIDDGILLRKYWFSVSEAEQLRRFKARLKDPVRRWKLSPID
LESVYRWEDYSRAKDEMMVHTDTPESPWYVVESDIKKHARLNMMAHLLST
IPYHAVEAPPVKLPRRPVVTGNYQRPPRELSRYVDDYAATLI
41409443NP_962279.1 hypothetical protein MAP3345c [Mycobacterium avium subsp. paratuberculoMATVYIPATLAMLQRLVADGSLAAVNGTAFALTPALREAYAEGDDDELAE
VALREAALASLRLLAGAEHEAEHGALPPRRAVLAADVDDLTYRPDLDDAV
VRLAGPVRIEDVIAAYVDNAAAEPAVAKAIEAVDAADLGDEDADLIVGDA
QDHDLAWYASQELPFLLELL
41409442NP_962278.1 hypothetical protein MAP3344c [Mycobacterium avium subsp. paratuberculoMSNTMSKTTSPITANLGDTKRPVVAGAERHPGWHALRKLAARITTPLLPD
DYLHLANPLWSARELRGRVVDVRRETEDSATLVIKPGWGFNFDYQPGQYI
GIGLLIDGRWRWRSYSLTSSPATSASARTVTITVKAMPEGFLSSHLVAGV
EPGTVVRLAAPQGNFVLPDPAPASILFLTAGSGITPVMSMLRTLVRRNQI
GDIVHLHSAPTEADVMFRGELAALANEHPGYRLQLRETRTRGRLDLSLLD
REVPDWRERQTWACGPEGMLNAAERVWSAAGIGEQLHLERFAVSKAAPAG
AGGMVTFARSGRSVDADAATSLMDAGEAAGVQMPFGCRMGICQSCVVGLV
EGHVRDLRTGAEHEPGTRVQTCVSAASGDCVLDI
41409441NP_962277.1 DesA3_1 [Mycobacterium avium subsp. paratuberculosis K-10]MAITDVDVFAHLTDADIENLAVELDAIRQDVEDSRGERDARYIRRTIAAQ
RALEVTGRLLLAASSRRSAWWAGTVTLGVAKIIENMEIGHNVMHGQWDWM
NDPEIHSSTWEWDMSGSSKHWRYTHNFVHHKYTNILGMDDDVGYGMLRVT
RDQRWKRFNLFNLVWNTLLALLFEWGVGLQHVEIGKILKRRMDHEEARQR
IDEFLAKAGRQVVKDYVAFPALTSLSPGATFLSTLKANAMANVIRNVWAN
AVIFCGHFPDGAEKFTKTDMIGETKGQWYLRQMLGSANFEAGPVLRFMSG
NLCHQIEHHLYPDLPSNRLHEISVRVRQVCDKYDLPYTTGSFLFQYAKTW
RTLAKLSLPNKYLRDDADNAPETRSERMFAELDPDFLGTDPATGRRRGLK
SAIAAVRGWRRGKRASVARRTGGELAA
41409440NP_962276.1 hypothetical protein MAP3342 [Mycobacterium avium subsp. paratuberculosMTATGIEGYRAFLARRDGEADLLNRRLANREQFFTHIEANPVRSARPADR
ATFLRNLRRRKPEPGLDDKMLFLLATAKLNQAERFGVGLGETYGRNSDES
LPPENVYLELEEHYHTRLLAYALDVFDLTFQVVPPPFVMRQFVKTGVFLP
ERLGFMFVGAAEMAGCILFDELRRVGSALFADEPQVAERIELLYSEILTD
EIGHVGYCASRCSTAERAIMRRLYPLIGRLFARQTAEISLLVDPKALRAR
LDRPFDVDELTAGVDNETYLVAHP
41409439NP_962275.1 hypothetical protein MAP3341 [Mycobacterium avium subsp. paratuberculosMTIVSEMPYGASMQSPATPSARGGGIREARRRETRARLFDAALAEISQRG
LAAADVSAIVADAGVARGTFYFHFPTKEHVLVEVERAEETRIVSELGGAT
GDLAAVLNQLVQHVLSAEKPWAQRFSGTCSDCTSARRGRSKTSWRSTRSD
SSWWASSAGPRTPGRSPPTLTRPNSRRSSSPGCSRCWPPAHTTVRC
41409438NP_962274.1 hypothetical protein MAP3340 [Mycobacterium avium subsp. paratuberculosMYRHCPALTTFAAMRTHGWQGEPPRSDEDAVARIVAAADRCVRRRGGQTT
IADVAAELGVSRKTVYRYFPSTTALLRAVATEGTRKFLEAMAERLSTIDD
IAEAVVEGVVLTVTAVPDEPYLQLLLEEPSHALLRSITSETARRVGQQVL
VEHTSVDWERTPMASRTLDELVEWSLRAVHSFLANPSDPPRDADQLRGYL
RRWLAPAIRQWVQQAAAGTIV
41409437NP_962273.1 hypothetical protein MAP3339c [Mycobacterium avium subsp. paratuberculoMSGQCSDDIERIANRLGFGCEHAAPWVTLRNPFGLANWTLPVLELLMVAG
AVLALWWAIRRLRRDRDPVNIVIWFATVIYLLIVEPPLYFPTVFRVDGTI
GAVFAHNVFTVQFMYDRLPLYIVGLYPAMLTLAYEVVRSLGVFRDWGAIV
GAVCVGFVHNCYYEIFDQLGPQLRWWAWNADNAINRPMLASVPLSSVLLF
ATVGPACVALFAQLLVTRPIERGRRLSRIALTGRTFGVAVLVPVGLVVAN
VPILLTGGQHPDGGLRRALYFALLAVFAVVAIPVLLRQWRNAAFTPSAPN
TFVAIFGSAYLLVLGSLWVLAMPAYLNAAHGLTRDGTPTGSLAYALVCFV
LAVGLTVSVTVPVGRLSGFLRRTDRREVMP
41409436NP_962272.1 hypothetical protein MAP3338 [Mycobacterium avium subsp. paratuberculosMTETRYIPFHGVRVHYDSAKSYDQLRAALLADIGEQPVPLNDIATDAGDW
ESYRKRVESHVGPSGFMLIVLIDHGAWITKAGIERRALRVILGNPLIAIT
MLRHDVTAGLFAPVELLLAEEGSGSSLTYVKPSSLMVPERDPAPNPELLA
AAEALDERLAALAVKVTGSVSEFA
41409435NP_962271.1 FadA6_4 [Mycobacterium avium subsp. paratuberculosis K-10]MNRDAVIVGAVRTPIGKGKASGALHDVLPADLLAHSLRELVARTGVDPAQ
IDDVIAGAVTQVGDQAVNIARNALLGAGFPESVPGVTIDRQCGSSQQAIN
FAAQGVIAGAYDVVIAAGVESMGRVPMGSQVLPGSNPFGEAMNARYPEGL
VPQGISAELIAAKWGFSRTQLDEFSAASHEKAARATKDGLFDNELIPIAG
LATDEFIRPGTTVQTLAGLQPAFYSEATEARFPQINWEITAGNSSPLSDG
SAAVLITSSETAARLGLRPLARIHTTAVVGSEPLYMLTGVIPATEKVLSK
AGLTLADIDLFEVNEAFAPVVLAWAQDTGADLDKTNVNGGAIAIGHPLGA
SGARIITTLVNALEQRGGRYGLQTMCEGGGMANATIIERLS
41409434NP_962270.1 hypothetical protein MAP3336c [Mycobacterium avium subsp. paratuberculoMLQGPLADRDAWSAVGECAIEKTMAVVGTKSAMLIMREAYYGTTRFDDFA
RRVGITKAATSARLAELVELGLLKRRPYREPGQRSRDEYVLTQAGIDFMP
VVWAMFEWGRRHLPGRHRLQLTHVGCGAEVGVEIRCAEGHLVPPDELGMR
LAKNSG
41409433NP_962269.1 hypothetical protein MAP3335 [Mycobacterium avium subsp. paratuberculosMRPGDYDESDVKIRSGRGSRPRTKTRPEHADARAAMVVSVDRGRWGCVLG
GDPDRRVTAMRARELGRTPIVVGDDVDVVGDLSGRPDTLARIVRRGERRT
VLRRTADDTDPTERVVVANADQLLIVVALADPPPRTGLVDRALIAAYAGG
LVPILCLTKTDLAPPEPFAQQFADLDLTVVAAGRDDPLPAVADLLAGKVT
VLLGHSGVGKSTLVNRLVPDADRAVGAVTEIGKGPHTSTQSVALPLTERL
GTTGWVIDTPGIRSFGLAHIQPDDVVMAFSDLAEAIADCPRGCGHMGPPA
DPECALDTLTGPAARRVAAARRLLDALNQNS
41409432NP_962268.1 3-phosphoshikimate 1-carboxyvinyltransferase [Mycobacterium avium subspMTTWTAPLAPQPVHATVTVPGSKSQTNRALVLAALAAAQGRGTPTLSGAL
RSRDTDLMIGALRTLGLRVDGTGPELTVSGHIAPGPHARVDCGLAGTVLR
FVPPLAALADAVVEFDGDEQARARPIAPLLDALRGLGVRIEGTALPFRVH
GSGALAGGTVAIDASASSQFVSGLLLCAASFTEGLTVQHTGAALPSAPHI
AMTVAMLRQAGVDVDDSVPNRWQVRPGPVAARHWEVEPDLTNAVPFLAAA
VVSGGTVRITGWPADSVQPADNILSVLGKLNAVVSQTDSSLEVRGSGSYD
GFDVDLRAVGELTPSVAALAALATPGSVSRLSGIAHLRGHETDRLAALSA
EINRLGGDCTETPDGLVITATPLRPGVWHAYADHRMAMAGAIVGLRVAGV
RVDDIGATSKTLPDFPRLWARMLDASLPDGEEHGM
41409431NP_962267.1 hypothetical protein MAP3333c [Mycobacterium avium subsp. paratuberculoMCGRFAVTTDPAQLAQKIKAIDETTGAAPSDTAPNYNVAPTSTIATVVSR
HSEPEDEPTRRVRLMRWGLVPPWAKAGPDGAPETKGPMLINARADKVTSS
PAFRASAKSKRCLIPMDGYYEWRVNSDAAAGKKPRKTPFFMYSEDGEPLF
MAGLWSVWKPAKDAPPLLSCTIITTDAPGELAQIHDRMPLVMPERDWDRW
LDPDAPVDEELLTRPPDVHAIGMREVSTLVNNVRNNGPELLEPAKPEPEQ
ARLL
41409430NP_962266.1 hypothetical protein MAP3332 [Mycobacterium avium subsp. paratuberculosMSSDREAVSAAFDAIDAALDDLLDCDYVALATREKLALLNRCEKLRRRLP
AVEHPLINALARDATPAELGGRLSHAIAEATLISRAEAARRVHTAADLGP
RVGLTGEPLPPLLAATAAAQREGSLGLEQVAVIRKFCHQLPGWIDQATRE
RAEADLAREATRYRPEQLAALAGTLADCLNPDGLYRDEDRARRRSLTLGN
QHADGMSELRGLLTPELRATLEAVLAKLAAPGMCNPLDENPCVEGTPSQH
AIDGDARSAAQRNHDGLLAGLRALLASGNLGQHNGLPASIIVTTTLADLE
TAAGRGLTGGGTLLPMSDVIRLSRHARHYLAIFDQGKALALYHTKRLASP
GQRIVLYAKDRGCTAPGCTIPGYYSEVHHCTDYATCHTTDINDLTFACGP
HHRLLQPGAWTTHKNAKGETEWIPPPHLDRNQPRTNTFHHPEKLLRGENG
GEDDDGDDDEAA
41409429NP_962265.1 hypothetical protein MAP3331 [Mycobacterium avium subsp. paratuberculosMASDSRSRRRDGDERRRQLCDAAIRVLAEHGSRGLTHGQVDRYAGVPEGT
TSYYYRTRAALLQGVGKRVAEIDVANLQSVIDEPLDPLSPFAHLARLTMM
QASGPGLMLNRARHELLLGAARDPGLAETSQIFAGRINSMARDAIAHLQP
DIRDPALLDAQTTAVTTFIAGVFTRLAAGDRNVGDAEQLAHLLEAVATAV
ALRAQRS
41409428NP_962264.1 hypothetical protein MAP3330 [Mycobacterium avium subsp. paratuberculosMRRVAAVKGISMGLRGLADKVAVVVGGATGIGAATAARLAGEGCRVVIGD
VAVDAARQTADRIAAAGGTATQVAFDLADPASVATLIDCAATTYGGVDLL
FNVGADMSTIRADTDVVDIDFDVWDRVMTVSLRGYVAAMKYAIPRMLDRG
GGAIVNMSSAAAFQGEPARPAYATAKAGIGALTRHVASRWGKDNIRCNAV
APGFTATETIRSVPQWPELEAAALKRIRGPRVGDPADVATLVAFLLSAEG
DWINGQVINIDGGTVLR
41409427NP_962263.1 hypothetical protein MAP3329c [Mycobacterium avium subsp. paratuberculoMSPGVSNSYAVATDDGRVIVNTGLVFEGPLHRKAFADIPGPARAIIVTQG
HADHWGGVNALRDGADDSDGAGDDRGTDIVMHRNYRYWRDDNALLMGYRV
PKTSFAFQKFSDAMLEHFKTIEPAALDFTFPEPTVTFDQRMNLRVGGRAF
ELAWTPGGETTDALVVWLPEERILFTGNLFGPLFGHVPNLMTIRGDRYRD
PILYIESLNTVLEFGPQRLITGHFAPIEGADRIAEEVTAMRDAMRAVHDR
TAELMNSGADLYTAMREIRVPERFDIGEGYGKTSWNVRAIWEMYTGWFRH
RSTTELYGVPPDSVAADLVDAAGAETLSEAARAHLDAGRPVQALHLTDLV
LTAEPAHARARAVAADAHEALLAGTENFWEKAWLTKSIRELRDPE
41409426NP_962262.1 hypothetical protein MAP3328c [Mycobacterium avium subsp. paratuberculoMNTVHFDFTDARVLVTGGTSGIGNAIATAFADSGAAVTVTGTRAAATGYP
DIDLGAFSYRQCHIQDPESVDALANSLSDLDILVNNAGGPYPAGDEYDPD
GYVASVTQNMFGPMRLTMRCHDLLKSSRAAGGASVVNVVSMSAFRSAVFV
PGYASSKMGLVALTMNLSRRWAGDGIRVNAIAPGLIDTRMTHPAMGIPEV
MDVEIGFHTPLGRPGTPADCAGAALFLCTEAASYITGSTIAVDGGYLTV
41409425NP_962261.1 hypothetical protein MAP3327c [Mycobacterium avium subsp. paratuberculoMSDFDNITTADDVFKLAAQRTGLSEIDSDSWREGLALIVDEVNTSPVFTP
FGRQRVLDDATNALGRRLQVHAYIQDHPEVLDAPVERPLIVLGMPRTGTT
VISYLLDQDPARRSLLHWQCVHPIPPASTETLRTDPRCLALLDEQRKILD
AVTRAKMPLPHWEDADGPTEDMFIHNQDFKGLSWDSFLPTDRYARWLFDE
ADMSSTYEYQKRYLQVLQSTAPGSWSLKMPSHSVHIEALLKVFPDARLIW
AHRDPYKATGSLCNLWRLPQSLVMNTELLDQTEMGRLAMWQMRYHVDRPL
RARERIGDERFFHMYYHEMMRDPMDVMRRIYEWADEPLTAETEARMRNWL
AHHPQDRFALNAYRLDEYGLTVEALQPIFAEYLDTFDIELEGTP
41409424NP_962260.1 hypothetical protein MAP3326c [Mycobacterium avium subsp. paratuberculoMGPRDVLVRMRACGICGSDAFYISIGGVPPRQGHTPLGHEPAGEVVEVGA
EVTGLAVGDHVVINPMAAPSGIIGNGGASGALADYLLIENAVRGTSLEVI
PDHIPWEVAALNEPMAVARHGVNRCQPRPTDKVVVFGAGPIGLGATLAFK
SLGVQHIVVIDLIPGRLDKAVRIGADAVVNSAEEDVAARLVELHGSGESM
FPGKAGTDIYLDAAGAPAVVSTALAAAKKGATLGIVGVHKEPVPVDLINV
MSNEITIVGSMGYPDEIFEVTGDLVRNWEKYALIVSHTIPFDRVGEALEL
ARTPGAADKVVVTFC
41409423NP_962259.1 short chain dehydrogenase [Mycobacterium avium subsp. paratuberculosis MSLNGKTMFISGASRGIGLAIAKRAAQDGANIALIAKTAEPHPKLPGTVY
TAAKELEEAGGQALPIVGDVRDPESVEAAVAKTIEQFGGIDICVNNASAI
NLGSITEVPMKRFDLMNGIQVRGTYAVSQACIPHLKGRENPHILTLSPPV
LLGKEWLEPTAYMMAKFGMTLCALGIAEEMREAGIASNTLWPRTLVATAA
VQNLLGGDEAMGRARKPEVYSDAAYVILNKPAREFTGNMLLCEDVLVESG
VTDLSVYNCVPGSQLGVDFWVDGVNPPGYTGP
41409422NP_962258.1 RNA polymerase sigma factor RpoE [Mycobacterium avium subsp. paratubercMVSTATSLLGEEQLAGFLASPGALSVLSGDTAAEGTGFIEMADSPDGPDG
VTSPEVPEAHAEPAAHEEAREETDAELTARFERDAIPLLDQLYGGALRMT
RNPADAEDLLQETMVKAYAGFRSFRAGTNLKAWLYRILTNTYINSYRKKQ
RQPAEYPTEEITDWQLASNAEHSSTGLRSAEVEALESLPDSEIKDALQAL
PEEFRMAVYYADVEGFPYKEIAEIMDTPIGTVMSRLHRGRRQLRGLLADV
AKERGFNRGQQTHEEVSS
41409421NP_962257.1 hypothetical protein MAP3323c [Mycobacterium avium subsp. paratuberculoMSESSGQGDALSESCPNDDSHGAVGCAEVIRQVWLLLDGECGPDTREQLR
RHLEACPGCFKHYGLEERIKALIATKCKGEKAPEGLRERLRLEIRRTTII
RGTQ
41409420NP_962256.1 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit [MycobacMKMAEDVRAEIVASVLEVVVNEGDQIGKGDTLVLLESMKMEIPVLAEVGG
TVSKVSVSVGDVIQAGDLIAVIS
41409419NP_962255.1 hypothetical protein MAP3321c [Mycobacterium avium subsp. paratuberculoMSTLGDLLAEHTMLPGNAVDHLHAVVGEWQLLADLSFADYLMWVCRDDGM
LVCVAQCRPNTAPTVLQTDAVGTVVASERLTLVAETFASGAAKADDVAAQ
QDSWLPGTHVEASPVRYGGHVVAVLTRHQTAVAADRASGQLEIAYRECAA
DLVHMLAEGTFPDVGDVAMSRSTPRAGDGFIRLDVNGVVAYASPNALSAY
HRMGLTTELEGHNLIEITRPLISDSFEAQEMAEHVKDLLAGGKSMRMEVD
AGGATVLLRTLPLVVNGASAGAAVLIRDVTEVKRRDRALISKDATIREIH
HRVKNNLQTVAALLRLQARRTTNPEGREALIESVRRVSSIALVHDALSMS
VDEQVNLDEVIDRILPIMNDVASVDRPIRINRVGDLGVLDSDRATALIMV
ITELVQNAIEHAFDPTAAEGSVTIRAERSARWLDVVVHDDGRGLPEGFSL
EASDSLGLQIVRTLVSAELDGTLGMSEASERGTDVVLRVPIGRRTRMLL
41409418NP_962254.1 WhiB1 [Mycobacterium avium subsp. paratuberculosis K-10]MDWRHKAVCRDEDPELFFPVGNSGPALAQIADAKLVCNRCPVTTECLGWA
LNTGQDSGVWGGMSEDERRALKRRNARTKARSGV
41409417NP_962253.1 hypothetical protein MAP3319 [Mycobacterium avium subsp. paratuberculosMRAVLIVNPTATSTTAAGRDLLAHALKSRLQLAVEHTNHRGHGTELAQKA
LADGVDLVVVHGGDGTVSGVVNGLLGRPGSLPTGPVPAVAVVPGGSANVL
ARSLGISRDPVAATNQLIQLLDDYQRHHTWRRIGLIDCGERWAVFNTGMG
VDAEVVAAVEAERDKGGKVTAWRYIRAAVPAVWGYTRREPMLTLELPGRE
PITGVSFAFVSNSSPWTFANERPVWTNPGCSFESGLGVFAPTTLKPIPTL
RIVRQMFAKRPAFDFKQLITEDDLPCLRVTSTGGPVACQFDGDYLGVRET
MTFKSVPDALAVVAPPRQKRL
41409416NP_962252.1 hypothetical protein MAP3318c [Mycobacterium avium subsp. paratuberculoMRAAARREEESDGCRGYADAVTTPAAPTAVRRAGLIVLLQGVAALVVAVV
LVVRGIAGADQHVVNGLATAGWFVLVGAAVIGAGRALTRGKRWGRGLAVI
TQLLLLPVAWYLAVGSHQPGFGIPAGAVALVVLGLLFSPAAVRWAAGGQD
DSASSANRGPDSR
41409415NP_962251.1 hypothetical protein MAP3317 [Mycobacterium avium subsp. paratuberculosMSHRIRHAAPHDAAAITEMIHALAEFERAADQCMVTETRLAAALFDAAPT
VHGHVAEVDGTVAGMALWFVNFSTWDGVAGIYLEDLFVRPGFRRRGLARA
LLAALAAECVRRGYTRLSWAVLNWNTDAIALYDGIGARPQREWTTYRLSG
PRLAELAESS
41409414NP_962250.1 isochorismate synthase [Mycobacterium avium subsp. paratuberculosis K-1MNDEPTFALCGPTQTLVADGVRRSYRDVAAAQAALRSQEVSIVLGALPFD
VRRPAALLTPDTVSVSDGPPDWPARKLPSVRVAAALPPPIDYRDRICRAR
EQLAATDNPLHKVVLARALHLVADAPLDARTILRRLIAADPGAYGYLVDL
SAAGHDHAGVALVGASPELLVARTGDRVECRPFAGSAPRAADPDTDAANG
AALASSAKNRHEHQLVIETIRAALEPLCDDLSIAAEPQLSRTATVWHLCT
PISGRLHDRSTTAIDLALALHPTPAVGGVPTDAAVELIADLEGDRGFYAG
AVGWCDARGDGRWVVSIRCAQLSADRRSALARAGGGIVAESDPDDEVAET
TTKFATILNALDVR
41409413NP_962249.1 acid phosphatase [Mycobacterium avium subsp. paratuberculosis K-10]MACSPARRLGPAAPACRPAESLHMGLHNHRLVLLRHGETEWSKTGRHTGR
TEVELTEAGRTQAERAGRALSELKLVEPLVISSPRQRSLATAELAGLNVD
EVSEQLAEWDYGSYEGLTTEQIRQSVPDWLVWTHGCPGGESVAQVSGRAD
AAVTAALRQMESRDVVFVSHGHFCRAVMTRWVELPLAEGSRFAMITASIA
VCGFEHGVRQLRALGLT
41409412NP_962248.1 hypothetical protein MAP3314c [Mycobacterium avium subsp. paratuberculoMSKTRVLAVANQKGGVAKTTTVASLGAAMVDEGKRVLLVDLDPQGCLTFS
LGHDPDKLPVSVHEVLLGEVEPNAALVDTAEGMTLLPANIDLAGAEAMLL
MRAGREYALKRALAKLADRFDVVIVDCPPSLGVLTLNGLTAADEVIVPLQ
CETLAHRGVGQFLRTVADVQQITNPDLRLLGALPTLYDSRTTHTRDVLVD
VADRYSLPVLAPPIPRTVRFAEASASGSSVMAGRKNKGAAAYGELAAALL
KHWKSGKPLPTFTVEV
41409411NP_962247.1 hypothetical protein MAP3313 [Mycobacterium avium subsp. paratuberculosMVRPERRTRGDIVAAATIAVVVAATAALIWWTSDARATVSRPAAVPAPNP
SPARQVPASLKQLWTAASPATTEPVVVGGVVATGAGRRIDGRDPATGQSR
WSYARDTDLCGLSWLYRYAVGVYRDDRGCGQVSTLDGSTGRRGPARSGYA
DPRVRLSSDGMTVLSVGDTRLELWRSDMVRMLTYSETDARVKPSARGLHS
GCRLISAAASSSAVSVLESCANQADLRLVLLRPGKDDDEPQQHIVAEPGI
APDSGARVLAVREATTAVYLPAPRPRVDVIDETGTTVSSTPLPRPPSPSA
AVSHAGSVMTWWTGDSLMVFDVNTLALRYTIAAGDKTAPLGPGAMMAGRL
LVPVTGAIGVYDPISGASERYIPVDRATSGAPPGAAVVPAVSGSRVFEQR
GDTVVALG
41409410NP_962246.1 RhlE [Mycobacterium avium subsp. paratuberculosis K-10]MTTPTSTTELTFAQLGVRDEIVRALDEKGIQHPFAIQELTLPLALAGDDL
IGQARTGMGKTFAFGVPLLQRITAGTAPRALNGTPRALVVVPTRELCLQV
TDDLTLAAKHLTADGGRPLSVVPIYGGRPYEPQIDALRAGADVVVGTPGR
LLDLAQQGHLQLGGLSVLVLDEADEMLDLGFLPDIERILRQIPDDRQSML
FSATMPDPIITLARTFMNQPTHIRAEAPHSAATHDTTVQYVYRAHALDKV
ELVSRVLQAESRGATMIFTRTKRTAQKVADELAERGFKVGAVHGDLGQVA
REKALKAFRTGDIDVLVATDVAARGIDIDDVTHVINYQIPEDEQAYVHRI
GRTGRAGKAGVAVTLVDWDELARWALIDKALGLDVPEPAETYSNSPHLYE
ELGIPAGAGGRVGAARKPQGPRRSAERATGKPDQKSETATRRSGTRRRRT
RGGQPVSGHPSGNGAASSNGEAAADAPAGSPPGNPGSSRRRRRRRKPADA
TAQSN
41409409NP_962245.1 hypothetical protein MAP3311c [Mycobacterium avium subsp. paratuberculoMTRSSCQSSEAAREADRAADSPAPRLSADHPGVNELFAVLAYGEIAAFYR
LTDEAKMAPDLRGRISMASMAAAEMQHYEQLRDALESRGVDVVSAMSKYV
SALENYHRLTMPSTWLEALVKTYVGDALAADLYLEIADGLPDEVADVVRA
ALAETGHSQFVVAEVRAAVTSSSKQRSRLALWARRLLGEAITQAQYLLAG
HDELVDLVVSGAGGLGQLNAFFDRLQQTHERRMRELGLG
41409408NP_962244.1 hypothetical protein MAP3310 [Mycobacterium avium subsp. paratuberculosMVALGAIATAVIINSGDSASTKATVGASAPHSVTSAPATTKASVPPSASP
SPSRPLPAETFTTVTSPSAAPSVAPSLTPGVAPAQTPTAAPPLAAAPTVT
VDPRTVVYSVSGSKQLLDLVNVVYTDAHGVPQTEFNVSLPWSKVVVLEPG
VQTESVVATSFYGRLSCSIFNAAGQRVVASANASNMATCAR
41409407NP_962243.1 hypothetical protein MAP3309c [Mycobacterium avium subsp. paratuberculoMEVKIGITDSPRELVLTSTQTPDEVEELVSAALSDGSDLLRLSDERGRRF
LVHTSKIAYVEIGIADVRRVGFGVGAEVVGKHAGKGR
41409406NP_962242.1 hypothetical protein MAP3308 [Mycobacterium avium subsp. paratuberculosMSELAKMPARRAVKSADRGRPTDGAAASNRRGNRLPRDERRGQLLVVASD
VFVDRGYHAAGMDEIADRAGVSKPVLYQHFTSKLELYLAVLARHVENLVS
GVQQALSTTKDNRRRLHAAVQAFFDFIEHDSQGYRLIFENDYVTEPEVAA
QLRVATESCIDAVYALISEDSGLDPHRARMIAVGLVGISVDCARYWLDSD
RPISKADAVEGTVAFAWGGLSHVPLTRS
41409405NP_962241.1 hypothetical protein MAP3307c [Mycobacterium avium subsp. paratuberculoMSGGRFGRATDGAAGRLCNPGKMTSQRPPRSTGRVPVLRDEWREPLRALR
DPLAREAGRTRADRERPRQWRKQTWLGRFVSTYGWRAYALPALVVLTAVV
IYQTVTGTSSPKPTASQPIQSPTAIGAVGTTIIDAPPRGLAAFDANLPAG
TLPDGGPFTEAGDKTWHVVPGVTPQIGQGTAKVFKYSVEVENGIDPTMFG
GDDAFAQMVDQTLANPKGWTHNPQFAFIRVDATAGAKPDFRISLVSPVTV
REGCGYEFRLETSCYNPVFGANREARVFINEARCVRGAVPFEGDVGSYRQ
YVINHEVGHAIGYLHHEPCEQQGALAPVMMQQTFSTSNNDAAQFDPDVVK
ADGKTCRFNPWPYPIA
41409404NP_962240.1 molybdopterin biosynthesis-like protein MoeZ [Mycobacterium avium subspMSTPLPPLVAPADQLTADEMARYSRQLIIPGLGVDGQKRLKNARVLVIGA
GGLGAPTLLYLAAAGVGTIGIVEFDAVEESNLQRQIIHGVADVGRSKAAS
ARDSIAAINPLVDVRLHEFRLDASNAVELFGHYDLIVDGTDNFATRYLIN
DAAVLAGKPYVWGSIYRFEGQVSVCWEDAPDGRGLNYRDLYPEPPPPGAV
PSCAEGGVLGVVCASIASVMSTEAIKLITGIGESLLGRLMIYDALEMSYR
TIAIRRDPCDASRPAITTLVDYEQLCGAAPAASTDAATGGAEAAITPRQL
RELLDSGAKLALIDVREPVEFDIVHLDGAQLIPQSSINSGEGLAKLPADR
MPVLYCKTGVRSAQALAVVRQAGFSDAVHLQGGIVAWAQQMQPDMILY
41409403NP_962239.1 hypothetical protein MAP3305c [Mycobacterium avium subsp. paratuberculoMTVEPPPDHVLSAFGLAGVKPVYLGASWEGGWRCGEVVLSLVADNARAAW
SARVRETLFVDGVRLARPVRSTDGRYVVSGWRADTFVAGTPEPRHDEVVS
AAVRLHEATGKLERPRFLTQGPTAPWGDVDIFIAADRAAWEERPLASVPP
GARVAPATADAQRSVELLNQLATLRKPTKSPNQLVHGDLYGTVLFVGSAA
PGITDITPYWRPASWAAGVVVIDALSWGEADDGLIERWNALPEWPQMLLR
ALMFRLAVHALHPRSTAEAFPGLARTAALVRLVL
41409402NP_962238.1 hypothetical protein MAP3304 [Mycobacterium avium subsp. paratuberculosMAPVTDEQVERVRALVAAIPPGRVATYGDIAAVAGLSSARIVGWIMRTDS
SDLPWHRVITASGRPARHLRTRQLELLRTEGVLATDGRIPLPEVRHRFGA
41409401NP_962237.1 LipV [Mycobacterium avium subsp. paratuberculosis K-10]MTATLHVHRYGPPGPARILALHGLTGHGQRWQHLAGMLPEFALAAPDLVG
HGRSSWSAPWTIDANISALTDLLDAQAGAPVLVVGHSFGAGLAMHLAAVR
PDRVAGLLLLDPAIGLDGAWMREIAEAMLSSPDYPDAEEARLEKLHGSWS
DVEPALLDAEIDEHLIELPNGRYGWRVCLPAMMSYWSELARDPVLPPAQT
ATILVRAKRTAPPYVGDELIAALQDRLGSRFRLLDFDCNHMVPYAKPDDV
AALARELLKAR
41409400NP_962236.1 hypothetical protein MAP3302 [Mycobacterium avium subsp. paratuberculosMVLQQPKEGSRTMKDERGFPIDEPPEGDVAEQQRPVDTDDETGLDTEYVS
AGDREANEADVIDQAYIVSTEDEWDDDR
41409399NP_962235.1 hypothetical protein MAP3301c [Mycobacterium avium subsp. paratuberculoMHAAMSFTWDAQAGAVLAPGVRGTVRVLGGPGTGKSSLLVDAAVAQIEAG
VNPESVLLLTGSGRLPMAERSALTTALLRSAGAGPAVREPLVRTVHGYAY
AVLRRAAERAGEAPPRLVTSAEQDAIIRELLAGDLADGPRAATAWPAALR
PALSTAGFATELRNLLARCAERGVDPQALERLGRRCRRPEWVAAGQFARQ
YEQVMLLRAAVGTAAPEATTPALGAAELVGAALEAFAVDAELLAAERGRI
RVLLVDDAQQLDPQAARLVRVLAAGADLALIAGDPNQAVFGFRGGDPGSL
LDGAAPAVTLTRSHRCAPAVARAVSGVAGRLPGSSAGRRIEGAGPGEGSV
AVRLAASAHAEAAAIADALRRAHLVDGVPWSQMAVIVRSVPRAGARLPRA
LAAAGVPVTAPAASGPLAEQPAVRALLTVLLATADGLDGQRALALLTGPI
GRVDPVSLRQLRRNLQRANAGRPPGDFAELLVEALTGTAPPPGAPFRALR
RVRAVLDAAGRCHRDGQDPRYILWAAWHRSGLQRRWLSVSERGGPAAAQA
GRDLDSVTALFDITDDYVSRTSGASLRGLVEHVAALQLPGAEPVATAEQV
SVLSAHAALGREWDFVVIAGLQDGLWPNTVPRGGVLGTQRLLDVLDGVSA
DASVRAPLLAEERRLLVAAMGRARQRLLVTAVDSDTDGSDREAALPSPFC
YEIAQWAGEDAEPAALQPVSAPRVLSAAALVGRLRGVVCAPDGAVDELDR
RCAATQLARLAKAGVPGADPASWHGLIPVSTAEPLRGGGDVVTLTPSTMQ
TLTDCPLRWLAERHGGTDPRDLRSAIGSVVHALIAQPHRSPAELVAELDR
VWRHLPFAAQWHSDNELARHRAMLEAFAQWRANTRGALTEVGVEVEIDGT
LSTGDGREVRLRGRVDRLERDAAGRLVIVDVKTGKTPVSKDDAQQHAQLA
LYQLAVAHGLLGAAGGDAEPGGARLVYVGKAAASGVVEREQDPLTAAAAD
QWREALRRAADATAGPQFIARRNDGCTHCPLRPCCPAHADGSGR
41409398NP_962234.1 hypothetical protein MAP3300c [Mycobacterium avium subsp. paratuberculoMSDRYSPRELACALGLFPPTEEQAAVIAAPPGPLVVIAGAGAGKTETMAA
RVVWLIANGYAHPGQVLGLTFTRKAAGQLLRRVRSRLARLAGVGLGAASP
NHGAVDPEAAPVVSTYHAFAGSLLRDYGLLLPVEPDTRLLSETELWQLAF
DVVNRYRGPLRTDKTPAAVTSMVLRLWGQLAEHLVDTSQLRETHLELERL
VHALPAGPYQRDRGPSQWLLRLSGTQSERAELVPLLEALDERMRAVKVMD
FGMQMASAARLVAAFPQVGADLRGRYRVVLLDEYQDTGHAQRIALSALFA
GGVDDGLALTAVGDPIQSIYGWRGASATNLPRFTTDFPRSDGTPAPVLEL
RTSWRNPPRTLRVANAISAEARRRSVAVHALRPRPDAPPGTVRCALLPDV
VAEREWIADHIDAHYRRARADGVSPPTAAVLVRRNADAAPIADALRARGI
PVEVVGLAGLLSVPEVAELVAMLRLVADPTAGAAAMRVLTGPRWRLGARD
LAALWQRARALGGAGTAGGPATAEAIASAADPRNVEADAVCLADAIADPG
PAEGYSAAGYARIAALAAELSALRAHLDHPLGDLVAVVRRVMDLDCEVRA
AAAAGWAGTEHLDAFADVVAGYAERADTGGTDASASASVAGLLAFLDVAE
SVENGLPAAPLAVARDRVQVLTVHSAKGLEWQLVAVAHLSGGVFPSTTAK
TTWLTDAAELPPLLRGDRARPGALGIPVLDTSDVTNRKQLSDKISEHRRQ
LEQRRVDEERRLLYVAVTRAEDTLLVSGHHWAATGIKPRGPSDFLCEIKD
VIDASAAAGDPCGTVEQWAPAPADGERNPLRDNAVEAVWPADPLASRRGE
VERGAALVRQAMAAEPGDPGADVEGWAADVDALLAERARVTGPPPQALPG
QLSVSSLVGLARDPAGAARRLRHRLPSRPEPHALLGNAFHAWVQKFYGAE
CLFELGDLPGAADSDVGDTAELAELQAAFLESPWAARTPVAVEVPFEMPI
GDTLVRGRIDAVFAESDGGATVVDWKTGAPPDSPEAMRQAAVQLAVYRLA
WAALAKVPESSVRTAFHYVRARTTVVPEALPTSDELAGLLAPTAPV
41409397NP_962233.1 hypothetical protein MAP3299c [Mycobacterium avium subsp. paratuberculoMRNGRSRKLSGLNQTLAAQRGHQLVGVVRIPEEHASPIRVITRRLAIALV
VLFAAAVIVYADRSGYRDLRGGSLTFLDCVYFSAVSLSTTGYGDITPYTE
TARLVHTLIFTALRIAFLAVLVGTTLEVLSERSRQGWKIQRWRSRVRNHT
IVIGYGTKGKTAVAAILGDETTQAEVVVVDTDRSTLEHAESADLVTVHGD
ATKADVLRLAGAQHAASIIVATSRDDTAVLVTLTAREIAPHAKIVASIRE
AENQHLLQQSGADSVVVSSATAGRLLGLATTTPSVVEMIEDLLTPDVGLA
IAEREVEQSEIGGSPRHLRDIVLGVVRRPAAAHRRPRGGRGRGQRPVALH
PQRGALMAIADFQLRSVPLLSRVGADRADQLRTDVEAAAAGWADAALLRV
DSRNQVLVADGRVVLGAAAELGDKPPPEAVFLGRLEDGRHVWAIRGALQA
PDDPEVRAEVVNLRSLGPIFDDTSSQLMSSAVALLNWHERSRFSSVDGSP
TRPARAGWSRVNPVTGHEEFPRIDPAVICLVHDGGDRAVLARQAVWPERM
FSLLAGFVEAGESFEVCVAREVREEIGLTVRDVRYLGSQPWPFPRSLMVG
FHAVADPAQDFAFNDGEIAEAAWFTRDEVRAALAAGDWSSDSESKLLLPG
SISIARVIIESWAALD
41409396NP_962232.1 hypothetical protein MAP3298 [Mycobacterium avium subsp. paratuberculosMTSAPLTVYTTSWCGYCHRLMTVLKSNGIPYEAVDIEHDPAAADFVSSVN
GGNKTVPTVKFADGSTLTNPSAAQVKAKLAEAGN
41409395NP_962231.1 hypothetical protein MAP3297c [Mycobacterium avium subsp. paratuberculoMPTLADPLTAGLDDEQREAVLAPRGPVCVLAGAGTGKTRTITHRIAQLVA
GGHVAANQVLAVTFTQRAAGEMRSRLRVLAAAAGTDAAVGSVSALTFHAA
AHRQLRYFWPRVVGDTGWQLLDSKFAVVARAASRTRINASTDDVRDLAGE
IEWAKASLIGPEEYPAAVAAAGRDIPLDAARVAGVYAAYEALKARGDHVT
LLDFDDLLLHTAAAIENDPAVAEEFRDRYRCFVVDEYQDVTPLQQRVLAA
WLGDRDDLTVVGDANQTIYSFTGASPRFLLDFSRRFPDATVVRLERDYRS
TPQVVSLANQVIAAARGRVAGSKLHLVGQRPPGPVPTFHEHSDEPAEAAA
VAKSIARLIESGTPASEIAVLYRVNAQSEIYEEALTEAGIPYQVRGGEGF
FNRQEIKQALLALQRAAEREGEDAREEPLPAVVRAVLEPLGLTAEEPVGT
RARERWEALRALAELVDDEVARRPQLDFAGLLTELRMRADARHPPVVQGV
ALASLHAAKGLEWDAVFLVGLADGTLPISHALAHGADSEAVEEERRLLYV
GITRARTHLALSWALARSPGGRQSRKPSRFLNGIAPQTRAEAAPARSRRN
RSTATRCRICNNNLTTPAAVMLRRCETCAADIDEDLLVRLKAWRLDVAKE
QKVPAYVVFTDNTLIAIAELRPGDEQALIAIPGIGARKLEQYGPDVLELV
RGR
41409394NP_962230.1 hypothetical protein MAP3296c [Mycobacterium avium subsp. paratuberculoMSAPTVSRQALPCHVGDPDLWFAEAPADLERAKQLCAGCPVRRQCLAAAL
ERAEPWGVWGGEILDRGAVLGFKRPRGRPRKDGRRAGAAA
41409393NP_962229.1 hypothetical protein MAP3295 [Mycobacterium avium subsp. paratuberculosMDDGYVSDIKRGRAARNAKLASIPVGFAGRAAIGFGKRLTGKSRDEVQAE
LLEKAANQLFTVLGELKGGAMKVGQALSVLEAAVPEEFGEPYREALTKLQ
KDAPPLPAAKVHRVLDAQLGTKWRERFSSFDDTPVASASIGQVHKGVWSD
GREVAVKIQYPGADEALRADLKTMQRLVGVFKQLAPGADVQGVVDELIER
TEMELDYRLEAENQRAFAKAYQDHPHFAVPRIVASAPKVVIQEWMQGIPM
AEIIRHGTTEQRDLMGTRLLELTFDAPRRLGMLHGDAHPGNFMLLPDGRM
GVIDFGAVAPLPDGLPVELGMTIRLARDKNYDLLLPTMEKAGFIQKGQQV
SVRDIDDMLRQYVEPVEVEVFHYTRKWLQKMSAIEIDRSVSQIRTARQMD
LPPKLVIPMRVIMSVAAILCQLDAHVPIKALSEELVPGFAEPDNAIV
41409392NP_962228.1 hypothetical protein MAP3294 [Mycobacterium avium subsp. paratuberculosMPAAAVSTPAATYALDPAMPVLLRPDGAVQVGWDPRRAVLVRPPRGLAAA
ELATLLRSMCSPTPLSELQRRALEHGLTDADGLRNLVTQLVGAGVASECG
RSGGRAPSVRIHGRGPLSELLVESLRCSGARIAHSSQPHAAVSGDDVDLV
VLSDYLVADPRLVRDLHEQGVAHLPVRVRDGVGLVGPLVIPGVTSCLSCA
DLHRRDRDAAWPVICAQLRDTVGVADRATVLATAALALSQVNRVIAAVRG
QPAASDPAPPQTLNATLEFDLHAGAIVARRWDRHPLCSC
41409391NP_962227.1 hypothetical protein MAP3293 [Mycobacterium avium subsp. paratuberculosMSTVEVMADLPFGFSSGEDPDKPGKKDPDSGSNPSDPFAAFGISGEFGMG
DLGQIFTQLGQMFSSAGSASAGGSDSGPVNYELARRVASNSIGFVAPIPA
TTNSAIADAVHLAETWLDGATALPAGTAKAVGWTPADWVDNTLETWKRLC
DPMAQQISTVWAASLPEEAKSMAGPLLQMMSQMGGMAFGSQLGQALGRLS
REVLTSTDIGLPLGPKGIAAILPDAVESFASGLERPRSEILTFLAAREAA
HHRLFSHVPWLASQLLGAVEAYAMGMQIDMSGIEELARDFNPASLSDPAA
IENLLGQGVFEPKATPAQTQALERLETLLALIEGWVQVVVAAALGDRIPG
AAALAETLRRRRASGGPAEQTFATLVGLELRPRKMREAAALWERLTEAAG
VDARDGIWQHPDLLPDADDLDDPAAFIDRVIGGDTSGIDEAIARLEQEGP
DSPGSGGDT
41409390NP_962226.1 hypothetical protein MAP3292c [Mycobacterium avium subsp. paratuberculoMNRRILTLMVALVPIVVFGVLLAVVTVPFVSLGPGPTFDTLGEVDGKQVV
AIEGTMTHPTTGHLNMTTVSQRDDLTLGEALTLWLSDTEQLVPRDLIYPP
GKSREDVDKANNADFKQSEDSAAYAALGYLKYPSAVTVAKVPEPGPSAGK
LKVGDAIDAVNGTPVATVEEFTGLLKNTKPGQTVTIDYRRKNEPAGVAQI
TLGANKDRDYGFLGVAVLDAPWAPFVVNFNLANVGGPSAGLMFSLAVVDK
LTTGDLAGSNFVAGTGTISADGKVGQIGGITHKMVAAHAAGATVFLVPAK
NCYEASSDNPSGLRLVKVETLAQAVDALHAITAGGQPPSC
41409389NP_962225.1 hypothetical protein MAP3291c [Mycobacterium avium subsp. paratuberculoMGMRPTARMPKLTRRSRILILIALGVIALLLAGPRLIDAYVDWLWFGELG
YRSVFSTVLVTRFVVFLIAGLLVGGIVFAGLAVAYRTRPVFVPSNDNDPV
ARYRALVLSRLRLVSVGVPVAIGLLAGIIAQSYWVRIQLFLHGGDFGIKD
PQFGKDLGFYAFELPFYRLLLSYLFVAVFLAFVANLLAHYIFGGIRLSGR
TGALSRSARIQLVTLVGLLVLLKAVAYWLDRYELLSHTRGGKPITGAGYT
DINAVLPAKLILMAIALICAAAVFSAITMRDLRIPAIGLVLLLLSSLIVG
AGWPLIVEQISVKPNAAQKESEYISRSITATRQAYGLTSDVVTYRNYTGD
AQATAQQVADDRATTSNIRLLDPTIVSPAFTQFQQGKNFYYFPDQLSIDR
YLDRNGALRDYVVAVRELNPDRLIDNQRDWINRHTVYTHGNGFIASPANT
VRGIANDPNQNGGYPEFLVNVVGANGNVVSDGPAPLDQPRVYFGPVISNT
SADYAIVGRNGADREYDYETSTETKNYTYTGLGGVPIGDWLSRSVFAAKF
AERNFLFSNVIGSNSKILFNRDPARRVEAVAPWLTTDSSVYPAIVNKRLV
WIIDGYTTLDNYPYSELTSLESATADSNEVAFNKLAPDKRVSYIRNSVKA
TVDAYDGTVTLYQQDEQDPVLKAWMQVFPGTVKPKSDISPELAEHLRYPE
DLFKVQRMLLAKYHVNDPVTFFSTSDFWDVPLDPNPTASSYQPPYYIVAK
NIAKNDNSSSYQLTSAMNRFKRDYLAAYISASSDPATYGRITVLTIPGQV
NGPKLANNAITTDPAVSQDLGVIGRDNQNRIRWGNLLTLPVGQGGLLYVE
PVYASPGASDAASSYPRLIRVAMMYNDKIGYGPTVRDALTGLFGPGAGAA
ATNIQPTEGGAPAASPPANAPAPAVTPGSAPPVAAPPVPDGSVTLSPAKA
AVLQEIQAAIGAAKDAQKKGDFAGYGAALQRLDDAITKYNNTK
41409388NP_962224.1 Mpt64 [Mycobacterium avium subsp. paratuberculosis K-10]MRSFSVAAFAAALVLVGPAGAAAAPKDYCADLKGANTGQTCQIQMADPGY
NVDISFPANYPDEQPVADFISKQRDDSPARAGEADVGERDRDGAGKVAGD
RRVDGTDHGGEQQRGHRPSGQQRPALLPAAQPTDQCGGHRRQHRAAQQPV
QPRVARTAQARLDRVDADQPQECDQADRMPAPRRGLGRETAGHSPRIR
41409387NP_962223.1 Mce1_1 [Mycobacterium avium subsp. paratuberculosis K-10]MRSRDANSDSLMQINSQRIPPYKLLAVAVLLVLSLILALIYGQFRGAFTP
KTSLTMLASRAGLVMDPGSKVTYNGVEIGRVGTISETVRDGKPAAKFTLE
VYPRYLKLIPSNVNADIKATTVFGGKYVSLTTPAHPSPQKITPHTIIDAR
SVTTEINTLFQTITSIAEKVDPVKLNLTLSAAAQSLSGLGEKFGQSVVNA
NALLDDVNPRMPQARKDIQGLAALGDTYADASPDLFDFLNNAVITSRTIN
AQQKDLDQALLSAAGFGNTGADLFTKGGPYLARGAHDLVPTAQLLDTYSP
EIYCLMRNEHDALPATGAAEGGFNGYSLNMNTEALSGLGLIANPVSAVPV
IASMVGGIVGVVGGAPNPYIYPENLPRVSARGGPGGAPGCWQKITRDLWP
APELIMDTGNSIAPYNHLDTGSPYALEYVWGRQVGDNTINP
41409386NP_962222.1 hypothetical protein MAP3288 [Mycobacterium avium subsp. paratuberculosMSDANLAAVLALCAALASAVGNVVRQRSAQEVTDKPVGHLALFGMLLRDT
RWWLGGLGDIGSYVLLAAALDRGSVLLVMSLQVTALLFALPIYARMTHHP
ITGREWAWALLLAVALAVLIAVGDPTGGQQRAPLQTWLVVAAVIGPLLVL
GLLGARVWADRPVAALLLAAVAGSLLAMFAVLMKGVVDILEHNPGQLWRS
FELYALVFCGVAGMIYHQSAYRAGALTASLPTIIVAKPVVGGILGIIVLR
ETLVAGGWEWVVLAVTAVVVIVATVGLARGEAASMSAGAGRDVRPTDRPK
AAYQA
41409385NP_962221.1 hypothetical protein MAP3287 [Mycobacterium avium subsp. paratuberculosMPDWTAAQLPSFAGRTVIVTGANAGLGEVTARELARVGGHVILAVRNTDK
GRAAADRMAGVATGRVEVRELDLQDLASVRRFADGIDTVDVLVNNAGIMA
TKHAVTVDGFEGQIGTNHLGHFALTNLLLPKLTDRVVTVSSLMHHFGYIS
LKDLNFRSRPYSAWLAYSQSKLANLLFTSELQRRLDAVPSSLRALAAHPG
WSHTNLQGNSGRKLGDAAVLAVDRIVSTDADFGARQTLYAVSQDLPGDTF
VGPRFGLYGRTQPTWRNWPAKRAGTAAALWELSEELTGTKFPL
41409384NP_962220.1 IS1547_2 transposase [Mycobacterium avium subsp. paratuberculosis K-10]MSADRPNRHLTVKEATSMVVVGADVHKRTHTFVAVDDVGRKLGEKVVAAT
TAGHAEAVMWARERFGTEVVWAIEDCRHLSARLERDLMGFGQSVVRVPPK
LMAQTRASARTRGKSDPIDALAVARGFLREPDLPVASHDEVSRELKLLVD
RREVLVAQRTATINRLLWRVHELDPDHAPKAGSLDLAKHRRILGDWLVTV
PGLVAELARDELADITRLTETINALAKRIGERVRVVAPVLLSLPGCAELT
AAKLVGEAAGVTRFKSEAAFARHAGVAPIPVWSGNTAGRVRMTRSGNRQL
NAALHRIAVTQIRLDGLGQTYYRHRIAVSGSKTEALRCLKRRLARVVFHH
LHTDHQNRIQPCQPAAA
41409383NP_962219.1 hypothetical protein MAP3285c [Mycobacterium avium subsp. paratuberculoMFCQVRAGDRRMYLGVIVNPKARRNRGASPARIAELRRIVGPWGEVHETA
SIEELRDTLGRIGPRVTHLVGDGGDGALHWLINEIERGVADPDSWPAFVP
TNGGSVNAVARKAGVRGHPEAIIRALVAAAESDRPPAEVRLDTLRLDGAT
ADGAAFHRLCFGLAAGGVGNRFYDRYYDAPDHGRLAVARVIARSFGDYIT
SKVAPSRVRTPNYASILFTPTLARVVIDGDEVPSRTHRLLHAGAIDLRIG
GPLRLFPKAAQPGALHFQAGDLRPSKIVVQLPLALTNGMLRGAELRDVTG
HEMIIEALDEPLSPIIDGERFVGIVQLVARAGPRIRIAPVGSATVGRARA
VAPT
41409382NP_962218.1 FadD29 [Mycobacterium avium subsp. paratuberculosis K-10]MLRTGRRDYIGFIFMIASRTRLSPAWKGDSSTMETLIDYLHLWEQRRPEQ
TLFRFVDVDGRELEHYTYRSFAERTRELAAYLSTEAGLRAGDCALLVYPP
GLEMVAALYACARIGVIAVPVSPPLPMSFESGLAKLGFIARDCQARAVLS
TKQFEYDFRMLLGQRHGGQPWSDAGLPELPWFATDGAQEFGGAPVPDTPG
DVLFLQYTSGSTSDPKGVIVSHENVIANVSAFTGGSEVLVSWLPQHHDMG
LISAYMFILLQGGTTHAMSPLDFLARPSAWLRLISDVRATHTPVPNFALE
YCLREDKVPAAELAGIDLSSLECIVVGAEPLRANTFHQFRERFAPYGLRP
EALTGAYGMAESTLIVSIRGRQTLTVNKRGLEKNVARVEKALPENSNQVP
LVSCGKPLEETVVRVVDPQTRQALGEGRVGEVWLAGPSKGRGYWNRPQLT
AEMFEARLAGDDEHSYLRTGDLGFLYEGELFVCGRSKDLIIVRGVNCYPS
DIEAVVERSAKQVRGGCVAALSVEQDDQEALVVVAEVRDEHNLPDARALA
RAIRRHCHIDPHTIVFAPPRSIPKTTSGKIRRASTRQLWLDGALPTFSSW
VNPAATRGHDGTAAGAGPLERFANLIESYDLTGDEDCSFADLGIDSLALA
ELRNDMQALLAEHGAAELADEVNTRLLQRLTVAEFFSLIRQFGEGSGQPL
DALRRALDQISAEYEAHEAAQMRADAALPLPDPAPARAGTPTDILLTGAT
GFLGPFLLSSLLARTPYTVHALVRATDPGHGLDRIVASLRKAQLWTPALE
AEVRARVRVICGDLAEPALGIGEPAFARLARDVDAVVHNGALVNYVRTYD
ALRPTNVEGTRELLRLAMTDHAKTFHLVSSTFIYGWSTQPVVGEWDANEK
MAGLDFGYSQTKWVAEQLALAAQRKGLDVRIYRPSLISPTRSGFGSQDDI
LVRLTAFMIEHGLAVNALNQISLLPADLIADHIVALMDLPDESGSVFNMT
ADDYYNLTDVTRILSERYGYRFDYHDIDSFAEQLNRRCTPDDQMYPLVDF
LTRSADKIAAMRDKRYDNTQYRHRRGLVPVRLREPALTETVDHLVRFLRT
ERMITEVEDEAQRSA
41409381NP_962217.1 hypothetical protein MAP3283c [Mycobacterium avium subsp. paratuberculoMFTVDDKATGPHDAALDHERIVLQARDVDFDWSALPFYYVPGEPFTTHFC
NVLHLLLPAGEEFIVEAFKDTLPLIKDDQLRRDVQGFISQEAMHSQAHAG
VLGHFAAKGIDVTPFTDQMRWLFGQLIGDRPRWSPRRRQSWLLERVSMVA
ALEHYTAILGEWILDTPQHDALGTDPVMLDLLRWHGAEEVEHKAVAFDTM
KHLRAGYWRQVRTQLLVTPALLWLFIRGVRFMYSVDPHLPPGSKPRWRDY
FSAARRGLVPGPFEFLRVIGAYYTPGFHPSQLGGVGRAVDYLARSPAARA
AH
41409380NP_962216.1 hypothetical protein MAP3282c [Mycobacterium avium subsp. paratuberculoMTTEVASTTVTATDGVRLAVHTYTGIDPARPTVLAIHGYPDNHHVWDGVA
GVLRRRFNVVAYDVRGAGQSSTPPERSGYRLDQLVADVDAVIGRLGVDSV
HLLAHDWGSIQGWAAVTDESVMGKIASFTSISGPHLNYAGRFLRSARTPG
GVLDVVKQILASSYIWFFLAPSAPEWAIRSGATVKVFEAVERIGGSTAGA
QRGAGYRSTDDYLNGLNLYRANMPGPILSPPARLPQTSVPVQVIVARRDY
FVSPALQRFTGSIPDGSRVVPIDGGHWVVNSHPDVIARLTGDWVDLTTRP
AGGHHTGQT
41409379NP_962215.1 hypothetical protein MAP3281c [Mycobacterium avium subsp. paratuberculoMRMTMAQAIWENIPADLYGRRKRDRMYTALYGVGALFGGLASASRWTPAR
VVPVRRTTTAVVTQREELAPDVVAFTLADPHGGLLPSWTPGAHIDVRLPS
GRRRQYSLCGPPGRRTDYRIAVRRIEDGGGGSIEMHDTFRVGDALEFEGP
RNAFYLVTDERDVLFVIGGIGVTPILPMIQTAQQHGINWRAVYAGRSRDD
MPLLDEVVAVAPERVSVWADDERGRIPTAADLLAEAGPATAVYVCGPTAM
LEAVRTARDEHADAPLHYERFGPPPVVDGVPFELELARSRRVLTVPGNRS
ALEVMLDRDPATPYSCQQGFCGTCKVKVLAGQVDRRGRTVEGDDEMLVCV
SRAKNDRLVIDA
41409378NP_962214.1 hypothetical protein MAP3280c [Mycobacterium avium subsp. paratuberculoMQNERVQGFGFHTLALLTAVGFAGPLLASAKRFRIPVVIGELIAGLAIGR
TGFGVVDVADPTFQLLANIGFALVMFVVGTHVPLRARLMRSALPAALARA
TLAGGIAAVLGVALAVQFDTGHAALYAVLMASSSAALALPVIDSLRLRGP
RVLSVTTQIAIADAACIVLLPLVIDIRRAPTATLGSLAVAGCAAALFVLL
RAVDRKGWRRRLHAYSEQHRFALELRTSLLVLFALAALAVATQVSIMLAG
FAVGLVVGAVGEPHRLARQLFGITEGFFSPLFFVWLGASLQVRELGAHPQ
LILLGAGLGCGAVLAHCAGRLLGQPLTLAVLSAAQLGVPVAAATIGTQQH
LLAPGEASALMFGALLTIAAASIATGLAARRQGAPEPGEPAK
41409377NP_962213.1 hypothetical protein MAP3279 [Mycobacterium avium subsp. paratuberculosMTDTVKVSVDRSSVAMGDDVESHREFWVFPESATVDDLLVEISSHFLPGI
AGPAGWRVYLGTRRDERQEIGLIYTRDDLGQQDQICRLSAGKTTLGELAR
RTGLPELDVYASYLTFDRARPLALDEITGGPTFTGCRPDKLESEAAADAK
RDWVMLRELDRRAAAVAGTRRDWVRRTLLAAPPPWIDVFIARNFHYLTEL
HCPASMALAAKLLGVNESPPEDFAARAHADVRPNVVILAMVLAAFEWGTE
RDTWRVGERPHRKAYLELLAHCGYRLSPIEQVMAGHIGIEQLKLSEADSA
RLDRIRQLRDQQHQLRMSRYYTKTLSEEQYRAAIEPVHAELSSLGELPGP
M
41409376NP_962212.1 hypothetical protein MAP3278c [Mycobacterium avium subsp. paratuberculoMPKKSLPVQARPEPGSGEYVLGPWRAAALSMAVIAPAAWYGLGALLGAAV
MIPVIYALARLRRHAPQARSTAELIGATLGRKAGTAAGIVQLLAYLVLAA
QFAATLGLQLLQLLSPGDDPAAIVSWLPVGAAAAALVVGAAACWASTRAV
ASLAMPLVLAGLLLYVCLAVAVTALVTLSTDPVVIGSAATPRPLSGQLVG
FGLGMVGVELLTVRTPRIARPGRSMSLATAVVAAAAVVLWVGDHRGVAGP
WRWSATMLAEAVPEFYTDEGRRWMAAAGIALAVAAALVTGWAATRTAAGL
AAMRGATPNAGLRLAVMGLVAVVAVVVSAHGMRSIGMVILGAAPLLLMAL
YVLVAEANSRIPGDSVVAWWVRLVMPALAVVAVVKPLVDSQFAPVQVATV
AAAAIGVGAAGAAPLLARHRERTAKSE
41409375NP_962211.1 hypothetical protein MAP3277c [Mycobacterium avium subsp. paratuberculoMRCRRLIRMTVPHTMPKTTAAFFVQAAVAFAISFVAALGGIYFLPLDPWP
RLFLGVTFLFLVSSAFTLAKVIRDQQEAATVRVRLDEARIERLLADYDPL
NTAN
41409374NP_962210.1 hypothetical protein MAP3276c [Mycobacterium avium subsp. paratuberculoMTTPVRFPDAAEVAARTPADRDRVLDVIRIVSLGGVVLGHTVMAASIIRD
HVLIWDNLLTTSALFQAMTWLLQIMPLFFFAGAAACVSSWTPGTDWGGWL
MRRCTRLFRPVFYYLVFWAVMLTVLYQALPQHIYEPIAGVSTQLLWFLGA
YVLVLAAMPVLYRITTTGRLAAGVAAVYGAIALIDVIRLHWPAMMPLGYL
NLAIWLIPAMFGVAYRRGLLGGRAALAVAAAFFAADVALVHWGPYQLSMV
GTGDHHLSNTSPPSLLLAGHAIILSALAIAAAPAIARWAQRPRVWWWTAI
GNSGAMTLYLWHMPVLLGVHLAFDYLGCPRFPGAPDFLAISVAQVLLVVV
AVAVLFVALRPLENNPLSGWDGAPAVMSRGWGAAVGALLCLAGIALLAAI
RWGLKDDGLVCMAVVVAALVAARIVAQHAGPAGHGSSSRPCSMA
41409373NP_962209.1 NarL_2 [Mycobacterium avium subsp. paratuberculosis K-10]MTDDATPTTVMVVDDHPIWRDAVARDLAESGFAVVATADGVTAAQRRAGV
VRPDVVVMDMQLPDGDGAQATAAVLAVSPSSRVLVLSASDERDDVLQAVK
AGAAGYLVKSASKAELAQAVTDTAAGRAVFTPSLAGLVLGEYRRIAQSKD
DGPTRPRLTDRETEVLRYVAKGLSAKQIAEKLSLSHRTVENHVQATFRKL
QVANRVELARYAIEHGLDEEP
41409372NP_962208.1 hypothetical protein MAP3274 [Mycobacterium avium subsp. paratuberculosMLTTMANHGPDPTTPLWRAAQVFRLLSCVYATGFQIAINPDLLRPVLGWV
LFAGLIGWRAASALAYLRGFGRKPAWVLAELVVVVLLMWSNNLVASPHWA
ADNQTWPTTLWASNPTISAAIQFGPVGGMLTGLAVMTANFAVKNYFALNL
GHNATVIIELAIGMAIGMAAQTARRAHDELQRAARLTAAAQERDRLARQV
HDGAIQVLALVAKKGHEIGGATTELADLASEQERALRRWLACTDIDRDAD
GDTVDLRTLLRRRDSDRVSISLPGTPVRLGRWAATELDAAVGNALDNVVA
HAGPGAHAFVLVEDLGDSVLVSVRDDGVGIAAGRVEEAARQGRLGISQSI
VGRLASLGGTAELHSEPGAGTEWELCVPRREGRDDG
41409371NP_962207.1 hypothetical protein MAP3273c [Mycobacterium avium subsp. paratuberculoMNTGFPDPETVRTALALASRAPSVHNTQPWRWRIDPAGLHLYADPARQLP
HTDPDGRDLILSCGIALQHCVTAFAAVGWRSRVRRLPDPDDPDHLATLEF
SPQTADYVDVALAAAIPRRRTDRRHYSCWPVPVGDIALMAARAARAGVTL
YQVQDVDGLHDIVAQSIRDHLTQDYLAELTTWSGRYFSVSGVPARNTPFP
DPAAKIPTRLFAGAALPMAQGSSAADDNAVVLALGTRHDDRLARLRAGEA
TGVVLLTATSAGLASCPVTEPLETPQTRAAVRADIFGDGHHPQMLLRVGW
APINADPLPATPRRDLADFVEWVG
41409370NP_962206.1 hypothetical protein MAP3272 [Mycobacterium avium subsp. paratuberculosMPATDDGVEILPVRECWDLLRGLTLGRLVTHADGQPDIFPVNYVVQRRTV
LFRTAEGTKLISAAINNRVLFEVDDHNVVGAWSVIIRGIARSLRTPEEIE
EAERAQVLPWTRSEKTHYVRIVPESVTGRRFRFGSPAG
41409369NP_962205.1 hypothetical protein MAP3271c [Mycobacterium avium subsp. paratuberculoMVKVFLVDDHEVVRRGLCDLLSSDPDLQIVGEAGTVAEAKARIPAARPDV
AVLDVRLPDGNGIELCRDLLSEHPDLRCLMLTSFTSDEAMLEAILAGASG
FVIKDIKGMELARAIKDVGAGKSLLDNRAAAALMAKLRGSAAQADPLSGL
TEQERTLLGLLSEGLTNRQIAARMFLAEKTVKNYVSRLLAKLGMERRTQA
AVFASKLNQQAGRPPTPPDWPG
41409368NP_962204.1 hypothetical protein MAP3270c [Mycobacterium avium subsp. paratuberculoMTGNRFDELAAARDQTEKLLRVIAEIGAGLDLDATLHRIISAARELTSAP
YGALAVRDRHANLISFVHEGMDAETVRRIGHHPVGKGLLSLSLLDTPALR
MDDLTAHPAAAGFPEHHPAMRAFLAVPITIRGAVFGNLYLTHVDEARVFS
DADEMAARALAFAAAVAIDNAQVFERERMSVKWIEASREITTALLSRTEP
HRRPMQLIAERACALTDAEQAIVLVPADPEQPGNPEVDTLVVLAAVGLPA
ADVLGQRVPVRGSTSGAVFKSGEPLITDEFRYPIQAFTDAGRRPAIVMPL
RARDEVVGVIAIARGTEQPPFDESYLDLVRDFATHAAIALVLAAAREDAR
QLAVLAERERIAHDLHDHVIQRLFAAGMDLQGTLARARSPEVADRLNRTL
DDLQTIIEEIRTTIFALRSPAAVAGDFRHRIQRVIAELTENRDLVTTVRM
DGPMTAVGAELAEHAEAVTAEAVSNAVRHSGASRLTVQIGVADMFTLDVI
DNGRGIASGNTRRSGLANMTRRAEQLGGSCEISSPPGGGTRVHWTAPLLD
H
41409367NP_962203.1 hypothetical protein MAP3269 [Mycobacterium avium subsp. paratuberculosMHLSPGEPSEREGLTMTWNLDGQTANVEQALAGGHTQPAGWFRFYFADQR
WEWSEQVQRMHGYEPGSITPTTELVLSHKHPDDRARVAATIDEIVTNHQA
FSTRHRIIDTAGNVRHVVVVGDRLTDEQGEVIGAQGFYIDVSTPHEQVQE
EMMSARLAEISRNRARIEQTKGMLMLIYGISDSAAFELLKWLSQEGNVKL
RPLAEQIAEDFRGADVPLPTRSEFDHLLLTAHQRLKASDTRS
41409366NP_962202.1 Hsp18_3 [Mycobacterium avium subsp. paratuberculosis K-10]MLMRSDPFRELDRLTNQVLGTATRPAVMPMDAWREGEHFVVEFDLPGIDA
ESLDIDIERNVLTVRAERPALDPSREMLATERPRGVFSRELVLGDNLDTD
KIEASYRDGVLSLHIPVAEKAKPRKIAVGRGEAPRAVTETAREVVNA
41409365NP_962201.1 hypothetical protein MAP3267c [Mycobacterium avium subsp. paratuberculoMADRRGNAGAPASDQGVYGISVAAELSGIAVQSLRLYERHGLVTPARSQG
GTRRYSADDLARLKRISKLVDAGVNLAGVARILALEDDNATLSAANTDLR
STNRALREAAKTADGDAATG
41409364NP_962200.1 hypothetical protein MAP3266c [Mycobacterium avium subsp. paratuberculoMRRSSPGTRRAMPSKPRGEAMGELADTGAQVVDGARREAQAYRGDNPRPL
GGYLAVLVVYGLVVTAATLAALASGRSLPTRWRAQDLLILTLGTHKLSRT
LTKDAVTSPLRAPFTHYAGTGGPAEVQEEVREQSQLRHSLGELLTCPFCL
DMWVATGFAIGLVFAPRYTRLVAGVFSVLTGADFLQLGYAIAQQAAQG
41409363NP_962199.1 hypothetical protein MAP3265 [Mycobacterium avium subsp. paratuberculosMTSIVIVGSGFTGFTCARRLAKTLRRAPVDITMISPVDYMLYTPLLPDVA
GGVVDARFVAVPLANSLRGVHAVRGRVDAVDFTGRTLTYRDPEERSHSMS
WDRLVLTPGSVTKLFDVPGLARHARGLKTTAEALYLRDHFVEQLELANIE
DDPRVAAARRTVVVVGASYSGTELVAQLRALADAAARQMGFDPGAVRFLL
LDLAEQVMPEVGKKLGDAALKVLRRRGIDVRLGTTLKEAHADHVVLSDDS
RIDTHTIAWVTGVTGAPLIQDLRLPTEKGRLKVQPDLQVPGHPGVFAAGD
AAAVPDLTQPGKITPPTAQHATRQGKVLARNVAASLGHGSAKEYKHRNLG
LVVDLGPRYAVANPLNIHLSGLPAKAVTRGYHLYAIPRGVNRWAVSLAYL
TDALFARSVVSIGLSSEDDAQFTASEGIPMPKTG
41409362NP_962198.1 hypothetical protein MAP3264c [Mycobacterium avium subsp. paratuberculoMPPDGSGGDVMREASTTIVTQLVELVTSLERENSDTAAGLYELIDNGVHH
VTGSQYAGITLAEKSKSVNSVAATHRYPMVLDAIQNKYGEGPCLAAAWEH
HVMHIADLAAEQRWQRYRRHALEQTPIRSILSFELFVDRTSMAALNFYAD
PPHAFTEESVELGTVYATHIALAWSMMRRQDQFRSALASRDIIGQAKGVI
MERFDLDAVEAFELLTRLSQQSNTRVVDIAAALIDSEHPLKQRRR
41409361NP_962197.1 hypothetical protein MAP3263c [Mycobacterium avium subsp. paratuberculoMKAVTWHGKRDVRVDSVPDPKIEQPTDAIIEVTSTNICGSDLHLYEILGA
FMKPGDILGHEPMGVVREVGTETGDLRVGDRVVIPFQICCGSCYMCGQQL
YTQCETTQVRDQGMGAALFGYSELYGEVPGGQAELLRVPQAQFTHIKVPV
GPPDSRFVYLSDVLPTAWQAVAYADIPDGGTVAVLGLGPIGDMAARIADH
LGYRVIAVDLVPERLGRAAQRGIHTIDLARLDAGLGDAIRDLTDGRGADS
VIDAVGMEAHGSPAAKLAQQVAGVLPDALGKRLMQTAGVDRLSALYSAID
AVRRGGTISLIGVYGGMADPLPMLTLFDKQVTLRMGQANVKRWVDDIMPL
LTDDDPLGVDDFATHVLPLERAPHAYEIFQKKQDGAVKVILKP
41409360NP_962196.1 GlgX_2 [Mycobacterium avium subsp. paratuberculosis K-10]MTSAKAAAPTPTGEVWPGKAYPLGASYDGAGTNFAVFSEVAERVELCLFD
GDGTESRVALPEVDGFVWHAYIPGIEPGQRYGYRVHGPYDPAAGQRCNPN
KLLLDPYSKAVDGTFEWNQSLFGYNFGDPDSRNDDDSAPSMPKSVVINPY
FDWGNDRPPDHHYADTVVYEAHVKGLTQTHPDIPEQMRGSYGAVAHPVII
EHLQSIGVTAIELMPVHHFANDSTLIEKGLSNYWGYNTIGFFAPDTKYSS
AATPGGQVQEFKAMVRSLHEAGIEVILDVVYNHTAEGNHLGPTLSMRGID
NAAYYRLVDDDKRYYMDYTGTGNSLNVGHPHALQLIMDSLRYWVTEMHVD
GFRFDLAATLAREFYDVDRLATFFELVQQDPTVSQVKLIAEPWDVGPGGY
QVGNFPPQWTEWNGKYRDTVRDFWRGEPATLDEFAYRLSGSADLYEHTGR
RPVASINFVTAHDGFTLRDLVSYNEKHNEANGEDNNDGESHNRSWNCGAE
GPTDDEQVNALRARQQRNFLTTLLLSQGVPMICHGDELGRTQNGNNNGYC
QDNELTWIDWANADVDLLAFTRVVSALRAEHAVFRRRRFFSGKPVGRRGQ
DGLRDIAWFTPDGTEMTDEDWGANFAKSVTVFLNGHGIPDRDARGQRLLD
DSFLLCFNAHHESIEFTLPPKEFGASWQVVVYTGPEETTPADEVPGAGVL
NVDAHTAVVLRAPDGG
41409359NP_962195.1 hypothetical protein MAP3261c [Mycobacterium avium subsp. paratuberculoMAAAGSLQERANMSRTVVVGASSGLGRCIGVGLAQRGDRVALLARRRQRI
EAAAKDAGPGAVAIECDVTDQASCASAIGEAADALGGIDNIVYTPAVGPL
VRMVDTDADTWRRIFDTNVIGASLVTAAAVPHLSASAGKAVYLSSDAGAF
GPPWPGLGAYGVSKAALERLVEAWRAEHPDIGFTCLIVGECAGGEGDGQT
GMNQGWDMDLAMKAVPLWSSRGCMPGKLMPVEDLIDVVHTILRTNASTSM
PLVVARGAPASQAAFAEANQS
41409358NP_962194.1 hypothetical protein MAP3260 [Mycobacterium avium subsp. paratuberculosMKYVDVDGVGRLSRIGLGTWQFGSREWGYGDSYAADAAGDIVRRALALGV
TLFDTAEIYGFGKSERILGDALGEQRAEVAVASKIMPVAPFPAVVRQRAR
ASARRLGLDRIPLYQVHQPNPVFPDSVIMPGMRDLLDSGEIGAAGVSNYS
LQRWRKADAALGRPVISNQVHFSLAYPKALKNLVPFAERENRIVIAYSPL
EQGLLGGKYGVDNRPGGVRAVNALFGTENLRRIEPLLQLLRDVAAQVDAK
PAQVALAWLISYPGVVAIPGASSVEQLEFNVAAADIELPAESRDALTDAA
LAFRPTSAARFLTDLARERIPGRG
41409357NP_962193.1 PknJ [Mycobacterium avium subsp. paratuberculosis K-10]MTNQQDPYWRNPLSYDPLGRVPPPEPEPVGPPPAQPATLAPPYRPGVNTL
ATLSLVFAFLFAPAGAVLGHLGLAQIRRTGELGRDRALVGVTLSYVFILL
AVVALAGWATLGGSTAAHRAAHEATTSAGPPPPTVPPDTITTLLPGLDAL
RNITADANLDVGPTWNSPGRSAQDGSIDRPECWGSIAAGSPDAYTPGAFT
GYHAGEFTDTRSMLKSIQVIQGVAAFRDAPGAQAQLDALLAGWRQCGGST
VTVTAPGGQPIAMALSTPADAGNGITTLDLTPKGIQVRSARAVAAKANVV
VDLNVSASGTTDSERARLAAVSIANYILGKIPG
41409356NP_962192.1 hypothetical protein MAP3258 [Mycobacterium avium subsp. paratuberculosMAVARRGMPWKNRAGGKSCARELGPGVVLRGGALTGVLAVSVGALVMSVA
CSRPGAATESAPELTVWPVGTALHQPVWSYRGHALVAVTEDQRVAEVAED
RAAAATTRLSAPLAAGRNLQISTKDPAVVFVPQPARGRVAVVDLQSLRQV
GDFDAGPAPAYLSEDAGLRMLLALSSDGRSVTPVDQYGYRKLATAPIAGA
PAEVIDGANRGREIDYHVYAPSGIRHYQGPDSPAPQRGSLDIDVAVSAGD
GTAVTRSYVAGHDDAVLYAVDSRRGGQGIEVLASTRLPAPIRALGTDDTR
IYAATDRQLVTLETASFTGFPARHIPVLRTVDYRSALPESARRAPLSGMA
VGPHRVYLTLAQAPFVVGIAKPRL
41409355NP_962191.1 hypothetical protein MAP3257c [Mycobacterium avium subsp. paratuberculoMARVAATRARNSPARRTRADGRDSMAPTAIKSPTDVVDFLVSQHQQIKAM
FANTLAASGKAREEAFIELRRLLAVHETAEEEIVHPRAKRKIAGGAGVVE
ERLHEEHEAKTALQKLEKLDVDSEEFTRELTKLRDAVIDHAEHEEHDEFA
KLGQELSGDELERMGRAAKLAEAIAPTRPHAGVESQLANLAAGPFAAMLD
RARDVIVGKG
41409354NP_962190.1 hypothetical protein MAP3256c [Mycobacterium avium subsp. paratuberculoMTATSKAPGADRYLPEQRDIEALKHAAETCRGCSLFADATQTVFGNGHPG
APIMLVGEQPGDQEDRAGAPFVGPAGRLLARALHDAGIDPGLTYQTNAVK
HFKFTRKDGKRRIHQKPGRTEIVACRPWLIAEIEAVHPRVIVCLGATAAQ
SLLGTSFRVSTQRGQPLKLPASPEVIPDVAPEPVLVATVHPSSVLRDRSE
RHDEVYRLFVDDLRSARSALG
41409353NP_962189.1 pyruvate decarboxylase [Mycobacterium avium subsp. paratuberculosis K-1MSKQEVSDYLLERLRAWGVEHVFGYPGDGINGLLAAWGRADNKPQFIQSR
HEEMSAFQAVGYAKFTGRVGVCAATSGPGAIHLLNGLYDAKLDHVPVVAI
VGQTNRTAMGGNYQQEVDLLSLFKDVASDYVQMVTVPEQLPNVLDRAIRI
AMTQRAPTALIIPADVQELPYSPPEHAFKMVPSSLGIEYPAIAPEDAAIA
RAAEILNAGKKVAMLVGTGARGAHHELAEVADLLGAGAAKALLGKDVLSD
ELPWVTGSIGLLGTRPSYELMRDCDTLLTVGSSFPYTQFLPEFGQCRAVQ
IDIDGRLIGMCYPYEVNLVADAKAALRALIPHLKRKEDRSWREGIEKNVA
RWWETMDKEAMVSADPINPLRLFSELSPLLPDNAIVTADSGSSANWYARN
LRFRGNMRGSLSGTLATMGPGVPYGIGAKFGQPDRPVIVFSGDGAMQMNG
MAELITVKRYWNEWKDPRLIIAVLHNNDLNQVTWEMRAMAGAPKFAESQN
LPDVDFAAFAAGLGLNAMAIKDPDELSDAWRSALSADRPTVLDVYTDPDM
PPIPPHATWEQFKSATAAVLSGDEDRTGFVKVGLKTKMQEFLPHKKS
41409352NP_962188.1 hypothetical protein MAP3254 [Mycobacterium avium subsp. paratuberculosMAAGPVRGGGRGAARRRPRDPDHRITERIPPRAHRRPRRPVAAHRRGVRS
PRPAGADRAGRRQPDGDLRRHRCGAPGRRDRHRLGGAVRPHLPAAVGTAR
AGAARRAVGRPQRRPARRDAAPRTARADRRAGAVGLPRGAGGDGMSTEPL
VGVVGVGYVGLTTAVCVAAAGRKTVAVDINPDRVGRLRAGVAVIDEPGLS
ELLGDGLAGGVLRFSADFAELADRDVVFVCVPTPSAPDGHADLAAVESVI
DRLGRVLRRGAVVALKSTVPVGTTSTMAQRLCHKGIRVVSTPEFLREGRA
VDDFRNPDRLVIGSHDELAAQLVHQAYGLAGHRVLRMSPESAELAKYASN
AFLAVKLSYTNSLAALCARVGADIDDVTCCMGADRRIGAEFLRPGPGWGG
SCLPKDTAALLDIAHRHRVSFAEVEAARQTNTAQARRIVTALRHTLGRPL
SGCRITALGLTFKAATSDTRESPALAACRELAAAGAQVAGHDPQLPNIDP
AVLQQNRVTAVDDPYRAAKAADAVVVLTEWPQFRSLDWRAVAQDAPLAVV
LDARNSLDPATVREAGLRYLGNGVPQGF
41409351NP_962187.1 hypothetical protein MAP3253 [Mycobacterium avium subsp. paratuberculosMKAQSLEGVLISGGSSGLGAATVAAVADRGGVPLVIDRKPPAADVPYVGC
DLADTDAVASAVESLAGKVGGRITGVFTPAGIDSCGTLEQVPAKDWEQVI
AVNLVGTAAVIRAALPYLKATGGRIVTCASTLGIKAVSDATAYCASKFGV
VGFTRALAAELAGQVGVTLLIPGGMHTPFFDGRPEQYKPPADAKLNQPED
VAQTVLFALCQPAGCEVREMVVCASTESSWP
41409350NP_962186.1 hypothetical protein MAP3252 [Mycobacterium avium subsp. paratuberculosMPMSTAVVARLDSAGDVLITGPAVRAVAARHDRVTMLVGPRGRAAAELLP
GVDELIEWQAPWVDFEAPELTAAHAEALIKQLRGLAPDRVYICTSFHQSP
LPLALLCRMAAVPWVGAVSVDYPGALLNLRHRVPDGIPEPQRALSLAEAA
GCALPAGDDGALRIRAVDPLPARLAEQLAPRPFVVFHPGAAVPARRPSPS
RSAAMVAALAGAGHRVVVTGSPDEAALTAAVAGDVAVDLGGRTSFAELAA
VFAAARVVVVPNTGPAHLAAAVGTPVVSLFAPVVPAGQWRPYGRRVRVLG
DQFAPCRASRARVCPVTPAWTASPTRSCSPPWQKAPWQKEGSHDRGPLRR
AAGSGAAHQHPGPPVARVGRTAGHGAARRRPVVGLRERGQRRRGPAPHRR
TGGPIPRGANSHVRHRLTRRHLGADRDRQRLRRRRGVRPRGAGARPAGRR
AGGAVHQRRQPQHDRGGQGRARRRHGDLGADRTGPQRAGRHVRRGDLRGR
RRHRDGAGGPSAADPRAVHGARRPPFTTGSIMSTSKPLVVVGDSMLDVDI
LGSATRLSPEAPVPVVDAERHVQRPGGAGLAALLAARTEAPVVLITGIAD
DDAGRALHDLLSCSGVRVLALPVSGTTVCKIRIRARGQSVLRLDRGDATP
VDGPLPAAAADALADARAICVADYGAGVTALPAVRAALTESARRVPVVWD
PHPRGAPPVPGCALVTPNHEEARGFCHDDGSGDGGEALLRTWAADAVCIT
RGAQGARVYEPRADVHRVAIPQRAAPAAGDVCGAGDRFAVAAAVVRAAVG
DAARFVAAGGAAAVSIPVSDTGSDPLTSRSRPADASAVDALGLAARLRRQ
GRTVVATGGCFDLLHTGHIRLLRQARELGDALIVLVNSDASVRALKGSGR
PVMRDADRARVLAALACVDAVAVFDGLTPERMLEDLRPDIWVKGGDYVAA
ELPEADVVYRHGGEVVILPTVAGYSSSRLIAAAATGRPE
41409349NP_962185.1 hypothetical protein MAP3251 [Mycobacterium avium subsp. paratuberculosMDLRRARPEPPLAVLLDRDDTLIVDRPYLNDPAGVRPTHDAAKALTRLRR
RGLLLAVVTNQSGVARGLISAGQLAAVNDRVDEVLGPFDSWQVCVHGASD
GCGCRKPRPGLILAAAEALGVPARRCVMIGDTGADVRAALAAGAAAVLVP
TDRTLPAEVEHARTHARVAATLNDAVSLVLSECR
41409348NP_962184.1 hypothetical protein MAP3250 [Mycobacterium avium subsp. paratuberculosMRHDDYTLVIPTVGRESLHRLLIALRSSMGPQPPEVVVVDDRPRPGDDLP
LPDDPPVRVLRSGGRGPAAARNVGWRASRTRWVCFLDDDVLPDRDWISAL
CLDLKAADACGAAGSQAVLEVPTPRRPSDDQRRTARLATAQWITADMAYR
RDILVAAGGFDERFPRAYREDSDLALRIVSAGGTILRGERRCTHPVAPAT
WRSSVRAQIGNRDNALMRRKHGRRWRTRIGEGPGRMPAHAATTAAGAVAL
LAGLLGRRATARRAAALWLLCTIEFAARRWLSGPRNVREALGLSASSVLI
PPVAVAHRLAGEWTFGARVPSRRWPCCWTATTP
41409347NP_962183.1 hypothetical protein MAP3249 [Mycobacterium avium subsp. paratuberculosMRILGVNAVFHDPAAALVIDGRVVAAAEEERFSRRKHGKPAVPFATWELP
VAAIRWCLDHAGVRAEDIDAVGYSYDPALMYEEPLDPAGLDRDWEHLRTL
YAERAPGFLKTALPGLNPAVVHHVRHHVAHAASTALASPHPETAVLVVDG
RGERASMLAGVYREHKLDVLAVQQLPHSLGLLYESLTEHLGFTRSSDEYK
VMAMASYGRPRFADRLRGRVYARGDGGFCTEPIDWEQLAPPRPPHAATLD
PVHADLACSVQRVVEDVLLELVGWLRDRTDGDALCLAGGVALNCVANTRI
HAEGGFDRVWVQPAAGDAGTALGAALHLAASFDEPIAPMPGAQLGRGWSD
AAVRAALDDAAVNYERPHDLPSAVGDALAENQLIGWFQGRAEFGPRALGG
RSLLADPRYPANAERLNAVKGREQFRPVAPMVLAERAAEIFSRGPLPSPY
MLFVHDVGEHWRSRIPAVTHVDGTARIQTVDADADPLLHATINRFAQHTG
VPVVVNTSFNTAGRPMVDTPRDALEVFGSSPIDVLAVGPYLVRRYL
41409346NP_962182.1 hypothetical protein MAP3248 [Mycobacterium avium subsp. paratuberculosMTGATTPKGNGETGFHPRPDGYQSPMRSLTRVLITGGAGFLGAHLCARLL
DDGVEVVSVDDLSTSGPAVRFGDRPGYRFVQRDVCEPGLIDEVGSGFDAV
FHLASAASPVDYQRRPIQTLCTGSAGTATALEIAERAGARFVLASTSEVY
GDPESHPQRESYWGNVNPAGPRSVYDEAKRFAEALTFAYHRLGRADVGAA
RIFNTYGPGMRADDGRMVPTFCLQALRGDPLTVSGTGLQTRSLCYVDDTI
TGLIALAHSDFAGPVNIGNPTELTVLSAAELIRELAGSTSTIQFTPPAAD
DPQRRCPDIRLARKRLGWRPRVDYRTGLSTTLAWFAERAGRTGESAQQLV
ATTDRRTR
41409345NP_962181.1 hypothetical protein MAP3247c [Mycobacterium avium subsp. paratuberculoMSTMPRTSFVIATRDRSAELTGTLTRLLDTTECPIIVVDNASRDDSVAAA
SRIAAAGRVTVIPLSRNAGAAARNIGVARCGTPYVAFCDDDSWWAPDAIA
RAEQIFDTFGTVALLAARTVLLPARRDDDFTEQLAHSPLGHRAGLPGPSI
LGFQACSALVRAWAFRRVGGFSPILHFRGEETLLACDLAADGWDLCFCPE
LVAYHRPSQIRSASRAQRARILRNALLTACLRRPVDRCARAGAALAWAAL
HDAAHAKALLEATAALPAALRERRRLPDAVERSLRMLESG
41409344NP_962180.1 hypothetical protein MAP3246 [Mycobacterium avium subsp. paratuberculosMSREGTRMRIAMISEHASPLAHLGGVDAGGQNVHVAELSCALARRGHDVV
VYTRRDDPRLPDSVDTPHGYSVVHVPAGPARVLPKDELLQYMYGFAQFLR
QQWCSDGPDVAHAHFWMSGVATQRAARAHSIPTVQTFHALGLTKRLHQGS
EDTSPDCRIDVEARVAREADWVAATSTDEVFELVRMGRARSRTSVVPCGV
DLDAFTPDGPVAARGARPRIVTVGRLVPRKGFDTIVRALPRIPDAELVIV
GGPPAAELAGDEQARRLQRLTGELGVADRVRLLGGVTRAQMPALLRSADV
VACTPWYEPFGIVPLEAMACGVPVVATAVGGIRDTVVDGATGRLVPPKDP
DALGEAVAALLRDGRRGRTLGEAGRERARARYSWDRVAADTERIYERLSP
ARRGVGTPSTRSG
41409343NP_962179.1 hypothetical protein MAP3245 [Mycobacterium avium subsp. paratuberculosMLDPVRAKRVLVWHVHGSWTQSFVAGRHRYLIPVAPDRGPDGIGLAGRCW
PNAREVAFEDLADRDIDLVVLQRPHEAELVARWAGRRVGVDVPAVYVEHN
TPRPSAAQTRHPLADRADIPLVHVTDFNRLMWDNGIAPTRVIDHGVADPG
RLYSGEIPRVATMINEPGRRGRVVGADLLEPLSAYAQIDVWGIGTEGLCA
NRGAVRGRGDVPTPRLFGDVARRRVYLHTARWTSLGLSLIEAMLLGMPVV
AVGSTMAPFVIPCEAGVVSADPARLGEGLRGFLDDQARAVAAGKAARDFA
TARFGLKRFLADWDQVIGELCR
41409342NP_962178.1 hypothetical protein MAP3244 [Mycobacterium avium subsp. paratuberculosMAGRFRIRLRAPPRCERLLGWVSEANGPGPQLRCGRPLRTAEKTGGFRMR
LRRSVLSKPGITRKRRGKGFSYHAPDGTTVRDPETLQRIKDLVIPPAWKK
VWISPHPNGHIQAVGVDAAGRRQYLYHCAWQQERAEEKFDRVLELSTELP
AWRARIAEDLAARGLTRERVLALGLRLLDRGYFRSGGEQYAEENESYGLS
TLLCEHVTVRRDAVEFDFPAKSGVRRTVRVEDREVVRAVRPLMRRRHRGD
RLLVCRTASGWSEVRADDLNDRFKELVGDQYTVKDLRTWHGTVLAAAAFA
EADAAVSRRVARRVEAAVMKEVAEELGNTPAVARGSYVDPRVITGYERGL
TIGAATRRAGRARDPDAAQEILDKATRMLIRRVAKGHSASGASVLPKSA
41409341NP_962177.1 hypothetical protein MAP3243 [Mycobacterium avium subsp. paratuberculosMKISSIVARRKVAGVSAGCLLGGMAMGIVGAPSAAAAPDCSPSGVNSTVS
AVEGSAQQYLAAHPDANQVVTAAYGQPRPQAESSLRSYFTGHPQEYNDLR
GILAPIGDTERQCNVTALPPYLESAYQEFMAG
41409340NP_962176.1 hypothetical protein MAP3242 [Mycobacterium avium subsp. paratuberculosMVSELALDGIQGVPAAGGVKRFVRYRARDVRAVTAGPAAGAGHAADRRSA
GLNGPLLGSSPAARSRRQVRALTTIAVIGATGTAGSRVVARLRPRDVAVV
EISRAQGVDVFDAPGLTRALEGVDVVIDVSNPVPPDGRSDIRQTLATAAR
NIMGACATQEVQRLVVLTIAGIEDPVFDEFPYYQAKREAKEILLDGPVPT
TVVKSTQWYEFATNHDAVSCDDNEVIVEDWLIQPIAADTVADVLVETALA
QTHTPRTITGPDAIRLPELTSKLLVRQGDRRAVRSVEPAVSALGAGALLA
SGHAVVVGPDVDTWLQTLAPPGGDGHRGAGGDGHRGADGDGKPRRG
41409339NP_962175.1 hypothetical protein MAP3241 [Mycobacterium avium subsp. paratuberculosMKPTRTERARSADRTGPLPLAGSLLVLLLALLGGLRAGPRRLGLGFLLAR
VALGVGLVLLGLTLFGQVVAAEDGPADLLGLALHALDGAFDRFLRPALLV
PHGFDLSGRW
41409338NP_962174.1 hypothetical protein MAP3240 [Mycobacterium avium subsp. paratuberculosMSGRKAMRVATFNILHGRTVCDGVNVERLRDCIRRLDPDVLSLQEVDCDQ
PRSEHADLTGAAAEAMGAVEHRFVAAISGTPGATWMAATGDEQPGTAAYG
IALLSRYPVASWQVLRLPRIPMRFPMYLPGPNRVMIVDEEPRAAVIAQLR
TPIGELTVANTHLSFVPGWNRRQLRRLIRDLRGLPGPRLLTGDLNMTPQT
VRRWSGMRALGNAKTFPADNPNRQLDHILTDDRRLRCAAVQADLMPISDH
RPLVVDLQRV
41409337NP_962173.1 hypothetical protein MAP3239 [Mycobacterium avium subsp. paratuberculosMPAGSRARFAAKPLTHSGTPVPLWLAAFQEAPLPALDLAGCPGLVVVAAH
PDDETLGVGAMITQLVAIGVRVQVVCVSDGGARPGSAASERLRAQTIRRF
ELRSATNTLNAPPPLSLGLPGGELTAHEDRLTGALTEILRAAGPGAWCAA
PWRGDGHPDHEAVGHAAWAACAHTGAALLEYPVWMWHWAVPGDPAVPWER
AHAVPAPAWAVSRKRLAAQRYRSRFEPTGGSAPALPGFVLARLLAVGEVV
FR
41409336NP_962172.1 hypothetical protein MAP3238 [Mycobacterium avium subsp. paratuberculosMRVTAGLVKHWLESGRLELPLPASGRTAERWQRLAELAAENIVAARVAEA
HVDAVAILHELGGKPPEPGQLWSVWAAEAPDAVLTATDIRGAYLLNGTKV
WCPGAGFCTHALVTARRDDGTPGLFAVTVTDPTVKALPSTWWNAGMAGSD
TRPVQFTNTHAVAVGDPGDYLIRPGFWHGAIGVAACWLGGARRVADPLYR
CAASQSADAYSLAHLGAVDAALAAGDAMLAAAAAQVDADPFDRAGTAQLL
ARRVRTVVEHAVDEAITRTGRALGPGPLCQDGRHAQRVADLSIYIRQSHA
ERDLAELGRLAGRRAVRAP
41409335NP_962171.1 hypothetical protein MAP3237c [Mycobacterium avium subsp. paratuberculoMTSGDARADTAAAAPRLREALRAAASALKEKGPRFALAGSYALWAYGAPE
PSHDADLVVAEADVETAVTTLASAGFEIERPPEDWLFKARTGDMLVDVLH
RLNGVPVDAQTLDRAEHHDVLAIGMPVLPPTMVLVQQLRSLGEHHCDFAK
LLPAVRAVRERLDWDEIRAQTADNDYAVAFLVLAERLRLTR
41409334NP_962170.1 CatB [Mycobacterium avium subsp. paratuberculosis K-10]MATDHTSGAPDPKQRDLESARFRRDTGYLTTQQGVRVDHTDDALTVGERG
PTLLEDFHAREKITHFDHERIPERVVHARGAGAYGYFEPYDDRLAQYTAA
KFLTSPGTRTPVFVRFSTVAGSRGSADTVRDVRGFATKFYTEQGNYDLVG
NNFPVFFIQDGIKFPDFVHAVKPEPHNEIPQAQSAHDTLWDFVSLQPETL
HAIMWLMSDRALPRSYRMMQGFGVHTFRLVNARGEGTFVKFHWKPRLGVH
SLIWDECQKIAGKDPDYNRRDLWEAIESRQYPEWELGVQLVAEDDEFSFD
FDLLDATKIIPEEQVPVLPVGKMVLNRNPDNFFAETEQVAFHTANVVPGI
DFTNDPLLQFRNFSYLDTQLIRLGGPNFAQLPVNRPVAQVRTNQHDGYGQ
HTIPQGRSSYFKNSIGGGCPALADEDVFRHYTQRVDGQTMRKRAEAFQNH
YGQARMFFKSMSPVEAEHIVAAFAFELGKVEMPEIRSAVVAQLARVDDQL
AAQVAAKLGLPEPPEEQVDESAPVSPALSQVTDGGDTIASRRIAVLAADG
VDVVGTQRFTELMEQRGAVVEVLAPVAGGTLAGGSGGELRVDRSFTTMAS
VLYDAVVVACGPRSVSTLSDDGYAVHFVTEAYKHLKPIGAYGAGVDLLRK
AGIDNRLAEDTDVLNDQAVVTTKAAADELPERFAEEFAAALAQHRCWQRR
TDAVPA
41409333NP_962169.1 hypothetical protein MAP3235c [Mycobacterium avium subsp. paratuberculoMVIAAADGDLQSDLRGAVAIGASAGGVEALSNLAAGLSPDVPFAYLMVLH
VPAGAPSILARIIDRSGPLPASAAQDGAPLQPGHIYVGVPDRHLLVDGAH
VLLSQGPTENGHRPAINALFRSVALTFGPRAIGVLLSGVLDDGVLGMAAI
RSRGGVTVCQSPDDALFPAMPANALDAGVVDRQAAAADIGVVLKELAHRE
IEDPDMQRDPGMELENRIAMMSRFATDFDTEKLGPPSGYTCPDCNGSLVS
LSEGNYRCRVGHAWTAEALLSARDNELEGALWVAVRSLQEKARLARDMAG
KAGAGLLSRRYTQIAEESERALHVLSHRLAGAAAEGETR
41409332NP_962168.1 hypothetical protein MAP3234c [Mycobacterium avium subsp. paratuberculoMNEQRSAVQIASEQDRDVPVLTVDGVLDSSTYRTVRDTVIKAAIDEPRAV
VVDVDRVRAPSASAWTVFTSARWHVSIWPDVPILLVCAHPQTRREITTAG
VTRYVPVHPTRELAVRAVHGRTLQVRRRARTELPRSDTSLHLARAVLTDW
LTQWDIREVIPVAATVATVFVENVLDHTESAPVLIVESHRDTVTVAVEDN
SFALPGRHEDADRGADIVSGLAIVSALCRVWGATPTSSGKTVWGSVGRED
RI
41409331NP_962167.1 hypothetical protein MAP3233c [Mycobacterium avium subsp. paratuberculoMNSTTDEADEAFEALLRYMRDSRGFDFTGYKRTSLMRRVRHRMDQAGYTA
FDEYLDFLQASSDEFTALFNTILINVTSFFRDPDAWEFVAAEVIPRLLAE
RGPNDPIRVWSAGCASGQEAYTLAMLLAEALGFDAFRQRVKIYATDVDED
ALTEARGASYDARAVESVPADLLARYFEQVNGRYVFHKDLRRAVIFGRND
LVKDAPISRVDLLVCRNTLMYLNAETQRNVLGRLHFALAPQGTLFLGHAE
MLLSHGDRFTPLSLKHRIFRKAVGSHSGLDHYDPAGAFYERHADLPGLAT
VRDLAFRASPVAQIVVTGEDTVAMINQQAETVFGLSARDIGRLLRDLEVS
YRPVELRAYLEQAKVERRSARIQDVKWQRPGAETVWFEIHVNPLVDAENG
LLGVSIVFFDVTATRALLDKVVQTNRQLEAAYEELQSTNEELETTNEELQ
STVEELETTNEELQSTNEELETMNEELQSTNDELHTINDMLRERSLELDD
AKSFLDSLVDSVRMGMVVVDREMKVILWNRGCEELWGLRADETTGTMLTA
LDIGLPLDAVRPLIGNAFVDPDGSGEVVVDAVNRRGRPARVRVTCTSFRG
NEGTVGGALLLMDVVG
41409330NP_962166.1 hypothetical protein MAP3232 [Mycobacterium avium subsp. paratuberculosMRRRVETERVTTEADRPGVELVALVASAGGLEALTTVLRDLPRDFPAAVV
VQQHLAGHDSLLATILTRQSGRPVGWAANGRAVTPGEVVICPPGKALELT
PQGRCRLHGAQQHGARGADVLLTSIAGSYGPRGVAVVLSGSGRDGAAGTV
AMRRAGGVVIAESPATALYPSMPIAAAQAGADLVLGIGEIAPVLADLVHG
LPLPRRSPPADAPDEAYLDGGVDPDGIFARLAARFGANTPAARAELARLR
AAELRRRRQELSAGVGATRETVATARRRAEESRRRALLAHRAADEAWARS
EQEHRDRDG
41409329NP_962165.1 hypothetical protein MAP3231c [Mycobacterium avium subsp. paratuberculoMQLRIAIVSGDDVVGEDPEQLGAALAAQGHDVTTCLRRAGRRRGGSAPDG
YRRVSVPVGPHDAAAPVDVLPYVGDWAGALERIWSKDRPDVVHAYGWLGG
LAAQLAARRRHIPTVQSFLGLAATARGHDGERGTERQRIEPLLARSANWV
TGESSADVDALARLRRRRVRVSALTCGVDAERYTPTGPADSRGALQRILY
VAPNPLWHNGIDLAIRALPKVRGAELVIAETDPGGDGHDGARAQLLRLSV
HLGVADRVRFAGPVGGDELPRLLRSADVLVCTPRRPPRPTPVLQAMASGV
VVVVATMGVLSDVVLDDITGIVVSPENPARLAAALRRLLAQKFQCESMGA
AGRSRAQSRFAWQRIALDALNIYQSLGVHEPAAPLDGDAVLR
41409328NP_962164.1 hypothetical protein MAP3230c [Mycobacterium avium subsp. paratuberculoMGLTTMTVRDDGAPVGAPAEAVRSDYGPVDPVLAVNGERRARPVAVEYKQ
FHGADAQSARRFFATAYDPGWRIAGVTNHCVVSHRRSDTGSMTVDEVAIQ
GRMTLEIPAGDTVVVIQPRAGALNVAGGPLATPDFPLLVAHGMACVLHCH
GARFDVVTIAAEVLQKVAAEWHTALSQQTQFLNWRPRSRAAVRAWHRALD
YAMATLASPDTARQPLIAAGMAGLLAGALLECYPSNLTEQDPVSDLALPE
TLKEAVSFIHRHATEDIGINDVAAAVHLTPRAVQYLFRRQLDTTPTEYMR
RVRLSRAHQELVAATTASSTVTEIAQRWGFAHTGRFAVLYRQTYGQSPHT
TLRQQTAV
41409327NP_962163.1 Hpx [Mycobacterium avium subsp. paratuberculosis K-10]MRARTDPFPDRLPPSRTVTVRAVDGTRLHAQVFGPPDGYPIVLTHGITCA
IRAWAYQIDDLAGDYRVIAYDHRGHGRSGVPKATGYSLKHLAADLDSVLE
ATLAPHERAVLAGHSMGGITIAAWSNRYRHKVSRRADAVALINTTSGELI
RQVQLLSVPPGLSPARVLAGRALIGAFAGFAVPRAARVPSRHLVALPATG
RDADPAIARLVYELFENTAPAGRAGCARALVSALGSRYLDLAGLTVPTLV
IGSERDRLTPIRQSRRIAEGLPNLIELVELPGGHCSMLEHPREVNRRLRA
LAESATRNLPTHRISS
41409326NP_962162.1 hypothetical protein MAP3228 [Mycobacterium avium subsp. paratuberculosMSGPPRIVDVVVVGAGFAGLAAARELNRQGHDVVVFEGRDRVGGRSFTGS
VAGLPADLGGTFVGPTQDAVLALAAELEVPTTPTHHEGKNLIHWRGWTHA
YHGTIPKLSLTGLLDIGRLRWQFDRIARSIPLAAPWEARRAAELDGLSLG
GWLRSVRATASSHALLAMVARVTWGCEPDEVSMLHAARYAHAAGGLDRLL
DVEDGAQQDRFPGGTQQIAAAAAAELGARVVLGAPVRRIERHGAGVTVRT
DLGDTEAGFVIVAIPPAHRAAIEFAPPLPAEYEQLARHWPQGRLSKAYAA
YSTPFWRADGFSGQALSDEGPVFITFDVSPHPDGPGILMGFVDARAFDSL
PADQRRRDALRCFATLFGDDALKPLDYVDHRWGAEEFAPGGPTAAVPPGS
WTRFGRWLREPVGPIHWAGTETADEWTGFLDGAIRSGRRAAAEVIALL
41409325NP_962161.1 hypothetical protein MAP3227c [Mycobacterium avium subsp. paratuberculoMRQSPSASARRSHHGDGKHSPAPTGSLPCNHVTLTSPAAASAGDLPARPG
LRTVAAGSMIGTTIEWYDFYLYATASALVFKPLFFPNISPSAGTLASFAT
YAAGFGARPLGAVLSGHFGDRLGRKTVLVAALLVMGLVTTAIGALPTYAE
AGLAAPALLASLRVVQGLAVGAEWGGAAVLSVEHAPPGRRGLFGSFTQLG
SPAGMLLATSVFFGVRKATGPAAFLGFGWRIPFLLSIFLVAVGLFVRLRL
TDAEVFDRLRSRDELARLPIVQVLRTDARNVVITTGLRLSQIGLFVLLTT
YSLSYLQDSFGKGSGVGLVAVLISSALGFLSTPGWALLSDRVGRRPPYLF
GALVSVVALVLFFVAAGTGSAVLVVVAIVFGVNVVHDAMYGPQAAWFAEL
FDTRVRYSGSSLGYHIGAVLSGGFAPLIAASLLVAGGGRPWLIVGYFAVL
AAITVGAACAARETRGEPIG
41409324NP_962160.1 hypothetical protein MAP3226c [Mycobacterium avium subsp. paratuberculoMSAARRIYLNAFDMACVGHQSAGLWRHPDDQGHRYRELSYWTELARTLEA
GGFDALFLADVLGVYDIYGASRDAAVVDAAQFPVNEPSAAVSAMAAVTET
LGFGITLSLTYEQPYALARRLSTLDHLTGGRVAWNIVTSYLDSAARNLGL
DAQIPHDQRYEIADEYLEVCYKLWEGSWEAGAVLRDRQRGVFTDPAKVHD
IEHKGRYFSVPGPFLCEPSPQRTPVLFQAGASPRGIRFAAAHAEAVFVSG
PTAQVVRESVRALRTAAAQLGRDPRAVKVFTMVTPVVAETHDAAVAKLAE
YRRFVSPRGALALFGGWTGVDLAELDPDEPLTYVETDANRSALASFTTAG
QAWTVAELAAEIGIGGRGPVLVGSPTEVADELERWVDDADVDGFNVAYVT
TPGTFVDFAKFVVPELRRRGRVPEEVPGSTLRERLGAAGPLLGDDHPGAA
YRLRRDR
41409323NP_962159.1 hypothetical protein MAP3225 [Mycobacterium avium subsp. paratuberculosMLGPLDEYPVHQIPQPIAWPGSSDRNFYDRSYFNAHDRTGNIFVISGIGY
YPNLGVKDAFFLVRRGDTQTAVHLCDAIDQDRLNQHVNGYRIEVKEPLRK
LRLVLDETEGVAADLTWEGLFDVVQEQPHILRSGNRVTLDAQRFAQLGSW
SGRIVIDGQEIAVEPATWIGSRDRSWGIRPIGEPEPAGRPADPPFEGMWW
LYVPMAFDDFAIVLIIQEQPDGFRSLNDCTRVWRDGRVEQLGWPRVKIHY
RSGTRIPTGATIEASAPDGTPVHFDVESKLPVPIHVGGGYGGDSDWLHGM
WKGEKFTERLTYDMTDPAIIARSGFGVIDHVGRAICRDGDKAPVEGWGLY
EHGALGRHDPSGFSDWLTVAP
41409322NP_962158.1 hypothetical protein MAP3224 [Mycobacterium avium subsp. paratuberculosMEAPVATEPAVDSVDRLQRSSRDVTTVPAVMSRWLSTVLPDGAEPEVTVE
SGVDSTGMSSETIILTARWRQDERPTEQKLVARVAPTAEDVQVFPTYRLD
HQFEVISKVGELTDVPVPRVRWLENTGEVLGTPFFVMDYVDGLVPPDVMP
YTFGGNWFADAPAERQRELQDATVGVLAKLHSIPNAANTFGFLTEGQTGD
TALRRHFNWVRSWYDFAVPDIGRSPLLERTFDWLEAHWPAAADAAEPVLL
WGDARVGNVLYRDFVPVAVLDWEMVTLGPRELDVAWMIFAHMVFQELAGL
ATLPGLPGVMREDDVRATYERLTGVEIGDLHWFYVYSGVMWACVFMRTGA
RRVHFGETEKPDDVESLFYHAGLMKRLIGEE
41409321NP_962157.1 hypothetical protein MAP3223c [Mycobacterium avium subsp. paratuberculoMRLFRGNYDTVGSVMKADPSGLDKAPGAGRPRDPRIDSAILSATAELLVQ
TGYSNISLAAVAERAGTTKSALYRRWSSKAELVHEAAFPTAPTALEAPAG
DIAADMRMMIEATRDVFTTPVVRAALPGLVADMTADPALNARVMSRFADL
FTAVRVRLREAVDRGEAHRDVDPDRLIELIGGATMLRMLLRPEEELDDAW
VEQTTAIVVHGVRR
41409320NP_962156.1 hypothetical protein MAP3222c [Mycobacterium avium subsp. paratuberculoMAVAGRTEQVWDDRLPGTIGSTVADIEAAGGRAVPVRADLTDRDDVARLV
DSAREALGPITILVNNAAFTAPGRPPAPGGEARAKPAAGGAKPASGGAKP
ASGGAKPGWPGFVSTPLHAYRRHFDIAVFAAYELMQRVCPDMIGAGGGAI
INITSVASRLPGDGPYADRSGGVLPGYGGSKAALEHLTQCVAYDLADHRI
AVNALSPSKPILTPGLSYYARDFDDTASADEFARAAVELALVDPGRVTGR
TIGHLQVLDGSFRPFGLD
41409319NP_962155.1 hypothetical protein MAP3221 [Mycobacterium avium subsp. paratuberculosMRHWLCPYLHVRRSRGQNRPHRLCTVGGSSTDWPPTDTVRTFVLYGGGVG
VFLSSEQARQRIGAALDAIDAAHDVLRQTSSDLVGTGFRIDVAERLETQD
RTNRGLMYRFFGEIADPPDEAGSLPVARSMLWARLRVSPGELRRRFALAA
RIRPRRSLTGPPLDPELPALAAAVAAGAVGEDHIRAVCAAVDALPCAVPR
SATSDAERTLVRHAAKLDAAVITKLGRRIADYLNPDGEFSDVDRARRRGL
HLGPQGVDGMSRLSGLLGPETRAYFEAVASAVRPGRHQPEGGGDPRARDE
RTPSQRCHDALKLGLEVAIASGGLGVHRGHPVTVIASTTLAELDQAARAV
ADPSIPMPAPALTGGGSRLPMPDMIRMAAKAIHYLAVFDEHTGRPLYLGR
QKRVATADQRLICYARDRGCTRPNCLEPGYRCEVHHAPDWADGGGTDADK
LFFACGPDHGAVSRGEWRTSVGDDGRLAWTDGNGPPQINRAHHPDELLRG
DPDPPEND
41409318NP_962154.1 hypothetical protein MAP3220c [Mycobacterium avium subsp. paratuberculoMPGMDKPTGRVVALIVLLLVVAALRGYLPAQHDATRSEAGGRAALGLVVA
ILAVTLALIAVAIVARLKDPRAPAPPAGALSETLGAGRGRPTWRVLLIGL
GVIVAWLLIVMLLARLFASHGLSPAPPPGTGASPPPHPAAPPAPPPQHPQ
RPRDGSQDTLGILLAGTVAMLLMVVASAVAGARRRWRSPAPAVPDEPAEN
PAPQPHSESLARAAERGLAEMADLRRDPREAIIACYAAMERELAHVPGAV
PQDFDTPSEVLARAVEHHALHADNAVQLVNLFTEARFSPHVMNEGHRDVA
VRVLRLVLDELGSRSVA
41409317NP_962153.1 hypothetical protein MAP3219c [Mycobacterium avium subsp. paratuberculoMKKTVALGLCLIIGIELLALTQHDRRLVLTASGVGLALVLLSLRRALGRG
AERESKHDADDLGDSLRRWLAATETTIRWSESTRADWDRHLRPMLARRYA
IATGQRQAKDPASFQATGQMLFGAELWEWVNPNNVTRTGGRQPGPGRAAL
EEILRKLEQV
41409316NP_962152.1 MoxR3 [Mycobacterium avium subsp. paratuberculosis K-10]MTLPAATTTAHCEAILDEIERVVVGKRNALRLILTAVLARGHILIEDLPG
LGKTLIARSFAAALGLQFTRVQFTPDLLPADLLGSTIYDMQSGRFAFRAG
PIFTNLLLADEINRTPPKTQAALLEAMAEGQVSIDGETHRLPKPFIVLAT
DNPIEYEGTYPLPEAQLDRFAIRLELRYLSERDETSMLRRRLERGSAEPA
VNQVVDAHDLLAMRESVEQVTVHEDVLHYVVSLANATRHHPQVAVGASPR
AELDLVQLARARALLLGRDYVIPEDVKALATAAVAHRITLRPEMWVRKIQ
GADVIGELLHRLPVPRTGAGPGQTG
41409315NP_962151.1 hypothetical protein MAP3217c [Mycobacterium avium subsp. paratuberculoMAADRLRRAAARGAGHDQLAATGAGGRPARRTRHAALLRGRGGARDGVGD
RRAGPVRGPADGSARRGNGTAGGESGSGHGKTVRATAQRWGRYHVAARVD
VLARGGLLSGTALVDAAEVIVFPLTPPQPTPIPRTELLDRLGAHLTRHVG
PGVEYADIRPYVPGDQLRAVNWAVSARRRQLHVTQRLTDRAADVVVLIDG
YRQPAGPATLATERIVRGAAQVVQTALRHGDRAGIVALGGNRPRWLGADI
GQRQFYRVLDTVLAAGAGFEHTTGTLAPRAAVPAGAIVIAFSTLLDTEFA
LALIDLRRRGHVVLAVDILEGSPFEDEQDPLVDRMWALQRSAMYRDMATV
GVDIVWWPGDRGLEQSMGVLPDRRRRVRGRLRG
41409314NP_962150.1 Omt [Mycobacterium avium subsp. paratuberculosis K-10]MGIDTSAITPEEETAFLTLQARAINNGWARPILPDPGAADAVTKIDYDFD
GLGLVTPVVCQTSLRAKLLDDRVRAFIAQHADAVVVDLGAGLDDGYARVK
PPDTVDWYSVELPGLAALRDKVMPPGPHEHTIGISVTDPEWISAIPADRP
AIVIADGLFPFLNKEQIIAVMRAITDHFPAGQLAFNDYGRMVIGVWISKL
FPQRMFKKVNQLRAFEGYNDPHTPERWNPKLTLVEETSLASVPEVDLFPT
WLRIATRMAGWSKRTARSARILRFSF
41409313NP_962149.1 hypothetical protein MAP3215c [Mycobacterium avium subsp. paratuberculoMTTTDPDDLTARARIRHAALREFGEKGYEGATIRSIAAAAGVSSGLLRHH
FGSKQELRQACDDYLVKTMRDLNAQVQDNAKRGDVHYVSARIPLGQHQDY
ITRALVEGGAGELFDALVSMTEEWLASADEHRAEPADVDAKSRATLITAM
ALAIPLLRQHISRGLGVDISTEQGDLRVAAILVDIYSNPLLTPEQAKSAR
DDLAGRLSAAAGPPGRPGRAAAAGRRPAPR
41409312NP_962148.1 NADH dehydrogenase subunit N [Mycobacterium avium subsp. paratuberculosMMTLPTPSIQYFLLCPTLIVFGVAVAGVLAEAFLPRRIRYTAQVTLALGG
LVAALFAVIEVAESLPASGRAAVLGAMAIDRPTLYLQGTVLLVAVMAVIF
IAERTQTKSDSKVAVVAGSGGLDSFTPQASAVPDSDAEREAERAGAAQTE
LFPLAMLSVGGMMVFPASNDLLTMFVALEVLSLPLYLMCGLARHRRLLSQ
EAAMKYFLLGAFSSAFFLYGVALLYGATGTLLLTGIRDALITRGDTSLAL
VGVALLSVGLLFKVGAVPFHSWIPDVYQGAPTPITGFMAAATKVAAFGAL
LRVVYVALPPLHDQWRPVLWTISILTMAVGTITAVNQGDVKRMLAYSSVA
HVGFILTGVIADNHTGLSATLFYLLAYSFSTVGAFAIVGLIRDADGVEDA
TLSHWAALGQRSPIVGVMFSMFLLAFAGIPLTSGFVSKLAVFKAAAQGGA
VPLVIVGVVASGVAAYFYVRVIVSMFFTEATEDTPHVVAPGILSKAAIAV
CAAVTVALGVFPQPLLDLADQAAQLLH
41409311NP_962147.1 NADH dehydrogenase subunit M [Mycobacterium avium subsp. paratuberculosMNHLPWLSILWLVPLAGSVLIILMPPGLRQLAKWTGLVFGVLTLAVAIVV
TAGFKTGGAPYQFVEKHQWIPAFGAGYTLGVDGIAVVLVLLTAVLIPVLQ
VAGWNDGGDRQRGVHAYVALTLAIESMVLVSVIALDVLLFYVFFEAMLIP
MYFLIGGFGAGSGRSRAAVKFLLYNLFGGLIMLAAVIGLYVVTSQHGAGT
FDFRDIVAGVASGRYGADPAVSKALFLGFMFAFAIKAPLWPFHRWLPDAA
VEATPATAVLMMAVMDKVGTFGMLRYCLQLFPDAATYFRPLIVVLAVIGV
IYGAIVAIGQADVMRLIAYTSISHFGFIILGIFVMTSQGQSGSTLYMLNH
GLSTAAVFLIAGFLISRHGGSRAIVDYGGVQKVAPVLAGTFLVSAMATLS
LPGLAPFVSEFLVLLGTFNRYWLAAAFGVTALVLSAVYMLWLYQRMMTGP
VAGGNEKIGDLRARELVVVAPLIALLLVLGIYPKPVLDIINPAVENTMTT
IGQHDPAPSVPMGTPRTAEGRR
41409310NP_962146.1 NADH dehydrogenase subunit L [Mycobacterium avium subsp. paratuberculosMTHYTPLLVALPLAGAAILLFGGRRTDRWGHWLGCATAVAAFVVGVGLLD
ELLGRPADQRAIHERVFSWIQVGQLQVDLGLQIDQLSVCFVLLITGVGSL
IHIYSVAYMAEDADRRRFFGYLNLFLASMLLLVIADNYVVLYVGWEGVGL
ASYLLIGFWYHKPTAATAAKKAFVMNRVGDAGLALGMFLMFSTFGTLSYA
GVFAGAPAAGRGALTAMGLLLLLGACAKSAQVPLQAWLGDAMEGPTPVSA
LIHAATMVTAGVYLIVRSNPLYNLSPDAQLAVVIVGAVTLLLGAFIGCAK
DDIKRALAASTMSQIGYMVLAAGLGPTGYAFAIMHLLTHGFFKAGLFLGS
GAVIHAMHEEQDMRRYGGLRAALPVTFVTFGLGYLAIIGVPPFAGFFSKD
AIIEAALAAGGGRGYLLGGAALLGAGVTAFYMTRVMLMTFFGEKRWAPGS
HPHEAPGLMTWPMILLAIGSLFSGGLFAVGGTLQRWLEPVVGRHEEVTHA
VPVWISTALALGVVAIGIAVAYRLYATAPIPRVAPLSVSPLTTAVRNDFY
GDAFNEEVFMRPGAQLTHALVEVDDAGVDGSVNALAALVSATSNRLRGLQ
TGFARNYALSMLTGAVLVIALILAVRLW
41409309NP_962145.1 NADH dehydrogenase subunit K [Mycobacterium avium subsp. paratuberculosMNPINYLYLSALLFTIGAAGVLLRRNAIVMFMCVELMLNAVNLAFVTFAR
MHGHLDGQMIAFFTMVVAACEVVIGLAIIMTIFRTRKSASVDDANLLKG
41409308NP_962144.1 NADH dehydrogenase subunit J [Mycobacterium avium subsp. paratuberculosMSAFAGHAVAATLASSYSQDTIVRTSTGEAVTFWVLGALAVIGALGVVLA
VNAVYSAMFLAMTMIILAVFYMIQDALFLGVVQVVVYTGAVMMLFLFVLM
LIGVDSAESLRETLRGQRVAAVAAGVGFGILLIAAVGNVASGGFAGLTTA
NANGNVEGLAALIFSRYLWAFELTSALLITAAVGAMVLAHRERFERRKTQ
RELSQERFRAGGHPTPLPNPGVYARHNAVDVAALLPDGSYSKLSVSPILQ
SRGGDGKDVAAPEPSPSLSQGGAS
41409307NP_962143.1 NADH dehydrogenase subunit I [Mycobacterium avium subsp. paratuberculosMAKFLDAVAGFGVTFASMFKKHVTEEYPEKPGPVAPRYHGRHQLNRYPDG
LEKCIGCELCAWACPADAIYVEGADNTEELRYSPGERYGRVYQINYLRCI
GCGLCVEACPTRALTMTNDYEMADDNRADLIYEKDRLLAPLLPEMTAPPH
PRAPGATDKDYYLGNVTAHGLREAQRAGEPR
41409306NP_962142.1 NADH dehydrogenase subunit H [Mycobacterium avium subsp. paratuberculosMLGKALAIFVFLMLNVLVAILLERKILGWMQLRPGPNRVGPWGVLQSLAD
GIKLALKETITPGGVDKFVYFAAPVISTIPAFTAFAFIPFGPVVSVFGHR
TPLQLTDLPVAVLFILGLSAIGVYGIVLGGWASGSTYPLLGGVRSTAQVI
SYEVAMGLSFAAVFLYAGSMSTSQIVAAQDRVWFVFLLLPSFVIYLISMV
GETNRAPFDLPEAEGELVAGFHTEYSSLKFAMFMLAEYVNMMTVSSLATA
LFFGGWHAPWPLNMWAGANTGWWPVLWFTAKMWTFLFIYFWLRASLPRLR
YDQFMGLGWKLLIPASLVWVLIAAVIRTLQNQGYAHWTPILVISSIVFAA
ALVLSLRKPFTTPHIRALRRQLRRKAKQLPTAPDSTPVFPTPPLPAKALA
AASKEKARG
41409305NP_962141.1 NADH dehydrogenase subunit G [Mycobacterium avium subsp. paratuberculosMTQTADTEGRVTQPEMVTLSIDGNEISVPKGTLVIRAAELMGIQIPRFCD
HPLLEPVGACRQCLVEVEGQRKPMASCTTVATDDMVVRTQLTSEAADKAQ
HGVMELLLINHPLDCPMCDKGGECPLQNQAMSNGRSDSRFTDVKRTFAKP
INISAQVLLDRERCILCARCTRFSEQIAGDPFIDMQERGALQQVGIYANE
PFDSYFSGNTVQICPVGALTGTAYRFRARPFDLVSSPSVCEHCASGCAQR
TDHRRGKVLRRLAGDDPEVNEEWNCDKGRWAFSYATQPDVITTPLVRDAD
GSLQPASWSHAIAAATRGLESALGNTGVLVGGRATWEDAYAYSKFARIVL
GSNDIDFRARPSSAEETDFLAARIAGRPITVSYSDLESAPVVLLAGFEPE
DESPIVFLRLRKAARKHGVPVYAVAPFATRSLTKMSGRLIKTAPGAEASA
LDRLATGEVGDLLSTPGAVIMVGERLATAPGGLSAAARLADTTGARLVWV
PRRAGDRGALEAGALPGLLPGGRPVADDDARAQIASAWNVSELPCGPGRD
VQEMLAAAAAGTLGALLVGGVDPDDFADPQAVLAALDGVGFVVSLELRHS
AVTQRADVVFPVAPTTQKAGAFVNWEGRFRPFQAALRGSMTQAGQSDHQV
LDTLADELGVYLGTATVEEIRTEYAALPYWEGKRAAGPDVAAAEPAPPGA
GEAVLTGWRMLLDNGRMQDGEPHLAGTARQPVLRLSADTAAEIGAADGDA
VTVSTPRGSISLPLVITDMPDPGGCGCR
41409304NP_962140.1 hypothetical protein MAP3206 [Mycobacterium avium subsp. paratuberculosMTTTSETSEASGAPQATPLTPVISRFWDDPESWTLQTYHRHGGYTAMKKA
LAMEPDAVIGMVKDSGLRGRGGAGFSTGTKWSFIPQGDTGAAAKPHYLVV
NADESEPGTCKDIPLMLATPHVLIEGVIIAAYAIRANHAFIYVRGEVLPV
LRRLQNAVAEAYAAGYLGRDIDGSGFDLELVVHAGAGAYICGEETALLDS
LEGRRGQPRLRPPFPAVAGLYGCPTVINNVETIASVPSIIGNGVDWFRSM
GSEKSPGFTLYSLSGHVTRPGQYEAPLGITLRELLDYAGGVRAGHRLKFW
TPGGSSTPLLTDEHLDVPLDYEGVGGVGSMLGTKALEIFDETTCVVRAVR
RWTYFYKHESCGKCTPCREGTFWLDQIYERLETGKGTAEDIDKLLDISDT
ILGKSFCALGDGAASPVMSSIKYFRDEYVAHVENGRCPFDPRDSMLTPNG
SDS
41409303NP_962139.1 NADH dehydrogenase subunit E [Mycobacterium avium subsp. paratuberculosMTGPQGQPVFLRLGPPPDEPNAFVVEGAPTSYPPEVRARLEVDAKEIMGR
YPDKRSALLPLLHLVQSQDSYLTPAGLEFCGEQLGLTGAEVSAVASFYTM
YRRGPTGDYLVGVCTNTLCAIMGGDAIFDALKEHLGIDNDETTPDGSVTL
QHIECNAACDYAPVVMVNWEFFDNQTPESARELVDSLRAGEPRHPTRGAP
LCVFRETSRILAGLPDERPDQGQGGAGAATLAGLKVAKEHGMQAPNPAEG
QQ
41409302NP_962138.1 NADH dehydrogenase subunit D [Mycobacterium avium subsp. paratuberculosMSTTTESTHDGAGETLVVAGGQDWDKVVEAARSADPGERIVVNMGPQHPS
THGVLRLILEIEGETVTEARCGIGYLHTGIEKNLEYRYWTQGVTFVTRMD
YLSPFFNETAYCLGVEKLLGITDQIPERVNVIRVMMMELNRISSHLVALA
TGGMELGAMTPMFVGFRGREIVLTLFESITGLRMNSAYIRPGGVAQDLPP
NAKTEIAQALDQLRQPLREMGDLLNENAIWKARTQDIGYLDLTGCMALGI
TGPILRATGLPHDLRKSEPYCGYENYEFDVITADTCDAYGRYMIRVKEMW
ESIKIVEQCLDKLQPGPIMVENGKIAWPADLKVGPDGLGNSPEHIAKIMG
GSMEALIHHFKLVTEGIRVPPGQVYTAVESPRGELGVHMVSDGGTRPYRV
HYRDPSFTNLQSVAAMCEGGMVADLITAVASIDPVMGGVDR
41409301NP_962137.1 NADH dehydrogenase subunit C [Mycobacterium avium subsp. paratuberculosMSSPDQDPREAIAQGDDEVIDVRRGMFGAAGTGDTSGYGRLVRTVTLPGS
SPRPYGSYFDDVVDTLTESLQSNGIEFHQAIEKVVVYRDELTLHVDRAAL
PHVAQHLRDDPRLRFEMCLGVSGVHYPHETGRELHAVYPLQSITHNRRVR
LEVAVPDEDPHIPSLYRIYPTTDWHERETYDFFGIVFDGHPSLTRIEMPD
DWHGHPQRKDYPLGGIPVEYKGAQIPPPDERRAYN
41409300NP_962136.1 NADH dehydrogenase subunit B [Mycobacterium avium subsp. paratuberculosMGLEEQLPGGILLSTVEKVAGYVRKNSLWPATFGLACCAIEMMATAGPRF
DIARFGMERFSATPRQADLMIVAGRVSQKMAPVLRQIYDQMAEPKWVLAM
GVCASSGGMFNNYAIVQGVDHVVPVDIYLPGCPPRPEMLLYAILKLHEKI
QQMPLGVNRETAIAEAEQAALSARPTIEMRGLLR
41409299NP_962135.1 NADH dehydrogenase subunit A [Mycobacterium avium subsp. paratuberculosMNVYIPILVLGAIATAFAVGSVVIASLAGPSRFNKSKMAAYECGIEPTET
SVSGPRATAGQRFPVKYYLTAMLFIVFDIEIVFLYPWAVSYDALGTFALI
EMVVFMLTVFVAYAYVWRRGGLTWD
41409298NP_962134.1 hypothetical protein MAP3200 [Mycobacterium avium subsp. paratuberculosMSDSTPQSSVALRILVYSSNAQTRERVMRALGRHLHPDLPELSYVEVATG
PMVVKTMDQGGIDLAILDGEATPTGGMGIAKQLKDELDTCPPLVVLTGRP
DDAWLASWSRAEAAVPHPIDPILLGRTVLNLLRTPVR
41409297NP_962133.1 hypothetical protein MAP3199 [Mycobacterium avium subsp. paratuberculosMTTLETLLHDPEMAGVWNLVPDRSAITFRIKNMWGLLTVRGRFTDFTGDG
QLTGKGAVFGRVDIRAASLDTGIGRRDQHLRSPDFFDVERFEKISVVVTG
LQPTKGKIADLRTDFTVKGVTAQLPLPVTILELDDGSIRITGETTLDRAR
FDLGWNRFGMIGRTATAAADVIFVRDSQ
41409296NP_962132.1 hypothetical protein MAP3198 [Mycobacterium avium subsp. paratuberculosMTASGAKTVVDTADRLFAAIERGDVTAVAAMWSDDIAVWRVGSRRDDDKA
RAVRVIDWFIGATARRRYQILDRQLFDGGFVQQHVLHATGHGGQAISLRV
CIVIRVGAHGMIERIDEYFDPAGIAPLM
41409295NP_962131.1 hypothetical protein MAP3197 [Mycobacterium avium subsp. paratuberculosMELEAQAQAAAAAAGAPVPHILVADNSPAALGNPFLICDEIKGETIARRI
QRRLDAADGHAARAHLLGQCAHAVAAIHRAEIDRIQDPGLRRQDQLTEWR
QRLDDMGDTTATFEWAFRWLAARRPRAAPAVLAHGDFRMGNLIVDGAQLA
AVLDWELVHVGQAYEDLAWFCIRAWRFGAPAGFGAGGLGSIESFLRAYEQ
ASATTVDRAAFHWWLVLATLRWGVICRYQAERHLSGLHRSVELATIGRRV
CETEWDLLNLLEGAA
41409294NP_962130.1 FadE12_3 [Mycobacterium avium subsp. paratuberculosis K-10]MDFTLPEHLPGVLAEMDAFIEDEIKPLEREHIQYFDQRREHARTDWDNDG
IPTREWEDLLAEMRRRADRAGWLRYGLPASLGGRDGSNVDMAVIREHLAH
KGLGLHNDLQNESSIVGNFPQVIMMERFGTDEQRREWSQALITGERSMAF
GLTEPQHGSDATWLQTRAERDGDGWVINGAKRFNTGVHRATHDLIFARTS
GEPGAAVGITAFLVPTEAPGFTVPYYWWTFNMPTDHGEVELTDVRVPADA
VLGEVDRGLEVAQTFLHENRIRQAASSLGAAQYCIDRAAEYAGSRTVFGK
PLSVNQAVQWPLAELQTEAQMVRLLVQYAAWHLDRDHHMEVSDKVSMANY
RANRLVCDAADRAMQIFGGLGYSRHEPFEHIYRHHRRYRITEGAEEIQIR
RVAQRLFKFGKK
41409293NP_962129.1 hypothetical protein MAP3195 [Mycobacterium avium subsp. paratuberculosMRAGPLMPAELLTAKGRQTRQAIEQAARKLFAERGFHGTTLADITSAAGK
SPAVFYRYFADKEDLLAALAESFLHEVVTPSGLSVHLPDSPDDDAFFTAV
VTGYWNMFKQNIGIMIAVAQLAATQQRFAAVQNEFRRFGIDLVAASVRRA
QEQGYGAELHPQHTAAAIALLFENFTTVFVGPSGLGIEISDEDAIATLST
IWKKTLYGV
41409292NP_962128.1 hypothetical protein MAP3194 [Mycobacterium avium subsp. paratuberculosMNTHVAIREVALRDGLQIEAPIPLSAKLELLAAVAATGVREVEATAFVSP
SKVPSMADAAELAAHLADYPDIEFSALVASPNGARRAVAAGLRAIEYVVA
ADDTFSAANVGRTSAEATEQIGDIVAIAHDGPGPPVTVEVVIATAWDSPF
EGPTPPQRVLDIAAAARDRGADRLSIADTIGTATPGRVSSLIAQLLPVIG
DMPLGGHFHNTRGCGLASAYAAVGAGVTRLDASVGGLGGCPFAPGATGNI
ATEDLVYLLTDSGFDVDVDLQAASAAAGVAKTLVGHDLPSALLRAGDRRR
S
41409291NP_962127.1 hypothetical protein MAP3193 [Mycobacterium avium subsp. paratuberculosMSAAGAAGPLDGIRVLELGTLIAGPFAGRLLGDMGADVIKVELPRAPDPL
RTWGQAEVDGHHVFWTVHARNKRAITLDLRHPRGRELFCELVEKSDIVVE
NFRPGTLEKWNLGYDVLCERNPGIILVRVSGYGQTGPDAAKAGYASVAEA
ASGLRHLNGFPGGPPPRLALSLGDSLAGMFGAQGALAALYRRSVTGRGQV
VDVALTESCLAVQESTIPDYDVGGVVRGPSGTRLEGIAPSNIYRSADGSW
VVIAANQDTVFARLCKAMGRAELATDERFATHVARGRNQDELDGIIGEWA
AQRQPDEIIETLSAAGVIAGPINTVAEVVNDPQLRARDMLVEHYDERLRR
NVLGPGIVPVLSESPGRLRNAGPARPGQHNDEVYRGLLGKTAEELEELRA
QEVL
41409290NP_962126.1 hypothetical protein MAP3192 [Mycobacterium avium subsp. paratuberculosMKHEYDRIPYLVAFQNNSGVRDVYGGLAEITVLESYLLKPKNKPSDTVLV
FMHPIGGGAYLPMINALARAGHHVIYCNSRFRGTDSALLMEKVVEDLGEC
IKDAKKRLGYTKVVLAGWSGGGSLSVFYQQQAQNPTITSSPSGDGPDLTK
LDLTPADGIMLLAAHISRHGTLTEWLDASILDESDPTKRDPELDLYDSDN
PNQPPYSQEFLDRYRQAQIERNRRITAWVKAKLAELKAAGRPDDEFGFVV
HGTMADPRWLDPTVDPNERTPGTCYLGDPRVVNMSPVGLARFCTLRGWLS
QWSYDDARGDALACGPDIAIPALVIGNLADDACTPSHTRRLFQAIGHHDK
EMHEIPGATHYYAGPDQRDALRSAVGIVTDWLVRHDFAEKA
41409289NP_962125.1 hypothetical protein MAP3191 [Mycobacterium avium subsp. paratuberculosMSLSVFAAELGPTGGATMESFIHLRKGRTPGRLHADLDGLKDDELGRGGF
TGRTANMYRRHDPTAYRVQGPLRPIDVLTSELKPSDASDANGGPLLMFAN
PDCRISLSRRSEPMPFYVRHVDGDLLCFVHGGAGLLHTEFGPMPYRQGDW
VYLPKATTWRQLPDAETTLLMIEATDEFRVPPPGPLGRHFPFDPSQATIP
EPQALDDDPAHDEYEVRLVHEGGPTTLFYQHNPLDVEGWRGDNFAFTFNI
ADYNVVTSDSVHLPPTVHLFMQATGVYVMNFLPKPAEGVPGTERTPWYHR
NVDYDEIAFFHGGSLYGIPMPPGLISHAPQGVHHGAPEKARERARRKFDE
YARVDWQVIAVDTRRRLTPSAEVLAHDLGQH
41409288NP_962124.1 FadB4 [Mycobacterium avium subsp. paratuberculosis K-10]MRAARVTRLDGPDAIEVTDVDEPTGDGVFVDVHAAGVAFPDALLTRGLYQ
YRPELPFVLGAEIAGVVRSAPEGAHVRSGDRVVGLTMLSGGMAEVAVLAP
DRVFKLPDKVSFEAGAGLLFNDLTVYFALTVRGRLQRGETVLVHGAAGGI
GTSALRLAPALGAARTIAVVSTTDKADIATAAGATDVVLADGFKDAVKEL
THGRGVDIVVDPVGGDRFTDSLRSLAPGGRLLVVGFTGGEIPTVKVNRLL
LNNIDVVGVGWGAWTGTHPGALAEQWAGLERLLTSGELAPPEPVVYPLDE
AAAAVASLENRTAKGKVVLRVRG
41409287NP_962123.1 FadE23 [Mycobacterium avium subsp. paratuberculosis K-10]MAINLELPRKMQAVTTKTHQGAAELMRPIARKYDLKEHAYPVELDTLISL
FEGASESIEFAGANALGGEDEERDKNHNGANMAALLQTLEASWGDLAMML
SVPYQGLGNAAISAVANDEQLQRLGKVWAAMAITEPGFGSDSAAVSTTAT
LDGDEYVINGEKIFVTAGSRATHIVVWATLDKSKGRPAIKSFIVPRDHPG
VTVERLEKKLGIKGSDTAAVRFDNVRIPKENLLGNPEIEEGKGFSGVMET
FDNTRPIVAAMAVGVARAALEEIRKILTDAGVEISYDKPAHVQSAAAAEF
LRMEADWESAYLLSLRAAWQADNEIPNSKEASMSKAKAGRMATDVTLKTV
ELAGTAGYSEQSLLEKWARDSKILDIFEGTQQIQQLVVARRLLGLSSAEL
K
41409286NP_962122.1 FadE24 [Mycobacterium avium subsp. paratuberculosis K-10]MTDSGSTKTPARVKRRDRQSGVGLQPHKRTGIDIAIALLTPLVGQEFLDK
YHLRDPLNRGLRYGTKTIFSTGAATSRQFKRVQNLRGGPTRLKSSGKDYF
DLTPDDEQKMIVETLDEFAAEVLRPAAHDADEAATYPRDLIAKAAELGIT
AINIPEDFDGIAAHRSSVTNVLVAEALAYGDMGLALPLLAPGGVASALTH
WGSAEQQATYLPEFAGENVPQACVAIAEPQPLFDPTRLKTTAVRTPSGYR
LDGVKSLVPAAADAELFIVGAQLDGKPALFIVESSTKGLTVKADPSMGIR
AAELGHVELSGVTVPLGARLGEDEATDDDYSEAIALSRLGWAALTVGTSH
AVLDYVVPYVKEREAFGEPIARRQAVAFMCANIAIELDGLRLITWRGAAR
AEQGLPFAREAALAKRLGADKGMQIGSDGVQLLGGHGYTKEHPVERWYRD
LRAIGVAEGVVVI
41409285NP_962121.1 hypothetical protein MAP3187 [Mycobacterium avium subsp. paratuberculosMSNDDLALALLLADRADAVTSARFGALDLRIDTKPDLTPVTDADRAAEAE
LRAVLARQRPNDSIVGEEFGGDTVFTGRQWIIDPIDGTKNFVRGVPVWAT
LIALLHDGVPVVGAVSAPALARRWWAAHGRGAFVAVNGAAARRLSVSSVA
QLDSASLSFSSLSGWAQLGLRDRFLALTDAVWRVRAFGDFLSYCLVAEGA
VDIAAEPEVSVWDLAALDILVREAGGTLTGLDGTPGPHRGSAVASNGLLQ
RQVLERLAL
41409284NP_962120.1 hypothetical protein MAP3186c [Mycobacterium avium subsp. paratuberculoMWEFGLLVLLVAVLAVFLVQRFVPRGPRGELLSGTLLVTGVSPRPEATGE
QYVTIAGVINGPTVNEHAVYQRMAVDVNQWPTIGQLFPVLYSSKNPDNWR
FAPPAPPEPSQPGG
41409283NP_962119.1 hypothetical protein MAP3185 [Mycobacterium avium subsp. paratuberculosMDFGFLPPEVNSARMYAGPGSGSLLAAAGSWDSLAAELSITAAVYESVLA
GLTGLYWHGPASRAMAAGAAPYVGWLHTTAERAQQTATQARAAAAAYELA
HAMTVPPAAVAANRTQLAALVATNFFGQNTAAIAATEAQYAEYWAQDAAA
MYAYSASSAAAAQFSPFPSPRRTTDPGGVTAQQAAVAAAETGSTGTDSGA
QVIPPTAGASEIPLDFRILDTILGAQTTFRSIFTTEGIPAGIIQADKNLG
ILPNLATVPAALPRTPALSASPSGLGRIDAVLARAARIGPMSVPAGWTAA
TGNPVAAAPVTGWSEPSAADARPGVTAPGLPGIPGATLRRAALVVPRYGV
RITVMARPPAAG
41409282NP_962118.1 hypothetical protein MAP3184 [Mycobacterium avium subsp. paratuberculosMDWAFLPPEINSARMYTGAGAASLLAAAGSWDALSAELTATADGYESVLS
GLGLQWHGPAADAMAFAAARYLTWLRATAEQTKQTAMQARTAAAAYEQAY
AMTVPPPVIAANRTLLASLVATNIMGQNTAAIADTEAQYADFWAQDTAAM
AGYSASSTAATQLPRFASANNSTNESGVTAQNAAVTAANANAAANKAVTQ
SFSPLADNPPGTTINNYYVDASSTSAANSNAFRVLDVIQGTGLGFSAPYN
MEQFVSGIIGAENNLGMLAKPGAAAANIAPALAAPALRGATAGLGGGLGG
GLGNVTATLSHAGTIGPMSVPATWSAPTSTHVSPLAPAGFTTLPGTEEPM
ASGYPGYPGMPGGGAARSAGAGVPPRYGVRLTVMPRPPAAG
41409281NP_962117.1 hypothetical protein MAP3183 [Mycobacterium avium subsp. paratuberculosMTTLVIALIGAGIVVLVVLGFWSLVVLREYERGVVFRMGHVRPLYGPGLR
FLIPLLDKMIRVDQRLVTLTIPPQEVITRDNVPARVNAVVMFQVTDPRKA
ILAVENYAVATSQIAQTTLRSLLGRADLDTLLAHREDLNNDLRTIIDKQT
EPWGVQVHVVEIKDVEIPESMQRAMAREAEAERERRAKVINARGELQASE
ELREAAETLSKSPASLQLRYLQTLLELGADQNSTVVFPLPVDIITPFLRN
PGLLQGVVDNVGRPG
41409280NP_962116.1 hypothetical protein MAP3182 [Mycobacterium avium subsp. paratuberculosMGAPATTVWLIAGYSLALLVVGWGFDVMARRASAHAARWRTGRFTYRPDH
DAWICPQDHWLWPTSFDPKHRVMRYRALPVVCNSCPVKAECTTSEHGREI
SREVDPWPHSDAGRFHRGIACCVAGLGIVLPLATLVTNHSAADALVLTAT
VLLVALLGLPLARHLWNTPSNAPQHLPHRTAIEDQVAAAIDRYSTRWGGW
KSKEDNAT
41409279NP_962115.1 hypothetical protein MAP3181 [Mycobacterium avium subsp. paratuberculosMIVWSALSLVALLGGIGVMFAVYGRWSQKVGWHSAETSTLSFRQPGDVGL
TPAQRACVWFFAIVSVLFLAQTLLGAAAEHYRADLSNFFGLDLARVLPYN
LARTWHLQLSLFWTAAAFLAGGIFLVPFIARREPKRQALLAYILLGAVAV
VVFGSLICEALSIYGVIPAGGLFSQQWEYLDLPRLWQILLIAGMFMWIAI
IWRGIRGRLKGESKMNMPWLFFFSGLAIPAFYTVGLLAGSDAHYTVADFW
RFWVVHLWVEDFLELFTTVMVAYMFVLLGVVREKIALGVIFLDVILYSAG
GVIGTMHHLYFSGTPVEHMALGAFFSAAEVIPLTFLTVEAWAFLQLGARQ
QSGDANPFPHRWAVMFLVAVGFWNFLGAGIFGFLINLPVVSYYQIGTALT
ANHGHAAMMGVYGMLAVGLAMFAFRYVIPADKWPEKLARISFWCMNIGLA
WMVFATLLPLGVLQLYHSVNDGYFEARSLGYITKPGNAVLEWLRLPGDVI
LIAGGVLPFVWIAWTALRNFRSGTTVQELPEHPLYTESPVMSEAGAAAAK
D
41409278NP_962114.1 hypothetical protein MAP3180 [Mycobacterium avium subsp. paratuberculosMTAPETSAQQTSSQPLVSRGWIQGVALVMIFGFLVMGILAYRTYSASMPM
PDKVVSESGRLLFTGADITRGQELYQARGLMEYGSVLGHGAYLGPDYTAE
YLRTATQDVADQLRAQGVADPRERVVTEFRTNRYHPDTKTLVFTDRQAAA
FDHIQDRYGAYFGENSTKYGCCRT
41409277NP_962113.1 hypothetical protein MAP3179c [Mycobacterium avium subsp. paratuberculoMSTAYPAPAIVVGVDGSRAAMHAAVWAIDEAVGRDIPLRLVYVIDPHGAP
GGHGPDTRLAAARAALADAHRAVDAFAQPVKVETEILWGNTAFKLLEQSR
SAVMLCVGQIGLNHACHGGPAIATSLVRSALCPVAVVQQAPSLPAAARVS
GVVAEVDNGTVLRHAFEEARLRGVGLCAVGNPSARVELERRLARWMRLYP
DVQAESAVLTGGVEQHLRADHRAGRLLVTDAYRAEALCHAGHSVLAVRCG
NL
41409276NP_962112.1 hypothetical protein MAP3178c [Mycobacterium avium subsp. paratuberculoMVSGLTMPDLRDRADVEALLRRFYGRALDDEVLAEPFARLRATGLDDHVP
TMCDFWETVLFRAGRYRGSALQAHRDIHRRTPLSDRHFRRWLTLWHNTVD
EMYRGPAADRAKIQAARIAWAMHRRLTGADSPELLVTQRVRDDRAPDRTG
SDDR
41409275NP_962111.1 hypothetical protein MAP3177 [Mycobacterium avium subsp. paratuberculosMILRSFEGVGSDEPVQVLSEDENWRLLGSVALGRLVTNFAGEAEIFPVNF
VVQDRTVLFRTAEGTKLFSAVANHAVVFEVDDHNLVEGWSVIVRGRARLL
KTDTDIQRAERAQLLPWTATLKPHYVRITPTEVTGRRFRFGPEPDRHEPV
A
41409274NP_962110.1 FprA [Mycobacterium avium subsp. paratuberculosis K-10]MRPYHVAIVGSGPSGFFAAASLLKAADGSEHPDVAVDMLEMLPTPWGLVR
SGVAPDHPKIKSISKQFEKTAADPRFRFFGNVSVGEHVQASELAERYDAV
IYAVGAQSDRALNIPGEDLPGSIAAVDFVGWYNAHPNFEEATPDLSGSRA
VVVGNGNVALDVARILVTDPDVLGLTDIADHALESLRPCGVDEVVVIGRR
GPLQTAFTTLELRELGELDNVDVIVDPAQLEGVTDEDAAAAGKTAKQNIS
VLRDYAKRSPRPGHRRIVLRFMTSPIEIKGDGRVESIVLGRNELVTDETG
RVSARDTGEREELPVQLVVRSVGYRGVPTPGLPFDEKTATIPNTGGRVEG
SRNEYVVGWIKRGPTGVIGTNKKDSQDTVDTLLADLANAGPDGLADFPDD
HADRLADWLASRQPKLVTTAHWELIDAHERAAGEARGRPRVKLPSLAKLL
RVSHG
41409273NP_962109.1 peptide chain release factor 2 [Mycobacterium avium subsp. paratuberculMSAVEPDRQADIAALDSTLTTVERVLDVDGLRARIEKLEHEASDPQLWDD
QARAQRVTSELSHAQGELRRIEELRARLDDLPVLYELAAEDGEGAAEALA
EADAELKALRADIEATEVRTLLSGEYDEREALVTIRSGAGGVDAADWAEM
LMRMYIRWAEQHKYPVEVFDTSYAEEAGIKSATFAVHAPFAYGTLSVEQG
THRLVRISPFDNQSRRQTSFAEVEVLPVVETTDHIDIPEGDVRVDVYRSS
GPGGQSVNTTDSAVRLTHIPTGIVVTCQNEKSQLQNKISAMRVLQAKLLE
RKRSEERAELDALKGEGGSSWGNQMRSYVLHPYQMVKDLRTEYEVGNPAA
VLDGDIDGFLEAGIRWRNRKDDE
41409272NP_962108.1 hypothetical protein MAP3174c [Mycobacterium avium subsp. paratuberculoMTNNTSVLAGAMTTAAHRWHDFWRGELGEWIITRGLRIVMVLIAAVLAAR
FVNWVALQVSRQPTTGFVESDALVRSEASKHRQAVASVISWVSVVIIGIW
VMLQIASILQFSVGGLVAPATVVGAALGFGAQQLVKDLLSGFFILAERQY
GFGDLVTLTVVAATEASGTVENVTLRVTRLRSPDGEVLTIPNGQIVKVVN
LSKDWARAVVDIPVSTSADLNRVNEVLHQECDRAMDNPVLGQLLLDSPTV
MGVESIEVDTVTLRLVARTLPGKQFEVGRQLRVLVIRALARAGIVTAADA
RVGLVEDASVPAAQAAEQQSDDDVQGAVQKR
41409271NP_962107.1 hypothetical protein MAP3173c [Mycobacterium avium subsp. paratuberculoMKFTLNILEKRGSDDDTEAEHRWPQYVFGGRMRTSTFVLIVAFLLVWWVY
DTYRPEPAPKPPAQQVVPPGFVPDPNYTWVPRSRLQQPPATVTYTPTPTS
TPPPPPPPPPVTTTTTTTTTPPFQLPKLPCILPAPFCPPSTTPSTPAPEQ
PQPGPGPTPTSPPPAS
41409270NP_962106.1 hypothetical protein MAP3172c [Mycobacterium avium subsp. paratuberculoMITLDHVTKKYKASARPALEDVNVKIDKGEFVFLIGPSGSGKSTFMRLLL
GEENPTTGDIRVSKFHVNKLRGRHIPKLRQVIGTVFQDFRLLQQKTVYEN
VAFALEVIGKRTDAINRVVPEVLETVGLSGKANRLPHELSGGEQQRVAIA
RAFVNRPLVLLADEPTGNLDPDTSKDIMDLLERINRTGTTVLMATHDHHI
VDSMRQRVVELSLGRLVRDEQRGIYGMDR
41409269NP_962105.1 hypothetical protein MAP3171c [Mycobacterium avium subsp. paratuberculoMRFGFLLNEVLTGLRRNVTMTAAMILTTAISIGLFGGGLLVVRLADNSRE
IYLDRVETQVFLTDDISTNDATCGSAPCKALRDKIDARQDVKSVRFVNRQ
DAYNDAIKKFPEFKDVAGKDSFPASFIVKLNNPEQHAEFDAAMQGQPGVR
SLLNEKDLIDRLFAVLDGLRNAAFAVALVQAVGAILLIANMVQVAAHTRR
TEIGIMRLVGASRWYTQLPFLVEAMLAAAIGVAIAVVGLILVRAWFLDNA
LSQFYQAHLIAKVDYADILYISPWLFVLGVSIAGLTAYATLRLYIRR
41409268NP_962104.1 SsrA-binding protein [Mycobacterium avium subsp. paratuberculosis K-10]MAKGSGRAKAAGGKGGSKQIIATNRKARHNYSIIETYEAGVALQGTEVKS
LREGQASLADAFATIDDGEVWLRNLYIPEYQHGSWTNHDPRRNRKLLLHR
QQIDRLVGKIRDGNLALMPLSLYFSEGKVKVELALARGKKAYDKRQDLAQ
RDAQREVVRQLGRRTKGMI
41409267NP_962103.1 hypothetical protein MAP3169c [Mycobacterium avium subsp. paratuberculoMGGVAARRVAALRVMLVAYPIETLLLGALAIFVGGPIHPGALLWGGLYGI
GMAFGMWAFFAALGSGPISVVSPLAAVLNAAVPVAVGMALGERPGQAALV
GVVLALAAVMLVSREAPAEGTPYRFTPKVAWLTVVAGSAMGLNLVFLHQA
PHACKLWPLVFARVAASLVVFAMAGTSQNLKMPRGRPLRLAVAVAVLDIF
ANITMLAALHTWLLSLASILISLYPAATVVLAMVVLRERVTRWQGIGMVL
AMGSVAMIASA
41409266NP_962102.1 hypothetical protein MAP3168c [Mycobacterium avium subsp. paratuberculoMTMADRLVTKVDKSAVLAGLFAVWDDIDALLAGLSETQWRAPSPLPGWDV
KAVVSHMIGTESFLAGIAAPEPDVDVSALEHVRNDIGAMNECWVRHLSAH
ADADVLESFRAITDDRRAALTSMSDEEWDAVTMTPTSPDSHGRFMRIRVF
DCWMHEQDIRVALGRPPSDADLAGPAASLAVDEIAATMGYVVGKLAKAPQ
GARVEFELTGPLARVIRVSVDGRATVVDDFAGEQATATIRCDGLQFTRLA
GGRPMCPARDQTVELGGDKGLASHVVARLNFVI
41409265NP_962101.1 hypothetical protein MAP3167c [Mycobacterium avium subsp. paratuberculoMVVRGPSVSGTLRLVKLTRDTDRALDDRSAQLQTEIDQLSEKLGVRPMLV
GLRTNDGLNVYVANDGSYHFTFYERGQLGFDRVGNLDDLLYWYTQSVVTG
QAAKSVGDRAERFKYEYQVLSALNSEWAKRNVRETAELFRRYGQPEDISL
LPDIGEPL
41409264NP_962100.1 hypothetical protein MAP3166c [Mycobacterium avium subsp. paratuberculoMTDPLWTAYAEKVDKVDGWFFEADVELFSHLLARQTAEGISGDMLEIGTY
QGKSAILMGYGLRDDEELVICDLFEAVVDHTHGSPSSRDQYSGLDQQQFL
ANWDRFHTRRPMIEVCESSQLDLADRAVRLAHIDGCHAYPCVAHDIELAV
RHTADRGVVVLDDYRGVETPGVAAAVWQAVGNGVLFPFAATYMKLYACAS
PADQHYWLEQVRGRGDICAFPDFEFPSYRSISEAQLRPLDR
41409263NP_962099.1 hypothetical protein MAP3165 [Mycobacterium avium subsp. paratuberculosMRFALATMGTRGDVEPFATIGRELQRRGHEIRMAVPPNYIRFVESAGLSA
VPHGPDQVKQNEDIVRKYGTAPNPMFLAWVISEDLKRLWPSLGTALMSLA
DGADLLLTDTSEHGLAANVAEYYDIPAATLHYYPSGGAAQLTQEAESAQR
RALGLSGPTAPAARRPMELQAYDEFFFPGLAAEWAQCGVRRPFVGALTLE
LPTEADDEVLSWIAAGTPPIYFGFGSSARVASPGDVIAMITTACAELGER
ALICSGVSDLTQIRTGDHVKAVSAVNHSTVFPACRAVVHHGGPGTTFAGI
RAGVPSLVLAVSVDQPLWAAVINQLEVGIGRHFSETTPDSLVADLRSVLD
PRYVTRTRAVAARMRTPAESASAAADVLEDAARQGSCG
41409262NP_962098.1 hypothetical protein MAP3164 [Mycobacterium avium subsp. paratuberculosMSRSIDVSTESPASVEQIHAAFGREDYWLARIAPAATTTLDSLVVDGDGT
VTVRVTQHLGRQLLPGAVAKFVRGDVKIVQTETWRRDGDGQVRGQVDVSA
SGGLGSGRAESWLEPAEDGGSRLRSAVRVEVKIPLVGRKLEKTIGADLAK
GIPEMLRFTTTWIDENA
41409261NP_962097.1 hypothetical protein MAP3163 [Mycobacterium avium subsp. paratuberculosMGAAAQGGNKRAGAPSLLPGGRWAAVLAGAVMLAQCTASSAAADPTVRPV
TAAELGASWHPGCPVEPGQLRRVDVDHIGFDGQTHRGELIVHQDLAPQVV
TIFARLYRLGFPIEKIRTVDHYRDADDELSMEDDNTSAFNCRGIPGSDRW
SEHAYGRAIDLNPRLNPCLYPTGAFQPQNARGLSGPRPHRPGPAARRRPG
RARLHRQRVALGWTVDGARRLPAFRAALKQPR
41409260NP_962096.1 hypothetical protein MAP3162c [Mycobacterium avium subsp. paratuberculoMPGHPSVRNVLVLATILLTLVAASSTGRVVHTSPSEAPPASMTPHASLVP
ESTSPAEDFTTISKLVNDAIAARGLPGAVVMVGHGGKVVFHQAYGSRKLA
GEPGLDGAPAPAEPMTEDTIFDLASLTKCLATAVAVMQLYEQGKVAFDDP
VQKYLPDFNTTNDPQRTKVTIRMLLTNTSGEGIDVSLRDP
41409259NP_962095.1 hypothetical protein MAP3161c [Mycobacterium avium subsp. paratuberculoMQHHVFGPLDMHDTRYLPPAKACGPHIIRGAAIAWAPNGEPTTECPEWTW
RTTLLPRIAPTARDEESRDDPSKNPDYYALLRGTVHDPTARRMGGVAGNA
GVFSTAHDVGVYAQALLDRLAGRPSDFPLQQGTVELMTTPQQPGHDPRQL
EAANRAARSGTPNYPAIKGQNLFGFGWDIDTGYSRPRGRVFPIGSFGNTG
FTGTTLWMDPGSDTYVILLSNSIHLRGSPPISNLRGDVATAAARALHLYG
AAPP
41409258NP_962094.1 hypothetical protein MAP3160 [Mycobacterium avium subsp. paratuberculosMEDLRGDLAQRYKRTPTGGSSVDSAIVGADMAALDRDGYVIWENLLSTEQ
CAQIRETVRPWLGHTGRNSFEGRRTQRVYSVLSRTRMCDRLVDHPRVLAV
LDRLLMPNYLLSALQAINIQPGEAAQLAHHDDGFYPVPRPRAPLAAATIW
AIDDFTADNGATVLYPGSHRWGKRRPGPDDEAIPVVMPAGSCVLFVGTLW
HGGGANTTDRDRLAVTAQYCQPWLRPMEAFTLSVPRDIARTVSDDIRRML
GYSIHPPFVGAVDGLHPLRLLEMEPDA
41409257NP_962093.1 hypothetical protein MAP3159 [Mycobacterium avium subsp. paratuberculosMVHSRMPALLTPGQTCWRTARADRFAAIIDAADYFRHVKAAMLRARHRIM
LVGWDFDSRVTFERGDKTLPGPNQLGAFLFWMVRKRPALQIHLLKSNLRL
LPALDGLWFGLTPVSLLNQISSRRMHFAIDGAHPVGSVHHQKIVVVDDAV
AFCGGIDLTLDRWDTRAHEHTSRRRRTAGRGYGPRHDVGVAVDGAAARAL
GEQARTRWQTATKQSLSPVTAKHSAWPSKLRPTLRNVDVGIALTLPDLDD
RPEVRQVEALNLAAIAAARDTIYVENQYLASRTIAQALAQRLREEHGPQI
VIVLARKGNNPLERGTMDSARHRLIRLLWDADEHHRLGVYWPVTDGGAPI
YIHSKVLAVDDRLLRIGSSNFNNRSMGFDSECDVAIEARGSQHDDVRREI
TSVRNELVAEHLGVPVATLQEAIADRGSLLAAVEELRGDGKTLRPFTERT
VANEAGPLAENELMDPDHVPRSLTRSVQRLITGRRG
41409256NP_962092.1 hypothetical protein MAP3158c [Mycobacterium avium subsp. paratuberculoMYHTRAGGRDASAARLYEDEAMRMLALLAGFAALAGMAAPAHADPAGTTG
SDASFLAALNQAGITYQNPATAIEVGKRACELMDQGSPQVEVIKNVSSSN
PGFTVDGAAQFTMIAASAYCPQHLGQRVGPG
41409255NP_962091.1 hypothetical protein MAP3157 [Mycobacterium avium subsp. paratuberculosMFLPHQIIGQLINKQLDDNMRRYFFRGMEFAAPVGDPGWFGPDSAVWRVH
SHLPALIFGLQCAAFMETLDPSIYWMGMHHSRLIKRDSNGNPVSHVPVID
PEGAATRLGHSVAFFIGTAYGSPETAERLAKSVRAMHHTIKGTRPDGARY
DADDPEWLRWNYATVVWGIATAHELYHPMPLRGKALDRYYGEFVRVGHAL
GGTDLPATKAETLECLESYLPKLAVTHGKAMGTGPNVAMPQAAVDWAIRD
TMPKWAKQMLQHRDCNIIERTARRSAVWAIINGIHAASGPAPEFRQAQAR
VRGGTTVPHTVPSYVLGTDQVRSRAEVERSFQSV
41409254NP_962090.1 hypothetical protein MAP3156c [Mycobacterium avium subsp. paratuberculoMSSPSRWAGVPLKDRRAERRALLVEAAYRLFGSGGEAAVSVRSVCRECGL
NTRYFYESFRDTDDLLGAVYDRVSEQLEEVIAAAIEQAGDSLRARTRAGI
AAVLGFSSADPRRGRVLFTDARTNPVLAARRRATQDMLRQGVLSEGWRLN
PRSDPVAAEVAAAMYTGAMAELAQQWLAGHLGGDLDAVVDYASKLVLR
41409253NP_962089.1 hypothetical protein MAP3155c [Mycobacterium avium subsp. paratuberculoMARIDNAMDPVRRVLRHQISVGALIELAVWLAIPYLCIGFAWTVFHADQT
HRIQARIEAVWPAGADVAAFGVATALWPASLQIADACRTP
41409252NP_962088.1 hypothetical protein MAP3154 [Mycobacterium avium subsp. paratuberculosMSVAPETTVALQDRFFRELPELAVRWQAETFPELRLLVLNEPLATQLGLD
TGWLRGPDGLRFLTGNLVPTGAAPVAQAYSGHQFGGFVPRLGDGRALLLG
ELVDNKGRLRDIHLKGSGATPFARGGDGLAAVGPMLREYVVSEAMHALGV
PTTRSLAVVGTGRPVYREATLPGAVLARVASSHLRVGSFQYAAATGNRDL
LRRLADHAIARHHPGAADAEQPYLALFEAVVAAQASLIAQWMLIGFVHGV
MNTDNMTISGETIDYGPCAFMEAYDPDTVFSSIDFWGRYAYGNQPVIAGW
NLARFAETLLPLFSENTEEAIALAERSFGVFQTRYDAVWATGMRAKLGLP
AQVDAEFAAALIDELLALLKANHVDYTSFFRQLGRAARGDDRSAAEPARE
MFMDLPGFDAWLARWRALGPDADAMDRVNPIYIPRNHLVEEALAAATDGD
LDPLDQLLAAVTAPYTERPGFERYASPAPEDFGKYQTFCGT
41409251NP_962087.1 hypothetical protein MAP3153 [Mycobacterium avium subsp. paratuberculosMADMIVKSPDEVVAFLKAQHNLIEDMFDQVLHATDPKAREEPFATLRQLL
AVHETAEEMLVHPPARKEADAGDAVVDARLHEEHSAKELLSAIEKLDSTT
DQFLDEVTKLREAVLEHATREENEEFPALQRLDSDDLKRMGTAVRAAEAI
APTHPDPGVESATLNFAVGPFASMLDRARDLIGRAIG
41409250NP_962086.1 hypothetical protein MAP3152c [Mycobacterium avium subsp. paratuberculoMYEQVNSSAAEPDDIGSRIDPVLARSWLLVNGTHPDRFQSAVNSRADIVV
FDIEDAVAPKDKNAARDNVVSWLRAGNVDWVRINGFGTPWWADDLTALAG
TPVGGVMLAMVESVDHVTETAKRLPDVPIVALVETARGLERITEIAATKG
TFRLAFGIGDFRRDTGFGEDPATLAYTRSRFTIASKAADLPSAIDGPTIG
SNPLKLIEATAVSTQFGMTGKICLTPDQCSVVNEGLSPSQDEIAWAKEFF
AEFERDGGEIRNGSDLPRIARATKILELARAYGIEALDIDEEERDHSPAP
SDTYHY
41409249NP_962085.1 hypothetical protein MAP3151 [Mycobacterium avium subsp. paratuberculosMIEHVFESLMAVDPAAGESALIERISELEMLKCAAAAAQARAAAALDAAR
RAAEAAAGVPAARRGRGVASEVALARRDSPARGGRHLGFAKALVHEMPHT
LAALECGALSEWRATLIVRESACLDAEDRRALDAELCADPAGLSGMGDAR
VAAAAKAIAYRLDPHAVVERAAKAENDRTVTIRPAPDTMTYLTALLPVAQ
GVSVYAALRREADTRGDGRPRGQVMADTLVERVTGRRATVPTPVAVNLVL
SDETLLGGADAPGEISGYGPIPAAVARRMVANAAADPRSRATLRRLYAHP
RAGALVAMESRARLFPQGLARFIGLRDQRCRTPYCDAPIRHRDHAQPWAD
GGATSAGNGLGLCEHCNYVKETPGWTVSAGVDETHTHTALFTTPTGQTYR
STAPPRAPAITMSTVEVRVTVAFARHAA
41409248NP_962084.1 hypothetical protein MAP3150c [Mycobacterium avium subsp. paratuberculoMSAGRRIQVARVYDKVGPDEGQRVLVDRIWPRGVRKDDPRVGIWCKDVAP
SKQLREWYHHEPERFDEFTSRYKSELRGNPALDELRTLAKRGSVTLVTAT
RDLDISQAVVLAELLKSG
41409247NP_962083.1 hypothetical protein MAP3149c [Mycobacterium avium subsp. paratuberculoMSGVEPILPRELTNVPEEIRGVPAPPVPALPQPYGLRVVDPDADAETVCE
WMSRPHLVQAWESNWPLARWRRYLRAQLDGEFSRPLIATLDGVDRAYLEL
YRAAKDSIATRYEHHPHDLGLHVAVADLDHIERGHVSYLLPHLVVSLFSL
DPRCRRIMFDPDHRNVLARKFCERSGCTFLGEHDMANRRMALYVLPRTPD
DVPRRRDA
41409246NP_962082.1 camphor resistance protein CrcB [Mycobacterium avium subsp. paratubercuMTTVAVWVGVALIGGVGSVLRFVVDGAVARRASRPFPLGTLVVNLSGAAL
LGFLGGLALSREAALLAGTAFVGAYTTFSTWMLETQRLGEERQLRAALAN
IVVSVVLGGAAAFIGQQLAQLV
41409245NP_962081.1 camphor resistance protein CrcB [Mycobacterium avium subsp. paratubercuMAQHDYRELAAVFAGGALGSLARAALSALAAGDPASWPWPTFTVNIVGAF
LVGYFTTRLLERLPTSSYRRPLLGTGFCGGLTTFSTMQVETLTMLEHHHW
GLAAGYTLTSIAAGLLAVHLATKLVRRVRVRR
41409244NP_962080.1 phosphoglucomutase [Mycobacterium avium subsp. paratuberculosis K-10]MVANSRAGQPAQPEDLVDLPHLVTAYYSIQPDPGDVAQQVAFGTSGHRGS
ALAGAFNEAHILAITQAIVEYRAAHGISGPLFIGRDTHGLSEPAWVSALE
VLAANDVVVMIDSRDRYTPTPAVSHAILSYNRGRTEALADGIVVTPSHNP
PSDGGFKYNPPNGGPADSDVTNAIAKRANEILRDGAGVKRVPLARARRAA
QRHDYLGNYVDDLPNVVDIDAIRSAGVRIGADPLGGASVDYWGEIAERHN
LDLTVVNPLVDATWRFMTLDHDGKIRMDCSSPDAMAGLIRTVTAEPGRFQ
IATGNDADSDRHGIVTPDGGLLNPNHYLAVAIEYLYTQRPSWPGGIAVGK
TAVSSSMIDRVVAGLGRKLIEVPVGFKWFVDGLIGGTLGFGGEESAGASF
LRRDGSVWTTDKDGIILALLASEILAVTGSSPSQRYQRLTAQYGTPCYAR
VDAPADRDQKARLSKLSAEQVTATELAGEPITAKLTAAPGNDAPLGGLKV
TTANAWFAARPSGTEDVYKIYAESFHGPQHLAEVQETAREVVNKVIG
41409243NP_962079.1 hypothetical protein MAP3145c [Mycobacterium avium subsp. paratuberculoMGERAPRPGPLPREVWILSWANVMVALGYGVISPALPTFARSFGVSIKAV
TFLVTVFSLSRLCFAPISGLLTERLGERRIYIGGLLIVAVSTAACAFSQA
YWQLMLYRVFSGVGSTMFYVSALGLMIHISPADARGRIAGLFTTSFMVGA
VGGPAVGGLAAGWGLTAPFVVYGVAMLGVALVLFLGLRNSALAAPRPPTR
STVTMREALRVRAYRSALLSNFATGWSAFGLRMALVPLFVSDVIGRGIGT
IGVVLAAFAGGNALAVVPSGYLSDRMGRRTLLIVGLVTSGAATVWLGFVA
SLPVFLVAAGVVGVVTGIYMSPLQAAVADILGNEARAGLPVATVQMMSDL
GAIVGSMAVGWAAEQIGYGWGFFISGVVLLIAAVGWVMAPETRTATELEA
DLMAAESDVEPV
41409242NP_962078.1 hypothetical protein MAP3144c [Mycobacterium avium subsp. paratuberculoMTEFLNLEDLLDIARAAVGTNVVVADYGLLESALARPRASAFGRDAYPDL
HVKAAALLHSLARNHALVDGNKRLAWTACRTFLAINAHWIEAPEDERFDF
VIGVATGALTSLDEIAERLRSWSYQED
41409241NP_962077.1 hypothetical protein MAP3143 [Mycobacterium avium subsp. paratuberculosMSGLRVGDPADPDTDLGPLVSRRQQQRVRDYIRIGQQEGARLVVGGADMP
DGLDRGWYVRPTLFAAAGNAMRIAREEIFGPVITVIPYRDDDEAVAIAND
SDYGLAGSVWSDDTDRALALATRIHTGTVGVNQGYTMDPFAPFGGVKASG
YGRELGPEGLDGYLDTKSIAVAASG
41409240NP_962076.1 hypothetical protein MAP3142 [Mycobacterium avium subsp. paratuberculosMILAREARMGHDAGVRTDGQGRRADVIRVISPHTEQPVAEVDAATPSDVD
AAVAAARAAFDAGPWSRGGPSHRIAAIRRLADIYDRRRAEMADTITAEIG
APISFARRAQVGLPAFMIRAFCDLAERHPWQETRPGFFGSDVYVRREPVG
VVAAIVPWNMPQFLIVTKLIPALLAGCTVVLKPAPESPLDALLLAEMISE
ADLPPGAVSVLPGDAALGAYLAGHRGVDKVSFTGSTAAGRAVAAACAANL
TKVSLELGGKSAALVLDDAPPDKVAAGVRAASLSNSGQICMR
41409239NP_962075.1 hypothetical protein MAP3141c [Mycobacterium avium subsp. paratuberculoMARFPKPPEGSWTQHYPELGTAPVSYEDSINPEVYELEREAIFKRAWLNV
ARVEQLPRKGSYLTRELKVVNTSIILVRNGSGEIKAFHNVCRHRGNKLVW
NDMPLEETRGVCRQFTCKYHAWRYDLDGNLTFVQQEEEFFDLDKSRYGLV
PVHCDVWEGFVFVNFAKTPEQSLREFLGPMITALEGYPFDKMTSRWCYRS
EVKANWKLYMDAFQEFYHAPVLHANQSPTAYSKAAAEAGFEAPHYRLDGP
HRLVSTSGVRAWEMSPEMRKPIEDICRSGLFGPWDKPDLGPMPDGLNPAK
CDPWGLDSFQLFPNFVILFWGQGWYLTYHYWPTSYHSHVFEGTLYFPVPR
TPRERVAQELAAVSFKEYGLQDANTLEATQTMLESRVVDKFVLNDQEILL
RHLHKETAAWIDDYRRMSTAGV
41409238NP_962074.1 hypothetical protein MAP3140c [Mycobacterium avium subsp. paratuberculoMTTVLRAARWADVVTGKIHAPAVIVVDDERISAMNPEGPLPDSATTVDLG
DTTLLPGLMDMELNLLIGGPGGPEGLPSPMHGVQDDPAYRTLRGAVNART
TLEAGFTTVRNLGLMVKTGGYLLDVALQRAVDAGWHAGPRIYPAGHAVTP
YGGHLDPTVFQRLAPGIMPLSVAEGIANGVPDVIACVRYQIRHGAKLIKV
SASGGVMSHSTAPGAQQYSDAEFAAIADEAHRAGVRVAAHAVGDSAIQAC
IRAGIDCIEHGFLASDETIQMMVDHGTFLVSTTYLTEAMAIDRIAPELRK
KALEVFPRAKAMLPKAIEAGVRIACGTDAPAIPHGQNAKELGALVQRGMT
PAQAIRAATVVAAELIEADDELGRLAPGYLADIIAVPGNPFDDIAATLDV
RFVMKNGQIYKTPAA
41409237NP_962073.1 hypothetical protein MAP3139c [Mycobacterium avium subsp. paratuberculoMELTDNILWLLKQAFYYSLTTINEAMREHGVSTAQIGVLRQLANEPGLSG
AELARRLLISPQGVQLALTALERRGLVERKQDPQHARILQAYLTGEGRKV
AETVVNDAIAAHQEVFGVLTEQEQQTLRELLGRVVEKGTGHELFTDHVDG
41409236NP_962072.1 hypothetical protein MAP3138c [Mycobacterium avium subsp. paratuberculoMAEQRTATHDGPTTVTDPEPGGTDTAGPGGRLYALPPRGRFVLTDTDRQL
VAFAGGSGITPVFSLLRTALTAGTRRARLFYANRSRDAVIFDEDLADLQR
RHAERFTLHHHLDDERGFATQEDISAFIATAGDADFYVCGPNEFMDAVCT
ALRDAGIAAERVHVEHFDVTDVGAAAPAEGQVQPGEVTIVLDGATTTAPY
QAGNTLLQTARMAGLRAPSSCEIGSCGTCMARLTQGSARMINNDALDPEE
VDDGWVLTCQALPTSPTVRVVYE
41409235NP_962071.1 hypothetical protein MAP3137c [Mycobacterium avium subsp. paratuberculoMRVAVVTGGASGMGEATCHELGRRGMKIAVLDVNEHAAQRVTDDLRTDGA
TALAVGADVTDRAAVEQAFAKVRSELGPVTVLVTSAGMFGFSPFLDITAE
SWSRIIDVNLTGTFHCCQVALPDMVAANWGRIVMISSSSAQRGSPFAAHY
AASKGAVITLTKSLAREYAPHGITVNNIPPSGIETPMQHQGQADGYLPSN
EQIAANIPLGYLGTGADIAAAVGFLTSDEARYITGQVLGVNGGAVM
41409234NP_962070.1 hypothetical protein MAP3136c [Mycobacterium avium subsp. paratuberculoMTRSGRPPEGSWTEHYPELGTGPVSFKDSTSPEFYELEREAIFKRAWLNV
ARVEELPRVGSYLTKEIEAARTSVIVVKGRDERIRAFYNVCRHRGNKLVW
NDFPGEETRGTCRQFTCKYHGWRYDLTGALKFVQQESEFFDLDPAEYGLR
PVHCDVWNGFVFINFDPQPRQSLREFLGPMITGLDGYPFDKLTERYDWVA
HNNSNWKIFADAFQEYYHVPALHSQQVPPEVRDSNAVFTCGHFQLDGPHR
LVSTAGRRRWLMPPEYMYPIERATRSGLVGPWRTPDIGELPAGLNPGGIE
QWGISNFQIFPNLEILIYGGWYLLYRYWPTSHNTHRFEAYTYFHPARSVR
ERIEHEVAAVVLKEFALQDAGMLGGTQAALEYGVVDDFPLNDQEILVRHL
HKVVVDWVDAYRRERETVGV
41409233NP_962069.1 hypothetical protein MAP3135c [Mycobacterium avium subsp. paratuberculoMSLLTITKLTDSVGAEVTGLDPAALAHDDSVGEAVLDALEDNGVLVFRGL
YLDPAAQVAFCGRLGEVDHSSDGHHPVPGIYPITLDKSKNASAAYLKATF
DWHIDGCTPLGDECPQKATVLSAVRVAERGGETEFANSYAAYDALTDDEK
RRFGALRVVHSLEASQRRVYPDPSPELMARWRSRRTHEHPLVWTHRSGRK
SLVLGASADYVVGMDVDEGRALLEELLQRATVPERVYRHGWSIGDTVIWD
NRGVLHRAAPYDPDSSREMLRTTVRGDEPIQ
41409232NP_962068.1 hypothetical protein MAP3134c [Mycobacterium avium subsp. paratuberculoMAASDRHPQRLTPLPADEWDEDTRAALASLIPAERANPVGAGNVLSTLVR
HPDLTAAYLPFNAYLLTRSTLSPRIREVALLRVVHRSKCGYLWSHHLPIA
RRAGLSESDIDDIRRGRCADPTDAAVVRAVDELTGDSTLSRQTWDRLCEL
FTQRQCMDLIFTIGGYLLLALAVNTFGVQEEETP
41409231NP_962067.1 hypothetical protein MAP3133c [Mycobacterium avium subsp. paratuberculoMVRIASVVARQLLDCKARPLVEVEITTDTGHVGRGAAPTGTSVGAHEAFV
LRDGDPTRYRGRSVHRAVAAVRDEIAPALTGAELDDPRSLDRVMIELDDT
PDKHRLGGNAIYSTSIALLRAAAAAAGTPTYTYVGALLGLTPPTTVPMPS
FNMINGGRYGDVEQSFSEFLVVPYRAESIQAAVEKGVSLFEVLGEVLAEH
LGRTPLLASSYGYIAPSGDPHAVLELLAEAVERAGCADVMAFALDCASSE
VCDNGSATYAFNGGRVTAEALIDYARALSQEFPMLFIEDLLDGDDWAGFT
KAVQTVNRSIIVGDDLIVTNRDRLRRAVETSAVDGFILMPNQVGTIAEAL
DCFEYASQNGLLAIPSGRSGGVIDDVVMDLAVGLGAPLQKNGAPRSGERI
EKLNFLLRAAEGIPDCALADVPALARF
41409230NP_962066.1 hypothetical protein MAP3132 [Mycobacterium avium subsp. paratuberculosMTAPGAARPQKRAGSLRPGELAQASVMGALCAAIAIIAVVLPHGGGLGLL
GSVPTGLLAYRYRIRVLITATVAAGVIGFLVVGLSGLAAIALCAYTGGLA
GIVKRHRRGTPTVLAVSLVAAGVVGAGMVIALTVLTRLRQLAFHAIGAAV
DGAASVVARVPPLHAAAVRFAEFFAAALQHWQWMVLGYALVAIVGASLVG
WWALSRVLERLRGIPDVHKLDAPARNGPTRPVPVRLDRVRLRYPHADRDA
LRAVSLDVQAGEHVAVTGANGAGKTTLMLVLAGREPTSGTIERPGSVGLG
ELGGTAVVMQHPESQVLGTRVADDVVWGLPPGTTTDVGRLLGEVGLAGLA
DRDTGSLSGGELQRLAVAAALAREPALLIADEVTSMVDRQGREQLLTVLS
GLTERHRTALVHITHYNDEAEYADRTINLGDTQGDTALIRTATAPAPTCP
AGRGRRAPVLELAGVGHEYASGTPWSRTALRDVSFTVHEGDGLLIHGGNG
SGKSTLAWIMAGLTVPTTGTCLLDGRPAAEQVGAVALQFQAARLQLMRSR
VDLEVASAAGFSSDDRDRVSAALAAVGLDAGLAERRIDQLSGGQMRRVVL
AGLLARSPRVLILDEPLAGLDAASQRGLVELLAERRRETGLTVVVISHDF
AGLEQLCPRILHLRDGSLDANPVAARPDPVPVAPPTKRPAARRRPVVLLR
PVPGSSPIHELWAGTKLLVVFAMSLLLTVFPGWVAVGLATALAAAGLRLA
HIPRGVLPSVPRWLWIFLGVVGVTAALAGGAPTIRLGTASLGLGGLLDFL
RATALTVVLLGLGALVSWTTNVAQIAPAVATLGRPLRVLRIPVDDWSVAL
ALALRTFPMLIDEFRVLYAARRLRPRRPAQTRWARLRRPATDLIDVVVAV
ITVTLRRADEMGDAITARGGTGQISAAPSRPKRNDWIALSIASAVCAAAV
AAELALLAGH
41409229NP_962065.1 hypothetical protein MAP3131 [Mycobacterium avium subsp. paratuberculosMTEHRLGASRVKRPLIPRMVRAFAIPIIFFWGLLAVTTNTFMPQVERVAE
ELAGPMVPHYAPSQRSLLHIGEKFHESNSTNLTMVVFEANRPLGDSDHLY
YDDLMRRLQRDTKHVQYVMDLWGKPFTAAGAQSVDGRCTYVLLRLAGDIG
QIQANQSVDAVRDIIKNDTPPPGLKVYVSGAAPLASDTLSIANASLNNVT
IVTIILIVVMLLLVYRTPSTLLVPLLGVLIEMLVAKGITSTLGHLGYIEL
SSFAVNIVIALTLGAGTDYGIFLMGRYHEARQAGESREDSFYIAYRGVAP
IIIGSGLTIAGACYCLTFARLNYFHTMGPAVAITMLFTIAAAMTLGPALL
TVGSLFGMFDPRTDSKGRLYRRIGASVVRWPVPILVASSAIVMVGAIFVP
TYRQNYDDRQYQPRNAPANLGFQAADRHFPKSKLFSEMLMIETDHDMRNS
ADFISLDRVAKALIRLHGVAMVQGMTRPLGRALEHASIPYLFTTQGSGNG
QQLPFNREQNSNTDAQAEIQAHSVAVLRKEIGFFQKVSDELHQTVLTVED
LQRVSDEMNEEVSNLDDFFRPIKSYFYWEKHCFDIPLCWAFRSLWDTIDH
IDHLAEDINQARISLTEVDKAFPQIIAQLKATADDTEALQLKLVNSYGSA
DLQSIQTDQTYDDLINVGNDFDRSRSDDYFYIPHEGFDNDDVKTGMKLMM
SPDGKAARFIVTHEGDAMGPEGVEHVEQFPEAIKTILKETSLAGARIYIG
GSGSNDKDIKQYAMSDLLIAAIAAFVLIFLIMLFITRSLVAALVIPGTVA
FSYAGAFGLSILFWQHLIGLHLHWLVLPLTFIILVAVGSDYNLLLINRVK
EELHGGIHTGLIRALGSTGGVVTSAGLVFAFTMLAMLTSELRTIGQVGST
VCIGLLLDTLIVRSFVVPSILRILGPWFWWPTLVRSRPLPQR
41409228NP_962064.1 MmpS2 [Mycobacterium avium subsp. paratuberculosis K-10]MSPRSTGRAVLARIWMPLVAVVAVGVGLLCMYKVHQFSEPEPVITVNGPQ
APEQFNLKRITYEVFGSAGQGGKLVYVDIDGHPHQVDITTLPWTHTESTT
LSVASGSISVHVHGGQVGCRMLVNDVVRDEQSGNHQDADVQCRVKSA
41409227NP_962063.1 hypothetical protein MAP3129 [Mycobacterium avium subsp. paratuberculosMSEAVYGLATVIALALASTLALVAAVHVHRLEGRATAPISEEIGSAKAVL
HKVRKGEPMSPAEVDYAKQVVADRGSLMTLCIPGALFMLGCFFVFGSLYH
LHGATPSERTFLGVIPMLTSTNLAIQIRRSARLRRRLRHLS
41409226NP_962062.1 hypothetical protein MAP3128 [Mycobacterium avium subsp. paratuberculosMAGREVTSRFAGLALAPVAIALAMLFAPFAGADGYTDQLVARFDSQTHVV
ADPGARPPLQNPDGLNRQILAGPWRWSSGPPIWVAAVAPAQSGVTTADSI
HEAMLRRDAQFSGVILVIDSRGYHVRAYHVPKVVADNVDEFMNQSAQDHR
NDPYGAASEFVGKLSGVSVPTRAPVSTSPLVQQQRDDWAWLKAAFVIAGI
ALATAGLIWFAVSRNRKHRKDIENREQIKQELITAASNVGDLDNEVLTDG
NTDVSAESLKANASLHDARKAYEKGDYGAARTHLRVVESTVAKANRKLHP
GQREPEGAGADSSVPAPERKQASVRTTDPETGQTVTISNADYRPTAQPGY
PHYFGGGYHNGIFFQPGFYPYPFWGPGWGWALGDVLLMDALLDDHWGGGF
ERGFEAGRDAAFADAGSHNAANYDAANYEAANYDGANYDGGYDAGGDIGF
DGGWDSGAGWDSGGSDSGGDIGF
41409225NP_962061.1 EmrE [Mycobacterium avium subsp. paratuberculosis K-10]MPGTGHNLRFLSCPVHTYLYMRARGGVLTYLFLICAILAEVVATSLLKST
QGFTRLWPTVICLLGYAVSFALLAVSISRGMQTDVAYALWSAIGTALIVL
IAVLFLGSPISVTKVVGVGLIIAGVVTLNLTGAH
41409224NP_962060.1 hypothetical protein MAP3126c [Mycobacterium avium subsp. paratuberculoMLVCLPGGTYSREYWDLDIAGHDGYSFADFATGNGYAVLTVDPLGTGESS
QPASDFGFAEIGAALDCALRALPGTTGVQAPAVAVAHSLGGYLALTQQAL
FGGYAAMAMLGCTNQHVAPLNLDPAFRARAATPQGRAELAAEILAALAQP
YFAGPREHLQGWFHLADVPADIVAADAVTAVSVVPRVFGTAMIPGIVAEH
AARIDVPVLLGYGVVDVSPDPRAEAALYRSSPDITTVVLAGSAHCHNMAS
SRHRLWRRLLAWAATAIDG
41409223NP_962059.1 hypothetical protein MAP3125c [Mycobacterium avium subsp. paratuberculoMSGQRCDGMVALVTGSSRGLGRAIAGRLAARGATVALTARTLDPDPKYQG
SLRQTRDEILAAGGKAVAVQADLSQPDERERLFAEVVDTVGAPDILVNNA
AVTFLRPLDGFPQRRARLMMEMHVLGPLHLCQLAIPAMRERGRGWIVNLT
SVGGDLPPGPPFSEFDRTAGFGIYGTAKAALNRLTKSLAAELYDDGIAVN
AAAPSNPVATPGAGTLDLAKTDTEDIALITETVFRLCTGDPKTLTGRIAH
TQPFLAEVGWPGTGPPVT
41409222NP_962058.1 hypothetical protein MAP3124c [Mycobacterium avium subsp. paratuberculoMVIKVAPPGVAPVAHRDVLRQARIIKALAPTDVPVPRVCWEDAGQAPYTP
PLYVMSRVEGDCGEPLFDGWPAVPGLADRYRNACRTMAALHRISPTELGL
GGEPVTDPVAEVHRWSDTLGTVDPALAPGWPKVRDALLDCAPRAMPPAVV
HGDFRLGNLLADGPRINAVIDWEIWSIGDPRIDVGWFLINCDPDTYRRVT
PPHGAVPSTAELADLYLHELGCDAGDLDWFSALACFKSAATWSLIVKHNR
RRSSPRAELESMATTLPRLLDRAGALLARRR
41409221NP_962057.1 hypothetical protein MAP3123c [Mycobacterium avium subsp. paratuberculoMAAVCLALSLPTAPTTGADPDAAPPPPEAAPAAEGALPSNPPAILKTPDG
WTLGLGARDEQQVPVAPLTTALSSREYLASGIFVGSLSGPTQPQGVLEVG
YEIGCGIDMSTSDGVTIGGTAGITPGVTGPVTGVPGDVLPLVVAPIAGVL
NVGLKPGLVIVVPVVKKQFRGPNPWVMVSNFHVKIDGCVGQSFIRSYAVL
NRVTDESDVVLSYVGVTKAV
41409220NP_962056.1 FadE1_2 [Mycobacterium avium subsp. paratuberculosis K-10]MSWDFSTEPQWARQLEWVEDFVREECEPIDLIVKESHDLDDPVRQALIPP
LQKIVKERGLWATHLGPHLGGPGYGQVKLALLNEILGRSECAPIVFGSQA
PDSGNSEILAHYGTPELKARYLEPLLDNRIVSCFSMTEPQGGADPKVFRT
TAVPDGDHWVINGEKWFSSFASMASFIIVMAMTDPEAPPYQRYSMFVVPG
DTPGITVLRDVGLGYQPLGGGREGYVRYENVRVPADHMLGPRGGAFVVAQ
TRLGGGRIHHAMRTVGLVRRIFDMICERAVSRYTQGEVLANKQLVQEMVA
DSWMEIEAFRLLTLQTAWKIDQFNDYRAVRADISAVKAMMQRVLHDVSAR
ALQLHGSLGTTHEMPFVQYLVESFVLGLADGPTEVHKVTLARLLLKDRAP
APDLFPSEHLLRLRAAAEAKFADKLAGIPRG
41409219NP_962055.1 hypothetical protein MAP3121 [Mycobacterium avium subsp. paratuberculosMDSRRRRRRDRRRRHGHRDHHRAGVTMPSMLELAAPGDGVRVLRLNRPHR
LNAIDEAMQTELRLVLDDLAADHAVRAVVLTGAGRGFCAGIDMRDFGPSM
VRADAPALERMRFQERMAALAEAVWALPQPVIAAVNGPCVGAGLALCLAA
DIRICSAAATFANAAILLGLSGAEMGMSYHLPRIVGTGVAADWMLTGRTV
SAAEADRRGLVSEVVEPDRLAERAVELARLIAGHAPLGAQLTKRALQVNT
DAASLASAMELENRNQVIAHATDEAAARRQMWSR
41409218NP_962054.1 hypothetical protein MAP3120c [Mycobacterium avium subsp. paratuberculoMTKIGYFLSCEQFGPKELVDQAKRAQDAGFEALWISDHFHPWNDEQGQSP
FVWSVIGALSEATSLPVSTAVTCPTIRIHPAIIAQAAATAAVQLQGRFVL
GVGSGEALNEHILGDPWPSAGVRLQMLEEAVEVIRKLHQGGEVSHHGKHY
EVQEARIYTRPEQPVPIYGSAFGPQAVRLAARIGDGYSISMPDGELVKQF
REAGGGDKPVQGGTKVCWDADADAALKTAHRLWGNEGLPGQTSQILPRPK
DFAALMPLVPPDTVAQSVACGPDPDRHIAQLRRYIDADIDEVYVQQIGPD
MDGFFAAWEQAVLPAVRN
41409217NP_962053.1 hypothetical protein MAP3119 [Mycobacterium avium subsp. paratuberculosMRVGIDFGTTHTVVAAVDRGNYPVVFFDGMDAWPSIIAANAAGELRYGAD
AAAVRHDPSWSVLRSFKRLLNDAGPQTRVKLAGRDYRLAELLTGFLARLK
TDLQQHSNATVAPGEPIEAAISVPANASSAQRLLTLDAYVAAGFHVVALL
NEPSAASLEYAHRYRSTITAKREYVLVYDLGGGTFDASLLKMTGHSNEVV
VSEGIQRLGGDDFDEAIVELVRAGADLPGLDAAGRALLAEECAARKEAVG
PQTRRFLVDLSPFDRPPFSCPVDDVYAACAPLVDPTMRLLERVLRDPSRG
RADVDWSEVAGIYVVGGAGGFPLVSRMLRARFGDKRVKRSPHPFAATAIG
LAVFLDKESGFALSERFSRNFGVFREAEAGAGVVFDPIVCKDVSLPADGQ
TPLVVKRRYRAAHNIGHFRFVECSRLVDGRPDGDITPYDPVLFPFDPALR
DRDDLGRQPVGRWRDGPDVEERYVIAPSGAVEVTLTTQPAGFERTFRLER
CASAS
41409216NP_962052.1 hypothetical protein MAP3118 [Mycobacterium avium subsp. paratuberculosMAITERDDGVSYVHTDHNLPPVAIVDRSPITARHRIVFAVIAFARGEPVN
AVWFVVAAICSYLIGFRFYARLIERKIVHPRDDHATPAEILDDGADYVPT
DRRVLFGHHFAAIAGAGPLVGPVLAAQMGYLPCTIWIVAGAVFAGAVQDY
LVLWISTRRRGRSLGQMARDELGASGGLAALLGAFVIMVIIIAVLALVVV
RGLAQSPWGVFSIAMTIPIAVFMGCYLRFLRPGRVAEVSVLGFALLLIAV
ATGSWVAETPWGASWLSLSPVTVSWLIIGYGFVASVLPVWLLLAPRDYLS
TFMKVGAIALLAVGICIARPVMQAPAVSHFASRGDGPVFSGALFPFLFIT
IACGALSGFHALISSGTTPKLLEKESQMRLIGYGGMLTESFVAVMALISA
AVLDQHLYFTLNAPAAQTGGTAATAAHYVNGLGLPGAPTTVDQLNRAAAA
VGEKSIVSRTGGAPTLAVGMAEVLYRVFGGAGLKAFWYHFAIMFEALFIL
TAVDAGTRVARFMLSDTLGNLGGPLARLRNPSWRPGVWLCSLAVAAGWGG
ILLMGVTDPLGGINTLFPLFGIANQLLAAIALTVITVIVVKKGLLKWAWI
PGAPLLWDLVVTLSASWQKIFSADPAVGYWTQHFQYLAAKSAGRTSFGSA
RNAHQLDQVIRNTFIQGSLSIAFAAAVVVVVIAGVLAALGAIRGPASRLS
RPLTEDEPVPSALFAPSGLIATAAEREVQRRWDAPGGKVVPKPAPRS
41409215NP_962051.1 ATP-dependent DNA ligase [Mycobacterium avium subsp. paratuberculosis KMSPSHAKLATVLLFDVATASADVGGTPSRLTKVARIADLLRRAAPNAALV
AIVVSWLSGELRQRQIGVGWAALRSRPPAAAHPTLTVVAVDAAFAEIGAV
AGKGAQARRAALLNALFAAATETEQTFLLRLLGGELRQGALAGIMADAVA
RAAGIPAAAVQRAAMLGGDLPAVAAAALSGEASALDAFTLRVGRPVAPML
AQTAAGVAQAIERHGGQAIFEAKLDGARVQIHRAGDQVTVYTRSLDDVTA
RLPEVVTATLALPVEALIADGEAIALRPDNSPQRFQVTASRFGRSLDVAA
AVAAQPLSVFIFDILHCDGIDLLDAPTTDRLAALDALVPPAQRVDRLLTA
DPDAAGRFLEATLAAGHEGVMAKAPGAPYQAGRRGAGWLKVKPVHTLDLV
VLAVEWGSGRRRGKLSNIHLGARDPATGEFVMVGKTFKGMTDAMLDWQTA
RFTELAVGGTDGYVVRVRPEQVVEVAVDGVQKSSRYPGGLALRFARVLRY
RDDKGPAEADTIDAVRALY
41409214NP_962050.1 hypothetical protein MAP3116c [Mycobacterium avium subsp. paratuberculoMEINGKKAVVVGGASGMGRASAELFAARGADVAILDRESSDGKAVAEGIG
AAFYPVDVTDFAGTEETLQSAVDKLGGLHVIVTTAGGGIAKRTLTKNGPH
DLESFQSVIDLNLIATFNISRLAAAHMAKNEPEDEERGVIINTASIAAFE
GQIGQVAYTAAKAAIAGMCLTMARDLGSVGVRVLAIAPSLFATGLTQGIP
DEFATQLTKDAAFPKRLGRPEEYAKLALAIVDNPMLNGQCLRLDAGQRFA
PK
41409213NP_962049.1 FadE22 [Mycobacterium avium subsp. paratuberculosis K-10]MGIALTDDHRELAEVARGFLTSQKARWAARSLLDATDEPRPGFWPNLVEL
GWLGLHIDEEYGGSGFGLPELVVVVEELGRAVAPGPFVPTVIASAVIAKN
GTAEQKSRLLPGLIDGTVTAGIGLDSRVRLGDGAADGEAGIVLGAGLAGL
LLIAAGDDVLVLERDRDGVSVDVPDNFDPTRRSGRVRLDNVRVSDADLLA
GARPSALARARTLLAAEAVGGASDCVDAAVAYAKVRQQFGRTIATFQAVK
HHCANMLVGAESGIAAVWDAARAAGEDEDQFHLIAAVAAALAFPAHVRNA
ELNIQVHGGIGFTWEHDAHLHLRRAVVTAALFGGDAPAADVFERTAAGTV
RDNSLDLPPEAEELRTTIRADAAAIAALDKDAQLDKLIETGYVMPHWPKP
WGRAADAVEQLVIEEEFRAAGIKRPDYGITGWVILTLIQHGTPWQIERFV
EKALRKDEIWCQLFSEPDAGSDAASIKTRATRVEGGWKINGQKVWTSGAH
YCARGLATVRTDPDAPKHAGITTVIVDMKAPEVEVRPLRQITGGSDFNEV
FFNDLFVPDEDVVGTPNSGWTVARATLGNERVSIGGSGSFYEGLADQLVQ
LAQQRPDRLAGGKIRVGSYLAEETALRLLNLRRAARSVEGTGPGPEGNVT
KLKLAEHMVEGAAIMAALLGPEVALTDGPGALSGRLMMGARGMAIAGGTS
EVTRNQIAERILGMPRDPLIN
41409212NP_962048.1 hypothetical protein MAP3114 [Mycobacterium avium subsp. paratuberculosMSDGPLRIEYCDGCARWVHPASGRCRDCGGALVAREVCGRGTVFTYTVNH
HPYNPEIPTPYVIAIVELAEQSDLRVAANIVDCEPDSVACGMPVTLLPER
GSGGGPAVRPGLSREPTRPGR
41409211NP_962047.1 hypothetical protein MAP3113c [Mycobacterium avium subsp. paratuberculoMCMAHFEKDAILSGIGISRIGRRTGIPGLELTMEAVRAAVADAGLAPTDI
DGIATLGDTLAADVNAQLGIDAADCGSGFGTGGLLSPVMSACRAVAERRA
RHVVVYRTIQMLGGTVPVKQEPNAAAPPLARMFETPEGEPKPAVGAMDDV
NDLVAAHDYSAANWLALNCRRHMQLYGTRKEQLGWVALNGRRNAALNPLA
VYRDPMTMADYLGARLVSTPLGLLDCDVPIDGSIAVVVSHLEYAPDCPHR
AVQVEAIGGSDGAGGWFHRADYPKMAMSDAAAQMWSRTDLTAADLDVAQL
YDGFTFLTLAWLEALGVCGDGEAGPFVEGGARIARDGELPLNTYGGQLSA
GRMHGYWALHEGCLQLRGDAGERQVARRPQVGVVSVGGGPVAGCMLLTCR
41409210NP_962046.1 hypothetical protein MAP3112c [Mycobacterium avium subsp. paratuberculoMNAEPRTGPAKTLASALARDIEAEIVRRGWAVGESLGSEPALQQRFGVSR
SVLREAVRLVEHHQVARMRRGPNGGLYICEPDAGPATRAVVIYLEYLGTT
LADLLNARLVLEPLAASLAAERIDEAGIARLRAVLHAEQQWRPGLPMPRD
EFHIALAEQSKNPVLQLFIKVLMRLTTRYALQSRTDSETEALEAVDHLHT
HHSRIVAAVTAGDPARAKTLSERHVEAVTAWLQRHHAGDRNRGRTPRRPL
NSEVPQGKLAEMLAATIGDDIAADGWRVGSVFGTETALLQRYRVSRAVFR
EAVRLLEYHSIAHMRRGPGGGLVIAEPAAQASIDTIALYLQYRDPSREDL
RCVRDAIEIDNVAKVVKRLAEPQVAAFVASRRSGLPDDSRQTPDDVRRAI
AEEFDFHVGLAQLAGNAPLDLFLRIIVELFRRHWSSTGQALPTWSDVRAV
HHAHLRIADAVAAGDLSVASYRLRRHLDAAASWWL
41409209NP_962045.1 hypothetical protein MAP3111c [Mycobacterium avium subsp. paratuberculoMTADDETRQYGFVHAALIYRSQQEFLDVVAGFVGDGLAGNEAVLLAVPPA
LMALLRDELYAGGEPPAGVRMADITESARNPSRFMAMQGAFVDEHPDRRV
RIVSQLAWPGRSREEFVACIEHEALVNEAMDGYPATALCLYDASTLDDGV
LADARATHPLLCKSGALQRSPDYAPGEVLERCNQPLPANPGAVTYLVRRS
ADLRPARSFAVDYAGWVGLSQESIEDLQLVATELATNSLMYTGGACRLAF
WQDDRYLVCEARDTGRFDDPLVGRLDPGPCGPASRGLYLVNAISDLVRTH
TTSTGTTIQAYLCFEPAVRPTG
41409208NP_962044.1 hypothetical protein MAP3110c [Mycobacterium avium subsp. paratuberculoMTIPERNPLPHPESATAWFGDRFGVPLPRGLRERAEAMSWDAFVATYGRS
GGPLRLGPWERTDSDCAATGLGSRAGNYRAVIAVGDQIGTATAAAAGPIA
ALTAMLHERGINLEILHFHQMRSATATATFIRGGNGARAEWAMGWSPDPT
RSALRAVIACANRLFAPQWSDGSR
41409207NP_962043.1 hypothetical protein MAP3109 [Mycobacterium avium subsp. paratuberculosMTATISTPQYLLDQARRRFTPTLNTIPGMGAIEKRLLAHEWQTKVLAEPP
AGSGLKPVLGDAGLPILGHIIELFRGGPDYALFLYRNHGPLIYLDSPIMP
AVTALGPDATQAVFSNRNKDYSQKGWHPVIGPFFNRGLMMLDFDEHMYHR
RIMQEAFTRSRLTGYVEHIDRVATAIVADWPTNDARFLFHPAMKELTLDI
ASLVFMGHEPGTDHDLVTTVNQAFTTTTRAGGAIIRQPIPPFKWWRGLRA
RQLLEDYFSERVKERRNATGNDMLTVLCHTEDDDGNSFTDDDIVNHMIFL
MMAAHDTSTSTTTTMVYNMAAHPEWQERAREESARLGDGPLDIEALEKLE
TLELIMNESLRMVTPLPFNMRQAVRDTELLGHYIPAGTNITIWPGMNHRL
PELWTDPDKFDPERFAEPRAEHKKHRYAFAPFGGGAHKCIGMVFGQLEVK
TVVHRLLRRYRLELARPGYQPRWDYGGMPIPMDGMPIVLRPL
41409206NP_962042.1 hypothetical protein MAP3108c [Mycobacterium avium subsp. paratuberculoMVQGRGVTSHPANPEPGARRRGDKQRQAILAVVRELLQEKPFAELSVSTI
SLRAGVARSGFYFYFDSKYAVLAQLMAEATEELEELTQYFAPRQPGESPE
QFAKRMVGSAAAVYAHNDPVMTACNEARHTDVEIRNLMDQQFEVVLAQIV
GIVEAEMKAGTARPISDDLPTLIRTLAGTTALMLTGDPVLTGPDSDRDRR
VAVLEQLWLHALWAGRP
41409205NP_962041.1 short chain dehydrogenase [Mycobacterium avium subsp. paratuberculosis MAQKASGRYYAGKRCLVTGAASGIGRATALRLAAHGAELYLTDRDGDGLR
LTVEDARALGASVPEHRALDIADYDQVASFAADIHAAHPPMDVVLNIAGV
SAWGTVDRLTHEQWRKMIAINLMGPIHVIETFVPPMVAAGRGGHLANVSS
AAGLVALPWHAAYSASKYGLRGLSEVLRFDLARHRIGVSVVVPGAVNTPL
VNTVEIAGVDRDDPDVARWVRRFAGHAVSPEKAADKILAGVARNRYLIYT
SPDIRALYAFKRLAWWPYSVVMRQVNVIFTRALRPAPATLVRHDQLETHP
EQPDRPVELE
41409204NP_962040.1 DNA polymerase IV [Mycobacterium avium subsp. paratuberculosis K-10]MSPRWVLHVDLDQFLASVELRRRPELAGLPVIVGGNGDPNEPRKVVTCAS
YEAREFGVRAGMPLRAAARRCPPDSGVTFLPSDPAAYDAASDQVMGLLRD
LGHPVEVWGWDEAYLAVTATDPIEVAEQIRGVISSETGLTCSVGISDNKQ
RAKIATGFAKPDGVFVLTDANWMALMADRPVDALWGVGPKTAKKLADLQI
TTVWQLAHSDAELLTATFGPRTGLWLLLLAKGGGDDHVSAQPWVPRSRSH
VVTFPRDLTDRAEMETAVTDLADQAVAEVLTAGRVVTRVAVTVRTATFYT
RTKIRKLDAPSTDRDVIVAAALRVLDLFELDRPVRLLGVRLELVMPD
41409203NP_962039.1 hypothetical protein MAP3105 [Mycobacterium avium subsp. paratuberculosMSGVEQRGQLRFCDPRVPAPERGDAARNRALLLDAARRLVAERGADAVTM
DDVAAAAGVGKGTLFRRFGSRAGLMMVLLDEDERAIQQAFLFGPPPLGPD
APPLDRLVAFGRERLRFAHTHHALLSAANRDPRTRYGPPSAVLRRHVRVL
LAAAHTTGDLDAQADALLALLDADYVHHQISDHGHTLQTLGDAWESLARK
LCGN
41409202NP_962038.1 hypothetical protein MAP3104c [Mycobacterium avium subsp. paratuberculoMRGWTPTTEGNWRIVAIKILALVGSLRSASINRQIAELASAVAGEDVVVT
VFEGLGELPFYNEEIDDAMTSDAPPLAPVAALRAAAADADAALVVTPEYN
GSIPAVIKNAIDWLSRPFGDGALKGKPLAVIGGSFGQYGGVWAHDETRKS
FGIAGARVVESIKLSVPFKTLAGKAPAEHAELSANVRDVVGKLAAEVG
41409201NP_962037.1 hypothetical protein MAP3103c [Mycobacterium avium subsp. paratuberculoMICDTPGRVSEFVRHRPYDQGISKLSFRTSCISTSSEPLGVVFRAPADPR
TTEPRGRGGTPEIGAELSKTGLRHPTAAGRESGGLPDR
41409200NP_962036.1 NrdH [Mycobacterium avium subsp. paratuberculosis K-10]MTITVYTKPACVQCSATYKALDKHGIAYEKVDITLDPEARDYVMALGYLQ
APVVVAGSDHWSGFRPDRIKALAGAELSA
41409199NP_962035.1 ribonucleotide reductase stimulatory protein [Mycobacterium avium subspMDSTGRNLVYFSSVSENTHRFVQKLGIPAIRIPLHGRIEVDHPYVLLLPT
YGGGRATPDLNAGGYVPKQVIAFLNNEHNRSLIRGVIAAGNNNFGAEFAY
AGNVVSRKCGVPYLYRFELMGTQDDVDAVRAGLAEFWKEQTCHQPSLQSL
41409198NP_962034.1 ribonucleotide-diphosphate reductase subunit alpha [Mycobacterium aviumMEGTDVSPTVAAEPVTAGAHGLPDETDYHALNAMLNLYDADGKIQFDKDV
LAARQYFLQHVNQNTVFFHNQDEKLDYLIRENYYEREVLDQYSRNFVKSL
LDRAYAKKFRFPTFLGAFKYYTSYTLKTFDGKRYLERFEDRVVMVALTLA
AGDTGLAEKLVDEIIEGRFQPATPTFLNSGKKQRGEPVSCFLLRIEDNME
SIGRSINSALQLSKRGGGVALLLTNIREHGAPIKNIENQSSGVIPIMKLL
EDSFSYANQLGARQGAGAVYLHAHHPDIYRFLDTKRENADEKIRIKTLSL
GVVIPDITFELAKKNEDMYLFSPYDVERVYGLPFADISVTEKYYEMVDDA
RIRKTKIKAREFFQTLAELQFESGYPYIMFEDTVNRANPIDGKITHSNLC
SEILQVSTPSLFNDDLSYAKVGKDISCNLGSLNIAKTMDSPDFAQTIEVA
IRALTAVSDQTHITSVPSIEQGNNDSHAIGLGQMNLHGYLAREGIFYGSE
EGIDFTNIYFYTVLYHALRASNRIAIERGTHFKGFERSKYASGEFFDKYT
EQVWEPATEKVRQLFADAGIRIPTQDDWKRLKESVQAHGIYNQNLQAVPP
TGSISYINHSTSSIHPIVSKVEIRKEGKIGRVYYPAPYMTNDNLEYYQDA
YEIGYEKIIDTYAAATQHVDQGLSLTLFFKDTATTRDVNKAQIYAWRKGI
KTLYYIRLRQMALEGTEVEGCVSCML
41409197NP_962033.1 hypothetical protein MAP3099c [Mycobacterium avium subsp. paratuberculoMPRPARPHSATKPGAKVDARSERWREHRKKVRNEIVDAAFRAIDRLGPEL
SVREIAEEAGTAKPKIYRHFHDKSDLFQAIGERLRDMLWTAIFPSIDLKT
DSAREVIRRSVEEYVTLVDKHPNVLRVFIQGRSTGTPQSTVTILNEGREI
TLAMADLFDNELREMELDHAAVELAAHAAFGSAASATEWWLGPEPDSPRL
MSRAQFVAHLSTIMMAVIIGTAETLGITMNPDQPIHDAVVRKPAVS
41409196NP_962032.1 hypothetical protein MAP3098c [Mycobacterium avium subsp. paratuberculoMTDVVTHTETAPTPAAKAAKPVHTRAVIIGTGFSGLGMAIALQKQGVGFV
ILEKADDIGGTWRDNSYPGCACDIPSHLYSFSFEPKPDWKNPFSYQPEIW
DYLKGVTEKYGLRRYIEFNSLVDRAHWDDDEHRWHVFTTDGREYVAQFLI
SGAGALHIPSLPDIEGRDEFAGPAFHSAEWDHTVDLTGKRVAVIGTGASA
IQIVPEIVGQVAELQLYQRTPPWVVPRSNPEIPPAVRAAMENVPGLRALV
RLAIYWGQEALAFGMTKRPNLLKVIEAYAKYNIRRSVKDKELRRKLTPHY
RIGCKRILNSSTYYGAVADPKTELVTDHIARITPDGIVTADGTHRPVDVI
VYATGFHVTDSYTYVQIKGLHGEDLVDRWNREGIGAHRGITVADVPNLFF
LLGPNTGLGHNSVVFMIESQIRYVADAIATCDKLGAQALAPTRAAQDRFN
DELQRRLGPSVWNSGGCSSWYLDEHGKNTVLWGGYTWEYWRATRAVKPQE
YQFYGIGSRPGV
41409195NP_962031.1 hypothetical protein MAP3097 [Mycobacterium avium subsp. paratuberculosMARTPDRQRRRELLDALIAEFAAGGIGDRSLRRVAEAVGTSHRMLLHHFG
SREGLLLAIVEEVERRQMRVLTELPRAPAEGFAAMWADLRRPELREFERL
FFECYSRAAQGEKPFARMLPDAVDDWLRQAETHSGAPFDPAMARLGLAVI
RGLLLDLVATGDEAGVDAAARAFVNLLNAGA
41409194NP_962030.1 hypothetical protein MAP3096 [Mycobacterium avium subsp. paratuberculosMSPTPFDRFPSSMRRARCTIWYMFTEDSVEIDAPPRLVWDVFTDVERWPE
WTASVTSLTGLDGPALAVGRRFAIKQPGMAKLVWQVTELIPGASWTWVQR
SPGARVAATHHVSARPGGGTLVRQQLDQRGALGALVGRLMAKKTKRFLAL
EARGLKARAEQLSRADGAHP
41409193NP_962029.1 ribonucleotide-diphosphate reductase subunit beta [Mycobacterium avium MSENMKLIDRVSAINWNRLQDDKDAEVWDRLTGNFWLPEKVPVSNDLQSW
ATLTAHEKQMTMRVFTGLTLLDTIQGTVGAVSLIPDALTPHEEAVYTNIA
FMESVHARSYSNIFSTLCSTAEIDDAFRWSEENPNLQRKAEIVMQYYKGD
EPLKRKVASTLLESFLFYSGFYLPMYWSSRAKLTNTADMIRLIIRDEAVH
GYYIGYKYQRGLALVDDAKRQELKDYTYELLFELYDNEVEYTQDLYDEVG
LTEDVKKFLRYNANKALMNLGYEALFPRDETDVNPAILSALSPNADENHD
FFSGSGSSYVIGKAVVTEDEDWDF
41409192NP_962028.1 hypothetical protein MAP3094c [Mycobacterium avium subsp. paratuberculoMTNTAASQTVNFCRSVLRWLRAGYPEGVPGPDRVPLLALLRSTPLTEEQI
AEVVREITKDGSPAIADGVINRDEIAEFISGMTHYDAGPENIIRVAARLA
AAGWPLAGIDVSEVIPGDDFAESAEIAARGQTPGVAS
41409191NP_962027.1 AdhC [Mycobacterium avium subsp. paratuberculosis K-10]MSTVSAYAATSATEPLTKTTIERRDPGPRDVAIDIKFAGICHSDIHTAKG
EWGHTNYPVVVGHEIAGVVTEVGAEVTKYKVGDHVGVGCMVNSCRQCSSC
TAGLEQYCKRGATFTYNSIDRDGSVTQGGYSQAIVVDEDFVVRIPDSLPL
DKAAPLLCAGITLFSPLRHWNAGPGTRLAIVGLGGLGHMGVKLGAAMGAE
VTVLSQSLKKMEDGLRLGAKHYHATADPDTFTKLRGSFDLMLNTVSANLK
LNDYLSLLDVDGTLVELGIPEHPMEVGAFPLALARRSLSGSNIGGIAETQ
EMLDFCAEHNVTPEIELIEPDYINEAYERVLASDVRYRFVIDISKL
41409190NP_962026.1 hypothetical protein MAP3092 [Mycobacterium avium subsp. paratuberculosMLFGVIRPARLAAVTAALMVACGGCGSDRPAATTTRSLVTPTTQIAGAGV
LGNDRRPDESCARDAAEADPGPAKRQVHNAPGADPAPVQVSADPQRIVVL
AGDQLDALCALGLQSRVVGAALPDGASGQPAYLGGAVRGVPGVGSRSHPD
VKAIAAAHPDLILGSQGLTPALYPQLAAIAPTVFTAAPGAAWRDNLRAVG
AATARAGAVDGLLSGFSQRAGDVGARHDASHFQASIVQLTTGSIRVFGAN
NFPASVLGAVGVDRPAAQRFTDKPYLEIGATDADLAKNPDLSVADADVVY
LSCATPAAADRAATVLDSGPWRKLSANRDNRVYVVNDEIWQTGQGLIAAR
GIVDDLRLVNAPIN
41409189NP_962025.1 CtaD [Mycobacterium avium subsp. paratuberculosis K-10]MTAEAPPLGELEAVRPYPDRTGPKGNLVYKLITTTDHKMIGIMYTVTCFA
FFFIGGLMALLMRTELAAPGLQFLSNEQFNQLFTMHGTIMLLLYATPVVF
GFANLVLPLQIGAPDVAFPRLNAFSFWLFLFGGLIAASGFIVPGGAADFG
WTAYTPLSDAVHSPGAGGDLWITGLIVAGLGTILGAVNMITTVVCMRAPG
MTMFRMPIFTWNILVTSILILIAFPILTAALFGLAADRHLGAHVYDAANG
GVLLWQHLFWFFGHPEVYIIALPFFGIITEIIPVFARKPVFGYTTLVYAT
LSIAALSVAVWAHHMFATGAVLLPFFSFMTYLIAVPTGIKFFNWIGTMWK
GQLTFETPMLFCVGFLLTFLLGGLTGVMLASPPLDFHVTDTYFVVAHFHY
VLFGTIVFATFAGVYFWFPKMTGRLLDERLGKLHFWLTFIGFHTTFLVQH
WLGDLGMPRRYADYLPSDGFQPYNVASTVGAFILGASMFPFVWNVFKSWR
YGEVVTVDDPWGYGNSLEWATSCPPPRHNFTELPRIRSERPAFELHYPHM
VERLRAEAHVGRAHGPADKDVTRLDDVQVRS
41409188NP_962024.1 SerB2 [Mycobacterium avium subsp. paratuberculosis K-10]MNSPPKVSVLITVTGVDQPGVTATLFEVLSRHGVELLNVEQVVIRHRLTL
GVLVCCPADVADGPALRHDVEAAIRKVGLDVSIERSDDVPIIREPSTHTI
FVLGRPITAAAFGAVAREVAALGVNIDLIRGVSDYPVIGLELRVSVPPGA
DGALRTALNRVSSEEHVDVAVEDYTLERRAKRLIVFDVDSTLVQGEVIEM
LAAKAGAEGQVAAITDAAMRGELDFAQSLQQRVATLAGLPATVIDEVAGQ
LELMPGARTTLRTLRRLGYACGVVSGGFRRIIEPLAEELMLDYVAANELE
IVDGTLTGRVVGPIIDRAGKATALREFAQRAGVPMAQTVAVGDGANDIDM
LAAAGLGIAFNAKPALREVADASLSHPYLDTVLFLLGVTRGEIEAADAID
GEVRRVEIPPE
41409187NP_962023.1 hypothetical protein MAP3089c [Mycobacterium avium subsp. paratuberculoMPENDSAAADPDLLIELRDVSLRRGGNVLVGPLDWAVELDERWVIVGPNG
AGKTSLLRIAAAAEHPSSGVAFVLGERLGRVDVTELRSRIGLSSSALAQR
VPSDEVVRDLVVSAGYAVLGRWRERYEDIDYRRAVDMLESLGAEHLADRS
YGTLSEGERKRVLIARALMTDPELLLLDEPAAGLDLGGREELVARLADLA
ADPDAPALVLVTHHVEEIPPGFSHCMLLSEGRVVAAGLLTDVLTSENLST
AFGQAIALDVVDGRYFARRVRTRAAHRRQL
41409186NP_962022.1 hypothetical protein MAP3088c [Mycobacterium avium subsp. paratuberculoMTSPEEAPLVPRPAATVMLVRDAPAGLKVFLMRRHSRMEFAAGVMVFPGG
GVDERDRNADLGGLGAWAGPPPQWWAQRFGIEPDLAEALVCAAARETFEE
SGVLFAGPAGAPDSIVGDASVYRDARRALADGTLSFADFLRTEKLELRSD
LLRPWANWVTPEAERTRRYDTYFFVGALPQGQRADGQNTESDRAGWTTPE
AALEDFSAGRTFLLPPTWTQLDSLAGRTVADVLAVQRQIAPVQPHVEIRG
DNWVFEFFDSDRYHRAREAGGLGWRH
41409185NP_962021.1 enoyl-CoA hydratase [Mycobacterium avium subsp. paratuberculosis K-10]MAALNEFVSVVVSDGSRDAGLAMLLVSRPPTNALSRQVYREVIAAADELG
RRDDVAAVILFGGHEIFSAGDDMPELRTLRGAEAETAARVRRDAIDAVAA
IPKPTVAAITGYALGAGLTLALAADWRISGDNVKFGATEILAGLVPGGDA
LARLTRVAGASKAKELVFSGRFFDAEEALALGLIDEMVAPDDVYDAAAAW
ARRFLDGPRHALAAAKAGVDAVFELPRAERLAAEQRRYVEVFSAGQGGDA
GADPHGG
41409184NP_962020.1 hypothetical protein MAP3086c [Mycobacterium avium subsp. paratuberculoMTRSTDAVPTPHATAEQVEAARHDSKLAQVLYHDWEAETYDEKWSISYDQ
RCIDYARGRFDAIVPEHVLRELPYDRALELGCGTGFFLLNLIQSGVARRG
SVTDLSPGMVKVATRNGQSLGLDIDGRVADAEGIPYEDDTFDLVVGHAVL
HHIPDVELSLREVIRVLRPGGRFVFAGEPTSAGDVYARELSTLTWRIATN
VTKLPGLGSWRRPQAELDESSRAAALEAIVDLHTFTPGDLERMAANAGAT
EVRTVSEEFTAAMFGWPVRTFEASVPPGRLGWGWAKFAFNGWKTLSWVDA
NIWRRVVPKGWFYNVMVTGVKPT
41409183NP_962019.1 hypothetical protein MAP3085c [Mycobacterium avium subsp. paratuberculoMSDATRIADIAATRARFGERTPLLVETVLLRRRASEKLGELGVSDWLFTD
EALQQATAAPVAVHRAGRLAGPGLVVHDVTCSIGTELAALRARGVTAVGS
DIDPVRLAMARHNIGSAAWLCRADALHPVTRDAVLMVDPARRVDGRRRLR
IDDYQPALSPLLDSYRGRDFVVKCAPGIDFEQVRRLGFAGEIEVTSYRGS
VREACLWSAGLAAAGVRRRATVLDRGEQITDADPDDCPVRPVGRWIVDPD
GAVVRAGLVRHYGARHGLWQLDPDIAYLSGDRLPATVRGLGVLEQLAFDE
RRLRQALTASDCGALEVLVRGVRVDPDALRKRMRLRGSRPLSVVITRIGA
RNSGQVTAFVCQPSR
41409182NP_962018.1 hypothetical protein MAP3084c [Mycobacterium avium subsp. paratuberculoMRYLLAAALLAPAVLLGWPAAAEPPSCAALGGSLEDGQMCRLRAAGPNYT
INMVFPADYPDEQALTDYITQNRDGFVNVAQSSGGRDQPYQLEATTEQHS
GGQPPHNTRSVVLKFFQDVGGTRSSIWYKAFNYNLGTKQPLTFDNLFAPN
AAPLDAIFPIVQRDLERQTPLGAAILPSTGHDPSHYQNFAITDDQLIFYF
APGEMLPAFGGPVQAQVPRNAIPPLAI
41409181NP_962017.1 hypothetical protein MAP3083 [Mycobacterium avium subsp. paratuberculosMQWTRSVKGSLAAGPALSARGYLGLNAQTPAGCSLMEWENTDNGRQRWCV
RLVQGGGFAGPLLDGFDNLYVGQPGAFLSFPVTQWTRWRQPVIGMPTTPR
FLGHGQLLVVTHLGQVLVFDSHRGQVAGSPLDLVDGVDPTDATRGLADCA
PARPDCPVPAAPAFSAATGMVVLGVWQPGAPSAGLVGLKYHPGQSPLLTR
EWTSDAVGAGVIASPVLSADGSTVYVNGRDQRLWALRAADAKVKWSAPLG
FLAQTPPAVTPQGLIVAGGGPDTRLAAFRDAGDHADQVWRRDDLIPLSSS
SLAGVGYTVVSGPPANGAPGMSVLVFDPGDGHTLNSYPLPAATGYPLGVS
VGTDRRVVAAISDGQVYGFAPA
41409180NP_962016.1 hypothetical protein MAP3082c [Mycobacterium avium subsp. paratuberculoMAASIGCPAMTTMWGAPLHRRWRGSNLRDPRQAKFLTLASLKWVLRNRAY
TPWYLVRYWRLLKFKLANPHIITRGMVFLGKGVEIHATPELAQLEIGRWV
HIGDKNTIRAHEGSLRFGDKVVLGRDNVINAYLDIELGDSVLMADWCYVC
DFDHRMDDINVPIKDQGIVKSPVRIGPDTWVGVKVTVLRGTSIGRGCVLG
SHAVVRGVIPDYSIAVGAPAKVVKNRQLSWESSAAQRAELAAALADIERK
KASR
41409179NP_962015.1 Phr [Mycobacterium avium subsp. paratuberculosis K-10]MPALLWFRRDLRLHDHPALSAAADSDEVLACFVLDPRLQRSSGPRRLQFL
GDSLRVLRDELDGRLLVTRGRPDIRIPEIAKAIGASSVHVSEDFTPFGKR
RDARVRAALASVPLVATGSPYLVAPGRVTKPDGSPYQVFTPFLRRWRDTG
WRPPVKTGAASARWLDPARLGITDCEIPDPGATLDLAAGEEAARNKWKSF
VDNGLANYADDRHRPDIEGTSRMSAHLKFGTIHPRTLVADLDLRAAAARA
YLRELAFRDFYADVLHHRPASAWRNWNSAFDAIRTDTGAEAGRRFAAWKA
GETGFPFVDAGMRQLRQTGFMHNRVRMTVASFLVKDLHLPWQWGAHWFLQ
QLVDGDLANNQHGWQWCAGCGTDAAPYFRVFNPAAQGEKFDPSGDYIRRW
VPELRCADDPHLRTGERPPGYPAPIVDHATERAEALRRYRSM
41409178NP_962014.1 hypothetical protein MAP3080 [Mycobacterium avium subsp. paratuberculosMVWERVAAAVTGPRSWLLAAVAVLAGVGVMALVGPNAAAGQAPQSLPQHS
PSARITALAGQFPGGDRTPLIVVVSRADGAVLGPADLGAARAARDRAQAA
AQPGAAPAQPLTPSQDGKAALGIVPLSTTLSGLALNDAVSALRTAAATGL
AADLQVHVTGGPAFGADIAGAFTHANVTLLAVTASVVALLLIATYRSPVL
WLVPLLVVAFADRVAAAVGTAVASLTGLSFDGATSGITSVLVFGAGTNYA
LLLISRYRQELRRHAGHRDALRRAVHRAGPAIVASNATVVLALLTLLLAA
TPSTRSLGALAACGLVIAAVSVLVVLPPLLAVCGRRLFWPFIPVDRPATE
SGAWRRVAEWVAGRPALAAVAAVAVLAALGGGLWGTRIGLSQTEQFRVRA
DSVAGYHVLAQHFPAGLANPTLVVADTGHAAAVHQAIAATPGVVSATESG
RSPSGLTQWSVVIDAPPSSVRAFDIVAALRDSTRAADSGALVGGADAAAL
DVRDAATHDRVLLIPAILAVILIVLAVLLRSVMAPPVLLVATMLGALGAL
GLGGWVSLHLFGFPALDYTTPLFAFLFLAALGVDYTIFLVTRAREETARH
GTRQGMVEAVAATGGVITSAGIVLAAVFCVLAVLPLMVLTQLGIIVGLGI
LLDTFVVRTLVIPALFTLVGDRIWWPNNPARHERSTP
41409177NP_962013.1 isopentenyl pyrophosphate isomerase [Mycobacterium avium subsp. paratubMDAMTHRKRRHIDVCLSDPVEFDGVTTGLDRYRLPYHALTQTSLGDINVS
TSFFGANLRAPILIGAMTGGAEMSKTINRNLAAAAQQLGIGMMLGSQRIM
LDTALGERAADSFAVRDVAPDVLLFGNIGLSQLAKTAVPHLVKALDRVGA
DALAVHTNPLQEAMQHNGDTDFSGSLSRLREAAAALDYPVLLKEVGHGIG
GAAAAELVGGEGQPPVAGIDVAGAGGTSWSRVEQFVRYGELRYPDLADWG
VPTARAIVEVRRLLPGIPLVASGGIRTGMDAAKAIALGADVVAVARPLLP
AAIESSAAVVDWLEPFIDGLRVCLHGCGVADLAGLRAVEPIRLA
41409176NP_962012.1 hypothetical protein MAP3078c [Mycobacterium avium subsp. paratuberculoMSHRNAPLSETGRLRLARCVVDEGWSLRRAAERFQVSVTTAERWARRYRE
LGEAGMADRSSRPHHSPNRTPTRTERRIIKVRVIRRWGPARIGYLLGIHP
STVHRVLTRYALAKLRWLDRSTGRIIRRMEPAGCGDLVHVDVKKLGKIPA
GGGWRMLGRAIGGHNSNADKSSGVFSKHRNPIRGYHYLHTAIDGYSRLAY
SEVLDDEIKETAAEFWTRANAWFAECGISVRKVLTDNGSCYRSRVFAQAL
GDIEHRRTRPYRPQTNGKVERFHRTLADEWAYARLYRSDTERCEEFTTWL
HTYNHHRGHTALGGQPPASRVPNLSGQYT
41409175NP_962011.1 hypothetical protein MAP3077 [Mycobacterium avium subsp. paratuberculosMTKRGAADRRLDRTELEKLMSADMRAITAQSDRIGRHFARQNNVSGTDFH
ALLHIMVAETAGTPLTPAQLRQRMDVSPAAITYLVDRMIDAGHIRREPDP
QDRRKTLLRYEKPGMALAHSFFTPLGAELRDALAHLSDRDLAAAHRVFAA
MIEAMSAFESRLAASTSKPPAAPGRKRATTAGRRGAPR
41409174NP_962010.1 hypothetical protein MAP3076 [Mycobacterium avium subsp. paratuberculosMNIRALLRQLRPSVRAKDWPLQVIPRTPWADQRPTFREAQPAVIDAALQR
CRRQPTGNWYAFAASTHVERGRPLGARVAGVDLVAWRDARGALCVGPRSC
PHLGADLATGTVCGGTLICRWHGLPLDGRAREFGWAPLPSHDDGTLAWVR
LDAVGGETPSPRPVIPPRPAGHTLASVAHLVGVCEPADIIANRLDPWHGA
WFHPYSFTRLEVLATPTEDANRFLVAVTFRMGRLGVPVVAEFDCPEARTI
VMRIVDGEGTGSVVETHATPIGSGPDGRPRTAVLEAVIAHSDRPGFARAL
WAAPLLTPVMRYAAGRLWRDDLAYAERRYEVRSQNR
41409173NP_962009.1 hypothetical protein MAP3075 [Mycobacterium avium subsp. paratuberculosMTAGATDRRRRILPAPTGLPDAGALPSRPRVAVVGGGIAGLTAATGLAER
GVAVEVIEREHYLGGRVGGWTEHHDGTDLAMNRGFHAFFRQYYNLRALLV
RLDPRLRMLVPVNDYPLIDAAGRRDSFRGLPRTPPLNAMAFAVRSPTFRL
RDFARIDARAAAPLAAVSVPGTYRRLDHIDAATFLEDIRFPEAARHLAFE
VFSRSFFADPAKLSAAELATMFHIYFLGSAEGLIFDVPSANYDSALWQPL
RSYLEQRHVRFRLGTSVGSIDAANRFAVHTDTDEELEVDAVVLATDVAGL
QRIVAASRGLANGEWRDRIAGLRTAPPFAVHRFWLDRPVSPRRPAFLGTA
GHKPLDNISVLDRYEREARAWAGAHHGSVVELHSYALDSAPSGAAALREL
RRIYPETAAAQIVHETLLHRSDCPLFAPGGYPHRPTVVTPTPGLLLAGDA
VRIDLPVALMERAATTGWCAANHLLKRWGLAGHPLVTVPTEGRSRLLRWL
ANREGATRS
41409172NP_962008.1 CrtT [Mycobacterium avium subsp. paratuberculosis K-10]MRAGDTRPAPGNLAAAFDAGAATYDRLVGASPGYHAQLLLSARRMRIPHD
GKGLRLLDAGCGTGASTAALLAVAPAADIVAVDASRGMLEVALAKRWPAS
VRFVHAPVQRLAEHGISGPFDGVLAAYLIRNVADRDEQLRRFRTLLRPGA
TLAVHEYSVRDSAAATLAWHALCWGIIIPAGWWRSGDTALYRYLWRSVLA
FDGATRFRARLADAGFTAVHSETMPGWEAGIVHTFLADAPS
41409171NP_962007.1 hypothetical protein MAP3073 [Mycobacterium avium subsp. paratuberculosMTGLGYTLPAALAVVIVCAAELTVLRTGLFRRPAYWLSMLIVLGFQVPVD
GWLTKRSSPVVIYDDRQISGLRFPFDIPVEDFLFGFAMVTAVLLLWERRR
ARR
41409170NP_962006.1 hypothetical protein MAP3072 [Mycobacterium avium subsp. paratuberculosMSDRWQYLVVLAACLVVTAPLEIAGAGVYRRWRRLAAAVLPVAAVFLLWD
EIAVAARVWTYDHAYLCGLSIPVRVPIEELLFFLIIPVCAVLTYNAVSTI
LDKVRRR
41409169NP_962005.1 hypothetical protein MAP3071 [Mycobacterium avium subsp. paratuberculosMRARRLQRLSERLFSGGAHADDPLVAAVTHTARRYRISSQLFADFLASMR
MDLTVTDYPDREALNRYMRGSAEAIGLQVLPILGTVTPVDEAAPYAAALG
RAFQLTNFLRDVDEDLARGRVYLPADELAADGVDRELLMWCHEHRRTDPR
VRRALIAQHHIARQTYRFATAGIAVLQHRSRPCVAAAAALYSEILDCIEK
SDFAVFDHRATVGTARRLRVGAVGLIRSWRARNSGRGIRSGAA
41409168NP_962004.1 hypothetical protein MAP3070 [Mycobacterium avium subsp. paratuberculosMRAIEGSADHVVVIGAGLAGLSAALHLAGRGRAVTVVEREAWPGGRAGRR
DIDGYRIDTGPTVLTMPDIIEDTFAAVGDTLARRLELCTLDPAYRAVFAD
GSSLDIHRDPDRMADAVAEFAGREQATGYRRLRAWLTRLYRTEFDGFIAA
NFDSPLSLLTPRLAQLIAIGGFRNWDRMVKRYLSDPRLQRIFTFQSLYAG
VAPRDALAVYAVIAYMDTVSGVVFPRGGVRALPDALAAAASDAGVQFRYG
TTVTALEKTGGRVGAVLTEQAGRISCDAVVLTTELPQTYALLGRTPRRAL
RLRHSPSAVVAHVGCPAVASQTAHHTILFGDAWDHTFADIIGAGQLMRDP
SLLVTRPTASDPTLAPRGRDLLYVLAPAPNLESGGIDWDSVGRGYVDDLI
ALVGQRLLPGLPGSATVLDVVTPADWARRGMAAGSPFALAHTFAQTGPFR
PANMVRGIDNAVLAGSSTVPGVGVPTTLISGRLAADRITGVSKRTPARID
MKAGSP
41409167NP_962003.1 IdsA2_2 [Mycobacterium avium subsp. paratuberculosis K-10]MPSGRERWDTMGALSFSPTTTAAAPAWTRIDDFGGWRAHVRAMVLDEVAD
FVGMRRADELDRAGIGTAGDILVQFVSGGKCLRSTFVYLGWLCGAPRDRA
ALRAAASFELLHAFALLQDDVMDGAQERRGRPAAHLQFGRWHQDRGLSGS
PRRFGESAAILLGDLCLIWAEQMLRDSGLEARRLQRAWPRYDAMRVELAV
GQFADLTNDIRQSPGLDAVLEVARRKSGNYTVRRPLEIGATMAGCDDRTV
ARLSRYGAAVGEAFQLRDDVLGVFGSPAVTGKPCAADLFERKATAVVVSA
HQLADPPVRRELIELATRDVLDAAAIERWKALIVETGAVRLIERMISDRV
ASAREQLCGLPVDESVRAALAEMAAVCTDRAE
41409166NP_962002.1 hypothetical protein MAP3068 [Mycobacterium avium subsp. paratuberculosMAVLHPARSADRFDPADCRYMADFARAHLFVYARSLGTVLRVDGEVDASN
ARDLTATIRRFGRLKTPLVLDLSRLRFISVESFRALLLLNDELRKSRVHC
CVVPGAAIRALLRLVHDNGLALADSVPEAFQNIEDIVRARREFLSDLARP
RPARTHAGSSAAS
41409165NP_962001.1 hypothetical protein MAP3067c [Mycobacterium avium subsp. paratuberculoMEKLGRRCGRLAGASALAVILLWAAPGHATADPAVTASPGMEIHQGHAVC
MVGLVEPRLRVAITSGQCDGGQSAVTDRDHHPIGEVVLGRRQLDTDSADA
STLPVEYEVIALARDVTASDLLPTGRRLLAAPGLRAVPGLPVCQLRRSTG
QHCGSVGTVTGGRFAIADMVVDGRDVGGPVYALTDDGNAVIVGLFEGMVR
SSPQFESWQAVMAQVYVDGRLPGAQQQLPALRMIDWRTGSFAAA
41409164NP_962000.1 hypothetical protein MAP3066c [Mycobacterium avium subsp. paratuberculoMRQRKFRACGRPKVVRSGGFPSTQNGNPRPVNVFELATAPFGWGSAIRGK
RFFHPDGVLAGGVVERVAPAGRGLPIPPSRIVARLSKATGTPGALPDFIG
LALRVNAPQPAGTPWDILLVSAGSGVLSRAVALRPATSWNAQTLTTLMPL
RYQDANWWLRARTAGDIGGARLALDDVRRRLERGGIEVSLDQACGRGDFT
PLARVSLTAVIDDDVSFDPVVNTAPGVSLHPRWLADLRARAYRHSRDGRD
ADQ
41409163NP_961999.1 hypothetical protein MAP3065 [Mycobacterium avium subsp. paratuberculosMARQAGRVRAALAAVVADTAVTEAASLKDGRATLALPGGLRWVAVHQPDG
YHPPRRFVDSIGGDGLAALPARIAVRWRHIHEFEDVGGDRTRVIDRVETP
VPASLLRPMFDYRHRQLAGDLAAHRLAAEHGLRPLTVAITGSSGLVGSAL
TAFLRTGGHRVIRLVRRAARGGDERRWDPEDPDPGLCDGVDAVVHLAGAS
IAGRFTDRHREAVRDSRIGPTRRLAELLGRGRPRPAALISASAIGYYGYD
RGDETLTEDSDRGDGFLADVVADWERAITLALDAGVRVVQVRTGIVQSPR
GGTLKLMRPLFSAGLGGRLGDGRQWLSWIGIDDLIDVYHRALWDSRLNGP
VNAVAPQPVRNSEYTTALAAVLHRPAVLPVPSLGPRLLLGGQGARELAGA
SQRVAPAKLAAAGHRFRHPDIERALRHLLGRGG
41409162NP_961998.1 hypothetical protein MAP3064 [Mycobacterium avium subsp. paratuberculosMKILMVSWEYPPVVIGGLGRHVHHLSTALAAAGHDVVVLSRRPTGTDSRT
HPSTDQISEGVRVIAAAQDPHEFTFGTDMMAWTLAMGHAMIRAGLPPKLH
DKKPGGNRPWRPDVVHAHDWLVAHPAIALAQFYDVPMVSTIHATEAGRHS
GWVSGPISRQVHAIESWLVRESDSLITCSASMADEITELFGPGLAEITVI
RNGIETARWPFAPRRPRTGPAELLYLGRLEYEKGVHDVIAALPRIRRTHP
GTTLTIAGEGTQQGWLVEQARKHRVLKAIRFVGHLEHSELLAMLHRADAA
VLPSHYEPFGIVALEAAAAGTPLVTSNIGGLGEAVIDGQTGVSCPPRDVP
ALAAAIRTVLDDPEAAQRRACAARERLTSDFDWHTVADKTAQVYLSAKRA
ERQPQARLPIVEHALPDR
41409161NP_961997.1 hypothetical protein MAP3063 [Mycobacterium avium subsp. paratuberculosMNSSHDRVPGLFTLVLHTHLPWLAHHGRWPVGEEWLYQSWAAAYLPLLRV
LDTLAGEDRRGLLTLGVTPVVNAQLDDPYCLDGMHHWLANWRLRAMEAAS
VRSAPRSKSAGYQACTPEALRALGIRESAEAERALDDFATRWRHGGSPLL
RRLLDAGTVELLGGPLAHPFQPLLAPRLREFALREGLADAALRLGARKGR
GPGGIWAPECAYAPGLEHDYAAAGVTHFMVDGPSLHGDTALGRPVGDTDV
VAFGRDLQVSYRVWSPKSGYPGHPAYRDFHTYDHLTGLKPARVTGRNVPS
ESKAPYDPQRADHAVDLHVADFVDVVRNRLTSESERIGRPAHVVAAFDTE
LFGHWWYEGPTWLARVLRALPEAGVRVGTLHDAIAGGFVGDPVDLPPSSW
GSGKDWQVWAGDQVADLVQLNSEVVDTALSTVDKALSQAGSQPAALDGPV
PRDRVADQILRETLLTVSSDWPFMVSKDSAADYARYRAHLHAHATREIAG
ALASGRRDTAQRLADGWNRADGLFGALDARRLPR
41409160NP_961996.1 hypothetical protein MAP3062 [Mycobacterium avium subsp. paratuberculosMSALVPDVPPHPPAGTAPAGDAVMMLTGERTIPGLDIENYWFRRHEVVYQ
RLARHCAGRDVLEAGCGEGYGADMIAGVARRVIAVDYDEAAVAHVRGRYP
RVDVMQANLAQLPLPDSSVDVVVNFQVIEHLWDQTQFVVECARVLRPSGL
LLMSTPNRITFSPGRDTPINPFHTRELNAVELTELLVGGGFRDVSISGLF
HGPRLREMDARHGGSIIDAQIARTVADDPWPPQLAADVAAVTVDDFELVP
SGADAASGHHIDDSLDLIAIAVAP
41409159NP_961995.1 hypothetical protein MAP3061c [Mycobacterium avium subsp. paratuberculoMTNIVVLIKQVPDTWSERKLTDGDWTLDREAADAVLDEINERAVEEALQI
REREGGEGSVTVLTAGPERATEAIRKALSMGADKAVHLKDDGMHGSDVVQ
TGWALARALGTIEGTELVIAGNESTDGTGGAVPAIIAEYLGLPQLTHLRK
LSIENGKVTGERETDDGVFNLEATLPAVVSVTEKINEPRFPSFKGIMAAK
KKEVTVLTLAEIGVEPDEVGLANAGSSVLSSTPKPPKTAGEKVTDEGEGG
NQIAQYLVGQKII
41409158NP_961994.1 hypothetical protein MAP3060c [Mycobacterium avium subsp. paratuberculoMAEVLVLVEHAEGALKKVTSELITAARALGEPSAVVVGTPGTAAPLVDGL
KEAGAAKIYVAESDDVDKYLITPVVDVLASLAESNAPAAVLLAANADGKE
IAGRLAAWIGSGLLVDVVEVKEGAKAVHSIFGGAFTVEAQANGDTPVITL
RAGAVDAEPAAGAGEQVTVEVPAAAENATKITAREPAVAGDRPELTEASI
VVSGGRGVGSAENFKVVEELADALGAAVGASRAAVDSGYYPGQFQVGQTG
KTVSPQLYIALGISGAIQHRAGMQTSKTIVAVNKDEEAPIFEIADYGVVG
DLFKVAPQLTEAIKARKG
41409157NP_961993.1 hypothetical protein MAP3059c [Mycobacterium avium subsp. paratuberculoMSIASVLIPSDHPSGSATGSSAAPRYSLLLSADPVMIEAAQRLRYEVFTS
TPGFALPSADGSGRDVDRFDEFCDHLLVRDDDTGELVGCYRMLAPAGAIA
AGGLYTATEFDIRAFDPLRPSLVEMGRAVVRDGHRNGGVVLLMWAGILAY
LDRYGYDYVTGCVSVPIGDADDAPPGSRLRGVRDFVVSRHGAPARYRVRP
HRPVVVDGTALDDIPPPARPSVPALMRGYLRLGAQVCGEPAHDPDFGVGD
FCVLLGKQDADTRYLKRLRSVSAAAELAGGR
41409156NP_961992.1 hypothetical protein MAP3058c [Mycobacterium avium subsp. paratuberculoMVYLDHAATTPMHPAAVEAMTAVLGTVGNASSLHTSGRAARRRIEESREL
IADKLGARPSEVIFTAGGTESDNLAVKGIYWARRDAEPRHRRIVTSEVEH
HAVLDSVNWLVEHEGAEVTWLPTAADGSVSPAALREVLTRHDDVALVSVM
WANNEVGTVQPVAELAAVAAEFGVPMHSDAVQAVGQLPVDFTASGLSAMS
VTAHKFGGPPAVGALLLRRDVACVPLAHGGGQERDIRSGTADVAGAVGMA
AAARISVDGLETNSARLRALRDRLVDGVLGGIEDVTLNGARDPLRLPGNA
HFTFRGCEGDALLMLLDANGIECSTGSACTAGVAQPSHVLVAMGVDPASA
RGSLRLSLGHTSIDADVDAVLRVLPGAVERARRAALAAAGAS
41409155NP_961991.1 tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase [MycobacteMRVLAAMSGGVDSSVAAARMVDAGHDVVGVHLALSTAPGTLRTGSRGCCS
KEDASDARRVADVLGIPFYVWDFAEKFQADVIDEFLSAYARGETPNPCVT
CNQKIKFSALSAKAVALGFDAVATGHYARLSGGRLRRAVDKDKDQSYVLA
VLSAEQLRHAAFPIGDTPKPQIREEAARRGLAVAEKPDSHDICFIPSGNT
RAFLGERIGVRRGAVVDADGTVLAEHDGVHGFTIGQRKGLGIAGPGPDGR
PRYVTAIDADTATVRVGEASDLDVREMLGRAVVFTSGTAPSGPFECAVQV
RAHGETADAVAELVGDELVVRLRAPLRGVAPGQTLALYRRDPDGDEVLGS
ATIAGTSR
41409154NP_961990.1 LpqA [Mycobacterium avium subsp. paratuberculosis K-10]MSQKANGRWLPLLGAVVLLAAACSRVVDGAAVPGPGANHRVVQGVDVDAI
LLDQSRMRAITGAGEHLSIIPSMDGTSPVDIEALAQTAPPECRFIYAETA
TFGRDLEAFHKTTFQDPPDGALISEGAAAYRDADTARRAFGSLVGAVTDC
ANGSGGQLYVGDWNADAGSLHLRPGGCGRDYRILSVAMLEVTFCGFAQSV
SDIVMTNIAANVPR
41409153NP_961989.1 hypothetical protein MAP3055c [Mycobacterium avium subsp. paratuberculoMSAFARPFATASGVGSWPGTVAREAAEVVVGELAGALAHIVELPARGVGA
DMLGRAGALLVDVAIDTVPRGYRLVARPGAVTRRAISLLDEDMDALEEAW
EAAGLRNDGRVVKVQAPGPVTLAAEIELANGHRAITDPGALRDLAASLGE
GVAAHRARLSRRLETPVVVQFDEPSLPAALGGGLPGVTALSPVPPLDEAL
ARGLLDGCVHTVGGEVLLHCCGPDMPWNLLQDSAFSAVSVDASALGAADL
DGMAAFVESGRAVALGVVAVGVPPRRPSAEQVAGAVVAVTDRLGFTRSAL
RDRIGVTPACGLAGATPEWARTAIGLARRAAELFAEDPDAIE
41409152NP_961988.1 LigA [Mycobacterium avium subsp. paratuberculosis K-10]MAGAGRNGPRTPVPLLHQGRADHLGRRVRRAVQRAARPGGAPPRAAGGRF
AHAAGRRGGFRHRLRRGGAPGADAEPRRRLRHRRANRLEQSRRERDRQGP
ALPVRAQDRRGGPVAGLPRRPAGTRRHPGRRPGRRGRDAQRTHHRRRART
PLAQRRLPGSGAARGARRGVLPARRLRGAQRQPGRRRQGAVRQSAQQRGR
VAAPEEPGRHRAAQAADDLPRHRPHRGVLAENPARGLHRAERVGAAGGRT
DRAGARAGRGAGADRLLGRAPLRPATRDRRCGGQSRRRRVAAPARRHLAR
AAVGGRLQVPAPGGADQAPRHPRQRRAHRARHPVCVHDPGQGGRVDGGAG
HPAQRRRGQAQGRADRRHRDDPQGRRRDPRGAGPGRRPARRHRTRIRHAH
NVSRVRHPAGAGQGGRRRHPLPQRPVLPGAAARAGVSRRRPRRTRHRGAG
LRGGHRAAQGRGDRRRGRLVRAHRGRPAAHRAVPDQGRHVVRERHTAAAE
PAEGEKGCAVACFGGAVDPARGADGGARPGDRVRRSGLDHVGVHRAARRG
GGGRPDDRGGAHRMVHRRLAPRDRGQVAGRRRADGRRARRQRAAHAGGAD
GGGHRVAGRFLPRRRQGGDPGARRQGRRFGVEEDRLRGGRRFAGLQVRQG
GRARRAHPGRGRLPQAAGRGPARNPGGLSR
41409151NP_961987.1 cystathionine gamma-lyase [Mycobacterium avium subsp. paratuberculosis MSGNYGDSTRSLKAVDPQAVSGQPVAPQPVLAATYHLSGDETAGVDSYGR
NSNPTWRQLESALAELEGAGGALVFGSGMAAISAVLRALAPPGSTVVVPA
DGYYQVRRHAAEDLAPAGVTVIEASSAQIYDAAATADVVLAETPTNPALD
VVGLHRLAIVCHGRGARLVVDNTAATPLGQQPLSLGADAVVASATKALSG
HSDLLAGYVATSRPELLAAVERQRLLAGAILGGFEAWLLLRSLGTAGLRF
ERQCQNARAVATLLARHPAVRAVRYPGLAEHPGHAVARAQMRRFGGLVAV
ELADAAAVRALLDGSELLIASTSFGGLHTSVDRRARWGDAVPDGFARISL
GIEDTDDLLADIERALLTLR
41409150NP_961986.1 hypothetical protein MAP3052c [Mycobacterium avium subsp. paratuberculoMVGAMTQTADRCEQASPWSPREAEILAVTLRLLQEHGYDQLTVDAVAGAA
HASKATVYRRWPSKAELVLAAFIEGVRQVAVPPNTGTLRGDLLALGETVC
EQVGHHASTIRAVMFEVSRHPALNDALQHQFLDQRRALIEHVLHQAVDRG
EISADAISDELWDLLPGYLIFRSIVPTRPPSRRTVQALVDGFLIPGLTAR
41409149NP_961985.1 hypothetical protein MAP3051 [Mycobacterium avium subsp. paratuberculosMLPTPISATDLNIYGDAELPWSRVLEAMRALPSPETPQFLGTVRPDGSPH
AAGVGSIEHAGNIYFTSGPATLKSRNLAANPACTLSVRLPGVDLILQGDA
HRTTDAGELDAVTALFRDAGWPCERDGDAVVAPYGAQSAGPPPWHLYRFV
LRAAVGVALTEPHGATRWAFSP
41409148NP_961984.1 hypothetical protein MAP3050c [Mycobacterium avium subsp. paratuberculoMKGFSIASLVKRGWMVLVVVVVVGVAGFCVYRLHGIFGSHNNTSAAGGIS
DQTEPFSPKHITLEVFGNPGGGGDHQLRGHQCPAAAGAQRSPAVVVDHGD
DPARGLQQPGGAGQQ
41409147NP_961983.1 MmpL2 [Mycobacterium avium subsp. paratuberculosis K-10]MTTDQATRSVVAQTIRRLSVPILLVWVAVAAISNIAVPNLEDVAKAHNVS
LNTPAAPSFQAMQHIGKVFHEYDSDSAAMIVLEGDKPLGDDAHRFYDALV
GKLEHDTKHVEHVQNFWGDPLTAAGSQSKDGKAAYVQVYLAGNQGDALAN
ESVDAIRNIVEHTPPPPGVKAYVTGAAPLVTDQFEVGSKGIFKVTVITVL
VILAMLLWVYRSVTAVFVLVTVIVEMAAARGIVAFLGSVGLIGLSTYATN
LLTLLVIAAGTDYAIFFVGRYHEARHEGQDRETAYYTMYRGTTHVVLGSG
LTVAGAVLCLRFTRLNYFQSLGIPAAIGIGVALAAALSLTPAVITVGSLF
GLFDPKRQMATRGWRRIGTAIVRWPGPILVVATGVALVGLLALPGYRTNY
DARPYMPASAPANTGYTAAERHFSQARLNPELLMIETDHDMRNPADMINL
ERVAKAIAHLPGIAQVQSMTRPLGTPIEHTSLAFQISAGSIGSIENLQYQ
KERAEDLLKQADNLKDTIGILNQQYALQKQLAASTHDETQSFHDTIAIIN
DLRDKIANFDDFFRPVRSYFYWEKHCFDIPACFAFRSVFDALDGIDELSA
QFEKLTASLDKLDAGQQKLVTLLPPQIADQEKNLALTLSNYATNLGINAQ
TRANTDTATALGQAYDAAKNDDSFYLPPEAFTNPEFKRGLKLFLSPDGKA
ARMIISHEGDPATPEGISHIEPIRNAAKQAVKNTPLGDSNIYLAGTAATY
KDIAEGAKYDLLIAGIAALSLILLIMVLITRSLVAAIVIVGTVALSLGAS
FGLSVLVWQDILGIKLYWICLALSVIILLAVGSDYNLLLISRFREEIHAG
LNTGIIRSMAGSGAVVTSAGLVFAFTMASFVSASLLVLGQIGTTIALGLL
FDTLIVRSFMTPSVAALLGRWFWWPQRVRPRPASTMLRPYGPRPAVRQLL
LWEDGDPAVAPETPSAARHSRG
41409146NP_961982.1 hypothetical protein MAP3048c [Mycobacterium avium subsp. paratuberculoMGLFGYLAVLAGVTELVLAVFVFAFVKRLLGRQPTPIGEEIGGTRRALDK
LRKGEPMSQEEFDCAAQTIADRSSPLAFSIPAAVFTIGCFIVFSTLELHG
VRSLRIYIGLFPILGATNLTVQLLRVAALKRRLPRANVVAASKT
41409145NP_961981.1 hypothetical protein MAP3047 [Mycobacterium avium subsp. paratuberculosMLAVPSYLLRIELLDRPGSLGSLAVALGSVGADILSLDVVDRSSGYAIDD
LVIELPAGAMPDTLITAAESLSGVRVDSVRPHTGLLEAHRELELLDHVAA
ADDKTARLQVLVDEAPKVLRVSWCTVLRSAGGELHRLAGSSGAPETKADS
APWLPLERAMTLDSSGDWVPKAWRDMDMTMVAAPLGDPHTAVVLGRPGPE
FRPSEVARLGYLAGIVATMLR
41409144NP_961980.1 aspartyl/glutamyl-tRNA amidotransferase subunit C [Mycobacterium avium MSQISRDEVAHLARLSRLALTDAELDSFAGQLDAILTHVSQVQAVDVTGV
EPTDNPLKDLNVTRPDEPMPCLTQAEALAEAPEAVDGRFAVPQILGDE
41409143NP_961979.1 aspartyl/glutamyl-tRNA amidotransferase subunit A [Mycobacterium avium MNEIIRSDAATLAARIAAKELSSVEVTQACLDQIAATDERYHAFLHVAAD
EALGAAAVVDEAVAAGERLPSPLAGVPLALKDVFTTVDMPTTCGSKILQG
WRSPYDATVTTKLRAAGIPILGKTNMDEFAMGSSTENSAYGPTRNPWNVE
RVPGGSGGGSAAALAAFQAPLAIGSDTGGSIRQPAALTATVGVKPTYGTV
SRYGLVACASSLDQGGPCARTVLDTALLHQVIAGHDIRDSTSVDAPVPDV
VGAARAGTAGDLKGVRVGVVKQLRGEGYQPGVLASFEAAVEQLTALGAEV
SEVDCPHFEYALAAYYLILPSEVSSNLARFDAMRYGLRIGDDGSHSAEEV
MALTRAAGFGPEVKRRIMIGTYALSAGYYDAYYNQAQKVRTLIARDLDAA
YESVDVVVSPATPTTAFGLGEKVDDPLAMYLFDLCTLPLNLAGNCGMSVP
SGLSPDDDLPVGLQIMAPALADDRLYRVGAAYEAARGPLRSAI
41409142NP_961978.1 6-phosphofructokinase [Mycobacterium avium subsp. paratuberculosis K-10MRIGVLTGGGDCPGLNAVIRAVVRTCDSRYGSSVVGFQDGWRGLLENRRI
QLHNDDRNDRLLAKGGTMLGTARVHPDKLRAGLNQIKQTLDDNGIDVLIP
IGGEGTLTAAHWLSEENVPVVGVPKTIDNDIDCTDVTFGHDTALTVATDA
IDRLHSTAESHQRVMLVEVMGRHAGWIALNAGLASGAHMTLIPEQPFDVE
EVCRLVKRRFQRGDSHFICVVAEGAKPIPGSISLREGGIDEFGHERFTGV
AAQLGAEVEKRINKEVRVTVLGHVQRGGTPTAYDRVLATRFGVNAADAAH
AGEYGQMVSLRGQDIGRVPLADAVRQLKLVPESRYDDAAAFFG
41409141NP_961977.1 hypothetical protein MAP3043c [Mycobacterium avium subsp. paratuberculoMVSGPGHKGYTGGMRNRGAIRGAVQQPAASAGAPGAPRPPGWRPGNDPAA
ATVPQPHGPAGRRPPAPSQRVSPPARPTPTLGATALDRFDQREDEAARFD
WRGLVHRLTGIDLGPGKEATYENELRARIRAAVGAAFPIAVLNLKGGVGK
TAVVEALGSTFAAVRDDRVLALDIDAGDLAERHGRHNPHSMANLLRGGPA
TRYEDIRALTYMNGFRLEVLGLPDYARTDWRLERQDVVKAFSMLRNHYSV
VLVDCVKALNSSVMEAVLPESRALVVVTSPAIDAIRKTQTTLEWLRHNGY
QRLMRSTVLAVNHVEPAKVDAVAVTELDRLSARVGATVVLPFDRHVHEGR
KIALDRLSKESRRSYLEMAAALADMFPGRGEQRGRGPH
41409140NP_961976.1 aspartyl/glutamyl-tRNA amidotransferase subunit B [Mycobacterium avium MSVAANAELMDYDDVIARFDPVLGLEVHVELSTVTKMFCGCTTAFGAEPN
TQVCPVCLGLPGSLPVLNQAAVESAIRIGLALNCEIVPWCRFARKNYFYP
DMPKNYQISQYDEPIAINGYLEAPLDDGTTWRVDIERAHMEEDTGKLTHI
GSETGRIHGATTSLIDYNRAGVPLIEIVTKPIVGAGERAPQIARAYVTAL
RDLLRALGVSDVRMDQGSMRCDANVSLKPIGTAEFGTRTETKNVNSLKSV
EVAVRYEMQRQAAVLASGGRITQETRHFHEAGYTSPGRVKETAEDYRYFP
EPDLEPVAPSRELVERLRLTIPELPWLSRKRIQQEWGVSDEVMRDLVNAG
AVDLVIETVKHGAPSEQARAWWGNFLVQKANEANIGLDELNISPAQVAAV
IALVDEGKLSNKLARQVVEGVLAGEGEPDQVMNARGLELVRDDSVTQAAV
DEALAANPDVAEKIRGGKIAAAGAIVGAVMKATRGQADAARVRELVLAAC
GQG
41409139NP_961975.1 LppZ [Mycobacterium avium subsp. paratuberculosis K-10]MPLSGPDMRDACGGGVGNVRSLTVMRGGRSGRSVRRGLAALCGLVLLTSG
CARFNDAQSQPFTTAPELKPQPSSTPPPPPPLPPTPFPKACPAPGVMQGC
LESTSGLIMGPDSKTALVAERTTGAVKEISVSAEPKVKTVIPVDPSGDGG
LMDIVLSPTYQQDRLMYAYVSTPTDNRVIRVADGDIPKDILTGIPKGATG
NTGALMFTSPTTLVVLTGDAGNPALAADPKSLAGKVLRIEQPTTVGQAPP
TTALSGVGSGGGLCTDPVDGSLYVADRTPTADRLQRITKTSDVSTVWTWP
DKPGVAGCAAMDGTVLVNLINTKMTVAVRLAPNTGAVTGEPDVVRKDTHA
HAWALRMSPDGNVWGATVNKTAGDAEKLDDVVFPLFPQGGGFPRNNDDKT
41409138NP_961974.1 hypothetical protein MAP3040c [Mycobacterium avium subsp. paratuberculoMTSQPNDAHWQRPGESPEPTPGRPASARLVDPEDDLTPVGYPGDFNPSTG
TTTVIPYGGAAAVAGSGAAGYHLLEQQEPLPYVQPHSAARHAAPEPTDVD
DDEHHDRLLDVGRRGTQHLGLLVLRAGLGVVLGAHGLQKLFGWWGGSGVT
GLRNSLSDVGYQHADILAYVSAGGELVAGVLLVLGLFTPLAAAGALAFLI
NGLLATVSARPHAHTFSFFLPQGHEYQITLIVMATAVILCGPGRYGLDAR
RGWAHRPFIGSFVALLAGIAAGVGVWVALNGVNPIG
41409137NP_961973.1 hypothetical protein MAP3039c [Mycobacterium avium subsp. paratuberculoMGTRPALARVSSGSVANVTAGRRSSSPLFRRARAQEPRWKRSPSMSSQRT
VRLSSSVRTVTPRSSATVRNRTISAESSTGSSSNGADGGQSITGISRPKV
KNPTARCATGDTLITTGAAAGGGDGTGDDEPLATRPSFHPDQRGAHGHGF
DC
41409136NP_961972.1 acetolactate synthase 1 catalytic subunit [Mycobacterium avium subsp. pMSAPTRRPAPDAPGAAGIAPAPPAPAAKPAAGKPKRIGPEQVTGAQSVIR
SLEELGVEVIFGIPGGAVLPVYDPLFDSKKLRHVLVRHEQGAGHAASGYA
HATGKVGVCMATSGPGATNLVTALADAQMDSIPVVAVTGQVGRTLIGTDA
FQEADISGITMPITKHNFLVRSGNEIPQVLAEAFHIAASGRPGAVLVDIP
KDVLQGQCTFSWPPRIHLPGYKPTTKPHSRQIREAAKLIAAARKPVLYVG
GGVIRGEASEQLRELAELTGIPVVTTLMARGAFPDSHRQHLGMPGMHGTV
AAVAALQRSDLLIALGTRFDDRVTGKLDTFAPEAKVIHADIDPAEIGKNR
HADVPIVGDVKAVIAELVEMLRHDGAPGNLDIADWWAYLDDVQSTYPLSY
GPQSDGSLGPEYVIEKLGQIAGPDAVYVAGVGQHQMWAAQFISYEKPRTW
LNSGGLGTMGFAIPAAMGAKMARPEAEVWAIDGDGCFQMTNQELATCAVE
GIPIKVALINNGNLGMVRQWQTLFYEERYSQTDLATHSHRIPDFVKLAEA
LGCVGLRCEREEDVVDVINAARAINDRPVVIDFIVGADAQVWPMVAAGTS
NDEIQAARGIRPLFDDETEGHA
41409135NP_961971.1 acetolactate synthase 3 regulatory subunit [Mycobacterium avium subsp. MSPQTHTLSVLVEDKPGVLARVAALFSRRGFNIESLAVGATEQKDMSRMT
IVVSAEETPLEQITKQLNKLINVIKIVELEDGNSVSRELALIKVRADAGT
RSQVIEAVNLFRAKVIDVSPEALTIEATGDRGKIEALLRVLEPFGIREIV
QSGVVSLSRGPRGIGTAK
41409134NP_961970.1 ketol-acid reductoisomerase [Mycobacterium avium subsp. paratuberculosiMANPSGETLPMFYDDDADLTIIQGRKVGVIGYGSQGHAHSLSLRDSGVQV
KVGLKEGSKSRAKVSEQGLDVDTPAAVAKWADVIMLLAPDTAQADIFKND
IEPNLSDGDALFFGHGLNIHFGLIKPPAEVTVAMVAPKGPGHLVRRQFVD
GKGVPCLIAVDQDPTGKGEALALSYAKAIGGTRAGVIKTTFKDETETDLF
GEQAVLCGGTEELVKAGFDVMVEAGYPPEMAYFEVLHELKLIVDLMYEGG
IARMNYSVSDTAEFGGYLSGPRVIDAGTKDRMREILRDIQNGDFVKKLVA
NVEGGNKQLEQLRKENAEHPIEVVGKRLRDLMSWVDRPITETA
41409133NP_961969.1 hypothetical protein MAP3035 [Mycobacterium avium subsp. paratuberculosMTKLAIIYYSATGHGTTMARRVAAAAESAGAQVRLRHVAETQDPESFAHN
PAWTANYQATKDLPAATGDDIVWADAVIFGSPTRFGSPAAQLRAFLDSLG
GLWAQGKLADKVYAAFTSSNTLHGGQETTLLSLYITLMHFGGIIVAPGYT
DPSKFVDGNPYGASLVTTHDNIHEFDEPTANALDHLARRVVETAGRLAS
41409132NP_961968.1 hypothetical protein MAP3034 [Mycobacterium avium subsp. paratuberculosMDVTIVGSGPNGLTAALICARAGLKVQVVEAQPTFGGGARTAADPDSAGV
LHDICSAVHPLALASPFFAEFDLPARGVQLAVPEISYANPLPGRPAAIAY
RDLDRTCAELEHGASFRRLLGPLVARSDDVVALLLGDKRSLPNSPTSALR
LGLRMLAQGTPAWGTLAGEDARALFTGVAAHIISRMPSLTAAGAGLMLAT
LAHSVGWPIPVGGSQAITDALIADLRAHGGELTAGAEVTEPPGGVVAYDT
APTALLRIYGDALPPRYAKALRRYTFGPGVAKVDFVLSDEIPWSDPRLRQ
APTLHLGGTREQMARAEADIAAGRHAQWPMVLAASPHVADPGRIDAAGRR
PFWTYAHVPAGSTLDATEAVTAVVERFAPGFRDVVVAARAIPAARLCDHN
ANYVGGDIGIGGNSAWRAIAGPTPRVNPWSTPIPKVYLCSAATPPGGGVH
GMAGYYAARTLLRREFGLGMPRLAP
41409131NP_961967.1 D-3-phosphoglycerate dehydrogenase [Mycobacterium avium subsp. paratubeMNLPVVLIADKLAESTVAALGDQVEVRWVDGPDREKLLAAVPEADALLVR
SATTVDAEVLAAAPKLKIVARAGVGLDNVDVDAATERGVLVVNAPTSNIH
SAAEHALALLLAAAREIPAADASLREHTWKRSSFSGTEIFGKTVGVVGLG
RIGQLVAQRLSAFGTHLIAYDPYVSPARAAQLGIELLSLDELLARADFIS
VHLPKTPETAGLIDKDALAKTKPGVIIVNAARGGLVDEAALADAVRSGHV
RAAGLDVFSKEPCTDSPLFELPQVVVTPHLGASTTEAQDRAGTDVAASVK
LALAGEFVPDAVNVAGGTVNEEVAPWLDLVRKLGLLAATLSDGPPVSLSV
QVRGELASEDVEVLKLSALRVLFSAVVEGPVTFVNAPALAEERGVTAEIS
TASESPNHRSVVDVRAVSHDGTAVNVAGTLSGPQLVEKIVQINGRNFDLR
ARGINLVINYVDQPGALGKIGTLLGSAGVNIQAAQLSEDAEGPGATILLR
LDQDVPADVRSAIGAAVGANKLEVVDLS
41409130NP_961966.1 3-isopropylmalate dehydrogenase [Mycobacterium avium subsp. paratubercuMKLAVIGGDGIGPEVTAEALKVLDAVLPGVDKTEYDLGARRYHATGELLP
DSVIDELRAHDAILLGAIGDPSVPSGVLERGLLLRLRFELDHHINLRPGR
LYPGVSSPLAGNPDIDFVVVREGTEGPYTGTGGAIRVGTPNEVATEVSQN
TAFGVRRVVVDAFERARRRRKHLTLVHKTNVLTFAGKLWSRIVAEVGRDY
PDVEVAYQHIDAATIFMVTDPGRFDVIVTDNLFGDIITDLSAAVCGGIGL
AASGNIDGTRTNPSMFEPVHGSAPDIAGQGIADPTAAIMSVALLLAHLGE
DAAATRVDRAVERYLATRGNERPATTEVGERIAAAL
41409129NP_961965.1 hypothetical protein MAP3031 [Mycobacterium avium subsp. paratuberculosMQTDPVATPDVGAGTRWSIMVVSLLATASSFLFINGVAFLIPSLQGARGI
RLDEAGLLASMPSWGMVVTLVAWGYVLDRVGERVVMTTGSALTALAAYAA
SSAHSMVLIAAYLFLGGMAAASCNTAGGRLVSAWFPPHQRGLAMGIRQTA
QPLGIALGAMVIPELAEHGPQAGLRFTALACVFGAVASVIGIVDPPRKPR
ASASDQELASPYRGSLTLWRIHAVAGLMMMPQTVTVTFMLVWLIRNLHWS
VAAAGALVTLSQLLGALGRVAVGRWSDRLGSRMRPVRYIAAAAVLVLLLL
AWADYLNSRWQAGLMVAISVIAVLDNGLEATAITEFAGPYWSGRALGIQN
TTQRMMAAAGPPLFGALISAAKYPPAWLLCALFPLAAMPLVPTQLLPPGL
ETRARRQSVRRLRWWRAVRSHALPDIVRRPGQPG
41409128NP_961964.1 hypothetical protein MAP3030c [Mycobacterium avium subsp. paratuberculoMIAREIAEHPFGTPNFTGRSWPLADVRLLAPILASKVVCVGKNYADHIAE
MGEATGPVPADPVIFLKPNTAIIGPNVPIRLPANASPVHFEGELAVVIGR
PCKDVSAAQAAENILGYTIGNDVSARDQQRSDGQWTRAKGHDTFCPVGPW
IVTDLNPLDPGDLELRTEVNGEVKQRSRTSLLIHDIGSIVEWISAVMTLL
PGDLILTGTPAGVGPIEDGDTVSITIEGIGTLTNPVVRKGKS
41409127NP_961963.1 glutamyl-tRNA synthetase [Mycobacterium avium subsp. paratuberculosis KMTAPANVRVRFCPSPTGTPHVGMVRTALFNWAYARHTGGTFVFRIEDTDA
ARDSEESYLALLDALRWLGLDWDEGPEVGGPYGPYRQSQRGEIYRDVVAK
LVEAGEAYYAFSTPEEVEARHIAAGRNPKLGYDNFDRHLTDSQRAAFLAE
GRQPVVRLRMPDEDLGWDDLVRGSTVFAAGSVPDFALTRANGDPLYTLVN
PCDDALMKITHVLRGEDLLPSTPRQLALYQALIRIGVAERIPQFAHLPTV
LGEGTKKLSKRDPQSNLFAHRDRGFIPEGLLNYLALLGWAIADDRDVFSL
DEMVAAFDVVDVNSNPARFDQKKADALNAEHIRMLTAADFAARLRHYLDV
HGHRLALDDAAFATAAELVQTRIVVLGDAWDLLKFLNDDEYAIDPKAAAK
ELGPDGAAVLDAALPALDAVTDWAAPQIEAALKTALIDGLGLKPRKAFGP
IRVGATGTTISPPLFESLQLLGRDRSLRRLRAARERAGQHSA
41409126NP_961962.1 hypothetical protein MAP3028 [Mycobacterium avium subsp. paratuberculosMGTNQRASIVMSDDEIADFVVKSRTGTLATIGRDGQPHLTAMWYAVVDGE
IWLETKAKSQKAINLKRDPRVSFLIEDGDTYDTLRGVSFEGVAELVDDPD
VAHRVGVSVFERYTGPYTDEMKPFVEQMMNKRVCVRIVARRARSWDHRKL
GLPPMPVGGSTAPAVLGTDR
41409125NP_961961.1 hypothetical protein MAP3027 [Mycobacterium avium subsp. paratuberculosMRQHSGIGVLDKAVGVLHTVAQSPCGLAELCERTELPRATAYRLAAALEV
HRLLARGDDGRWRLGPAVTELAAHVNDPLLAAGSAVLPLLRETTGESVQL
YRREGTDRVCVAALEPAAGLRDTVPVGARLPMTAGSGAKVLLAHSDAATQ
KAVLANAKFTERTLAEVRRRGWAQSVAEREPGVASVSAPVRDSRGAVIAA
ISVSGPIDRIGRRPGARWAADLVSAAEALTRRL
41409124NP_961960.1 isopropylmalate isomerase large subunit [Mycobacterium avium subsp. parMGIDTGTTATPRTLAEKVWDDHVVVSGGANEPDLIYIDLHLVHEVTSPQA
FDGLRLAGRPVRRPDLTLATEDHNVPTVDIDKPIADPVSRTQVETLRRNC
AEFGVRLYPMGDAEQGIVHVVGPQLGLTQPGMTVVCGDSHTSTHGAFGAL
AMGIGTSEVEHVLATQTLPLRPFKTMAVNVDGELPAGVTAKDIILALIAK
IGTGGGQGHVIEYRGSAIESLSMEGRMTVCNMSIEAGARAGMIAPDDTTY
EFLRDRPHAPKGAQWDAAMRYWQQLRTDPGAVFDTEVYLDAASLSPFVTW
GTNPGQGVPLAAAVPDPELMTDDAERQAAEKALAYMDLRPGTPMRDIAVD
AVFVGSCTNGRIEDLRVVADVLRGRKVAPGVRMLVVPGSMRVRAQAEAEG
LGEVFTAAGAEWRQAGCSMCLGMNPDQLAPGERCAATSNRNFEGRQGKGG
RTHLVSPAVAAATAVRGTLSAPADLD
41409123NP_961959.1 isopropylmalate isomerase small subunit [Mycobacterium avium subsp. parMSMEAFHTHTGIGVPLRRSNVDTDQIIPAVYLKRVTRTGFEDGLFASWRS
DPSFVLNLSPFDRGSVLVAGPDFGTGSSREHAVWALMDYGFRVVISSRFG
DIFRGNAGKAGLLAAEVSQDGVELLWKLIEQSPGLEITANLQDRNITAGT
TVLPFKIDDHTAWRLLEGLDDIALTLRKLDRIESYEATYPDWKPRTSPVA
41409122NP_961958.1 HupB [Mycobacterium avium subsp. paratuberculosis K-10]MNKAELIDVLTQKLNTDRRQATAAVENVVDTIVRAVHKGDSVTITGFGVF
EQRRRAARVARNPRTGETVKVKPTSVPAFRPGAQFKAVVSGAQRLPSEGP
AVKRGVVGGAAKKTAAKKAPAKKAAAKKAPAKKAAAKKAPAKKAAVKKAP
ARKAATKAPVRKAATKAPAKKVAAKKAPAKKAATKAPAKKAASKAPARKA
AAKKTTARRGRK
41409121NP_961957.1 MutT1 [Mycobacterium avium subsp. paratuberculosis K-10]MPTQNSSTARRAGTRVVYAAGAVLWRPGDAEPDGGDVEVAIIHRPRYDDW
SLPKGKVDPGETAPVAAVREVREETGQCAVLGRRLDTVRYPIEQGVKKVY
YWSARATGGEFVPGDEVDQLLWLPVAEAMQRLNYTQDRKVLRHFNKKPAD
THTVLVVRHGTAGRKSRFSGDDAKRPLDKRGRAQAEALVPQLLAFGASQV
HAADRVRCHQTVQPLAEELDVPVHNETTLTEEAYAKNPKRARHRMLEIAG
EPGTPVVCTQGKVIPDLIAWWCDRDGVRPDKSRNHKGSTWVLSLSAGRLV
AADHIGGALAANVRA
41409120NP_961956.1 polyphosphate kinase [Mycobacterium avium subsp. paratuberculosis K-10]MMRHDRNVTEIDAETRPDENLWHSGDSAVGAPPAATPAAMTDLPEDRYLN
RELSWLDFNARVLALADDNSLPLLERAKFLAIFASNLDEFYMVRVAGLKR
RDEMGLSVRSADGLTPRKQLALIGEHTQRIATRHARVFLDSVRPALAEEG
IHIVTWADLDQAERDELSTYFTEQVFPVLTPLAVDPAHPFPFVSGLSLNL
AVMVRQTEDGGQHFARVKVPNNVDRFVELAAPRAGAEGENRGVVRFLPME
ELIAAFLPLLFPGMEIVEHHAFRITRNADMEVEEDRDEDLLQALERELAR
RRFGPPVRLEIADDMTEGMLELLLRELDVHPGDVIEVPGLLDLSSLWQIY
DLDRPALKDPAFVPDTHPAFADRESPKSIFATLREGDVLVHHPYDSFSTS
VQRFIQQAAADPNVLAIKQTLYRTSGDSPIVRALIEAAEAGKQAVALVEI
KARFDEQANIRWARALEQAGVHVVYGLVGLKTHCKTCLVVRREGSAIRRY
CHIGTGNYNSKTARLYEDVGLLTAAPDIGADLTDLFNSLTGYSRKVSYRN
LLVAPHGIRTGIIERVEREIAAHRERGQGRIRLKMNALVDEQVINSLYRA
SQAGVRVEVVVRGICALRPGVQGYSENIFVRSILGRFLEHSRIIHFRNIN
EFWIGSADMMHRNLDRRVEVLAQVKDPKLTAQLDELFESALDPSTRCWEL
GPDGQWTPSPQEGHTVRDHQVSLMERHRSP
41409119NP_961955.1 hypothetical protein MAP3021 [Mycobacterium avium subsp. paratuberculosMSGKRADGGHDGAGDVALIIAVKRLAAAKTRLAPVFSARTRESVVLAMLT
DTLTAATRVPSLGSITVITPDEAAAAAAAGLGADVLADPTPEGHPDPLNN
AIATAERAVSGSFTNIVALQGDLPALQSQELAEAVAAARAHRRSFVADRL
ATGTAALFAFGTRLDPRFGSDSSARHRSSGAIELTGAWPGLRCDVDTPTD
LAAARRLGVGAATARAIAAH
41409118NP_961954.1 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase [Mycobacterium aviMGAGAWGTALAKVLVDAGGPGTEVTLWARRPELAERINATRSNPDYLPGT
SLPPGIHATADAGEALRDATTVLLGVPAQAMRANLERWAPLLRDGATLVS
LAKGIELGTLMRMSQVIVSVTGVDPAQVAVISGPNLASEIAACQPAATVV
ACSDSGRAVALQRMLNSGYFRPYTNSDVVGTEIGGACKNVIALACGMAAG
VGLGENTAAAIITRGLAEIMRLGIALGAKGATLAGLAGVGDLVATCSSPH
SRNRSLGERLGRGATIGSVLAGSPDGGDGHVVEGVTSCQSVLALAASYDV
EMPLTDAVHRVCHKGLSVDEAMALLLGRRTKPE
41409117NP_961953.1 D-alanyl-alanine synthetase A [Mycobacterium avium subsp. paratuberculoMNASQRVRVAVVFGGRSNEHAISCVSAGSILRNLDPRRFEVVAIGITPQG
SWVLTDGDPAALAISDRQLPEVTSASGTELALPADPGRSGQLVSLPPGAS
EVLASVDVVFPVLHGPYGEDGTIQGLLELAGVPYVGAGVFASAAGMDKEF
TKKLFAAEGLPIGDYAVLRPSQSTLSLQDRERLGLPVFVKPARGGSSIGV
SRVSSWDELDAAVAAARDHDPKVIVEAAIAGRELECGVLEMPDGTVQAST
VGEIRVAGVRGREDSFYDFATKYLDDTAELDVPAKVDDEIADAVRELAIR
AFKAVDCQGLARVDFFLTETGPVLNEINTMPGFTTISMYPRMWAASGVDY
PSLLATMVETALARGVGLR
41409116NP_961952.1 hypothetical protein MAP3018 [Mycobacterium avium subsp. paratuberculosMATESEADGGPPRAVIMVAVALAVTTIGVILAIAATREAPPQPVAVAAFP
APHAGDAACRALLDALPQRLGDYQRAPLEQPAPAGAAAWRTGPDSEPVVL
RCGLDRPAEFVAGSPIQVVDRVQWFAVRPDPQSAGDAGRSTWYTVDRPVY
VALTLPSGSGPAPIQRLSDVIGQRIAAAPVNPGPPAG
41409115NP_961951.1 thiamine monophosphate kinase [Mycobacterium avium subsp. paratuberculoMSVGPLLPGFPVLAVGPPGRQPYGGGVRDESTLRQLGEFAVIDRLVAGRR
QPAAVTLGPGDDAALVTTGDGRVVVSTDMLVQDRHFRLDWSTPHDIGRKA
IAQNAADIEAMGARPTAFVVGFGAPGQTAAAQVDALVDGMWDEAQRVGAG
IAGGDLVSCPQWVISVTALGELDGRSPVRRAGAEPGSLIAVAGDLGRSAA
GFDLWRNQIGGFDELRRRHAVPQPPYGQGAVAAAGGAQAMIDVSDGLIAD
LRHVAEASGVGMDVSTAALAADRDAVAAAATAVGVDAWPWVLTGGEDHAL
VACFPGPAPAGWRIIGRVLDGPARVLVDEREWSGPAGWQSY
41409114NP_961950.1 uracil-DNA glycosylase [Mycobacterium avium subsp. paratuberculosis K-1MTARPLNELVEPGWARALQPVAEQVARMGQFLRAEIAAGRRYLPAGPNVL
RAFTYPFDEVKVLIVGQDPYPTPGHAVGLSFSVAPDVSPLPRSLANIFQE
YTADLGHPPPSCGDLTPWAQRGVLLLNRVLTVRPSNPASHRGKGWEPVTE
CAIRALTARQQPLVAILWGRDASTLKPILAQGNCVAIESPHPSPLSASRG
FFGSRPFSRANKLLAEMGADEIDWRLP
41409113NP_961949.1 short chain dehydrogenase [Mycobacterium avium subsp. paratuberculosis MARWLITGCSTGFGREIAGAALQAGHRVVVTARRADAVRGFAEEFGELAL
PVALDVTDRDQIAAAVAAADAAFGGIDVLVNNAGHGYLSAVEEGEDAEVR
KLFDVNYFGAVDMIKAVLPGMRARGCGHIVNISSMTGLVANPPNAYYSST
KFALEAVTEALAAEVRPLGIKVTAIEPGAFRTDWATRSMKESGTPIADYT
DVAARKDLIKQFADHLPGDPRKVAEAVLMVTGLDEPPLRLLLGRDVLKAM
RDKIAAMSASIDEWEAVTKDVNFPGA
41409112NP_961948.1 hypothetical protein MAP3014 [Mycobacterium avium subsp. paratuberculosMLREPDHVRRPGRRRQPPSEVLTRVDPFDPDAVLADYGLRPEQVNELLPC
TASVLVNILEEQPMPEHPVATRSQHEQELAALDLIEHPTVRAAYRSVAQT
WLGRADASDAMRARFDDAFAEVMFSAAIWSSNQDKLRPKVSCITRLAHPV
DGRRVPGSRWGIDNPDSVYRVIPISGEERYEIHGWVGEHRMTENYFTLWD
ARMGTIDVLNGRTMRVEPDGSFTITVDAQPANGRPNHVRTSAAAHEFYIR
DVLLDRDRDDPNYFEVQRLGGPPATPARTLDEQAEATAAMMAYFADFTGK
LSHGVYKMPANRFDLAWSAEKAGAMRNQVYVMGRFDLAPDEAFVVEVNDG
GAEYFTVPLSNIWGTTLDIVDRTGSLNKAQSVANEDGSYTYVIAPTDPGV
ANWIDSDGLREAILTLRMAEFGEHGPREDLGARGRVVKLDRLDTEVAHLP
RVSPQQRAAELAQRRAGYLRRLPEGTI
41409111NP_961947.1 hypothetical protein MAP3013c [Mycobacterium avium subsp. paratuberculoMTIPWTPDRLGDLTGRRVIVTGATNGVGLGTARALAKAGAEVILAVRNTE
LGKQRAAQMGGSTAVEKLDLADLSSVRAFADRIEAPVDILINNAGALTDR
RTETVDGFEMTLGTNLLGPFALTNLLLPKVRSQIINVGSDAHRSATLHLD
DLHLRRHKWTRLGAYAQSKLAVMLWGLELDRRLRAAGSPIVTQLTHPGWV
ASNLSNLGDAPLKAVAHKAVKVVADRLANDIDEGAAPTLYCISEPIPPGS
YVGVSGRFGLRGGPVLIGRTPLACDYDTAARLVAFAERETGTELRV
41409110NP_961946.1 hypothetical protein MAP3012c [Mycobacterium avium subsp. paratuberculoMGEFDNTVAVVTGAARGQGRSHAVALAQQGADVIVVDICADLPAIPYALG
TEAELAETVRLVESAGRAAVPVIADVRDLQALRAGVQAGIDRLGDIDVVV
ANAGVVAIGVTEAESEPVFNTIVDTNLKGVWHTMLATVPSIVRKGRGGSV
VLVSSSQGLTGRGGDGSAAMFAYAASKHGVVGLMRSAANAYAPHKIRVNS
VHPSGVATPMILNDFVVNRMLENPNPALSQTLLPEVPLVESRDVTGAVLW
LAGPRSRYVTGVAIPVDAGHVVM
41409109NP_961945.1 hypothetical protein MAP3011c [Mycobacterium avium subsp. paratuberculoMRGVVARAENTAGPARAETRRGSPVDVRRWVLRLRRMATAYAVVAALGSL
AIGSESVNCPTAVGGQSDIGQGGPGPRASRAPRAAPTWWWPPAEPRPAVH
EVAAVRGGIQLRQVAFDGRGAWADGPEAIRGYLEEALTRIGVTDASARGR
WIDGMMTIADHESQFHSAAINLADSNAYGPAQLDGGPLHATRGPWQLMPD
TFAAFHQPGTSNSAWDPVAAACASMNYQMSRYGVSPDGSNQRLLVGQANP
GIRQGY
41409108NP_961944.1 hypothetical protein MAP3010c [Mycobacterium avium subsp. paratuberculoMAAQRRWVTLGSSWTSHDRPLDAAALRDWAHTAVSDLITHIDEINRLNVF
PVADSDTGANMLFTMRSALAELQAAGGPGCVARAAAALSTGALNGARGNS
GVILSQILRGVADVTATAAARAGGELARIEAAVLGAALQRGVELVITSMG
GEEIPGTIVSVLRAAATAVAQCARAGEGVTAAVIAAGDAAVIALEKTPEQ
LDVLADAGAVDAGGRGLLVLLDALRTTITGQAPARTVYRLAPRTAAPEAA
APRPAPQFEVMYRLDDCAPAAADALRDRLTELGDSVGIASAPSSAQHTYS
VHVHTDDAGAAVEAGLAAGRLSRIVISALSSGGPGLPAGGWTRERAVLAV
VDGDGAAGLFSGEGACVLQRDPAAADPVTTISAHQLMRAVVDTGAAQVMV
LPNGYVAAEELVAGCTAAIGWGIDVVPIPTESMVQGLAALAVHDTGRQAV
DDGYTMARAAGAARHGSVRIATETALTWAGSCRPGDGLGIAGGEVLIVAA
DAVGAAIGLLDLLLASGGDLVTVLLGAGIDADGSDAHAGAVVDILEEHMH
DHHPGTELVTYRTGHHGDVLLIGVE
41409107NP_961943.1 hypothetical protein MAP3009c [Mycobacterium avium subsp. paratuberculoMASLTDRLDFVVGAKAAEQLEELFGIRTVDDLLRHYPRSYTEGASRWGAD
DERPPAGEHITIIDTITETKTWPMKKTPKKVCHRITLGAGRNKVTATFFN
ANYLKKGLTEGTKVMLSGEVGFFKNVMQLTHPAFLILDSPDGRNKGTRSL
KNIANASGASGEAVLDAYERHFFPIYPASTKMQSWDIFSCVRLVLDVLDP
VPDPLPEPLRAKFDLVCEDQALRDIHLAENEARRQRARERLTFDEAVGLQ
WALVARRHGELSESGPPAPPRPDGLAAELLRRLPFELTAGQREVLDVLSD
GLASTRPLNRLLQGEVGSGKTIVSVLAMLQMVDAGYQCALLAPTEVLAAQ
HLRSIRDVLGPLAMAGQLGGADNATRLALLSGSMTAAQKKQVRDEVAGGQ
VGIVVGTHALLQDAVEFHNLGMVVVDEQHRFGVEQRDRLRAKARPGVTPH
LLVMTATPIPRTVALTVYGDLETSTLRELPRGRQPITSNVIFVKDKPAWL
GRAWRRIGEEVAAGRQAYVVAARIDESDDDGAADQNAKAPETAEGLYARL
RSQELAQLRLGLMHGRLSAEEKDAVMAAFRAGDIDVLVCTTVIEVGVDVP
NATVMLVMDADRFGISQLHQLRGRIGRGEHPSLCLFASWAAPDSPAGRRL
TAVAETMDGFALADLDLKERREGDVLGRNQSGRAVTLRLLSLADHQEYIE
AARDFCVQAYAGNRFDPGLSLLAARFTDTDRIEYLDKS
41409106NP_961942.1 hypothetical protein MAP3008c [Mycobacterium avium subsp. paratuberculoMNVNRKVLLWLAAAAALAVLVAYQAVGSSTRHTAEYAARADVPTVQPGTD
VLAGIAVLPVRQHRYDYLRSAFGDAWDDDNDAPMGHNGCDTRDDILNRDL
VDKTYVSVKRCPDAVATGTLHDPYTNKTIAFQRGPKVGESVQIDHIVPLA
YAWDMGAYAWPGPERRRFANDPANLLAVDGQANQDKGDAAPAQWMPPNAA
FHCQYAMQFIAVLRGYALPVDQASTGVLRQAAATCPAG
41409105NP_961941.1 hypothetical protein MAP3007 [Mycobacterium avium subsp. paratuberculosMTGESGSAAPSIALNDENTMPVLGLGVAELSDDETERAVSAALEVGCRLI
DTAAAYGNEAAVGRAIAASGIPRAELFVTTKLATSDQGFKGAMDACEASL
ERLGLDYVDLYLIHWPAPALGTYVNSFGGMIQSRGNGHARSIGVSNFTEE
YLTTVIDLTFVTPAVNQIELHPLLNQEALRKTNAEHNVVTQSYTPLALGK
LNDHPTVNSVAAEYGKTASQVLLRWNLQLSNAVIFRSANAEHIASDFDVF
DFELAAEHMDAINALNDGTRLRPDPDTYEGS
41409104NP_961940.1 LipN [Mycobacterium avium subsp. paratuberculosis K-10]MTKPLTDTAPVDPGAQRGSMPLTNRIQGAVTSVGVKVIPWIPTAVRRGLV
RGRSVIIDGNTLDPTLQLMLSGLRAVGIDGLVVDDDPELSRAQMHESTVG
FPGPQIHVDVAELALPGPAGDIPARHYRPAGGETQAPLLVFYHGGGWSIG
DLDTHDSLCRLTCRDAGIHVLSIDYRLAPEHPAPAAIDDAYAAFTWAHEH
AGELGAIPGRVAVGGDSAGGNLAAVVSQLARDAGGPAPVLQWLIYPRTDF
TARTRSLSLFSRGFLLTKRDIDWFESQYLRNSRLDRTDPRVSPALAESLA
GLAPALIAVAGFDPLRDEGQSYAEALRAAGTPVDLRYLGSLTHGFANLFQ
LGGDSMVATSELISALRAHLSRV
41409103NP_961939.1 hypothetical protein MAP3005c [Mycobacterium avium subsp. paratuberculoMADNPKRPPRFDMKSASGGKSGRLVQIGGTAFVVIFAVALVFYIVTSHHK
KAGPTGAGDTVRVTSSKLITQPGSSNPKAVVTLYEDFLCPACGNFERTFG
PTVSKLIDLGAIAADYSMVSILDSPRNQNYSSRAGAAALCVADESLDAFR
RFHTALFSTAIQPSETGKTFPDNARLIELARESGVVGKVPDCINSGKYIA
KVTGEAAAAKIRATPTIKINGEDYDPSTPDALVGKIKEIVGDIPGLDGAV
APAAM
41409102NP_961938.1 hypothetical protein MAP3004c [Mycobacterium avium subsp. paratuberculoMTGAVATEATGLTPDSPAGPAVPALSAWSVLVAGVIGLVASVTLTLEKID
ILLDPAYVPSCNINPILSCGSVMITPQASLLGFPNPLLGLVAFTVVVVTG
LLAVTKVVLPQWYWIGLAAGLVVGAVFVHWLIFQSLYRIGALCPYCMVVW
VVTIALLVVVASIAYRPALGDRRSGPGWLLFQWRWSIVALWFTAVFLLIM
VRFWDYWSTLL
41409101NP_961937.1 hypothetical protein MAP3003c [Mycobacterium avium subsp. paratuberculoMTRIIGGVAGGRRLAVPPRGTRPTTDRVRESLFNILAARRELTGLAVLDL
YAGSGALGLEALSRGAATALFVESDPRAAAVIARNIDTLGLPGATLRRGA
VAAVLAGGAATAVDLVLADPPYDVGAAEIDAVLAALAAHGWVRAGSVAVV
ERPAGSAPLSWPPGWSGWPHRVYGDTRLELAERL
41409100NP_961936.1 phosphopantetheine adenylyltransferase [Mycobacterium avium subsp. paraMTGAVCPGSFDPVTLGHVDVFERASAQFDEVVVAILTNPAKKGMFDLDER
IAMIEESTTHLSNLRVEAGQGLVVDFVRSRGMTAIVKGLRTGTDFEYELQ
MAQMNKHIAGVDTFFVATAPRYSFVSSSLAKEVAMLGGDVSELLPEPVNR
RLREKLSGRS
41409099NP_961935.1 hypothetical protein MAP3001 [Mycobacterium avium subsp. paratuberculosMSSSVLAAEVEVRPCDRLAVLFDELAELTGQRNAIDGRIVEIVAQIEREQ
LWGATGARSLGALVAWKTGCSPGNAETIAAVARRLDSFPRCAAGLREGRL
SLDQLGVIAQRAGAGSDAHYAQLATVATVNQLRTAVKLEPRPQPEAKPAP
QPGLTKTSDEELSCWRIKLDRLDAATFDAALAAHREALISEWKRDHNHRA
GESVPPLPGTLEAFIRLIETGWDAEAHRRPHGHHTTVVVHLDAAQRIAGL
HLGPLLSDAERRYLTCDATCEVWVERDGQPIGAGRSTRVINRRLRRALEH
RHRGCAIPGCGATRGLHAHHLRHWEDGGPTELSNLVLVCPYHHRAHHRGE
ITITGPADTLLVTDSSGRHLKPGSLARKPTRPPPAVPPCPGPLGQRADWW
WYDPFQPQPPPTTN
41409098NP_961934.1 acetolactate synthase catalytic subunit [Mycobacterium avium subsp. parMTLDNPLDGPEAAADLIALLADEGVADFFINPGTDSAPIQEALAAARAAG
TPSPRAVLCVHESVALAAAIGHHMASARPQAVMVHVDAGTLNLGCQLHNA
QRNGTPVVVFAGRTPYSSAPDVRGHRDTHIHWQQEQLDQPAVMRNYAKWH
MEVPRGRELAPIVRRAFQVAQSSPPGPAYVMLPREALMEPGGRALQRRLP
PAVPPGPDPAALGRLAGILVAGQRVVIVTARTAADPAAATVLARIAEILG
APVIDQGDRANLPPGHPLHVTGDAAPLQDADTVLLLDSEVPWVPAQLAPP
ATARVVQIDADPVKPSMPLWSYPVEIALTADTRVALLLLEQTLLRLANDE
LREKWSTRRGAVESQVAQRRREAARRAESDSDADAPDAMLAALGGALPDD
AVVVQEAVTNRPAVARQVRRPPGQLFDTGAPALGWALGGAFGIKLARPHA
PVVAICGDGSFNFGVPTAALWSAHRYGAPFVTVVLNNHSYLASKTPVTEL
YPQGISVRDNDFPETRLTPETDYAALARACGGSGRDVHTPAQMREAIGWA
LDEAGQGRCAVLDVRLPQT
41409097NP_961933.1 hypothetical protein MAP2999 [Mycobacterium avium subsp. paratuberculosMTTVLSAVGHALAVAGSMTWEILWALILGFALSAVVQAVVRRTTIVALMG
DARPRTLAVSAGLGAASSSCSYAAVALARALFRKGADFTAAMAFEIGSTN
LVVELGIILTLLMGWQFTAAEFVGGPLMIVVLALLFRLFVRPRLVDAARA
QAQRGIAGSMEGHAAMDMSVAGDGPFWRRLLSAAGFTAVSHVFVMEWLAI
LRDLVLGLLIAGAVAAWVPEKFWQSFFLVDHPGWSVLWGPIVGPLVAIVS
FVCSIGNVPLAAVLWNGGISFGGVIAFIYADLLILPILNIYRKYYGTRMM
LTLLGTFYAAMVAAGYLVELIFGTSGLIPAQRAATVAEASVSWNYTTWLN
VAFLVLALVLIVRFVRTNGLAMVRMMGGSPDPAEHRH
41409096NP_961932.1 hypothetical protein MAP2998c [Mycobacterium avium subsp. paratuberculoMRGDVPASAAVLVAAIRIAHLRLGFGRSTPNRIAVSYGLLTVSWLALTAT
NADGPGRMAVKGLVAAFLAVTGVRGWLVARRVERRIILLQDASQRFPGAA
AALRAAPRTEPASPRWRPTVALLTAVVLVTTGALAAVYLAHRQSPDCRTA
NDMARFVASHPDMLDPAFISANSGGPTLADYQLWSEQLDRYAASSGGDVA
PGLRSAAALSARATAVVREARADPADWQDPRQQRRRNDYAIIAGQLVTEV
RALESHCPPRSSLLTRRT
41409095NP_961931.1 hypothetical protein MAP2997c [Mycobacterium avium subsp. paratuberculoMYRVFEALDELSAIVEEARGVPMTAGCVVPRGDVLELIDDIKDAIPGELD
DAQDVLDARDSMLSDAKTHAESMVSSATTESESMLNHARAEADRVLSDAK
AQADRMVSEARQHSERMVAEAREEALRIATAAKREYEASVSRAQAEADRL
LENGNISYEKAVQEGIKEQQRLVSQNSVVEAAHAEATRLIDSAHAEADRL
RGECDIYVDNKLAEFEEFLNGTLRSVGRGRHQLRTAAGTHDYAVR
41409094NP_961930.1 hypothetical protein MAP2996c [Mycobacterium avium subsp. paratuberculoMELCGRRRRISDMTRQHSTSSVRGAAPRPASPMTFDITRPGRRPGAMVTL
RTTVPSPARIGLDMIAIEAGAPLDLDLQVQSVSEGVLVTGSVTGPTVGEC
ARCLTALDGEVRVRLTELFAYPDSTTEATTEEDEVGHIVDDTVDLEQSII
DAVGLELPFSPVCRPDCPGLCPECGVSLAAEPGHQHDRIDPRWAKLAGMF
ASDEARDER
41409093NP_961929.1 ribonuclease III [Mycobacterium avium subsp. paratuberculosis K-10]MSSRQPLLDALGVELPDELLSLALTHRSYAYEHGGLPTNERLEFLGDAVL
GLTITDALYHRHPDRTEGDLAKLRASVVNTQALADVARKLCDGGLGAHLL
LGRGEANTGGADKSSILADGMESLLGAIYLQHGIDTAREVILRLFGALLD
AAPTLGAGLDWKTSLQELTAARGMGAPSYLVTSTGPDHDKEFTAVVVVAD
TEYGTGVGRSKKEAEQKAAAATWKALDVLDSAAQTSA
41409092NP_961928.1 formamidopyrimidine-DNA glycosylase [Mycobacterium avium subsp. paratubMPELPEVEVVRRGLHAHVVGKTIGAVRVHHPRAVRRHEAGPADLTARLLG
ARITGTDRRGKYLWLLLDGCDTALVVHLGMSGQMLLGAVPRAEHVRISAL
LDDGTVLSFADQRTFGGWMLADLLEVDGSILPRPVAHLARDPLDPRFDAA
AVVKVLRRKHSEIKRQLLDQQVVSGIGNIYADEALWRAKVHGARIAATMT
GRQLTAVLDAAAEVMRDALAQGGTSFDSLYVNVNGESGYFDRSLDAYGRE
GESCRRCGAVMRREKFMNRSSFYCPKCQPRPRL
41409091NP_961927.1 hypothetical protein MAP2993 [Mycobacterium avium subsp. paratuberculosMATVVAFHAHPDDEVVLTGGTIARAVAAGHRVVVVTATDGRVHNEDTDHR
LDELRSSARILGAQRVECLGYADSGYGPLFYPDPPGRTRFGRADLDEAAG
KLAGILRDEHADLLLSYQANGGYGHRDHVRVHHVGKRAAELAAVPRVLEV
TMPREMLLRISDLAHLLRLPGPYEADIVGSAYAPRAAITHRINVFRFARQ
KRDAFAAHRSQIGRSGPAARLFGLLLRLPPQVFGALFSHEWFVDPALPTG
TVRRDIFD
41409090NP_961926.1 hypothetical protein MAP2992c [Mycobacterium avium subsp. paratuberculoMAELWVERTGTRRYTGHSSRGARVLIGSEDVDGVFTPGELLKIALAACSG
MASDVPLARRLGDDYRAVIRVSGAADREQERYPLLEETLELDLSGLSDED
RQRLLLVVHRAVDQVCTVGRTLTSGTTVNFEIAAGAGHAGA
41409089NP_961925.1 hypothetical protein MAP2991c [Mycobacterium avium subsp. paratuberculoMPEPDARLTAWVHGHVQGVGFRWWTRCRALELGLTGYAANQPDGRVLVVA
QGPRPAGEKLLELLRGGTTWPSRPGRVDKVVADWSAPQERFEGFVER
41409088NP_961924.1 hypothetical protein MAP2990c [Mycobacterium avium subsp. paratuberculoMADVTIVTSASNVRNAARFRAGRHPALRRCGPIWAVVWLAVYLKSLTLKG
FKSFASPTTLRFEPGITAVVGPNGSGKSNVVDALAWVMGEQGAKTLRGGK
MEDVIFAGTSSRAPLGRAEVTVTIDNSDNALPIEYSEVSITRRMFRDGAS
EYEINGSSCRLMDVQELLSDSGIGREMHVIVGQGKLDEILQSRPEDRRAF
IEEAAGVLKHRKRKEKALRKLDAMSANLARLTDLTTELRRQLKPLGRQAE
VARRAQTIQADLRDARLRLAADDLVNRRGEREAIFEAEAAMRREHDEASA
RLAVASDELAAHEKALGELSGRAESVQQTWFALSALAERVAATVRIASER
AQHLDLEPVTTGDTDPDALEAEAERVAAAEQQLLAELATARSRLETARAE
LAEREREAAEADRAHMAAVRAEADRREGLARLAGQVETMRARVESIDDSV
ARLSERIEAAAARAQQAKAEFETVQGRVGELDQGEVGLDEHHERTVAALR
LADERVAELQAAERDAERKVASLRARIDALAVGLERKDGTAWLTENHSGA
GILGPMAKLVKVRSGYEAAVAAVLGSAADALAADGLGAARSALGALKQAD
GGRAALVLGDWPADPPAPQPAPAGALWALDLIDAPERLRGAITAMLSGVA
VVDDLDRALALVAEHPRLRAVTLDGDLVGAGWVSGGSDRKLSTLEVTSEI
DKAGAELAAAEAQVAQLSAALSGALAEQAARQDSAEQALAALNESDSAIS
GMYEQLGRLGQEARTSEDEWSRLLRQREELEAGRTQTVAEVTELENRLRN
AQETPQEPAAEPVNRQQIAAATDAARSAEVEARLAVRTAEERANAVRGRA
DSLRRAAAAEREARVRAQQAREARLRAAAVAAAVADSGRLLATRLNAVVA
AASRIRDALAAERQQRATAMAAVRDEVNALSARVAALTDSLHSDEVANAQ
AALRIEQLEQMVLEQFGMAPADLIAEYGPHIALPPSELEMAEYEQAKERG
EQVFAPAPIPFDRPTQERRAKRAERELAELGRVNPLALEEFAALEERYNF
LSTQLEDVKAARKDLLGVVDEVDARILQVFSEAYTDVEREFSDVFGVLFP
GGEGRLRLTDPSNMLTTGIEVEARPPGKKITRLSLLSGGEKALTAVAMLV
AIFRARPSPFYIMDEVEAALDDTNLRRLISLFELLRARSQLIIITHQKPT
MEVADALYGVTMQGDGITAVISQRMRGQQVDQLVTT
41409087NP_961923.1 hypothetical protein MAP2989c [Mycobacterium avium subsp. paratuberculoMSQGLWIAVAVLVVIAVLVVITALVLGLARYRRRRISFSTRPEPGAIDRS
GGYTASSGITFSQAPTAQPAERLDTTGLPAVGDDATVPRDAPRRTISEVE
LPEPETPAAPAAEAPAPEAPESPEAPAPEAPAPEIEEIAPTEGRLERLRG
RLARSQNALGRSLLGLIGGGDLDEDAWQDVEDTLLVADLGPVVTESVIAQ
LRGRLASSDVRTEADAKAVLRDVLINELRPDLDRSIRALPHADHPSVLLI
VGVNGTGKTTTVGKLARVLVADGRRVVLGAADTFRAAAADQLQTWASRVG
AEVVRGAEGADPASVAFDAVDKGIAAGADVVLIDTAGRLHTKVGLMDELD
KVKRVVTRCAAVDEVLLVLDATIGQNGLAQARVFAEVVEITGAVLTKLDG
TAKGGIVFRVQQELGVPVKLVGLGEGPDDLAPFEPAAFVDALLG
41409086NP_961922.1 Amt_2 [Mycobacterium avium subsp. paratuberculosis K-10]MRVTYPILGQPNTGDTAWMLASSALVLLMTPGLAFFYGGMVRARSVLNML
MMSISAMGVVTVLWVLYGYSVAFGDDVGNFMGKPTSYWGLKGLIGVNAVA
ADPSKGTAATDIPLAGTLPATVFVAFQLMFAIITVALISGAVSDRLKFAA
WLVFAGLWATFVYFPVAHWVFAFDGFASEHGGWIANKLHAIDFAGGTAVH
INSGVAGLMLAIVLGKRRGWPTTLFRPHNLPFVMLGAGLLWFGWYGFNAG
SATSSNGAAGSTFMTTTIATATAMLAWMLTERIRDGKATTLGAASGIVAG
LVAITPSCSSVNVLGALVVGLVAGVVCALAVGLKFKLGFDDSLDVVGVHL
VGGLAGTLLVGLLAAPESPAISGVTGVSKGLFYGGGWAQLERQAVGAFSV
LIYSGVVTLILALILKYTMGLRLNPEAEASGIDEAEHAESGYDFAVATGS
VLPPRVAVADTRNGLEEQRVGDKVEAEQS
41409085NP_961921.1 GlnB [Mycobacterium avium subsp. paratuberculosis K-10]MKLITAIVKPFTLDDVKTSLEDAGVLGMTVSEIQGYGRQKGHTEVYRGAE
YSVDFVPKVRIEVVVDDSIVDKVVDSIVRAARTGKIGDGKVWVSPVETIV
RVRTGERGTDAL
41409084NP_961920.1 PII uridylyl-transferase [Mycobacterium avium subsp. paratuberculosis KMTPTGPDPSGHQNACGAVDLAASRRQLLSEGGKLHAAELRHAWLDLHESW
LAAKAAQIGIADDSGFALVGIGGLGRHELLPYSDLDLMLLHDNKSDEVLQ
RVADALWYPLWDANVRLDHSVRTVSGALGVAYGDMIAALGMLDARHVAGD
ARLSDELIAGARRQWRSAIRSRMDELVEMTQARWDRCGRIAQRAEPDLKS
GRGGLRDVQLLDALGVAQLIDRHGMARPESPGGSLDDAHLTLLDVRTELH
RVSGRGLDQLLAQYGDELSAALHIGDRFDLARKLSDASRTIAYHAETGLR
TAENALPRRGVSALVRRPKRRPLDEGVVEYAGEIVLARDARPDTDVGLVL
RVAAASASTGLPIGAATLSRLAAAAPEMPEPWPREALDDLLVLLSAGPTT
VTTIEALDRTGLWGRLLPEWDAIRDLPPRDVAHKWTVDRHVIETTVNAAP
LATRVARPDLLALGALLHDIGKGRGVDHSVLGAGLALEIGPRLGMAPADV
ELLAQLVRHHLLLPVAATRSDLNDPKTIERVSKTLGEDPLLLEVLHALTE
ADSKATGPGVWSDWKASLIDDLVRRCRMVMAGEPLPKVEPAAPQYLSLAA
DRGVHVQIKPGGGERLDVVMAAPDQRGLVSKAAAVLALNSLRIHSASAST
HEGFAVVEFVVSPLFGSPPEAGLLRQQFTGALGGDVDVLGTLEKRDSDAV
GAATRRAGEVQVGVPVTRSTAPPRILWVDTAAADQLIVEVRAMDRLGLLA
LLTRALERAGTDIVWAKVNTFGSTAADAFCVTAGDAGARGAVEQSLLTVL
GGPAVEVLEEPVGD
41409083NP_961919.1 hypothetical protein MAP2985 [Mycobacterium avium subsp. paratuberculosMAASRSNDWGPVSVPVSSLDPRAGNDHSDRSGALRGWQRRALVKYLAGQP
RDFLAVATPGSGKTTFALRVAAELLGQRAVEQVTVVVPTEHLKVQWAQAA
ARHGLALDPRFSNSNPRIAPEYHGVMVTYAQVAAHPTLHRVRTEQRRTLV
IFDEIHHGGDAKTWGDAIREAFGDATRRLALTGTPFRSDDSPIPFVRYEA
GPDGVRRSQANHTYGYPEALADGVVRPVVFLAYSGEARWRDSAGEEHAAR
LGEPLSAEQTARAWRTALDPAGEWMPAVIAAADQRLRQLRAHIPDAGGMI
IASDRVAARAYATLLTKITSETPTVVLSDDPGSSARISEFAASTSRWLVA
VRMVSEGVDVPRLSVGIYATSASTPLFFAQAVGRFVRSRRPGETASIFLP
SVPNLLQLASELEAQRNHVLGEPHRVSEGDPLDGDPATRTQNEKSELDNG
FTSLGADAELDQVIFDGSSFGTAAPAGSEEEADYLGIPGLLDAEQMRALL
HQRQDEQLQRRAGQPSAGDAPPATVHGQLRELRRELNTLVSIAHHRTGKP
HGWIHNELRRRCGGPPIAAASREQLRARIDAVRRLNAEHS
41409082NP_961918.1 hypothetical protein MAP2984 [Mycobacterium avium subsp. paratuberculosMLEVIEKGSGSAEHPTPLLFVHGGWHAAWCWENFLDFFADAGYRAVALSL
RGHGASPTSKPLHRVSIADYLDDVAAVAGELGGAPILIGHSLGGFVIQRY
LETHRVPAAVLVGSVPPQGVLRLALRVWRRRPSMTMEAWNDPTLLKFLAT
PALAREYLFCAATPEAIVESCRQRAGAESVRAAMTDPMLRRVRTRRVSTP
ILVLGATHDGFVSAADVRATARAYRTDPEFFAMGHNMMLEPGWVAVAERI
RDWLQAPTAARHR
41409081NP_961917.1 hypothetical protein MAP2983c [Mycobacterium avium subsp. paratuberculoMFESLSDRLTGALAGLRGKGRLTDADIEATTREIRLALLEADVSLPVVRA
FVTRIKERAKGAEVSGALNPAQQVVKIVNEELIGILGGETRQLAFAKTPP
TVIMLAGLQGSGKTSLAGKLAAWLRGQGHTPLLVACDLQRPAAVNQLQVV
GERAGVPVFAPHPGASPESGPGDPVAVAAQGLAEARAKHHDVVIVDTAGR
LGIDDELMAQAAAIRDAIDPDEILFVLDAMIGQDAVTTAEAFREGVGFTG
VVLTKLDGDARGGAALSVREVTGVPILFASTGEKLEDFDVFHPDRMSSRI
LGMGDVLSLIEQAEQVFDAEQAEAAAVKIGSGELTLEDFLEQMLAIRKMG
PIGNLLGMLPGAGQMKDALAAVDDKQLDRLQAIIRGMTPEERADPKIINA
SRRLRIANGSGVTVSEVNQLVDRFFEARKMMSSMLGGMGIPGLGRKSATR
KAKGAKGKAKKGKKGARGPTPPEVRSPLGPGMPAGFPDLSQLPEGLNELP
PGLADFDLSKLKFPGNK
41409080NP_961916.1 hypothetical protein MAP2982c [Mycobacterium avium subsp. paratuberculoMRWHLRGRSLPDEGPIELWVVDGRISTEPVAGADTVFGASGGGWIVPGLV
DAHCHVGLGEHGEIPLDEAIAQAEIERDVGALLLRDCGSPTDTRSLDDRD
DLPRIIRAGKHLARPKRYAAGFSRELDDEWQLPDAVAQEAKRGDGWIKLV
GDWIDRSVGDLAPLWSDEVLKAAIDTAHAHGARVTAHVFSEDALPGLINA
GIDCIEHGTGLTDDTIELMVSRGTALVPTLVNVVENFPGIAQAAAKYPTY
AAHMRDLYARGPSRIAAAREAGVPIYAGSDAGTMVAPGRIADEVEALKGI
GMTATQALGAACWDARRWLGRPGLEHGASADLLCFAEDPRSGPAVLRNPD
LIMLRGNIFRSPA
41409079NP_961915.1 hypothetical protein MAP2981c [Mycobacterium avium subsp. paratuberculoMRVLAIYVSVPAARDLEDAMPYDVIIRDGLWFDGTGGAALTRTLGIRDGV
LVDVAESLDEAGCPEVIDAAGKWVLPGFIDVHTHYDAEVLLDPGLRESVR
HGVTTVLLGNCSLSTVYADSQDAADLFSRVEAVPREYVYGALISNRTWST
AADYVKAVDALPLGPNVGSLLGHSDLRAAVLGLDRATDPAVRPTGDELAK
MAALLDEALDAGLLGMSGMDAAIEKLDGERFRSRALPSTFATWRERRKLI
EVLRRRGRILQSAPDLDNPALALMFFLTSSRIFGRGRGVRMSMLVSADAK
SMPLAVHTFGLGTRILNKLLRSSVRFQHLPVPFELYSDGIDLPVFEEFGA
GTAALHLRDQLQRNELLADTDYRRRFRREFDRVKLGPSLWHRDFYDAVIV
ECPDKSLIGKSFGAIADERGLHPLDAFLDVLVENGERNVRWTTTVANHRP
KQLDKLAADPSIHMGFSDAGAHLRNMAFYNFALRMLKRTRDAQAAGAPFL
TIERAVHRLTGELADWFGIDAGTLRPGDRADFVVIDPAGLDESVDAYHEE
AVPFYGGLRRMVNRNDDAVIATGVGGVVVFGGSHRKGEFRDGYGHTVKSG
RYLRAGQRVRARVGAPRVTA
41409078NP_961914.1 hypothetical protein MAP2980c [Mycobacterium avium subsp. paratuberculoMARTQQQRREETVARLLDASIATIIEVGYARASAAVITKRAGVSVGALFR
HFDTMGDFMAATASEVLRRQLESFTKRVADIPADQPVLEVVLGILRDLTS
GPVNAVIYELTVAARTDEKLRETLQHELAQYAAKIDEVSRALPGVEGFPA
DTFPVLVALMRNVFDGAAVVEGVLPQPEIAARRIPVLTALLNAALPP
41409077NP_961913.1 DacB [Mycobacterium avium subsp. paratuberculosis K-10]MRKLWTAAAALLLVGACGAPTAAADSTQPAGSIPIPDGPAQTWIIADLDS
GQVLAGRDPNVAHPPASTIKTLLAQVVLDEVSLDATVVADAADTQVECNC
VGIKPGRSYTARQLLDALLLVSGNDAANTLAHMLGGPEATVAKMNAKAAA
LGATNTHASTPSGLDGPNGSGSSTAHDLAVIFRAAMANPVFAQITAEPSA
MFPGDNGLQPITNQDELLQRYPGAIGGKTGFTNAARKTFVGAAARGGRRL
VIAMMYGLIKEGGPSYWDQAATLFDWGFAQSPQASIGSL
41409076NP_961912.1 hypothetical protein MAP2978c [Mycobacterium avium subsp. paratuberculoMLSLEEISDRLEIQQLLVDYSTAIDNRRFDDLDDVFTPDAYIDYTALGGI
EGRYPEVKKWLAEVLPNFPVYAHMLGNFSVRIDGDTASSRVICFNPMVLG
GDTDQVLFCGLWYDDEFVRTPGGWRMTRRVETKVFQKVM
41409075NP_961911.1 30S ribosomal protein S16 [Mycobacterium avium subsp. paratuberculosis MAVKIKLTRLGKIRNPQYRIAVADARTRRDGRSIEIIGRYHPKEDPSLIE
INSERAQYWLSVGAQPTEPVLKLLKITGDWQKFKGLPGAEGRLKVAPPKP
SKLELFNAALAEAEGGPTTEAAKPKKKAATSGAKKAAKAAEPEAAASEAA
EPEAAAAPAEGGEQAESSAES
41409074NP_961910.1 hypothetical protein MAP2976c [Mycobacterium avium subsp. paratuberculoMSTVVVDAVEHLVRGIVDNPDDVRVDMVTSRRGRTVEVHVHPDDLGKVIG
RGGRTATALRTLVAGIGGRGIRVDVVDTDQ
41409073NP_961909.1 16S rRNA-processing protein [Mycobacterium avium subsp. paratuberculosiMELTVGRVVKAHGISGEIVVEIRTDDPAARFAPGNTLRAKPSRGGPERSC
VIESAREHGGRLLVRLAGVTDRDAADALRGTLFVVDSAELPDIDEPDTYY
DHQLEGLQVRTTGGRRVGAVAEVLHTAAGELLAVRDDADGAPREVLVPFV
SAIVTAVSLDDGLIEIDPPDGLLDL
41409072NP_961908.1 tRNA (guanine-N(1)-)-methyltransferase [Mycobacterium avium subsp. paraMRIDVVTIFPAYLDPLRQSLPGKAIQSGLVDLRVHDLRRWTHDAHRSVDD
APYGGGPGMVMKAPVWGEALDEIASAETLLVVPTPAGVLFDQATAARWSA
ERHLVFACGRYEGIDQRVVEDAARRMRVEEVSIGDYVLPGGESAAVVMIE
AVLRLLDGVLGNPASRHDDSHSPALDRRLEGPSYTRPPSWRGLDVPEVLL
SGDHARIAAWRREVSLQRTRERRPELLADPVGPQDDPGR
41409071NP_961907.1 LppW [Mycobacterium avium subsp. paratuberculosis K-10]MRVRPLTLFTATAAVTLLIAAGSEALVQAKVYHLPVAAPVRVLTQPPPPQ
SAALMLEAATPPQPPQALPNAGFAQLPARIQQAADQAAASGAALSVAILD
RGTHQLVSIGNGQIVGTASVAKLFIADDLLLHQAEGKAALSADDRQALDI
MLQSSDDGAAERFWGQGGGAAIISEVASRYGLTSTTPPGDGRWWNTMSSV
TDLIRYYDMLLDGSGGLPADQARIIVSDLAQSTPNGVDGYPQRFGIPDGL
YAEPVAVKQGWMCCIGADWMHLSTGVIGADRRYIMVVQSLQPADDATARE
TITRAVKTIFPDGRIEAPPHGL
41409070NP_961906.1 50S ribosomal protein L19 [Mycobacterium avium subsp. paratuberculosis MSPAVAGRLGHFPPAARCARKPETIGRATASHPRVGGCRRPRPQGSVSHM
NRLDFVDQASLRDDIPVFGPGDTVNVHVKVIEGAKERIQVFKGVVIRRQG
GGVRETFTVRKESYGVGVERTFPVHSPNIDHIQVVTRGDVRRAKLYYLRE
LRGKKAKIKEKR
41409069NP_961905.1 hypothetical protein MAP2971c [Mycobacterium avium subsp. paratuberculoMTDTADSSNPQSHAGDADPKVSTRNPDTRPDDDAGAPAPVPEPGTKPDAA
APTEGSKRSTLREFAILAVIAVLLYYVMLTFVARPYLIPSESMEPTLHGC
TGCVGDRIMVDKVSYRFGAPRPGDVIVFKGPPSWNLGYKSIRSNNTALRW
AQNALSFVGFVPPDENDLVKRVIAVGGQTVQCRAETGLTVNGKPLREPYL
DRNTMAADPSVYPCLGSEFGPVTVPAGRLWVMGDNRTHSADSRAHCTSVP
AEALKGVLCTGDPASGTVPVSNVIGKARFIVWPPSRWGGVGSVNPQQGQ
41409068NP_961904.1 ribonuclease HII [Mycobacterium avium subsp. paratuberculosis K-10]MATTWPPRTVIRKSSGLRTLESALYRSGLGPVAGVDEVGRGACAGPLVVA
ACVLGPGKLESLAALDDSKKLTESVRERLFPVIRRYALAYHVVFIPPAEV
DRRGVHVANIEGMRRAVAGLSLRPGYVLSDGFRVPGLAVPSLPVIGGDAV
AACIAAASVLAKVSRDRLMVAMDAEHPGYGFADHKGYSTPAHSAALARLG
PCPQHRHSFINVRRVANGSGGRVVADCKPDLPLQRDEGR
41409067NP_961903.1 hypothetical protein MAP2969c [Mycobacterium avium subsp. paratuberculoMSAEDLEKYETEMELSLYREYKDIVGQFSYVVETERRFYLANSVEMTPRN
ADGEVYFELRLSDAWVWDMYRPARFVKQVRVVTFKDVNIEEVEKPELRLP
E
41409066NP_961902.1 hypothetical protein MAP2968 [Mycobacterium avium subsp. paratuberculosMAEQSEAGAVASAAGGEKADPATVFAALAEIIYQGSDANEMYAAICIAAT
LTVRGCDHASLLVRENDRYVTVGASDQLARHIDELERRAGDGPCIDAIEE
ETPQIDPDLTTPSLWPKLASVLVAETPVRGAMGFRLLVDKRKGAALNLFS
DTPNMFDAESAGRAAVLAAFASVAINAVAKGEDAASLRRGLLSNREIGKA
VGMLMLLHEMTEDEAFDLLRRHSQALNIKLAEVARAVIDNRGQLPPEIEN
QLPPNT
41409065NP_961901.1 hypothetical protein MAP2967c [Mycobacterium avium subsp. paratuberculoMGVTVAVTGPTGEIGRSAVTALEREPGVDAIIGMARRPFSPSSRGWQKTT
YQQGDILDREAVDAVVAQADVVIHLAFIIMGSRDESARVNLQGTRNVFEA
TVAAGRPRRLVYTSSVAAYGYHSDNPVPLTEDVPARGSAEHYYSAQKAAS
EAMLAEITKDSPLEVFVLRPCIVAGPGATALADAMPWNQLPGPLRAIVKA
VQAIPVLKPVVPDPGYPLQLVHHDDVASAIALAATAPAPPGAYNIAGDGV
VTVADVAKALGGRPVRVPAVAATAASAAISKAPLVPSMLEWLHTARTSMV
MDTTKAKTQLGWRPVHTSAQALAALASAV
41409064NP_961900.1 formate dehydrogenase accessory protein [Mycobacterium avium subsp. parMQVTSRRRVTHLTAGQAIARPETLVVEEPLEIRVGGAAVTVTMRTPGSDF
ELAQGFLLTEGIIGAREDVHSIRYCAGCGEDGANSYNVLDVTLAAGLGRP
ELDVTRNFYTTSSCGVCGKASLEAVRSVSRFSPAADPATVAAATLQAMPH
QLRSAQKVFDSTGGLHAAALFRADGTMLVVREDVGRHNAVDKVIGWALEQ
QRLPLRATVLLVSGRASFELAQKTVMAGIPVLAAVSAPSSLAVSLAEESG
VTLVAFLREDSMNIYTRADRIG
41409063NP_961899.1 hypothetical protein MAP2965c [Mycobacterium avium subsp. paratuberculoMRAALGITGRCGRPRPAARPRPSAAPGRVAAMTTETTMTRIQLGAMGEAL
AVDHLTRMGLRVLHRNWRCRYGELDIIACDKCAELHWMQHFGTVAGSA
41409062NP_961898.1 hypothetical protein MAP2964c [Mycobacterium avium subsp. paratuberculoMTLSAPGSAHLVLAQNVVHLDQAAAVFEAMLEGWRRQQSARFLRAGTIGA
RLRLIRRLEAFSGLYPWQWAPADGEAFIDHLRSTTVEAVSTARSYEIDIS
LFMEYLLDPRYGWAGVCADQFGDVPQAIFHEGNSIQHKLDYEGDPRRRPL
SYDEIQALFDAADARSGTIQGRGVKGALGAARDAAVLKTIYAFGLRRTEA
SRLDLVDLRRNSQAPQFGGFGVVMVRYGKAPKGAPPKRRTVLLVPEMDWV
VETLDQWLTEIRPRFSPPDRHPALWVTERGGRLSPRSINEAFVAARDDAR
LDRSLNLHCLRHSAVTHWTEFGYPARFVQEQVGHAHASTTSIYTHVSNEY
RNKLLKASLMGRLGDHWDGAPT
41409061NP_961897.1 hypothetical protein MAP2963c [Mycobacterium avium subsp. paratuberculoMIKKMGYRWRLRDLMADQQMFKTTDLIPHLVERGITLSREQVFRLVTQPP
QRLSMDTLVALCDILGCTPNDLIVLEVVNKPVRKTAGAGGEWCAGGHAQK
NSRTTAWQVMTRPHSTAPIAHVRESLVSSVISAVGSGMTRQRAQQLLVEA
KGWSTANARHLHEYLGENPGAFTAPTHECPAAFPRLLTLLAAAGHADAVS
LLGCAKCGRTDLALRRNSPEGRCCPWCVIRTELRPCARCGEDGYIIARRA
DGPVCRRCYNKDPQFLQVCAGCGRKRPPNARRDDGTVLCQRCSLPPTQSC
CRCGNVRRVHAQTADGPICRTCYRSPARKCGVCGEIAQIQARATDTHPDT
CVRCYRNIGECVVCGRTRAGGKYRGGSLHCVTCWPHHPRHCDSCEKPGIA
CATWPLGTVCRDCYHRRRLHPQPCANCHRTAVMVGRNPDGQDICAPCCGV
DLDFSCRTCGIEGLNYADGKCTCCVMTDRVNVLLSLDDGTVVPQLQPLAD
ALSAANPESVQTWLQASSSARLLAQLVAERRAISHELLDELDQDNATRYI
RQLLVTTGILTSRQEEFAQLQIWASRKIQHLPPHQSRVVRPFAEWRVIRD
ARKRAARRRYTIGSAANDRQKISTTIAFLTWLDDQEIPLDSVTQLHLDRW
LDAHPTKHKYLAAFIGWLEKQRLTQAELVVPQRRSQLPSRLLSDDELEQQ
LKRCLTDDTLPLDVRVVGALIRLYAPPLVRIAELTTDRYHTDDDGSYLTI
GRHPVLLPPTLARLIEQLIARGPVNTLLRNGSADNPAYLLAGRPPSRPVN
PRSLQQRLTKHGLPVIHARNTAMITNAATLPPPVVAELFGIHPTTAYQWA
QYAQSSWAAYLQACQSTAQPGLRC
41409060NP_961896.1 hypothetical protein MAP2962c [Mycobacterium avium subsp. paratuberculoMALGRAFSVAVRGVDGQIVEIEADITSGLPGVHLVGLPDAALQESRDRVR
AAVSNCTNNWPQARLTLALSPATLPKMGSVYDIALASAVLSAQRKNPWHR
LDKTVLLGELSLDGRVRPVRGVLPAVLAAKRDGWPAVVVPADNLAEASLV
DGIDVWGVRTLGQLQDWLSGTGALDGRIEPDTTVPEPTADLVDVVGQTQA
RFAVELAAAGAHHLMLTGPPGVGKTMLAQRLPGLLPPLTESESLEVTAIH
SVAGLLSGDTPLITRPPFVAPHHSSSVAALVGGGSGMARPGAVSRAHRGV
LFLDECAEIRLSALEALRTPLEDGEIRLARRDGVACYPARFQLVLAANLC
PCAPADPQDCVCAAVAKRRYLGKLSGPLLDRVDLRVQMHPMRAGAFGGGD
GESTAQVRRRVAQARQAAAQRWLPYGFRTNAEVSGPLLRRKFRLGSAAMD
PLQKALDRGLLSIRGLDRTLRVAWSVADLAGRTSPGPEEVATALSFRQAG
AQR
41409059NP_961895.1 hypothetical protein MAP2961c [Mycobacterium avium subsp. paratuberculoMTPADPRALRAWAYLSRVAEPPCPGLGALVRRVGPVEAADRVRRAAVDDA
LAKHTEARREIDRAAADLELIARRGGRLVTPDDDEWPVLAFAAFGAAAPR
PPGTAPMLAPLVLWAQGPARLDEVAHRAAAVVGTRAATAYGEQVAGDLVA
GLVQRDVAVVSGGAYGIDGAAHRAALDCDGVTVAVLAGGLDVAYPSGHSA
LLHRIGQHGLLFTEYAPGVRPARYRFLTRNRLVAAMAGATVVVEAGLRSG
AANTAAWARALGRVVAAVPGPVTSSASAGCHALLRNGAELITRAEHVVEL
IGHIGELAAEEPHPVTPLDGLGEAERRVYEALPGRGAATVEQLAAGCGLL
PEQALGPLAMLELAGLVRRQDGRWRIVRTAAGPAPPPA
41409058NP_961894.1 ViuB [Mycobacterium avium subsp. paratuberculosis K-10]MDVAGLPQPLTLDSFAELPAEKKPSVRTLTVRHVDAASRQIALDVVVHGE
HGIAGQWAATAQPGQPIYLMGPGGAYTPDPAADWHLLAGDESALPAIAAA
LEALPPSAVGKAFIEVAGHEDEIPLTAPDGVEVHWVYRGGRADLVPEDRA
GDHAPLIEAVTSAPWLPGQVHVFIHGEAQAVMHNLRPYVRKERGVDAKWA
ASISGYWRRGRTEETFRQWKKELAQAESAQA
41409057NP_961893.1 hypothetical protein MAP2959c [Mycobacterium avium subsp. paratuberculoMAFGDYQNEIYFRGLGGVAPSLPMAFAELESRAERAMSPSVWSYVTGGAG
DERTQRANREAFDRWGLIPRMFVGAAERDLSVQMFGLTLPSPVFMAPIGV
IGICAQDGHGDLATARAAAATGVPMVVSTLTADPMEDVAAQFGDTPGFFQ
LYTPKDRELAASLVHRAEAAGFKGIIVTLDTWIPGWRPRDLSTANFPQLR
GMCLSNYTSDPVFRAALARPPEEDPQGTVLQWISTFGNPLTWDDLPWLRS
LTDLPLIIKGICHPDDARRARDGGVDGIYCSTHGGRQANGGLPALDCLPG
VIEAADGLPVLFDSGIRSGADVVKALALGATAVGIGRPYAYGLALGGVDG
IVHALRSILAEADLIMAVDGYPTRKDLTPDTLRRVV
41409056NP_961892.1 site-specific tyrosine recombinase XerC [Mycobacterium avium subsp. parMPDSEPILEEFDEYLALQCGRSAHTRRAYLGDLRSLLAFAGERGTGLDGL
SLPLLRSWLSAAAAGGVARTTLARRTSAVKAFTAWAVRRGLLTADPAARL
QVPKTHRTLPAVLRQDQALGAMAAAKTGAAQGDPIALRDRLIVEMLYATG
IRVSELCGLDIDDVDTGRRLVRVLGKGNKQRSVPFGAPAGEALHAWLADG
RPALANAESGPALLLGARGRRLDVRQARTVVHQTIAAVSGAPDMGPHGLR
HSAATHLLEGGADLRVVQELLGHSSLATTQLYTHVAVSRLRAVHDQAHPR
A
41409055NP_961891.1 hypothetical protein MAP2957 [Mycobacterium avium subsp. paratuberculosMRWAALMLVVGLVGAVPAAAGDLHLEWPLRPPPVVVRAFEAPAQDWHPGH
RGVDLAGTAGQPVYAAGAGTVVFAGLLAGRPVVSVAHPGGLRTSYEPVRA
VVRVGQPVTAQTVLGELRPGHPGCRASPAGGACLHWGALWGPASGARYLD
PLGLVASTPIRLKPLGG
41409054NP_961890.1 30S ribosomal protein S2 [Mycobacterium avium subsp. paratuberculosis KMAVVTMKQLLDSGTHFGHQTRRWNPKMKRFIFTDRNGIYIIDLQQTLTFI
DKAYEFVKETVAHGGTVLFVGTKKQAQESIAAEATRVGMPYVNQRWLGGM
LTNFSTVHKRLQRLKELEAMEQTGGFEGRTKKEILGLTREKNKLERSLGG
IRDMSKVPSAIWVVDTNKEHIAVGEARKLGIPVIAILDTNCDPDEVDYPI
PGNDDAIRSAALLTKVIASAVAEGLQARAGVGRGDGKPEVEAAEPLAEWE
QELLASATATAAPTEAGAPEPTTDPS
41409053NP_961889.1 elongation factor Ts [Mycobacterium avium subsp. paratuberculosis K-10]MANFTAADVKRLRELTGAGMLDCKNALAESDGDFDKAVEALRIKGAKDVG
KRAERATAEGLVAAQGGALIELNSETDFVAKNAEFQALADQIVAAAASSK
AADVDALKAAKIGDTTVEQAIAELSAKIGEKLELRRVAHFDGTVEAYLHR
RAADLPPAVGVLVEYQGSGKDSDKEAAHAVALQIAALKARYLSRGDVPED
VVASERRIAEETAKAEGKPEQALPKIVEGRLNGFFKDAVLLEQPSVSDSK
KTVKALLDEAGVTVTRFVRFEVGQA
41409052NP_961888.1 amidase [Mycobacterium avium subsp. paratuberculosis K-10]MRHVHAFGDDALGDLDAVGLADALRAGRVSRAEVVEAAIARTEAVDPLLN
GLAYAAFQQARSAAERPDPPAGFSAFFDGVPTFIKDNIDVAGQPTMHGTD
AWTSYNAVADSVFTRLYLATGLISVGKTQLSEFGFSAAAEHPRLGPVRNP
WDTDYTAGASSSGSGAFVGAGVVPIAHANDGGGSIRIPAACNGLVGLKPS
RGRLPLDATLRRMPVGVVANGVVTRSVRDTAAFYREAERIWRNRLAPIGD
VTGPGRQRLRIAVLTRSIQRECSPRIRELTLKTAGLLEELGHRVDLLDEP
PVAASFVDDFVLYWGFLALAPVRSGRHLFGPTFDRDKLDSLTRGLYRHTS
RNLHRLPLAIARLRRARRRTAPLFGIYDAALTPTVADETPRIGFLAPTDY
QQVISRLIDWVSFTPLHNVTGEPAISLPLAQSEHGMPVGMMLSADIGQEA
LLLQLAYELEEARPWARIQAA
41409051NP_961887.1 hypothetical protein MAP2953 [Mycobacterium avium subsp. paratuberculosMTEADDAPLGYLLYRVGAALRPEVSGALGPLGLTLPEFVCLRILSMFPGM
SSAELSRRAGVTPQAMNTVLRRLQEVGAVARPSSVSSGRSLPAHLTGAGC
TLLKRAEAAVRGADARILAKLTETQQREFKRMLQKLGSDG
41409050NP_961886.1 hypothetical protein MAP2952c [Mycobacterium avium subsp. paratuberculoMPKTTKGGAPKKGELPSTLQRSSAKAQRTFAKAHDAAAQEYGSEERAHRV
AYSAVKHSFEKVGDHWEPKAKKGPSDQRARSGGPRASGASAEGVDANASK
KHLLDVARRLDVRGRSTMTKSELVDAIKKHNRRARAR
41409049NP_961885.1 hypothetical protein MAP2951 [Mycobacterium avium subsp. paratuberculosMGFVAQQQSVPGVQAKMEPIPDCGENSYRGSGKLLGKKAIITGGDSGIGR
AVAIAYAREGADVLIAYLNEDDDARDVARHVTDAGRKCVLVPGDLSDPAH
CRAVVDRAVRELGGVDILVNNAAYQMMHKNLDEISDEEWDYTFRLNVGAY
FYLTKAALPHLRAGSSIIGSSSVNSDTPNPTLAPYAATKAAIANFSASLA
QLLGDKGIRVNSVAPGPIWTPLIPSTMPPDSVESFGDNVPLGRAGQPAEL
APIYVLLASDEASYISGARVAVTGGRPIL
41409048NP_961884.1 hypothetical protein MAP2950c [Mycobacterium avium subsp. paratuberculoMKVTKNAVLTAAAAGGIAAASVFAAAPAAAAPNIQGFGVSEQLVDGPLVT
DYTVSNLQPSNVSIPGYTPKGTLYQADVSVRSDGGVVTPMVHDFIARGPN
GQNYRVIDNVAVPNGLSPAPIPQGTESTGTLYFDVTGAPPNGVVYNDGMQ
DVLMWTSNVPSSAPGAPNSPAPGAPNSPAPGAPPAPAAHT
41409047NP_961883.1 hypothetical protein MAP2949c [Mycobacterium avium subsp. paratuberculoMSNPDHRPTQVRAQAQRHAAETRATMQERRNGQRGGLSGWVAERAARWDL
SGQDEDTLQRQKYLWNALVDYWFRMEIDGWENIPDTPPALLVGVHSGAPF
VWDAWTVGLQWWRRFGPDRPLHGTAHDALMAIPLFGRYFRSMGVLPAAPD
AIATALAEGRDVALWPGGEVDSLRPWTERDRANLAGRTGFVKMAIRAGVP
IVPIATVGGADAMPVLIRGDRLSKALRLDRLLRLKVFPLAISLPWGIAPA
ALPQLPLPAKIRTRFMPPVELDNDPARVQDDEYVERKYREVQDSIQQGMD
ALARRRAFPVFG
41409046NP_961882.1 hypothetical protein MAP2948 [Mycobacterium avium subsp. paratuberculosMSDISRRGAYGPGEARTSRGLEMSLDVVVLTNEDDFESALPDLSRFARPA
RRAALSTDGDGQFGPADVAIIDARSNVAAAQAVSHRLTADHPATAVVALV
APADCAAVDVDCNFDDVMLPGTCAEELQARLRLAIGRRRGGLDGTLKFGD
LLLHPASFTASLDGRELNLTLTEFKLLNFLVQHAGQAFTRTRLMQQAWGY
EGNGRARTVDVHIRRLRAKLGTRHQSLVGTVRGVGYRAPTPPQPEWIVGH
QKP
41409045NP_961881.1 hypothetical protein MAP2947 [Mycobacterium avium subsp. paratuberculosMACPTDFRVSRYRIAAARRCAFEGSVAGESARTRRKYAVLSNEDLPRRMT
GSIARDRRSSVHRSQYAKRRNGSMAEENKSGPAEAVKGVVEDVKGKAKEA
VGAVAGRDDLTREGQAQQDKAEAQRDAAKKEAEAEAARGGAEAAEERQRA
NQ
41409044NP_961880.1 uridylate kinase [Mycobacterium avium subsp. paratuberculosis K-10]MTESREPHVAGSAAPRPEPANGLASGQPSSRARYSRVLLKLGGEMFGGGQ
VGLDPDVVAQVARQIAEVVRGGVQVAVVIGGGNFFRGAQLQQRGMERTRS
DYMGMLGTVMNSLALQDFLEKEGIVTRVQTAITMGQVAEPYLPLRAVRHL
EKGRVVIFGAGMGLPYFSTDTTAAQRALEIGAEVVLMAKAVDGVFSADPR
QYPEAELITAISHREVIDRGLRVADATAFSLCMDNGMPILVFNLLTNGNI
ARAVGGEKIGTLVTT
41409043NP_961879.1 ribosome recycling factor [Mycobacterium avium subsp. paratuberculosis MIDEALFDAEEKMEKAVAVARDDLSTIRTGRANPGMFSRIVIDYYGAATP
ITQLASINVPEARLVVIKPYEASQVGAIETAIRNSDLGVNPTNDGTLIRV
AVPQLTEERRRELVKQAKSKGEDAKVSVRNIRRKAMEELHRIRKDGEAGE
DEVGRAEKDLDKTTHQYITQIDELVKHKEGELLEV
41409042NP_961878.1 hypothetical protein MAP2944c [Mycobacterium avium subsp. paratuberculoMATSDPGAGDEPEHAVENTTEGAAGQRAKKKTSRAGRDLRAAIAVGAGIG
AVLIVTLVFAPRFWVPIVAMAILVASHEVVRRLREAGYVIPVIPLLAGGQ
LTVWLTWPFHAAGALAGFGVTVVACLFWRLFMQDNRKRPEPFAGSPSANY
LRDASATVFLACWVPLFASFAALLVYPADGAGRVFCLMITVVASDVGGYA
VGVLFGKHPMVPAISPKKSWEGLAGSLVLGITAATLAATFLAGKAPWVGA
LLGVVLVFTCTLGDLVESQVKRDLGIKDMGRLLPGHGGLMDRLDGVLPSA
VAAWTVLTLVP
41409041NP_961877.1 hypothetical protein MAP2943c [Mycobacterium avium subsp. paratuberculoMVQQLVFSEPRPGKPPRHLADLDADGRASAVAELGLPAFRAKQLAHQYYG
RLIADPRQMTDLPAGLRDAIADTMFPILLTAASEVTCDAGQTRKTLWRAL
DGVTVESVLMRYPHRNTVCISSQAGCGMACPFCATGQGGLSRNLSTAEIL
EQVRAGAAALRDDFGDRLSNVVFMGMGEPLANYARVVAAVRRIVAAPPQG
FGISARSVTVSTVGLAPAIRKLADERLGVTLALSLHAPDDELRDTLVPVN
NRWKIAEALDAARYYADVTGRRVSVEYALIRDVNDQPWRADLLGRRLHRA
LGPLVHVNLIPLNPTPGSQWDASPKPVEREFVRRVRAAGVSCTVRDTRGR
EISAACGQLAAEGG
41409040NP_961876.1 Mpt53 [Mycobacterium avium subsp. paratuberculosis K-10]MRLQGMSRLSFVCRLLAATAFAVALLLGLGDVPRAAATDDRLQFTATTLS
GAPFNGASLQGKPAVLWFWTPWCPYCNAEAPGVSRVAAANPGVTFVGVAA
HSEVGAMANFVSKYNLNFTTLNDADGAIWARYGVPWQPAYVFYRADGSST
FVNNPTSAMPQDELAARVAALR
41409039NP_961875.1 hypothetical protein MAP2941c [Mycobacterium avium subsp. paratuberculoMDRGLVGLAVAAGMVAALNPCGFAMLPAYLLLVVRGAGTRAPGVAAAGRA
LAATAGMALGFLTVFGLFGALTVSAAGAVQRWLPYATVVVGVLLVALGGW
LLAGRSLSALTPRPVGPRWAPTARLGSMYGYGISYAIASLSCTVGPFLAV
TAAGLRSGSLLTGAAVYLGYVAGLTLVVGVPAVAAATAGAATADRLRRML
PFVDRISGAVLVLVGLYVAYYGGYEVRLFGAGGDPRDAVIGAAGRLQGAL
VGWVHRHGLWPWALALLALAAVPFGHAWRRGQRADRLPDPAAAAAPQVAD
QHHEDQRREPDQKPVLDVADVVAAQHGQQQPEDDQADDVPGPVVDPAPSP
RRRRHLDGVDAGEVLDLGTGHGESPSDRIGLSNPDSGTTAGRARGARPHH
GPRRWRAAQ
41409038NP_961874.1 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Mycobacterium avium suMARAGGGRHNEWVTNPTSDGQPRGRLRVLVLGSTGSIGTQALQVIAANPD
RFEVVGLAAGGANLDTLLRQRAETGVTNVAVADEHAARRAGDIPFCGPEA
ATRLVEETEADVVLNALVGALGLRPTLAALESGARLALANKESLIAGGPL
VLAAAAPGQIVPVDSEHSALAQCLRGGTGDEVAKLVLTASGGPFRGWTAE
ELEHVTPEQAGAHPTWSMGPMNTLNSASLVNKGLELIETHLLFGIPYDRI
EVVVHPQSIVHSMVTFVDGSTLAQASPPDMRLPISLALGWPHRVPGAAAC
CDFSTASSWEFEPLDNEVFPAVELARHAGQAGGCMTAIYNAANEEAAAAF
LAGRVSFGAIVETIADVLHAADQWAPKFSETPANVDDVLDAQRWARQRAQ
RAVAQARPATASAKTPGVV
41409037NP_961873.1 hypothetical protein MAP2939c [Mycobacterium avium subsp. paratuberculoMMFVIGIVLFALAILISVALHECGHMWVARATGMKVRRYFVGFGPTLWST
RRGETEYGLKAVPLGGFCDIAGMTSVEELAPDEADRAMFKQATWKRVAVL
FAGPGANFVICLVLLYAIALIWGLPNLHPPTKAIVGETDCVAPEVAPGKL
ADCTGPGPAALAGIRPGDVIVKVGDTPVSTFDDMAAAIRKVHGNVPIVVD
RDGTAITAYVDVTPTQRYLSGGSGPQGAPPQPSTVGAIGVGAVKVAPAHY
GVFSAIPASVVFAGDLTVEVGKALVTIPTKVGALVHAIGGGQRDPQTPMS
VVGASIIGGDTVDHGLWVAFWFFLAQLNLILGAINLVPLLPFDGGHIAIA
VFEKVRNLIRSARGMVAAAPVNYLKLMPATYVVLVFVVGYMLLTVTADLV
NPIRLFQ
41409036NP_961872.1 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [Mycobacterium aviMTTGLGMPQTPAPTLAPRRRTRQLMVRDVGVGSDYPISVQSMCTTKTHDV
NSTLQQIAELTAAGCDIVRVACPRQEDADALAEIARHSQIPVIADIHFQP
KYIFAAIDAGCAAVRVNPGNIKEFDGRVGEVAKAAAAAGIPIRIGVNAGS
LDKRFMAKYGKATPEALVESALWEASLFEEHGFSDIKISVKHNDPVVMVA
AYEQLAEQCDYPLHLGVTEAGPAFQGTIKSAVAFGALLSRGIGDTIRVSL
SAPPVEEVKVGIQILESLNLRPRSLEIVSCPSCGRAQVDVYTLANEVSAG
LDGLDVPLRVAVMGCVVNGPGEAREADLGVASGNGKGQIFVRGEVIKTVP
ESQIVETLIEEAMRIAAQMNSEGGPEATSSGSPVVTVS
41409035NP_961871.1 hypothetical protein MAP2937c [Mycobacterium avium subsp. paratuberculoMSAPPLFRLVGERRVSVVRDAAAVWRVLDDDPVASCMVAARVADHGIDPN
AIGGELWTLRGADESLCFAGANLIPLRGAPGDLTAFADEAMRGARRCSSL
VGRADLVMPMWERLEAAWGPARDVRDRQPLLALSSYPSCDIDTAVRQVRP
EELDAYLVAAVDMFIGEVGVDPRIGDGGRGYRRRVASLITAGRAWARFEH
GQVVFKAEVGSQSPGVGQIQGVWVHPEWRGLGLGTAGTATVAAVIVGSGR
TASLYVNNFNTVARAAYARVGFAEIGTFATVLLD
41409034NP_961870.1 hypothetical protein MAP2936c [Mycobacterium avium subsp. paratuberculoMSTPLFRPQFLTSAPMVTTRTVATSASGLLLVAVIALSGCTPRPDGPGPA
AEKFFRALAVGDTATAAQLSDNPNEAREALNAAWSGLQASHLDAQILNAK
YAEDTGTVGYRFTWHLPKNRTWTYDGQLKMARDEGRWEVRWTTTALHAKL
GEHQTFALRADRPRRASVNELGGSDVLVPGYLYHYTLDATQAGNGAALFG
TAHAVVDVLRPFNGALADPQLLAEQASSSTQPVDLVTLHPDDNDKVFPAI
GRLPGIVVTPQPEMLPTDPHFAPAVVAAVKKAVIDQLDGQAGWRVVSVNQ
NGVEVEVLHEVEGSPAPSVSLTIDRAVQNAAQHAVDTRGGKAMIVVIKPS
TGEILAIAQNGGADADGLPATNGLFPPGSTFKMITAGAAVDRDMATPNTM
LGCPGHLDIGHRTIPNYGGFDLGVVPMSRAFASSCNTTFAELSSKMPPRG
LTQAATRYGIGLDYQIDGITTVTGSVPPTVDLAERTEDGFGQGKVLASPF
GMALVAATVAAGKTPVPQLIVGRQTAVQGDTTPISPKMVDALRPMMRLVV
TNGTAKEIAGCGAVYGKTGEAEFPGGSHSWFAGYRGDLAFAALIVGGGSS
EYAVRMTKVMFESLPPDFLA
41409033NP_961869.1 hypothetical protein MAP2935c [Mycobacterium avium subsp. paratuberculoMGESGEEMVALRVSDADRNGIMRRLHNAVALGLIDIDEFEQRSSQVSYAR
TRGELDDLVGDLPGPGAIVTSAADRVELRGWAGSLKRHGEWTVPTRLALV
RRLGSVELDLTRARFAGPVVVIELDMRFGSVQIRLPDGASASIDDVEVYV
GSAVDRRKDAPGEGRPHVVLTGRVVCGSVVIRGPRRSLLRRRLSG
41409032NP_961868.1 methionine aminopeptidase [Mycobacterium avium subsp. paratuberculosis MPARTALSPGALSPTLPVPARIPRPEYVGKPTAREGSEPWVQTPEVIEKM
RVAGRIAAGALVEAGKAVAPGVTTDELDRIAHEYMIDHGAYPSTLGYKGY
PKSCCTSLNEVICHGIPDSTVIEDGDIVNIDVTAYIDGVHGDTNATFLAG
DVAEERRLLVERTREATMRAINAVKPGRALSVIGRVIESYANRFGYNVVR
DFTGHGIGTTFHNGLVVLHYDQPSVSTIMQPGMTFTIEPMINLGGLDYEI
WDDGWTVVTKDRKWTAQFEHTLLVTDTGVEILTLP
41409031NP_961867.1 cobyric acid synthase [Mycobacterium avium subsp. paratuberculosis K-10MSGALLVAGTSSDAGKSVVVAGLCRLLARRGVRVAPFKAQNMSNNSAVTV
EGGEIGRAQAIQARAAGLEPSVRFNPILLKPGSDRTSQLVIKGQVAESVT
ATSYVQHRDRLAALVLNELTCLRDEFDAVICEGAGSPAEINLRATDLANM
GLARAADLAVILVGDIDRGGLLAHLFGTVAVLDPQDQALIAGFVVNKFRG
DPALLQPGLRRLHDITGRPTYGVLPYADRLWLDAEDSLSVLAHRVVGAPD
PPLGDDWLRVAAVRLPRISNSTDVEALACEPGVLVRWVSEPSDVADADLV
VIPGSKATVADLSWLRERGLAAAITAHAAAGRPVLGICGGFQMLCRRIDD
RVESGAGEVAGLGLLDADIAFHPAKTLRRWQRPLAGYEIHHGRVSRCAEH
SWFDSDAEPQGLVRGAVFGTHWHGLLDNDDFRRAWLVRVADAAGRRFVPG
DTDVAARRDAQLDLAADLLAAHLDVDAVLGLLDGPPPRPRLATRLCR
41409030NP_961866.1 hypothetical protein MAP2932c [Mycobacterium avium subsp. paratuberculoMMTTLDGFGVPVVVAGPENGVVVVILGDEDRAPAAYDAVCERLHTASLRT
VVIGFDPRLTPKSVIGILDALGIGWAVVMGDRAGGELAWELTATRLGRFV
GLVVIDRGHPRAADRDGAIRDGHCPPVEIGTTVLVSSPAARAVAQASQQY
VYADYRVVHLGRRTVQESTAQLAAEIILRTSTW
41409029NP_961865.1 GlnA4 [Mycobacterium avium subsp. paratuberculosis K-10]MTGSDTAMLSLAALDRLVAAGAPETRVDTVIVAFPDMQGRLVGKRMDARL
FVDEAAATGVECCGYLLAVDVDMNTVGGYAISGWDTGYGDLVMRPDLSTL
RRIPWLPGTALVIADVVGADGSPVAVSPRAVLRRQLDRLAGRGLFADAAT
ELEFMVFDEPYRQAWASGYRGLTPASDYNIDYAISASSRMEPLLRDIRRG
MAGAGLRFESVKGECNRGQQEIGFRYDEALRTCDNHVIYKNGAKEIADQH
GKSLTFMAKYDEREGNSCRVHLSLRDAQGGAAFADPSRPHGMSTMFCSFL
AGLLATMADFTLFYAPNINSYKRFADESFAPTALAWGLDNRTCALRVVGH
GAHTRVECRVPGGDVNPYLAVAAIVAGGLYGIEQGLALPEPCAGNAYRAR
GVGRLPGTLAEAAALFEHSALARQVFGDDVVAHYLNNARVELAAFHAAAT
DWERMRGFERL
41409028NP_961864.1 hypothetical protein MAP2930c [Mycobacterium avium subsp. paratuberculoMVLNGSEPLGGDPPRRPVVGLTAYLERVQTGIWDIPAGYLPADYFEGVTR
AGGIAVLLPPQPMDTGIVGSLLDGLHALVITGGYDLDPAGYGQRPHPSTD
APRTDRDAWEFALLRGALQRGLPVLGICRGAQVLNVAFGGTLHQHLPDVL
GHGGHRAGNGVFSTLPVRTVAGTRLAALLGETVDAPCYHHQAIDKVGDGL
VVSAWDPDGVVEAVELPGDAFVLAVQWHPEQSLQDLRLFTAIVDAARSYA
GVAR
41409027NP_961863.1 AldC [Mycobacterium avium subsp. paratuberculosis K-10]MSTARLINPATEEVLRSVEHADAAAVDDAVDRARAAQRRWARLAPADRAA
GLRAFAAAVDAHRDELAALEVANSGHPIASAEWEAGQVRDVLTFYAGSPE
RLSGKQIPVAGGLDVTFHEPLGVVGVITPWNFPMPIASWGIAPALAAGNA
VLVKPAEPTPVTTIRLAELAVQAGLDRDLLQVLPGPGTVVGERFVTHPDV
RKIVFTGSTEVGKKVLAGAAAQVKRVTLELGGKSANIVFADCDLQRAAAT
APAGVFDNAGQDCCARSRILVQRTVFDRFMELLEPAVTGIVVGDPASRDT
QMGPLVSAAHRAKVASYVPDGAPVAFRGTAPTGPGFWFPPTVLTPSRTDR
CVTEEIFGPVVTVLAFDDEQDAVALANDTSYGLSGSIWTNDLSRALRVSR
AVEAGNLSVNSHSSVRYHTPFGGFKQSGLGRELGPDAPAQFTETKNVFIA
IDEEP
41409026NP_961862.1 short chain dehydrogenase [Mycobacterium avium subsp. paratuberculosis MMDLTQRLAGRVAVITGAGGGIGLAAARRMHAEGATIVVADIDADAGAAA
ADELSGLFVPTDVADEDAVNALFDTAARRYGRIDIAFNNAGISPPDDDVI
ENTEPPAWQRVQDVNLKSVYLCCRAALRHMVSARRGSIINTASFVAVMGS
ATSQISYTAAKGGVLALSRELGVQFARQGIRVNALCPGPVNTPLLQELFA
KDPQRAARRLVHVPVGRFAEPGEIAAAAAFLASDDASFITASTFLVDGGI
SAAYVTPL
41409025NP_961861.1 hypothetical protein MAP2927 [Mycobacterium avium subsp. paratuberculosMAVMDFATLPPEVSSGLMHSGPGAGSLIRAAAAWDGLARQLRAAATSYRA
ATAALGDAAARYIDWLGGNAARGEQAAEGLTAAADAHRSACAAMVPPPVI
AGNRTHRLALVSANCLGQHSPAIAEVDADYERMWARNAAAMYAYADASAA
AVTLTPFTAPPGDCGAATRSWALTAAPELISAGGQVMAAIPDALEQLSAA
PLRTLDAAMSAVTPALSKLNSLTAPSDLAIGHLNSMNKAAALQTLFPGPA
AAPRVCAVVGRAMTVGVLSAPPGAAALAPLARQPRPDRAGEHIRLVPPGE
PAGPHAAGESGG
41409024NP_961860.1 hypothetical protein MAP2926 [Mycobacterium avium subsp. paratuberculosMILRGGDETRRWRPAIAVAAALGVFIALVAGSALRPACAAAALPEPPAWT
APTVARVAGRPSTISRAAPATSRSAAPANNTNKKPFHSTWMTKERPLSWN
RLSPHAVLSPMPISFSPLGFAPRGAQSRAPATFLPDRDVLTLFGVARR
41409023NP_961859.1 hypothetical protein MAP2925 [Mycobacterium avium subsp. paratuberculosMPGSLRDVLPAAAALLGVADAGHEPGGSAVTDWVGAERVDRVLVLLVDGL
GWQLLAQLAGDAPLLAAVRAGEVGRLTRLDCTFPSTTPTSLVSLATGAAP
GQHGILGFTLRVPGTDRVLNHVRWRDDPAPDAWQPLPTWFERLAAAGVRA
RAVLPSSFLGSGLTEAAYRGARLVPAEPADDYPRLVGEELRAGPGLVYGY
TAELDTAAHLFGIGSPQWHTAAAAVDALLSGLLEALPPNAALLVTADHGG
LNVPPEARVDLDSDPRLAAGIRVVAGEPRVRYLHTEPGAAPDVQAAWSEL
LDGRAAVYSRVQAVATGMFGPVADRHLPRLGDVVVVCSGDTAVLASAHEP
PETARLVGFHGAATPAETAIPLMLFRR
41409022NP_961858.1 NicT [Mycobacterium avium subsp. paratuberculosis K-10]MPALRPARRGTYSRARCPVPDTARAGRTPVTSTEIDRWPARATRFLGALA
PTEWWRLASMLGAILALHLIGWLTLVLLVAPGQYSLGGKAFGVGVGLTAY
TLGLRHAFDADHIAAIDNTTRKLMNDGQRPLAVGFFFSLGHSTVVFALAV
LLACGVRTVVGPVRDDSSALHHYTGLIGTSVSGVFLYAIALLNVVVLVGI
LRVLARVRRGDYDPHTDAAELERQLDNRGLMNRWLGRFTKSITQSWHCYP
VGLLFGLGFDTATEVALLVLAGTSAAAGLPWYAILCLPVLFAAGMCLLDT
IDGSFMNFAYGWAFSNPVRKIYYNIIITALSVAVAWVIGSIELLVLFADE
FGWRGSFWDWLGGLDLNTVGYAVVGMFVLTWAVALLIWRYGRIEERWAGA
DPRAGTGREA
41409021NP_961857.1 mycothione/glutathione reductase [Mycobacterium avium subsp. paratubercMETYDLAIIGTGSGNSLLDARFAGKRTAICEHGTFGGTCLNVGCIPTKMF
VYAADVATTIREAARYGVDTHLDGVRWPDIVSRVFGRIDPIALSGEEYRR
SSVNIDLYRSHTRFGPVQFDGRYLLRTDAGEQFTAEQVVIAAGSRPVIPP
AILESGVTYHTSDTIMRIPALPEHLVIVGSGFVAAEFAHIFSALGVHVTV
VIRSGRMLRQYDDMICERFTRLAAAKWELRTQRNVVGGSNRGSGVTLRLD
DGSTLDADVLLVATGRISNADLLDAGQAGVDVENGRVVVDEYQRTSARGV
FALGDVSSPYQLKHVANHEARVVRHNLLCDWDDTESMAVTDHRYVPSAVF
TDPQLATVGLTENQAIARGFDISVAIQNYGDVAYGWAMEDTTGVVKLIAE
RTSGRLLGAHIMGPQASSIIQPLIQAMSFGLTAAQMARGQYWIHPALPEV
VENALLGLY
41409020NP_961856.1 hypothetical protein MAP2922 [Mycobacterium avium subsp. paratuberculosMTGGAAGWVPDVLPGYWQRTLALGADPAGEGDIVATLIRRGDDAAPAADH
AVLAVHGYTDYFFHTALADHFAARGFAFYALDLHKCGRSRRDGQTPHFVT
DLANYDTELERALSVASGGNRRVLVYGHSAGGLIVSLWLDRLRRRNPVAH
SAVGGLVLNSPFLELPGPPILRHSLTVALIAGLSRVRSKGVARSPVQGGY
GTTLHRDYGGEFDYNLQWKPVGGFPITFGWLHAVRRGQARLHRGLDVGVP
NLILRSDHSVQETPDPASMHRGDAVLDVTQIARWAGCIGNRSTIIPVADA
KHDVFLSLPGPRAAAYRQLDLWLDGYLRDRSTDSTRAPASRDEG
41409019NP_961855.1 malate:quinone oxidoreductase [Mycobacterium avium subsp. paratuberculoMSSLARTTRADVVLVGAGIMSATLGALLRRLQPDWSMTFVERLDAVAAES
SSPWNNAGTGHSALCELNYTPQRADGSIDIAKAVRINEQFQVTRQFWAYA
VENGMLTDRGFVTPIPHASFVRGARAVEYLRRRQQALAPNPLFAGIELIE
DADEFARRLPLMADRRDFSEPTALNWARHGTDVDFGALSRQLIGFCVRGG
ATALFGHQVHNLTRESDGSWTLLIRNRRTGEKHWCNAKFVLVGAGGDALP
LLQKSGIGEARGFAGFPIGGRFLRADNPVLTEAHRAKVYGAPAPGAPPLG
ALHLDLRYVNGKPWLVFGPYAGWSPKFLKHGHFTDLPRSVRPHNLVALLG
VGVTQLTLLRYLIGQLRLSAPDRMRMLREFAPTAVDSDWELTVAGQRVQV
IRRDRRRGGVLDFDTTVVAAGDGSIAGLLGGSPGASTAVPIMLDVLQRCF
ADRYRSWLPALKEMVPSLGVTLSDEPALYEEVYSWGTKILGLDELDEERP
K
41409018NP_961854.1 hypothetical protein MAP2920c [Mycobacterium avium subsp. paratuberculoMTEALRRTWAKDLDAQTLYELLKLRVEVFVVEQAIPYPELDGRDLLAETR
HFWLETSDGEVICTLRLMEEHAGGEKAFRIGRLCTKRSARGQGHTTRLLR
AALAEVGDYPCRINAQTYLADMYAQHGFVRDGDDFLDDGVPHVPMLRPGS
GLAEKP
41409017NP_961853.1 hypothetical protein MAP2919c [Mycobacterium avium subsp. paratuberculoMKPYPFSAIVGHDRLRLALLLCAVRPEIGGALIRGEKGTAKSTAVRGLAA
LLSAATGSDANLVEMPLGATEDRVIGSLDLQRVLRDGEHAFSPGLLARAH
GGVLYVDEVNLLHDHLVDVLLDAAAMGRVHIERDGISHSHDARFVLIGTM
NPEEGELRPQLLDRFGLTVDVHASRDVEVRAQVIRQRMAYEADPDGFAER
YADADAELARRIAAARALVDDVVLPDTELQRIAALCAAFDVDGMRADLVV
ARAAVAHAAWRGAPTVEEQDIRVAAELALPHRRRRDPFDDPGIDREQLDE
ALAQAGSEPDPDPDPPGGGQAGETEQQPPQRDSAQDAKPRPPTTKPSAPP
SKTFRTRALRVPGVGEGAPGRRSRARNASGSVIAATDGADTGCGGHGLHL
FATLLSAAERAGAGPLRPGPDDVRRAVREGREGNLVIFVVDASGSMAARD
RMAAVSGATLSLLRDAYQRRDKVAVITFRQQQARLLLPPTSSAHIAGRRL
ARFDTGGKTPLAEGLLAARELIVREKARDRARRALVVVLTDGRATAGPDP
LGRSRIAAARLVAEGAAAVVVDCETSYVRLGLAEHLARQLGAPAVRLEQL
HADSLTRAVRDAA
41409016NP_961852.1 cob(I)yrinic acid a-c-diamide adenosyltransferase [Mycobacterium avium MPQGVPLQVPDDGLTTRARRHTPVLAVHTGAGKGKSTAAFGMALRAWNAG
LSVAVFQFVKSAKWKVGEEAAFAALGRLHEEQRIGAPVEWHKMGAGWSWT
RKAGSDDDHAAAAADGWAEIAGRLAAARHDFYVLDEFTYPLKWGWVDVDE
VVSVLAGRPGHQHVVITGRDAPQRLIDAADLVTEMAKVKHPMDAGRKGQK
GIEW
41409015NP_961851.1 cobyrinic acid a-c-diamide synthase [Mycobacterium avium subsp. paratubMVNVPAVVVAAPASGSGKTTVATGLIGALRGAGRRVAAFKVGPDFIDPGY
HGLTAGRPGRNLDPVLVGENLIGPLYAHGAAGADIAVVEGVMGLFDGRIG
PSGASPAAGSTAHVAALLGAPVVLVVDARGQSQSIAALLHGFSTFDAATR
VAGVILNRVGSARHEQVLRQASEQAGVPVLGAIPRSAELELPTRYLGLVT
AVEYGRRARLAVEAMTALVARHVDLAAVAAVAAARPVTTPWDPAAAVGDP
GGCGGERATVAVATGKAFSFGYAEHAELLAAAGARVAEFDPLVDALPDGT
DALLLPGGFPEQFTAELSANEVVRRQINELAAAGAPVHAECAGLLYLVSE
LDGHPMCGVLAGQARFTPQLTLAYRDAVAVVDSPLYAAGQRAVGHEFHRT
TVTFSDDYPPAWMYRTQESGHRDGAVRGGVHASYLHTHPAAAPAAVARFV
GCALAARADPGRTRAHPGNH
41409014NP_961850.1 CysG2 [Mycobacterium avium subsp. paratuberculosis K-10]MTESAYLVGLRLTGKKVVVVGGGTVAQRRLPLLIASGADVHVISRSATRS
VEAMTGITLQLREYRDGDLDGAWYAIAATDDPRVNEAVVAEAERRRIFCV
RADVAVAGTAVTPASFSYAGLSVGVLAGGEHRRSAAIRSAIREALQTGVI
TPEGPVGSDAVKGGVALIGGGPGDPELITVRGRRLLAQADVVVADRLAPP
ELLAELPPHVEVIDAAKIPYGRAMAQDAINDVMIERARAGSFVVRLKGGD
PFVFARGYEEVLACADAGIPVTVVPGVTSAIGVPALAGVPVTHRAVNHEF
VVVSGHLPPGHPESLVNWDALAALTGTIVLLMAVERIELFAEALLKGGRP
ADTPVLVVQHGTTAAQHTLRATLADTPEKIRAEGIRPPAIIVIGAVAAFG
V
41409013NP_961849.1 EfpA_2 [Mycobacterium avium subsp. paratuberculosis K-10]MTALNDSERAVQNWTSARPDRPAPVRSTPPAETAPKPAAETAVKRTSKYY
PAWLPSRRFIAAVIAIGGMQLLATMDSTVAIVALPRIQNELSLSDAGRSW
VITAYVLTFGGLMLLGGRLGDTIGRKRTFIVGVALFTISSVLCAVAWDEA
TMVIARLSQGVGSAIASPTGLALVATTFPKGPARNFATAVFAAMTAVGSV
MGLVVGGALTEVSWRLAFLVNVPIGLVMMYLARTALRETNRERMKLDATG
AVLATLACTAAVFAFSMGPEKGWISLTTISSGVVALGAALAFVIVERTAE
NPVVPFDLFRDRNRLVTFIAIFLAGGVMFTLTVCIGLYVQDILGYSALRA
GVGFIPFVIAMGIGLGVSSQLVARFSPRVLTIAGGYLLVLAMLYGWWCMH
RGVPYFPNLVLPIVVGGIGIGMAVVPLTLSAIAGVGFDQIGPVSAVTLML
QSLGGPLVLAVIQAVITSRTLYLGGTTGPVKTMNDAQLQALDHGYTYGLL
WVAGAAVIVGAAALFIGYTPEQVAHAQEVKEAMDAGEL
41409012NP_961848.1 hypothetical protein MAP2914c [Mycobacterium avium subsp. paratuberculoMDTTDDTIRIRFATEDDWQAVYANQAGAYGVSVDPADVEAWKRRVDLEDI
LVAEDVSDPARPTVVGTSLCYKLRLTVPGGVTLKAAWLAMIAVAATHLGR
GVWQQLSIRGFGILQERNYPILCGVPTQPTVYEILGAGVASYARTYNIEP
RFTDLRAKPERNRARVVEADEARGLLPDLYDRWCAVTPGALSRSRAWWAD
VLEDRVTQRDNGSMLNYVVHPDGFMTYRVIGASPHAFRRPFGNLIVQDFC
PITPEAHTDLLATLLSLKMFDNSVIETPVDDPLPLKLKDQLAAQTTKVND
FLWMRIMNVPEVLPKRAYRADADLVLDVTDPLGVAGGRFLLRIRDGVGTC
TPHDGPADIKIGLGDLGSIYMGAHRAWELHQADRITELRSGALLDLDAAF
TTQRAPYCGTLF
41409011NP_961847.1 prolyl-tRNA synthetase [Mycobacterium avium subsp. paratuberculosis K-1MITRMSQLFLRTLRDDPADAEVPSHKLLIRAGYIRPVAPGLYSWLPLGLR
VLRRIEHIVREEMNAIGGQEILFPALLPRAPYEATNRWTEYGDSVFRLQD
RRGNDYLLGPTHEELFTLTVKGEYSSYKDFPVLLYQIQNKYRDEARPRAG
ILRVREFVMKDSYSFDIDDAGLKAAYHAHREAYQRIFARLQVRYVIVSAV
SGAMGGSASEEFLAESPVGEDTFVRCLESGYAANVEAVITARPDPQPVEG
LPEAVVHDTGDTPTIATLVDWANRAGLGRAVTAADTLKNVLLKVRQPGGD
WELLAIGLPGDREVDDKRLGAALEPAEYVLLDDADFARYPFLVKGYIGPK
ALKDNGVRYLVDPRVVDGTSWITGADEPGRHVVGLVAGRDFTADGTIEAA
EVRDGDPSPDGAGPLVSARGIEVAHIFQLGRKYTDAFTADVLGEDGKPVR
LTMGSYGLGVSRMVAVIAEQHHDELGLRWPASVAPFDVHLVIANKDAQAR
AGATALADDLDRLGVEVLLDDRQASPGVKFKDAELLGVPWIVVVGRGWAD
GVVELRDRFAGQTRELATGPSLAADIAAALRG
41409010NP_961846.1 hypothetical protein MAP2912 [Mycobacterium avium subsp. paratuberculosMTSGKDADNAALCDALAIEHSTIYGYGIVSAMSPPSVNDMVVEALEQHRQ
RRDDVIAMLTARKVTAPVAAAGYQLPLVVGSPADAARLAARMENDGAGAW
RVVAEHAETGDDRAFAATALVQSAVMAARWNRVLGAWPITTSFPGGND
41409009NP_961845.1 hypothetical protein MAP2911 [Mycobacterium avium subsp. paratuberculosMPSAVPPVNRRVNRREVLAGGAALAALGAVSACSKPAPKPPPVEQLLGPL
DQARHDSALAGAAAAALGNPPQVAAALTVVASQRAAHARALSTEISRAAG
KLATSSTSETTSPSPAQPAGPPPPPPPVSDVINALRASADSASRLVGTES
GYRAGLLASIAASCTASYTVALVPGGPSI
41409008NP_961844.1 hypothetical protein MAP2910c [Mycobacterium avium subsp. paratuberculoMTTGLPSQTQVIELLGGEFARAGYEIEDVVIDAHARPPRITVIADGDDGL
DLDAAATLSRSASALLDKLDTIEDHYVLEVSSPGVDRPLRTPKHFRRARG
RKVDVVLSDNSTVTGRVGETGDDTIALVVRAGRDWAIREIPLGDVVKAVV
QVEFSPPAQAELELAGVGGTDKTEERRK
41409007NP_961843.1 transcription elongation factor NusA [Mycobacterium avium subsp. paratuMNIDMAALHAIEVDRGISVNELLETIKSALLTAYRHTEGHQNDARIEIDR
KTGVVKVIARETDEDGNVISEWDDTPEGFGRIAATTARQVMLQRFRDAEN
ERTYGEFSTREGEIVAGVIQRDSRANARGLVVVRMGTETKASEGVIPAAE
QVPGESYEHGNRVRCYVIGVTRGAREPLITLSRTHPNLVRKLFSLEVPEI
ADGSVEIVAVAREAGHRSKIAVKSNLPGLNAKGACIGPMGQRVRNVMSEL
SGEKIDIIDYDDDPARFVANALSPAKVVSVSIIDQAARAARVVVPDFQLS
LAIGKEGQNARLAARLTGWRIDIRGDSPGGAGGHSESRPEHGATHGMAHD
R
41409006NP_961842.1 hypothetical protein MAP2908c [Mycobacterium avium subsp. paratuberculoMRTCVGCRKRELAVELLRVVAVPTGNGEFAAIVDTAGNLPGRGAWLHPAP
QCAQQAIRRRAFTKALRITGSPDTSAVVEHIESLHAPERPATEQVAKNMS
TP
41409005NP_961841.1 translation initiation factor IF-2 [Mycobacterium avium subsp. paratubeMAGKARVHELAKELGVTSKEVLARLNEQGEFVKSASSTVEAPVARRLRES
FGGGKAAEGAAKAPAKAAAKGDAKTAAKGDVKAPDKALDAALDNAIKAGG
NGEAAAPPAQPGGTATTPAAQATPEAPARPGPAAARPSAPAPGQPKPPAP
GQPPRPGATPGPRPGPAPKPAARTPRVGNNPFSSAQPVDRPIPRPVPRPG
APRPGAPRPGASPGNMPPRPGGVGGPGRPARPGAPRPGGGRPGGPGGRDG
GGGNYRGGGVGASPGGGGGFRGRPGGGGGGRPGQRGGAAGAFGRPGGAPR
RGRKSKRQKRQEYDSMQAPVVGGVRLPHGNGETIRLARGASLSDFAEKID
ANPASLVQALFNLGEMVTATQSVGDETLELLGSEMNYNVQVVSPEDEDRE
LLESFDLTYGEDEGTEEDLQTRPPVVTVMGHVDHGKTRLLDTIRKANVRE
AEAGGITQHIGAYQVTVEHDGVERPITFIDTPGHEAFTAMRARGAKATDI
AILVVAADDGVMPQTVEAINHAQAADVPIVVAVNKIDVEGADPQKIRGQL
TEYGLVPEEFGGDTMFVDISAKQGTNIDQLLEAVLLTADAALDLRANPDM
EAQGVAIEAHLDRGRGPVATVLIQRGTLRVGDSIVAGDAYGRVRRMVDEH
GDDVEEALPSRPVQVIGFTSVPGAGDNLLVVDEDRIARQIADKRSARKRN
ALAARSRKRISLEDLDSALKETSQLNLILKGDNAGTVEALEEALMGIQID
DEVALRVIDRGVGGITETNVNLASASDAVIIGFNVRAEGKATELANREGV
EIRYYSVIYQAIDEIEKALRGMLKPIYEENQLGRAEIRAIFRSSKVGIIA
GCMITSGVVRRNAKARLLRDNVVVSENLTINSLRREKDDVTEVREGFECG
MTLGYSDIKEGDVIESYELVQKERT
41409004NP_961840.1 ribosome-binding factor A [Mycobacterium avium subsp. paratuberculosis MPDPARARRLAKRINTIVASAIEFEIKDPGLDGVTIVDTKVTADLHDATV
FYTVMGRTLDDEPDYGAAAAALERAKGALRTMVGAGTGVRFTPTLTFTRD
TTSDSVARMDELLARARAADADLARVRSGAKPAGEADPYRESGSGVEPGR
DGSIGDDDQPEY
41409003NP_961839.1 hypothetical protein MAP2905c [Mycobacterium avium subsp. paratuberculoMTTTNPNTELTGVRVDAHGAVELLSRAGTVAVIAHVHPDADTIGAGLALG
LVLDKCGKRVEVSFAEPAGLPESLASLPGCRLLVRPDEIRRDADLVVTVD
VPSVKRLGVLSELAVTGREVLVIDHHASNDVFGTANFIDVAADSTTMMIA
DILDAWGKPIDPDVAHCIYAGLTTDTGSFRWASARALRLAARLVDIGVDN
AGISRALMDTHPFGWLPLLSRVLASAQLLPDAVGGRGLVYAVVGNQDWIS
SRPEEVESIVDIVRTTQQAEVAAVFKEIAPGQWSVSMRAKAQVDLAAVAS
GFGGGGHRLAAGYSTTGSIEDAVASLRAALG
41409002NP_961838.1 enoyl-CoA hydratase [Mycobacterium avium subsp. paratuberculosis K-10]MTDEILLSNTEERVRTLTLNRPQARNALSAALRDRFFGALADAETDDDVD
VVIITGADPVFCAGLDLKELGGSSALPDISPRWPALTKPVIGAINGAAVT
GGLELALYCDILIASENARFADTHARVGLLPTWGLSVRLPQKVGIGLARR
MSLTGDYLSAADALRAGLVTEVVPHDQLLGAAQAVAASIVGNNQNAVRAL
LASYHRIDDAQTSAGLWQEAMAARQFRTSGDDIAANREAVLARGRSQVR
41409001NP_961837.1 hypothetical protein MAP2903c [Mycobacterium avium subsp. paratuberculoMMLATTTLALKEWSAAVHALLDGRQRVLLRKGGIGEKRFELAAGEFLLFP
TVAHSHAQRVRPEHQDLLAPAAADSTDDELVIRAAAKVVAAVPVNRPDGL
PAIEDLHIWTAESVRADRLDFRPKHKLAVLVVSVTPLAEPVRLARTPDYA
GCKSWVQLPVHARLGPPIHDDETLAAVADRVRDAVG
41409000NP_961836.1 hypothetical protein MAP2902 [Mycobacterium avium subsp. paratuberculosMSLTSLRPAQPALHTLRHLGGRAAGRLLGLPPATTDYTVRRVAVPMRDGV
ELVADHYAPATSAPAGTLLVRAPYGRGFPFALVFGGLYAARGYHVVLQSV
RGTFGSGGVFEPMAHEVADGADTVAWLREQPWFTGRFATIGMSYLGFTQW
ALLQDPPPDMATAVIMVGPHDFNESTWGTGSFAVNDFLGWSDMVSHQEDP
VRARAALHQLRARRKVAEAAAGVPLGEAARALLGTGAPWFESWIEHADPS
DPFWNSLRCNEALDRVRVPVLLVGGWQDLFIRQTLQQYAHLRARGVDVAL
TVGPWTHTQLLTSGLGVCTRESLQWLDTHLGDAPGRRAGRVHVYVTGVDR
SRAWRRLPDWPPATTERALYLRPGGYLGETAPSLKGLAPATFRYDPAHPT
PTTGGPLLSPNGGYRDDTRLASRDDVLAFTSATLTEDVYVYGNPVVELAH
GADHPHADLFVRVSEVDAAGRSRNVTETYRRLSAAAKPQADKVIRLELDG
TAHRFRAGSRIRLLIAGSWSPRYAHNLGSGEPVLTARRLTPVTHSVRYGR
SRLLLPVGPAEPSADGVADPVGDGG
41408999NP_961835.1 hypothetical protein MAP2901 [Mycobacterium avium subsp. paratuberculosMTPRTRLVHSRQGTAEASGGVVFANVRLLGALGALLAAAIAGTAGVLSAP
PAPDGGAAGPVELRSTAQPLETTMKSPIVATTDPRPFDPCEDIPFDAVQG
LGLAFTPPEHEDGLRCHFDAGNYQVAVEPIIWRTYEQSLPADAVETTIAG
HRAAQYWVLKPTYHNSYWFYSCMVAFKTSYGVLQQALYYSTVYSNPEVDC
MQTNLQRANDLAPYYKF
41408998NP_961834.1 hypothetical protein MAP2900c [Mycobacterium avium subsp. paratuberculoMESLGWGVVAGQESSNAGQPTLWAVSDLHTGHLGNKPVTESLHPSSPEDW
LIVAGDVAERTDDIRWALDLLRRRFAKVIWVPGNHELWTTTRDPVQIFGK
ARYDYLVNMCDEMGVITPEHPFPVWTERGGPATIVPMFLLYDYSFLPDGA
ASKAEGLMIARDRNVVATDEFLLSPEPYPTREAWCRERLEITRARLEALD
WMTPTVLVNHFPLVREPCDALFYPEFSLWCGTTKTADWHTRYNAVCSVYG
HLHIPRTTWYDDVRFEEVSVGYPREWRRRKPYGWLRQVLPDPQYAPGYLN
DFGGHFEITPEMRRQATQFRERLRQRQSR
41408997NP_961833.1 hypothetical protein MAP2899c [Mycobacterium avium subsp. paratuberculoMTGTLVSSVLPASDALAYSEVYSDPPGLAPLPEEEPLIARSVAKRRNEFI
TVRHCARIALGELGLPPAPILKGEKGEPRWPDGVVGSLTHCTGYRGAVVG
RTGAVRSVGIDAEPHDVLPDGVLNAISLPAERSEIPSALPGDLHWDRILF
CAKEATYKAWFPLTRRWLGFEDARITFEADHPGATTGGFVSRILIDPAAL
CGPPLTALSGRWSVARGLVLTAIVL
41408996NP_961832.1 tRNA pseudouridine synthase B [Mycobacterium avium subsp. paratuberculoMSPPGLVVVDKPAGMTSHDVVGRCRRIFATRRVGHAGTLDPMATGVLVLG
VERATKILGLLTAAAKSYSATIRLGQATSTDDAEGDVARSVDARHLTSQA
IEAAVGGLRGDIHQVPSTVSAIKVAGKRAYKLVREGQAVELPARPVRIDR
FEVRGLRAAGACVDVDVEVDCSSGTYVRALARDLGAALGVGGHLTALRRT
RVGRFGLEQAYGLDELAECPRLSYSLDEACLLIFGRRDLSADEAEAAGNG
RALAAAGIDGVYAACAPDGRVIALLRDEGARTKSVVVLRPATL
41408995NP_961831.1 lipid-transfer protein [Mycobacterium avium subsp. paratuberculosis K-1MSNKVYVVGVGMTKFEKPGRREGWDYPDMARESGTNALADAGIDYREVQQ
GYVGYVAGDSTSGQRALYELGMTGIPIVNVNNNCSTGSTALFLAAQAIRG
GLVDCAIALGFEKMQPGSLGGGAQDRESPMGRHVKAMAEIDEFAMPVAPW
MFGAAGREHMRQYGSTAEHFAKIGYKNHKHSVNNPFAQFQESYTLEDILA
ARMISDPLTKLQCSPTSDGSGAAILASEAFVDKHGLAGQAVEIVGQAMTT
DFASTFDGSAKNLIGYDMNVQAAQQVYNQCGLGPQDFQVIELHDCFSANE
LLLYEALGLCGPGEAPKLIDNGDTTYGGRWVVNPSGGLISKGHPLGATGL
AQCAELTWQLRGTADKRQVENVSAALQHNIGLGGAAVVTAYQRAER
41408994NP_961830.1 FadE21 [Mycobacterium avium subsp. paratuberculosis K-10]MIEWSDTDLMVRDAVRQFVDKEIRPHLDELESGAMSPYPIARKLFSQFGL
DTMAAEAVKKVLDRERSGVDENGDSSGAANEFSGGGAQGSMIAVLVSEIA
RVSIGLLSTASVSLGLGAATIASRGTLAQKERWLPELMTLEKIAAWAITE
PDSGSDAFGGMKTSVRRSGDGDGAYILNGQKTFITNGPYADVLVVYAKLD
EGDPSVDKRNRPVLVFVLDAGMPGLTQGKPFKKMGMMSSPTGELFFDNVR
LTPDRLLGESEQHTEGDGRDSARANFAAERIGIAMMALGIIDECHRLCVD
YANSRTLWGKNIGQFQLIQLKLAKMEIARMNVQNMVFHTIERQRAGKPLT
LAEASAIKLYSSEAATEVAMEAVQLFGGNGYMAEYRVEQLARDAKSLMIY
AGSNEVQVTHIAKGLLSS
41408993NP_961829.1 hypothetical protein MAP2895 [Mycobacterium avium subsp. paratuberculosMVRRHRLLETFLVNELGYAWDEVHDEAEVLEHAVSDRLVARIDAKLGFPQ
RDPHGDPIPATDGQVPTPPARQLWACGDGDTGTVARISDADSEMLRYFTD
VGINLDSRLRVLTRREFAGMISVAIESGDGAETTVDLGSPAARAIWVTA
41408992NP_961828.1 hypothetical protein MAP2894 [Mycobacterium avium subsp. paratuberculosMRADEERGGLTAVGQDYLKAIWNAQEWSPEGAPQKVSTKMLAEKIGVSAS
TASESIRKLAEQGLVDHEKYGAVTLTEAGRRGA
41408991NP_961827.1 bifunctional riboflavin kinase/FMN adenylyltransferase [Mycobacterium aMAGVQRWRGQDEIPTDWGRCVLTIGVFDGVHRGHAELIAHAVKAGRARNV
PTVLMTFDPHPMEVVYPGSHPAQLTTLTRRAELVEELGIDVFLVMPFTTD
FMKLTPDRYVHELLVENLHVVEVVVGENFTFGKKATGNVETLRRAGERFG
FAVEAMSLLSEHHSNQTVTFSSTYIRSCVDAGDVVAAMEALGRPHRVEGV
VVRGEGRGIQLGFPTANVAPPMYSAIPADGVYAAWFTVLGHGPVTGTVIP
GERYQAAVSVGTNPTFSGRTRTVEAFVLDTQADLYGQHVALDFVARIRGQ
HKFDSVDDLVVAMGQDTERARQLLSAG
41408990NP_961826.1 30S ribosomal protein S15 [Mycobacterium avium subsp. paratuberculosis MALTAEQKKEILGTYGLHDTDTGSPEAQVALLTKRIADLTEHLKVHKHDH
HSRRGLLLLVGRRRRLLKYVAQIDVERYRSLVERLGLRR
41408989NP_961825.1 polynucleotide phosphorylase/polyadenylase [Mycobacterium avium subsp. MSVAEIEEGVFEATATIDNGSFGTRTIRFETGRLAQQAAGAVVAYLDDEN
MLLSATTASKSPKEHFDFFPLTVDVEERMYAAGRIPGSFFRREGRPSTDA
ILTCRLIDRPLRPSFVDGLRNEIQVVVTILSLDPNDLYDVLAINAASAST
QLGGLPFSGPIGGVRVALIDGTWVAFPTVEQLERAVFDMVVAGRKVDGAD
GPDVAIMMVEAEATSNVIELIDGGAQAPTETVVAQGLEAAKPFIEVLCTA
QQELADKAARPTSDYPTFPDYGDDVYYSVASVATDELSKALTIGGKAERD
ARTDELKAEVLARLAETYEGREKEVSAAFRSLTKKLVRQRILTDHFRIDG
RGITDIRALSAEVAVVPRAHGSALFQRGETQILGVTTLDMVKMAQQIDSL
GPETTKRYMHHYNFPPFSTGETGRVGSPKRREIGHGALAERALVPVLPSL
EDFPYAIRQVSEALGSNGSTSMGSVCASTLALLNAGVPLKAPVAGIAMGL
VSDDIEVEAGDGTKSLERRFVTLTDILGAEDAFGDMDFKVAGTKDFVTAL
QLDTKLDGIPSQVLAGALSQAKDARLTILEVMAEAIDEPDEMSPYAPRVT
TIRVPVDKIGEVIGPKGKIINAITEETGAQISIEDDGTVFVGATDGPSAQ
AAIDRINAIANPQLPTVGERFLGTVVKTTDFGAFVSLLPGRDGLVHISKL
GKGKRIAKVEDVVNVGDKLRVEIADIDKRGKISLVLVEEDNSAPADTPAA
APADATS
41408988NP_961824.1 PepR [Mycobacterium avium subsp. paratuberculosis K-10]MRAGKVVEAQPHPHAALRRSTLPGGLRVVTEYLPAVRSASVGVWVGVGSR
DEGATVAGAAHFLEHLLFKSTPTRTAVDIAQAMDAVGGELNAFTAKEHTC
YYAHVLDADLELAVDLVADVVLNGRCAAEDVELERDVVLEEIAMRDDDPE
DALGDMFLGALFGDHPVGRPVIGTARSVASMTRTQLHSFHVRRYTPERMV
VAVAGNVDHDEVVAMVREHFGPHLVRGRQPIAPRKGAGRVNGRPGLLLGT
RDAEQTHVSLGVRTPGRGWQHRWALSVLHTALGGGLSSRLFQEIRELRGL
AYSVYSTVDIFADSGALSVYAACQPERFAEVMAVTSGVLESVARDGITES
ECRIAKGSLRGGLVLGLEDSGSRMSRLGRNELNYGRHRSIEHTLAQIDRV
SVDEVNAIARRLLTQHYGAAVLGPYGTKRSLPQQLRAMVR
41408987NP_961823.1 hypothetical protein MAP2889c [Mycobacterium avium subsp. paratuberculoMVLGFWDITVPIVGAPMAGGPGTPALAAAVSNAGGLGFVPAGYVSAEQFA
DDIAAARKATTGPLGVNLFVPQPSVADWVALDYYAAELEEIAEHYQVEVG
HPRYGDDDGWEQKLEVVADVRPELVSFTFGVPPPDVIRRLGALGLLVMVT
VTSAYEAGVAVAAGADSLVVQGPAAGGHRGTFAPDMEPANESLHQLIDRI
RHAHDIPIIAAGGLGTADEVGAALRRGAVAAQVGTALLLADEAGTNAAHR
TALKNPLFATTVVTRAFSGRYARGLENDFTRMLDHVAPLGYPEVNQMTTP
IVEAAAAIEDPNGIPLWAGAAFKHASAGPAADIVAGLAATG
41408986NP_961822.1 hypothetical protein MAP2888 [Mycobacterium avium subsp. paratuberculosMRVGVPTETKTNEFRVALTPAGVAELTRRGHEVLVQSGAGEGSSIPDSEF
KAAGAQLADTAEQVWADAELLLKVKEPVPAEYDLLRRNQILFTFLHLAAS
RACTEALLTSGTTSIAYETVQTADGTLPLLAPMSEVAGRLSAQVGAYHLM
RTHGGRGVLMGGVPGVKPADVVVVGAGTAGYNAARVAGGMGAMVTVLDVN
INKLRLLDAEFGGQVRTRYSSAYDLEGTVKRADLVIGAVLLPGAKAPNLI
SNSLVAQMKSGAVLVDISIDQGGCFEDSRPTTHDDPTFAVHDTVFYCVAN
MPSAVPKTSTVALTNATMPYVLALADRGWRAACRSNHALAKGLSTHDGAL
LSQQVAADLGLPCTDPAGVLQQD
41408985NP_961821.1 hypothetical protein MAP2887c [Mycobacterium avium subsp. paratuberculoMSAPSVSASVHIDARPEVVYRLITDLPTLASLAEEAVAMQWRKGDAARPG
AVFTGHNQNGGRRWSTKCTVTDAEPGRRFAFDVRHTVFPVARWQYDIVGT
DGGCDVTESTWDRRPGWFAKVAGRATGVTDRAGANAEHIRLTLQRLKQRA
EAE
41408984NP_961820.1 hypothetical protein MAP2886c [Mycobacterium avium subsp. paratuberculoMVTIDNQAAGPHDASVDHERLVLEARDVDFDWAQLPFHYVPGEPFATHVL
NVLHLQLPAGEQFFVEVFKQALPLIRDDQLRLDVQGFIGQEGVHSRAHAN
VLAHFAARGIDLRPYTGQIEWLFGTLLGPRPNWSPRRRQSWLLEQISLVS
AIEHYTAILGEWILDSPAHDRIGTDPVMLDMLRWHGAEEVEHKAVAFDTM
KHLRAGYWRQVRTQLVVTPAMLLLWIRGVRFMYSRDPYLPPHTKPRWRDY
FRAARRGLVPGPLRFVRAVANYYRPGFHPSQLGGLQRAVDYLAVSPAARA
SH
41408983NP_961819.1 short chain dehydrogenase [Mycobacterium avium subsp. paratuberculosis MTVTSTITADDGVTLAVHRYTDIDPARPTILAIHGFPDNHHVWDGVADEL
TGAPYNFVAYDVRGAGESSCPATRSGYGFAQLVRDMGAVIDSLGVGRVHL
LAHDWGSIQAWAAVTDKAVTGESVMDKVASFTSISGPHLNYAGTFLHSAR
TPRAVARVVRQLIASGYIGFFLCPGAAELSFRAGIGVKVIAALERIGHTS
TRSQRRDTRRSLRDYLNGLQLYRQNMPAPMLAPGPRLPETTVPVQTLVPR
RDVFVTPALQRFTGAIPQRARVIEIEGGHWVVTSRPDVIARLTTEWVDLQ
SAGAVAPQLTGERRELPGERREVRGRLALVTGAGAGIGRATAVELARQGA
RKVVTVDRDRAAADQTADAVRAAGAGAAVYQVDVSDEAAMNDLAAQVRNE
HGVVDILVNNAGIGMAGRFLETSPANWDAIMGVNVRGVIWGSRAFGTQMV
ERGQGGTIINVASAAAYLPSKSMVAYGTTKAAVLALSESLRADFADEGIT
VTAVCPGFVNTNIAKSTIYAGMSAQQQEWARDRADTAYRRRNFTPEATAK
AIVKAIKTGPAVVPIAAESRIGYALRRISPGAIRLLARWDIRQT
41408982NP_961818.1 hypothetical protein MAP2884c [Mycobacterium avium subsp. paratuberculoMSIRWAASRPPSIWASRPADLYGRRDHDRFTAVLWGVRAVFEGFASVSRW
HPARVKPVQRKLTAVVTKREFAAPDVVALTLADPDGGLLPSWTPGAHIDV
LLPSGRRRQYSLCGPPGHRGEYRIAVRRIADGGGGSIEMHEAFGVGDTVE
FEGPRNAFYLGTAEHDVLFVIGGIGVTPILPMIRVAAQRGIDWRAIYTGR
SREYMPLLDEVVSVDPQRVTVWADDEHGRFPTAAELLAAAGPATAVYVCG
PSAMLEAVRIARNEHAGAPLHYERFSPAPVVDGVPFELELARSRQVLAVP
ANRTALDVMLDRDPTTPYSCRQGFCGTCRVKVLAGQVDHRGRTDPGQDGM
LVCVSRADGGRLVIDA
41408981NP_961817.1 hypothetical protein MAP2883 [Mycobacterium avium subsp. paratuberculosMTRQTSGAGVAGRRPNRRGHATRESMLEAALRSLASGEPGSVSANRIAKD
IGATWGAVQYQFGDTDGFWAAVLHRTAERRAATFSSLSSPVSPEAPLRER
VGAIIETLYRGLAAPDSRAIENLRAALPRDPDELERLYPRTAAELFSWGK
SWLETCQQAFAGLAVDPDRVREVAALIPGAMRGLVSERQLGSYADLDMAR
RGLTNALAAYLEQSRP
41408980NP_961816.1 hypothetical protein MAP2882c [Mycobacterium avium subsp. paratuberculoMIWRRGGLIFVPEGGQLRWEGTMAKPPLSMKPTGWFQVAWSDEIGVGDVH
KMKYFDQEMVAWRAESGQLTVMNAYCEHLGAHLGYGGKVVGEVLQCPFHG
WQWSAEGRNVCIPYQDRPNRGRRMRTYPVVERNASVYIWHDLQRREPYFD
PPDVFAAFGDGSSADDYYPQQRLYRQALEMHPQYVLENGVDFAHFKFVHN
TPIVPVFTRHDFAEPVSYVDFTITFEGDDGQKIEDVNSGVQAINGGLGIA
VTKSWGMIDNRTISAITPVDERTSDVRFMVYIGRTPAKDAARAQRKAAEF
GDEVIRQFTQDIEIWQHQRYSDPPALAADEYQGFMAIRQWAKQFYPEFAA
QEA
41408979NP_961815.1 hypothetical protein MAP2881c [Mycobacterium avium subsp. paratuberculoMGTAPIRVFQVGSGNVGSEMIRRIATQPDLELIGVHCYSPEKIGKDTGQF
AGLAPNGVKFTGTVEEIIAAKPDVLTFHGVFPDEDLYVKVLEAGIDIVTT
ADWITGWRRDKNHPHPSGKPVTQLLAEAAAKGGATFYGTGMNPGLNQILG
VVCSADVAEIENVTTIESVDVSCHHSKDTWIEVGYGQPVDDPEIPAKLEK
YTRVFADSVYMMADCFDLTLDEVTFSYELGACTKDVDLGWYTLPKGSLGG
NYIKYQGMVDGVPRVETHLEWQMTPHTDPSWNVKGCYITQIKGDPCIYNK
HMIFPKPGVDLSNPDNFASIGMTVTGMPALAAIRSVVAAPPGLLTSADLP
LRGFAGRFKK
41408978NP_961814.1 hypothetical protein MAP2880 [Mycobacterium avium subsp. paratuberculosMHSIEVPAEVRAALDALDAADAAIRALDFDALHPVVRLRALERMEASRRR
QIAVSHGVIAGLAGEGPGNVGGPVHKVIADRLRISYAEACRRLREAKQLS
PRLTLTGQELPPELPATAGVWREGMLDGQHLRVIEKFVRDLPETTPVRAL
EEAERFLAHQATLLRPDQLEKVAHQCALRINPDGKFSDADRARQRGFTWC
GQRADGMSFGKLWASPELRANLDAWLARFAAPGMCNPDDEAPCVAGEPDE
ESATKDSRTPAQRQHDALNALLRGRLGDPKLGLHNGLPVTVVVSTTLREL
TTGAGRAVTGGGTLLPMRDVIRMARHAYHYLAVFDEHSSRPLYLGRSRRV
ASPDQRVVLYAKDRGCTHPGCDAPGYWCEVHHLNEWATGGLTDVDNLTFA
CGPHHKLIENGWRTKKLADGRTAWIPPPQWDRGARTNDFHHPERDFDGED
P
41408977NP_961813.1 hypothetical protein MAP2879c [Mycobacterium avium subsp. paratuberculoMRAGWANAAAAITVVVAACPCPTGSADSTPDSPPFPIGQLGVPVHARAAS
GATADITVNSATWLPPGCTSHFATPTAGSACNVVELTITATSHRFFQVNQ
RYMFAGYGGGNQPWTHPDDAPQPATMAVDYQRLGKMPPLQTGGLHDGQTA
HGFVGFAMPAGGDLYLTINDPEQPAPYTEAGWIVHT
41408976NP_961812.1 dihydrodipicolinate reductase [Mycobacterium avium subsp. paratuberculoMRVGVLGAKGKVGSTMVAAVQAAEDLTLSAEVDAGDPLSLLTDGGTEAVI
DFTHPDVVMGNLEFLVRNGIHAVVGTTGFTAERLAQVREWLADSPGTSVL
VAPNFAIGAVLSMHFAKQAARFFDSAEVIELHHPHKADAPSGTATRTAKL
IAEARKGLPPNPDATSTSLPGARGADVDGIPVHAVRLAGLVAHQEILFGT
EGETLSIRHDSLDRTSFVPGVLLAVRRIREHPGLTVGLEPLLDLG
41408975NP_961811.1 hypothetical protein MAP2877c [Mycobacterium avium subsp. paratuberculoMNKALRIQLLVAFLCVALVVYFALLGRVAIAMIASGRAAAVGLGVAVLIM
PALGLWAMIATLRAGFAHQRLARLIAADGMELDTSALPRRPSGRIRRDAA
DALFATVRTEVENHPDDWRRWYRLARAYDYAGDRRRAREAMKTAVDLQGH
Q
41408974NP_961810.1 hypothetical protein MAP2876c [Mycobacterium avium subsp. paratuberculoMTDTPSKTLLIVHHTPSPHTHEMFEAVVSGATDPEIEGVEVVRRAALTVS
PAEMLAADGYLLGTPANLGYISGALKHAFDCSYYQLLDSTRGRPFGLYLH
GNEGTEGAQRAVDTITTGLGWTKAAETVVVSGKPSKDDLQACWELGATVA
AQLMD
41408973NP_961809.1 hypothetical protein MAP2875 [Mycobacterium avium subsp. paratuberculosMIAVTIEDPAIMPEAFFTVDGDSYVPGTMTRGPWGAAMGGQIVGGLLGWG
IEQSGVDPDLQPARFTVDLLRPALLAPVQIRTSVQREGRRIKLVDAGLVQ
NGVVVARASALFLRRGDHPDGQVWSPPVQMPPLPTSSEGFPADMPFLIWG
YGATRAGSPGIAAGEWEQAHSQKFAWARLFRPMVHGHPLTPFTRLAFVGD
ITSSLTHWGTGGLRYINADYTVSASRLPDGEFLGLAAQSHYGTAGVAAGA
ATLFDRHGPLGTSWALALAQPADAFQPAYT
41408972NP_961808.1 FadD13 [Mycobacterium avium subsp. paratuberculosis K-10]MPPVIEIAREHNPFPTTGVSRGRDGIPRYDELPATLVDMLADQVDARPDS
EAVVELGGGRLTYRQLWDRAARVAGGLRADGLRRGDRVAVRYPAGIDWVL
AFWGTVLAGGVAVAVNTRSAQPEVDFVLSDSGARLQLAPGDPLPDGKPYV
TEQLGAADTAALFYTSGTTGYPKGVPTTHEAFLTNTENAIRCLQQPRDLG
EDMRTLISVPLFHVTGCNSQLLAAARLGGASVILPALDLDALLNAVVAER
VSVMVTVPAIYALLLRHKDFAGTDVSRVRWVGYGGAPIAPSLVRTVKDAF
PHATVFNGYGMTETASLMTVLPDREAVEHADSVGYAVPSVDLGLIPFGDN
EPGVGELVTRGANVTAGYWNRPQATASTFAGGWLHTGDVVRVDDAGRVHI
IDRLKDIINRGGENVSSVEVEAVLLGAPGVADACVLGVPDDVMGEKVGAV
LFGDDDIDVPAVLEHCRGRLADFKVPQYVTVVDGPLPRNAGGKLLKARLR
DQVHWGDPLR
41408971NP_961807.1 hypothetical protein MAP2873c [Mycobacterium avium subsp. paratuberculoMTASLLVANRGEIALRIIRTATELGMRTVAVYAADDAHSPHVHAADEAMP
LPGSGPPAYLNQAALLAVAENTGATLIHPGYGFLSENAEFAKACAAASHT
FVGPDGRVLELLGNKTAARRAAIAAGVPTLAATDGPSGVEDIEAFFAAHP
GGIMIKALAGGGGRGMRKVHNAAQIAGAYQRCAAEARLGFGDPALFAEAL
LGDARHIEVQVVAAPAGHQTHALAVGDRDCSMQRRYQKLIEIAPAQGLSE
ELRRALHQAAVRLCARVGLRGLATVEFLVSGERFVFLEVNPRIQVEHTVT
EQTTGLDLVAVQLAIAGGESYYRLGLPAGIASDGTEVIGEPAAQRGIAIQ
LRVNAETFGADFSVLPSAGTLTAFCPPSGPGVRVDTYGRPGLVVSPQYDS
LLAKVIVAVHGSSWRAAMRKADTALSEFGVEGVATNIGFLRRLLAEQRLE
TGWVNTDFVDEKLPELAAAALTHQPGPQPGAVELYPGEDALRAQLAGTVV
EVAPEGADYPAGAQLVVLEAMKMQHVLAAPDALRTVRVLVTPGQVVGTGD
PLLVFTRTTGGDDGESETAATDLDLTRADLDEVIERHARTLDEGRPDAVA
KRHRQGRRTARENIDDLVDPGSFVEYGALAIAAQRSRRSEEDLIANTPAD
GLVAGLATVGADRFGPAAAQAVVASYDYTVLAGTQGMRNHAKTDRVFDLA
ARKRLPVVLFAEGGGGRPGDTDVGGAAGLDVPTFRMLAGLRGRVPLVSVV
SGRCFAGNAALAGVCDVIIATPDANIGMGGPAMIEGGGLGVYPPEAIGPI
AVQRRNGVVGLVARDEAHAVSLAKQYLSYFQGRLDRWQAPDPRVARHVVP
QNRLRAYDVHRAIEAIVDVGSVLELRPDYGVGIVTALVRVEGVPYGLIAN
STHHLGGAIDAEAADKAGDFLALCESFGLPVISLCDTPGFMVGPDAETQA
AVRRFGRMFVLGARLTVPLGMIILRKGYGLGAMAMAGGSFRAPQFTVAWP
TGEIGGMGLESAVRLGYRKELAAVTDPAERQNLFDRLVAAAYQHGKALRA
ATTFELDDVIDPAASRAWITRLSGG
41408970NP_961806.1 3-ketoacyl-ACP reductase [Mycobacterium avium subsp. paratuberculosis KMTSQDLTGRTAIITGASRGIGLAIAQQLAAAGANVVLTARKQEAADEAAA
QVGPQALGVGAHAVDEDAARQCVQLTLERFGSVDILVNNAGTNPAYGPLI
EQDHARFAKIFDVNLWAPLLWTSLAVKSWMGEHGGSIVNTASIGGLHQSP
AMGMYNATKAALIHVTKQLALELSPRVRVNAIAPGVVRTRLAEALWKDHE
DPLSSSIALGRIGEPIDVAAAVAFLVSDAASWITGETLVIDGGTVLGAAQ
GFRPAPTPS
41408969NP_961805.1 hypothetical protein MAP2871c [Mycobacterium avium subsp. paratuberculoMRVLLSAYDSRGGVQPLAALAVQLRALGVDARVSAPPDAEFAELLARAGV
PLVAFGDSLRAMKTAATTPSEEQLRRQLDGLIAAQFDAAAAARECDALVV
AGFPPAAAAARSAAEKQGAHYVYVSYQPTILPSPHYPPPGYADAPSAAGL
IDNRLLWQLDGRYMQALFGETLNARRAAIGLPPLDDLRGYALTERPWLAT
DPTLDPWRPPGDLDVVQTGAWLLADDRRLPAELEAFLDAGAPPVYVGFGS
MPMRACRDVARVAIEAVRAQRRRAVVSRGWAGLGPIDDGEDCLVVGEVNH
QALFGRVAAVVHHGGVGTLTAAALAGAPQVVVPQGADQPYWAARVAELGI
GAAHDGPAPTVESLSAALGTALTERTRARAGAVAATIRTDGAARAARLLV
ARLAG
41408968NP_961804.1 hypothetical protein MAP2870 [Mycobacterium avium subsp. paratuberculosMPKITDSISTADGTCPVRLFFPDGSGPWPGVVMYPDAGGVRDTFDQMAAE
LAGFGYAVLLPDVYYRSGEWAPFDMATVFADQQERNRLFAMIGSVTPDRM
ATDAAAFFDYLAARPEVSGDRFGVCGYCMGGRTSLIVAGRLPDRVAAAAS
FHGGGLVTDSDDSPHLLADRMSATVHVGGAQDDASFTTDHAEQLDKALTA
AGVRHTIEWYSAAHGFAVPDNAPYDPAAAERHWDAMRDVFAAALPR
41408967NP_961803.1 thymidylate synthase [Mycobacterium avium subsp. paratuberculosis K-10]MPIPTPYEDLLRLVLDRGTAKSDRTGTGTRSLFGQQLRYDLSAGFPLITT
KKVHLKSVVYELLWFLRGDSNVDWLHRHGVTIWDEWASDTGDLGPIYGVQ
WRSWPTPSGEHIDQISAALDLLRTDPDSRRIIVSAWNVGEIPRMALPPCH
AFFQFYVADGRLSCQLYQRSADLFLGVPFNIASYALLTHMMAAQAGLSVG
EFVWTGGDCHIYDNHVEQVRLQLSREPRPYPELILAHRDSIFDYTYDDVV
VHNYDPHPAIKAPVAV
41408966NP_961802.1 DfrA [Mycobacterium avium subsp. paratuberculosis K-10]MTRAEVGLVWAQSTSGVIGRGGDIPWSVPEDLTRFKEVTMGHTVIMGRRT
WESLPAKVRPLPGRRNVVVSRRPDFVAEGARVAGSLEAALAHAGSDPAPW
VIGGAQIYLLALPHATRCEVTEIEIDLRRDDDDALAPALDDSWVGETGEW
LASRSGLRYRFHSYRRDPRSSVRGCSPSRPS
41408965NP_961801.1 hypothetical protein MAP2867c [Mycobacterium avium subsp. paratuberculoMAVITEPVKTFSRKFMGYDTTAVDAHIEMLTAKQQLLIDDVESLRARLQE
SNEQTAALRKEVAALTDTSPAPHAVQQRMAKMLARAVDEVAEMQAEARAE
ADALIAAAEAEAQAAERKRDEVLADMAAQQEALEAEYRETKEKLDAELAD
MRAEAQAAIDEARRAAERECEQLLGDAKQGADHYRDTARRAVEEASAQRI
KILEQLMSVYRELEDVPAALQAAYDEQQGSADDGVLAAMDGKVRAG
41408964NP_961800.1 hypothetical protein MAP2866c [Mycobacterium avium subsp. paratuberculoMSPGGGIVGAVSTRRLSVAQARRIAVAAQGFTEPRPAGAVTRAHLNRLIS
KIQVLQLDSVSVTVRAHYAPVFSRLGPYDREVLDRAAWGPRSSRLLVEYW
AHEAALMAVEDWPLLRWRMRQYRHGRWGTHIVQANPRLADAVVAAVAELG
PSTAGQIEAHLAAEPRRRKGAWWNRSDTKWVAEALFAAGVLTTATRVGFA
RHYDLVERVLPADVLARRVDDDEAIRELTLRAAGALGVGTEADIRDYFRL
SAAQVKPAIAELVAAGDLERVEVAGWPAPAYLRAGRAVPRTDRGTALLCP
FDPLIFFRPRVERLFEFHYRIEIYTPAAKRRYGYYVWPLLMDGRLAARVD
LKADRAEGTLRVLGAFAEPQAPRPRVAAVLAGELWSMASWLGLGGLSVAD
RGDLALALRAVA
41408963NP_961799.1 FAD-dependent thymidylate synthase [Mycobacterium avium subsp. paratubeMAEIAPLRVQLIAKTDFLAPPDVPWSTDADGGPALVEFAGRACYQSWSKP
NPKTATNAGYIKHIIDVGHFSVLEHASVSFYITGISRSCTHELIRHRHFS
YSQLSQRYVPENDSRVVVPPGLDDDPELQQILAAAADASRATYTELLARL
EAKFADQPSAVLRRKQARQAARAVLPNATETRIVVTGNYRAWRHFIAMRA
SEHADVEIRRLAIECLRRLADVAPAVFADFEIATLADGTEVATSPLATEA
41408962NP_961798.1 dihydrodipicolinate synthase [Mycobacterium avium subsp. paratuberculosMSTVGFDAPARLGTVLTAMVTPFAADGSLDTAAAARLANHLVDSGCDGLV
VSGTTGESPTTTDDEKRELLRVVLEAVGDRARVIAGAGTYDTAHSVRLAK
ACAAEGAHGLLVVTPYYSKPPQRGLIAHFTAVADATELPVLLYDIPGRSV
VPIESSTIRALASHPNIVGVKDAKADLHAGGQIIAETGLAYYSGDDALNL
PWLAMGATGFISVISHVAANQLRELLSAFTSGDIATARKINATVTPLCDA
MARLGGVTMSKAGLRLQGIDVGDPRLPQVPATPEQIEALTADMRAASVLR
41408961NP_961797.1 hypothetical protein MAP2863c [Mycobacterium avium subsp. paratuberculoMDVDLAPPGPLAAGGLRVTALGGISEIGRNMTVFEHLGRLLIIDCGVMFP
THDEPGVDLILPDLRHIEDRLDDIEALVLTHAHEDHIGGIPYLLKLRPDI
PVVGSKFTLALVAAKCREHRLKPVFVEVSEGHKSTHGVFECEYFAVNHSI
PDALAIAVHTGAGTVLHTGDIKLDQLPLDGRPTDLPGMSRLGDAGVDLFL
CDSTNAELPGVGPSESEVGPTLHRLIRGAEGRVIVACFASNVDRVQQIID
AAVALGRRVSFVGRSMVRNMGIARELGFLRVADADVIDIGAAELMPPERV
VLITTGTQGEPMSALSRMSRGEHRSITLTAGDLVVLASSLIPGNEEAVYG
VIDELAKIGARVVTNAQARVHVSGHAYAGELLFLYNGVRPRHVMPVHGTW
RMLRANSKLAARTGVPEESILLAENGVSVDLVAGRASISGAVPVGKMFVD
GLVDGDVGDITLGERLILSSGFVAVTVVVQRGTGRPVAPPHLHSRGFSED
PKALEPAVRRVEEELEALVAENITDPSRIAQGVRRTVGKWVGETYRRQPM
IVPTVIEV
41408960NP_961796.1 hypothetical protein MAP2862 [Mycobacterium avium subsp. paratuberculosMARNPVAQTAFGPMVLAAVEQNEPPGRRLVDDDFAELFLPAPLRWLVGAT
RFAPVRHLMIRGSEFTGPGLWANLACRKRFIADKLKESLDDINAVVILGA
GLDTRAYLLTRRVRIPVFEVDLPVNVARKFKTVRRVLGELPLSVRLVALD
LEHDDLLTALAEHGYRTDYRVFFICEGVTQYLSEATVRRTLDGLRAAAPG
SRLVFTYVRSDFIDGTNRYGTRTLYRNVRQRRQLWHFGLQPGEVADFLAE
YGWRLVEHAGPDELMQRYVVPTGRKLKASQLEWSAYAEKT
41408959NP_961795.1 3-ketoacyl-ACP reductase [Mycobacterium avium subsp. paratuberculosis KMPRSSEGPLTGKVAFITGAARGQGRAHAVRLAADGADIIAVDLCDQIASV
PYPLATPEELAATVKLVEDIGSRIVARQADVRDRESLSAALQAGLDELGR
LDIVVANAGIAPMSAGDDGWHDVIDVNLTGVYHTIKVAIPTLVKQGTGGS
IVLISSSAGLAGVGSADPGSVGYVAAKHGVVGLMRVYANLLAGQMIRVNS
IHPSGVETPMINNEFTREWLAKMAAATDTPGAMGNAMPVEVLAPEDVANA
VAWLVSDQARYITGVTLPVDAGFLNK
41408958NP_961794.1 hypothetical protein MAP2860 [Mycobacterium avium subsp. paratuberculosMPVVVVATMTVKPESVDTVRDILTRAVEEVHDEPGCQLYSLHQSGETFVF
VEQWADEEALKAHSTAPAIGKMFSAAGEHLDGAPDIKMLQPVPAGDPGKG
QLRP
41408957NP_961793.1 hypothetical protein MAP2859c [Mycobacterium avium subsp. paratuberculoMWPPGRSGGGVTSTTSRTGCHPTHANSGPIPQLPQSLVVTSVAGGVDDAV
ATTLAVMPSKTAARSGNRTSRSKATSRSNGSRGARPAAPRRKPGRPTRRR
QHPPLVAAGLTCGRALRAGWMLAARGTGGAARSIGRARDIDPGHRRDGIA
LLLLGFSVVVAASSWFHAAGPVGAWVDTALRTFIGAGVLALPVVTAAVAV
TLMRTEPDPDVRPRLILGAGLIALSVLGLRHLWSGSPGDPDARRRAAGFI
GFAIGGPLSDGLTPWIAAPLLFIGFMFGLLLLTGTTIRELPVVMRNLFHT
RFVEDYTDEDYTDEDYTDGDYGDEPYDYAGEFDDAAAQPEPEPAAWAPDD
DAQAALQDDIPTVPEPAVKTGRGRKRGRAADNSDTIELDRVVEGPYVLPS
LSLLVAGDPPKKRSAANNVMADAITEVLNQFKVDAAVTGCTRGPTVTRYE
VELGPGVKVEKITALQKNIAYAVATESVRMLAPIPGKSAVGIEVPNTDRE
MVRLADVLTAPSTRRDHHPLVIGLGKDIEGDFISANLAKMPHLLVAGSTG
SGKSSFVNSMLISLLARATPEEVRMILIDPKMVELTPYEGIPHLITPIIT
QPKKAAAALAWLVEEMEQRYQDMQASRVRHIDDFNAKVRSGEITAPLGSQ
REYRPYPYVVAIVDELADLMMTAPRDVEDAIVRITQKARAAGIHLVLATQ
RPSVDVVTGLIKTNVPSRLAFATSSLTDSRVILDQAGAEKLIGMGDGLFL
PMGASKPIRLQGAFITDEEIQAVVAACKDQAEPEYTEGVTAVKTSSERAD
VDPDIGDDMDVFLQAVELVVSSQFGSTSMLQRKLRVGFAKAGRLMDLMET
RGIVGPSEGSKAREVLVKPDELAGTLALIRGSGAGSADADGGDPD
41408956NP_961792.1 N-acetylglutamate synthase [Mycobacterium avium subsp. paratuberculosisMTESPQRYRPLVRRARTSDVPAIKELVDTYAGKILLEKNLVTLYEAVQEF
WVAELPDSPGRVVGCGALHVLWSDLGEIRTVAVNPAMTGHGIGHAIVDRL
LQVARELELKRLFVLTFETEFFGKHGFTEIEGTPVTAEVFEEMCRSYDIG
VAEFLDLSYVKPNILGNSRMLLVL
41408955NP_961791.1 hypothetical protein MAP2857c [Mycobacterium avium subsp. paratuberculoMPGQPQTGPMVGRANIANLANTLTLLRLVLVPVFLLALFAGDGHETGFRI
LAFLIFAFACITDRLDGLLARNYGMATEFGAFVDPIADKTLVGSALIGLS
MLGELPWWITVLILAREFGVTVLRLAVIRRGVIPASWGGKLKTVVQVFAI
GLFVLPWAGTPGPFRVGAAVVMGAAIVLTVITGIDYVVSTVREVRRTAA
41408954NP_961790.1 hypothetical protein MAP2856c [Mycobacterium avium subsp. paratuberculoMPPLVREVIGDVLREARTTQGRTLREVSDTARVSLGYLSEVERGRKEPSS
ELLNAICDALDVPLSSVLTDAGERMASEERAAVAAPAGPSIDASTKVVIP
PVASLALA
41408953NP_961789.1 hypothetical protein MAP2855c [Mycobacterium avium subsp. paratuberculoMANPFVKAWKYLMAKFNATIDERADPKVQIQQAIEEAQRTHQALTQQAAQ
VIGNQRQLEMRLNRQLADVEKLQVNVRQALTLADQATAAGDTAKATEYNN
AAEAFAAQLVTAEQSVEDLKTLHDQALNAAAQAKKAVEQNAMVLQQKIAE
RTKLLSQLEQAKMQEQVSASLQSMSELAAPGNVPSLDEVRDKIERRYANA
IGAAELAQGSVQGRMLEVEQAGVQMAGHSRLEQIRASMRDEALPTGGTPA
AGGTQAAPAPGQGAGDAVSEKPLGQ
41408952NP_961788.1 hypothetical protein MAP2854c [Mycobacterium avium subsp. paratuberculoMAVNATQPGPWRALLQRGVAAAADLSDLVARKISAATDPRARLLRRRRRA
LRWGLIFTAGCAFWAVLTIVLAAWGWFALLLEITGAVAVVMAIPATLLLL
RYRWLRAEPLPAPRTTNVRRLPPPGSAARPAMYALGASERGFASLLAVLE
RGAMLPAAEICDLTAAAGRTSAAMASTAAQVVSMERAAQAGEESRSYLAP
TINAFTAQLSAGVRQYNEMVTAAARLVSAANGDGSTASQHYRAELVGATD
RLNGWAQAFDELGGLRGAG
41408951NP_961787.1 hypothetical protein MAP2853c [Mycobacterium avium subsp. paratuberculoMDVGVALPGDLVDQLGVQIVHGQHVPAPHLVERVRKVHERNENRQRHAQV
NVERRRDQPERGQHQHRRHRHPPHHPGRRALAGQVVAHPVAHRVRQPPAA
AIADELNEIGPGAAPVLAHGALRTWLSATAAAARPPRAPWP
41408950NP_961786.1 hypothetical protein MAP2852 [Mycobacterium avium subsp. paratuberculosMTELTGTTVANTRTVEGFLNALQDADYDAAEAALADDLVYENVGLPTIHG
RARAMKLFRRMEDRAAFEVKIHRIAADGGAVLTERTDALIFGPLRLQFWV
CGVFEVQNGRITLWRDYFDFFDMLKATARGVAALLLPSLKATF
41408949NP_961785.1 hypothetical protein MAP2851c [Mycobacterium avium subsp. paratuberculoMRVAVVAGPDPGHSFPAIALCRRFADAGDTPTLFTGAEWLDTARGAGVDA
VELDGLAATDEDVDAGARIHRRAARMAVLNVPALRDMAPDLVVSDVITAG
GGMAAELLGIPWIELSPHPLYLPSKGLPPIGSGLAPGTGLRGRLRDATMR
ALTARSWRAGLRQRAAARAEIGLPARDPGPLRRLIATLPALEVPRPDWPD
EAVLVGPLHFEPTDRVLDIPAGSGPVVVVAPSTALTGARGLAEVALSCLT
PGETLPAGARLAVSRLAGPALAAPPWAVVGLGSQAELLRHADVVVCGGGH
GMVAKTLLAGVPLVAVPGGGDQWEIANRVVRQGSARLIRPLSADALVVAV
NEVLSSPGYRAAAQRAAAGIADVADPVRVCREALAG
41408948NP_961784.1 hypothetical protein MAP2850c [Mycobacterium avium subsp. paratuberculoMLAGMRLTEFHERVVLRFGTTYGSSVLVDHVLTGLGGRTAAQAIEDGVDP
RDVWRALCVDFDVPREQW
41408947NP_961783.1 hypothetical protein MAP2849 [Mycobacterium avium subsp. paratuberculosMDISPQLSEVSSYGGFFALTVGGDPAGWRPVTECYADGSADLIAATARRY
RTRDLRIGASLVHLAHASRLWSPVLGCAIGHGVVPDLGDLHRAATGAQLR
LPEPVGRRVTAPHPELLYRLVVDEHLGPLAAGLRVGLAPALLAGNVASAL
VGAARALLSARPDLRSAIVETTLALLDTGIMSGAGTVTGPPLDFRRASCC
LFYRLPGGSVCGDCVLDR
41408946NP_961782.1 recombinase A [Mycobacterium avium subsp. paratuberculosis K-10]MSAGLSRLLRRPRRVELESNTCSATVGDVRSVNLSVAFSSVTANRPIPVR
RHTDYRRGTMTQAPDREKALELAMAQIEKSYGKGSVMRLGDEMRQPISVI
PTGSIALDVALGIGGLPRGRVVEIYGPESSGKTTVALHAVANAQAAGGVA
AFIDAEHALDPEYAKKLGVDTDSLLVSQPDTGEQALEIADMLIRSGALDI
LVIDSVAALVPRAELEGEMGDSHVGLQARLMSQALRKMTGALNNSGTTAI
FINQLREKIGVMFGSPETTTGGKALKFYASVRMDVRRIETLKDGTNAVGN
RTRVKIVKNKVSPPFKQAEFDILYGRGISREGSLIDMGVDQGFIRKSGSW
FTYEGEQLGQGKENARTFLMENDEVANEIEKKIKEKLGIGAVVTDDLSDD
GVLPAPVDF
41408944NP_961780.1 hypothetical protein MAP2846c [Mycobacterium avium subsp. paratuberculoMTCGFSRADRSPYHGPVTSTVARDVSGVRTYQVRTYGCQMNVHDSERLAG
LLEAAGYRRAAEGAEVADVVVFNTCAVRENADNKLYGNLSHLAPRKRGNP
EMQIAVGGCLAQKDREAVLRRAPWVDVVFGTHNIGSLPTLLERARHNKAA
QVEIAEALQQFPSSLPSARESAYAAWVSISVGCNNSCTFCIVPSLRGKEV
DRSPDDILAEVRSLVADGVLEVTLLGQNVNAYGVSFADPALPRDRGAFAR
LLRACGEIDGLERVRFTSPHPAEFTDDVIEAMAQTPNVCPALHMPLQSGS
DRVLRAMRRSYRAERFLGIIDRVRAAMPHAAITTDLIVGFPGETEEDFAA
TLDVVRRARFAAAFTFQYSKRPGTPAAELDGQIPKAVVQERYERLVELQE
SISLQGNQALVGQTVELLVATGEGRKDSATARMSGRARDGRLVHFAADDR
VRPGDLVTTVITGAAPHHLIADAGVLSHRRTRAGDAHAAGRRPRGVGLGM
PAVGPPAGPAQPVGCAS
41408943NP_961779.1 hypothetical protein MAP2845c [Mycobacterium avium subsp. paratuberculoMCLMNDDRNHDDSQLGALRTEIEAAERRVAGGIDPGARGFVVSILVFVLL
GSFILPHTGGVRGWDVLFGTHDAGAAAVALPSRVFGWLALVFGVGFSTLA
LVARRWALAWIALAGTAIAGAAGMLAIWSRQTVPAGHPGPGWGLIVAWIT
VLVLIYQWARVVWSRTIVQLAAEEQRRRVAAQQQSTTLLDDLPKPEDPAA
GT
41408942NP_961778.1 hypothetical protein MAP2844 [Mycobacterium avium subsp. paratuberculosMPPRAAGARDTDPRGRCERCSDERMTGDQPRDDSARPAPRPGPRPGPRPV
SAGRPAAHPVVVPPPPSDPHRFGRVDDDGTVWLISAAGERVVGSWQAGDR
EAAFAHFGRRFDDLATEVTLMEERLASGTGDARKIKAHASELAEALPTAT
VLGDIDALAARLASIAEQAEAAVAAERSRREEHRAAQTARKEALAAEAEE
LAANSTQWKAAGDRLRAILDEWKTITGLDRRVDDALWKRYSAAREAFNRR
RGAHFAELDRERSSIRQAKERLCERAEELSGSTDWTATSAEFRKLLAEWK
AAGRAAREVDDALWRRFKQAQDVFFTARNAATAEKDAELRANAAAKEALL
AEAEKLDTGNHDAARAALRAIAEKWDAIGKVPRERSAELERRLRAVEKKV
REAGDAGWSDPQAQARAEQFQARAEQYEQQARKAAAAGRTKEAEEARANA
EQWRQWAQAAVEALSRKP
41408941NP_961777.1 hypothetical protein MAP2843c [Mycobacterium avium subsp. paratuberculoMSKVDVAALIALCAALASAVGDVIRQRSAHEITDKPVGHLELFRMSLRDT
RWWLGGLAAITNYSLQAAALAWGSVVLVTALQVTALLFALPLYARLAHQR
IKPREWAWALILAAALAVVIIVGDPASGKQRAPLHIWVIVALVMVPVLVA
CVVAARRWAGSPFAPVLLAVVAGSSLALFAVLTKGVVEMSEHSLVGVLTS
PEFVPWLLVALTGMIFQQSAFRAGALTASLPTMTVAKPVVAGLLGVLVLD
ETLNAHGPKAFVLVGAVAVVIVATIALARGEAASINRPEPGPGSAPRKAR
DATADVAADDDDTGPFSGRLLVADSSRW
41408940NP_961776.1 hypothetical protein MAP2842c [Mycobacterium avium subsp. paratuberculoMLSVIAIVPSAPVLVPELAGTAADELAELSAATLAAAALLPDRWLIIGTG
AADQELGDDAVGTFAGFGMDVPVRLSPPADGRAETAPAALPLCALLGGWL
RGQVQPQAAARARIYRADHDADTAVRRGRQLRAELDALPEPVGVLVVADG
ANTLTPAAPGGHHPGDAAAQQALDDALAGGDIAALRRLPGQILGRVAFGV
LAGLAEPGPRSAKELYRGAPYGVGYFAGAWQL
41408939NP_961775.1 tRNA delta(2)-isopentenylpyrophosphate transferase [Mycobacterium aviumMTAAVRPLPIIGPTGTGKSQLALDVAERLGPLGAEIVNADAMQLYRGMDI
GTAKLPVDARRGIPHHQLDVLDVTQTATVARYQRAAAADIEAILAAGAVP
IIVGGSMLYIQSLLDDWSFPATDPRVRARWERRLGEVGVGELHAELARRD
PAAAAAILPTDARRTVRALEVIELTGRPFAASAPRIGAPRWDTVIIGLDC
DTTLLDERLARRTDAMFEQGLVAEVTGLLGRGLRDGVTAARALGYAQVIA
ALDAGGGDEQLRQAREQTYAGTRRYVRRQRSWFRRDHRVRWLDAGACSPP
RLADAALEAWRHVS
41408938NP_961774.1 diaminopimelate epimerase [Mycobacterium avium subsp. paratuberculosis MKFAKGHGTENDFVLLCDPPAELRLTGAGVAALCDRRRGLGADGVLRVTA
AAAAAAAGVLDRLPDGVAGDDWYMDYRNADGSVAQMCGNGVRVFAHYLRA
SGLETRDEFVVGSLAGPRPVTVHAADATGADVSVDMGKANTLGGGGEAFE
ATVGGRRFAGLAVDVGNPHLACLDPELSVDELAALDVAAPVSFDAAQFPD
GVNIEVLTAPAAGVVHMRVHERGVGETRSCGTGTVAAVVAALAAAGADTG
TLTVRVPGGDVVVTVTDATSYLRGPSVLVAHGEISEEWWQQAQR
41408937NP_961773.1 hypothetical protein MAP2839c [Mycobacterium avium subsp. paratuberculoMHHLLLPMTHPEFRDDAPAITEPSTGELALEDRSALRRVAGLSTELTDIS
EVEYRQLRLERVVLVGVWTDGTAADSRASMAELAALAETAGSQVLEGLIQ
RRDKPDPSTYIGSGKAAELRDVVLATGADTVICDGELSPAQLTALEKAVK
VKVIDRTALILDIFAQHATSREGKAQVSLAQMEYMLPRLRGWGESMSRQA
GGRAGGSGGGVGLRGPGETKIETDRRRIRERMAKLRREIKDMKQVRDTQR
SRRLHSDVPSIAIVGYTNAGKSSLLNALTGAGVLVQDALFATLEPTTRRA
EWDDGRAFVLTDTVGFVRHLPTQLVEAFRSTLEEVVDADLLVHVVDGSDV
NPLAQIDAVHQVISEVIADHHGDPPPELLAVNKTDAAGDVALAKLRHALP
GAVFVSAATGDGIDGLRRRIAELAVPAEAAVDVVIPYHRGDLVARLHADG
RVQQEEHNAEGTRIKARVPLALAGRLREFAAP
41408936NP_961772.1 FadE20_2 [Mycobacterium avium subsp. paratuberculosis K-10]MLGGSNPSRPEVVHEQRHQIPAHAFRVRTRTVPRVLPGLPRSSRRAVSRR
MGEGEDRRPRGVARGRQAGLPGHGGARGVRRRGQPRFPVQHHHHRGDHPR
PLQRDRLRPAQRHRRALPAGPGHRGAEAALAAEILHRRTDYGDRDDRAGH
RQRPAGHQDPGGQAGRPLRAQRVKDVHHQRINSDLVIVVAQTDPDKGAQG
FSLLVVERGMEGFERGRHLDKIGLDAQDTAELSFTDVHVPAENLLGQEGM
GFIYLMQNLPQERISIAVMAAAAMEQVLEQTLEYTKERKAFGKSIGSFQN
SRFVLAELATEATVVRMMVDEFVRLHLDHKLTAEQAAMAKWYSTEKQVHL
IDRCLQLHGGYGYMREYPVARAYLDARVQTIYGGTTEIMKEIIGRSLGV
41408935NP_961771.1 hypothetical protein MAP2837c [Mycobacterium avium subsp. paratuberculoMEQSNASPATRRIVSGSFPRAIAARSPETQYGRRRKGSHARRLEGLVKVH
RGRMRKLVGSALVSLTTTALAAVLLAPAATASPIGDAEAAIMAAWEKAGG
DTSPLGARKGDVYPVGDGFALDFDGGKMFFTPATGAKFAYGPILDKYESL
GGPAGSDLGFPAINEVPGLAGPDSRVVTFSASDKPVIFWTPEHGAYVVRG
AINSAWDKLGSSGGVLGVPVGDETYNGEVSTQKFSGGQVSWNRQTKQFST
EPPGLADQLKGLQVAIDPTAAINTAWRAAGGPGGPLGAKQGGPTPVGGDG
IVQNFAGGKVFFTPATGANALESDILAKYESLGGPAGSDLGFPTTNETDG
GIGPSSRIATFSAPDKPVIFWTADHGAFVVRGAMRAAWDKLRAPAGKLGA
PVGDQAVDGDVISQQFTGGKISWNRAKNAFSTDPSNLAPLLSGLQISGQN
QPSSSAMPAHPKKFSWHWWWLMAAVPVAVLLVLLIWVLFVWRRRRPGPEA
TGYGVDHGYDAAEGQWGHDDADVATEHFGAPPSGEPPAGSGAAARVSWQR
QAPADGGYGFEEEDPDAVDTDSIPVVSDEMLAEADYPAAEADYTDYTDAV
PEVAEPETADDAAYADADYAEVDYPDVGYREDEYPDLAVPHTPPDADAVT
GGIPAAEADDEYAELAAPQAQPEERPEPQPGPEEVAEAAGGAVAAGVAGT
RPRSGRHAAADEEDASENGLAGPDGRPTIHLPLEDPYQAPEGYPIKASAR
YGLYYTPGSDLYRDTLPELWLSSEEVAQANGFTKAD
41408934NP_961770.1 LexA repressor [Mycobacterium avium subsp. paratuberculosis K-10]MHAVDPSLTERQRTILNVIRSSVTSRGYPPSIREIGDAVGLTSTSSVAHQ
LRTLERKGYLRRDPNRPRAVDVRGVDDDVAAPATEVAGSDALPEPTFVPV
LGRIAAGGPILAEEAVEDVFPLPRELVGDGTLFLLKVVGDSMVEAAICDG
DWVVVRQQHVADNADIVAAMIDGEATVKTFKRAGGQVWLMPHNPAFDPIP
GNDATVLGKVVTVIRKV
41408933NP_961769.1 hypothetical protein MAP2835c [Mycobacterium avium subsp. paratuberculoMTGGTQMTVIHTLAPRPSSLRRPVNGPVQGVRYGRDGLTRPRRPGQVRPA
GAATRYHGTGVAMSVAPHRRRSVTWVTTVGLALAAGAITLWLGLVANVGQ
VLNGDAPSSAAHVPDRLAVVRVDPGESLSDVAHRVAPDAPAAQVADRIRE
LNDLNSPTLVAGQTLIAPVG
41408932NP_961768.1 transcriptional regulator NrdR [Mycobacterium avium subsp. paratuberculMHCPFCRHPDSRVIDSRETDEGQAIRRRRSCPECGRRFTTVETAVLAVVK
RSGVTEPFSREKVISGVRRACQGRQVDDDALNLLAQQVEDTVRAAGSPEV
PSHEVGLAILGPLRDLDEVAYLRFASVYRSFESADDFEREIQALREHRGV
ATPG
41408931NP_961767.1 hypothetical protein MAP2833c [Mycobacterium avium subsp. paratuberculoMPTDLHPDLAALAPLLGTWTGRGSGKYPTIQPFDYLEEVTFSHVGKPFLA
YAQKTRAAADGKPLHAETGYLRVPQPGRLELVLAHPSGITEIEVGSYAVT
GGLIEMRMSTTSIGLTPSAKEVTALARWFRIDGDELSYSVQMGAVGQPLQ
DHLAAVLHRQR
41408930NP_961766.1 hypothetical protein MAP2832 [Mycobacterium avium subsp. paratuberculosMTERKRKNTLRPVREVSAPRLEFRTIHGYRRAYRIAGSGPAILLIHGIGD
NSTTWNTVQAKLAQRFTVIAPDLLGHGQSDKPRADYSVAAYANGMRDLLA
VLDIERVTIVGHSLGGGVAMQFAYQFPHLVERLILVGAGGVTKDVNFVLR
WASLPLGSEAIALLRLPLVLPAVQLMGRVLGTALGSTGLGRDLPNVLRIL
DDLPEPTASTAFSRTLRAVVDWRGQIVTMLDRCYLTEAIPVQIVWGTKDV
VVPVRHAWMAHAAMPGSRLEIFEGSGHFPFHDDPARFIDVVERFIDSTEP
AAYDQEALRRLLRSGGGAQAVTGPAPTRVAVLSAMGSDERSAT
41408929NP_961765.1 hypothetical protein MAP2831 [Mycobacterium avium subsp. paratuberculosMTHRQDAGDQYQPGQAGMYELELPAPQLSTSDGRGPVLVHALEGFSDAGH
AIRLAAKHLKAALDSELVASFAIDELLDYRSRRPLMTFKTDHFTHYDDPE
LSLYALRDSVGTPFLLLAGLEPDLKWERFITAVRLLAERLGVRQTIGLGT
VPMAVPHTRPITMTAHSNNPELIKNFQPWIAEIQVPGSASNLLEYRMAQH
GHEVVGYTVHVPHYLTQTDYPAAAQALLEQVAKTASLELPLTALSEAAEV
IRAKIDEQVEASAEVAQVVAALERQYDAFIDAQENRSLLTRDGDLPSGDE
LGAEFERFLAQQAEKKFDDDDQA
41408928NP_961764.1 hypothetical protein MAP2830c [Mycobacterium avium subsp. paratuberculoMMKAMRVPILMLCSVVGVAASLTSCHRPVEHVSGAPVSAPRVGGPVQRLS
QPEQKAVAGPVEPDRRIGAIFIDGGPLHVCTGSVLHSVAGNLIITAAHCL
AGASLITFVPGFAGDAAPGPADVWKADAVYLDPRWTNGKDPHADYAVARV
SNDSGAAVESRVGLALTLGVTPPPGSRVTVLGYPAGVGGSPIGCQAATSV
TDTGFPALACEGLVDGTSGAPWVSGTTVVGLIGGLERGGCAANMSYSAPF
DAQTAELLARAEAGGPGDPIPNDLQDAC
41408927NP_961763.1 soluble pyridine nucleotide transhydrogenase [Mycobacterium avium subspMSSPQEYDMVVIGSGPGGQKAAIASAKLGKSVAVVERGQMLGGVCVNTGT
IPSKTLREAVLYLTGMSQRELYGASYRVKEKITPADLLARTQHVIGKEID
VVRNQLMRNRIDLLIGHGRFVDPHTIEVEDPSRREKITISGKYVVIATGT
RPARPSGVEFDEDRVLDSDGILDLKSLPTSMVVVGAGVIGIEYASMFAAL
GTKVTVVEKRDDMLDFCDPEVVEALKFHLRDLAVTFRFGEEVTAVDVGSA
GTVTTLASGKQIPAETVMYSAGRQGQTDHLDLHNAELEADNRGRIFVDDN
FQTKVPHIYAVGDVIGFPALAATSMEQGRLAAYHAFGEASDGITELQPIG
IYSIPEVSYVGATEVELTKDAIPYEVGVARYRELARGQIAGDSYGMLKLL
VSTQDLKVLGVHIFGTSATEMVHIGQAVMGCGGTVEYLVDAVFNYPTFSE
AYKVAALDVMNKVRALNQFRR
41408926NP_961762.1 hypothetical protein MAP2828c [Mycobacterium avium subsp. paratuberculoMTTHRQPDFTLSRPGALIAALPAVLGFVPESSLVLVSLEDGRLGSVLRVD
LSDELAHRVDHLAEVTAAARPEAVIAVIVDAAGAPCPSCNEDYRQLCDAL
LEALARNDIELYAAHVVDRVALGGRWHCVDGCGASGLIDDPSASPLAAAA
VLDGRRLYARRADLQAVIAVEDPERSAALTAAVRRQAGRRTAALRANPVR
RTRGDVEKAMAAAARVSSGEALSDTELARLGCALSDPQVRDMLYALAVGE
GADEVESLWAVLARTLPEPWRVEALVLVAFSAYARGDGPLAGVSLVEALR
CEPGHRMAGMLDTALQSGLRPEDIRDLARTGYRLAKQFGVRLPPRRPFGR
RAG
41408925NP_961761.1 IdeR [Mycobacterium avium subsp. paratuberculosis K-10]MTAWAISCGRVTFSWPGMTIVTPAGPVSTVTRALGTTPASLSREIRSMSP
WTCSVSWRTTTATGAPDGNSVSRTRLASSAPDSGPTPRSSSPGIGLPNGE
VVGLFSTLTRRRSTSSLITCSQRHASACTSSQGSRMTSTSSRSASRCLRI
TATASARPLSVSSRWRSPATCSSPSRSIRDTVWLTVGPL
41408924NP_961760.1 RNA polymerase sigma factor SigB [Mycobacterium avium subsp. paratubercMNPMTVQAEREVAMANASTSRFDGDLDAQSPAADLVRVYLNGIGKTALLN
AAGEVELAKRIEAGLYAEHLLETRKRLGENRKRDLEAVVRDGQAARRHLL
EANLRLVVSLAKRYTGRGMPLLDLIQEGNLGLIRAMEKFDYTKGFKFSTY
ATWWIRQAITRGMADQSRTIRLPVHLVEQVNKLARIKREMHQNLGREATD
EELAAESGIPIDKINDLLEHSRDPVSLDMPVGSEEEAPLGDFIEDAEAMS
AENAVIAELLHTDIRSVLATLDEREHQVIRLRFGLDDGQPRTLDQIGKLF
GLSRERVRQIERDVMSKLRNGERADRLRSYAS
41408923NP_961759.1 hypothetical protein MAP2825 [Mycobacterium avium subsp. paratuberculosMWDSGGMKHGSDSGFDGGFDDFDRNKSRPVLITAAAPSYEEQHRARVRKY
LTLMAFRIPALILAAVAYGAWHNGLISLAIVAASIPLPWMAVLIANDRPP
RSPDEPRRFDNARRRTPLFPRAEQAALEPPPAAQARWQPGGWDGIDRDRP
PFH
41408922NP_961758.1 hypothetical protein MAP2824c [Mycobacterium avium subsp. paratuberculoMQTQTIERTETDERVDDGTGSDTPKYFHYVKKDKIAESAVLGNHVVALCG
EVFPVTRAAKPGSPVCPECKQIYDRLKKG
41408921NP_961757.1 hypothetical protein MAP2823 [Mycobacterium avium subsp. paratuberculosMSDQVAKPSRHHIWRITLRTLSKSWDDSIFSESAQAGFWSALSLPPLLLG
LLGTLAYVAPLFGPDMLPSILRQLISTAHSVFSPSVVNEIIEPTVRDIAN
NARGEVVSLGFLISLWAGSSAISAFVDSVVEAHDQTPLRHPVRQRFFALF
LYVVMLVGVVATAPLVVVGPRKVGEHIPLGLSNVLRYGYYPALIVGLTIA
VMILYRVALPEPLPSHRLILGAMLATTVFVTATLGLRFYLRWITSTGYTY
GALSTPIAFLLFAFFGGFAIMLGAELNAAVQEEFPAPKTHAHRLRTWLFS
RSPALERTVQTLASPIANPATQRREVAPAEPRG
41408920NP_961756.1 hypothetical protein MAP2822 [Mycobacterium avium subsp. paratuberculosMTAITAAHRQRPVQMREQHRCGIGWHSRLPKQRRRKPVGVDVQEHQVVAA
AIEPVGGQVHLLRRGQVDEVGVLRIDAAPASGAGPLFRPTQVHQDAGTDG
HDRHPRDPAEPNLTRS
41408919NP_961755.1 hypothetical protein MAP2821 [Mycobacterium avium subsp. paratuberculosMSTSRTVVQSDSAFESDVGYARAVRVGPHVWVAGTTGAGPAGDIAAQARD
ALRRIEIALHQAGAALADVVRNRIYVTDISRWREVGAVHAEVFGAIRPAA
TMVEVSALIAPELLVEIEADAYVATGGKPPSGPGR
41408918NP_961754.1 RNA polymerase sigma factor [Mycobacterium avium subsp. paratuberculosiMAATKASPATDGPVKRTATKSPSSPAKRPAAKAANGSAPAKRATKTASRS
AKSEAGAAAEPAKKTRSSAKGADAKAPSARGTKAAKGGPADPDALDTDGA
VEDLDTEPDLEGEPGEDLDIDTDLNLDDLEEDVAADDADIEPGDAEEGED
EEAAAPKAAGATVADEDDEIAEPSEKDKASGDFVWDEDESEALRQARRDA
ELTASADSVRAYLKQIGKVALLNAEEEVELAKRIEAGLYATQLMSEMAER
GEKLPAAQRRDMMWICRDGDRAKNHLLEANLRLVVSLAKRYTGRGMAFLD
LIQEGNLGLIRAVEKFDYTKGYKFSTYATWWIRQAITRAMADQARTIRIP
VHMVEVINKLGRIQRELLQDPGREPTPEELAKEMDITPEKVLEIQQYARE
PISLDQTIGDEGDSQLGDFIEDSEAVVAVDAVSFTLLQDQLQSVLETLSE
REAGVVRLRFGLTDGQPRTLDEIGQVYGVTRERIRQIESKTMSKLRHPSR
SQVLRDYLD
41408917NP_961753.1 PpgK [Mycobacterium avium subsp. paratuberculosis K-10]MTSTDSTAHTPAAPAAGPPPRRGFGVDVGGSGIKGGIVDMDTGLLIGERV
KLLTPQPATPSAVAKTIAAVVDAFEWTGPLGVTYPGVVTHGVVQTAANVD
KAWIGTNARDIISAELNGQEVTVLNDADAAGLAEEHYGAGRNQSGLVVLL
TFGTGIGSAVIHNGTLIPNTELGHLEVGGKEAEQRAASSVKERHGWSYEK
WAKQVTRVLVSIENALWPDLFIAGGGISRKADKWLPLLENRTPVVAAALL
NTAGIVGAAMAATSDVTH
41408916NP_961752.1 hypothetical protein MAP2818c [Mycobacterium avium subsp. paratuberculoMMPSDDELVRLRSVAETLAAEAAAFVRRRRAEVFGTEPGGASAPDGGAVR
SKSTPTDPVTVVDTETERLLRDRLAQLRPGEPILGEEGGGPAEPSPPGDG
TVTWVLDPIDGTVNFVYGIPAYAVSVGAQVDGESVAGAVADVVGDRVYSA
AAGLGAHVSDGAGRQPLQCAAVDDVSMALLGTGFGYARQRRAAQAALLAR
MLPVVRDVRRIGSAALDLCMVAAGRLDAYYEHGLKVWDRAAGALIAAEAG
ARVVLPAPDGDGAGLVLAAAPGIADELLAVLERFDGLDPILD
41408915NP_961751.1 hypothetical protein MAP2817 [Mycobacterium avium subsp. paratuberculosMVTQITEGTAFDKHGRPFRRRNPRPAIVVVSLLAVATAVIWTVALTRPAK
VHEAAVCNPPPKSTGPAGSTASAPAQLGEQVSRSAMMDVTPAKLADTKVR
VLNASGRGGQAGDVAGAMKDLGFAQPTAANDPLYAGTRLTCQGQIRFGTA
GQATAAAVWLVAPCTELFNDNRADDSVDLALGTDFTALAHNDDIDAVLAT
LRPGATEPSDPTLLAKIHASSC
41408914NP_961750.1 hypothetical protein MAP2816c [Mycobacterium avium subsp. paratuberculoMPTDYDAPRRTETDDVSEDSLEELKARRNEAASSVVDVDESESAESFELP
GADLSGEELSVRVIPKQADEFTCSSCFLVQHRSRLASEKNGVMICTDCAA
41408913NP_961749.1 hypothetical protein MAP2815 [Mycobacterium avium subsp. paratuberculosMSDTRVAPHNVRYRERLWVPWWWWPPAFALAGIIAFEFNMGVTRQSSWWP
YAALFAVAAAALLWLGRIEVRVTADPAAPGEVELWAGPAHLPVTAIARSA
PVAPSAKSAALGRQLDPAAYVLHRAWVGPMILVVLDDPDDPTPYWLVSCR
HPERVLSALRG
41408912NP_961748.1 deoxyuridine 5'-triphosphate nucleotidohydrolase [Mycobacterium avium sMSTSLAIVRLDPGLPLPSRAHEGDAGVDLYSAEDVRLEPGRRALVRTGVA
VAIPFGMVGLVHPRSGLAARVGLSIVNSPGTIDAGYRGEIKVALINLDPA
EPIVVHRGDRIAQLLVQRVELVELVEVSSFDEAGLAGTSRGDGGHGSSGG
HASL
41408911NP_961747.1 hypothetical protein MAP2813c [Mycobacterium avium subsp. paratuberculoMAVFGRRARRGDEDTPVGAEIPEPDPVVAHDDADEQAADELEGPFDIDDF
DDPAVAELARLDLGSVLIPMPEAGQLQVELTETGVPSAVWVVTANGRFTI
AAYAAPKTGGLWREVAAELAESLRNDSAKVSIQDGPWGREVVGTAAGVVR
FIGVDGYRWMIRCVVNGTHETMEALEQEARAALADTVVRRGDTPLPVRTP
LPVQLPEPMAQQLREAAAAQQAAAQQAQSQQSPGNEPAARRSADGSAMQQ
LRTTTGG
41408910NP_961746.1 hypothetical protein MAP2812 [Mycobacterium avium subsp. paratuberculosMVVDLRGVRAVLLPGTGSDDDYIHRAFSGPLAGVGAVLVAPPPRPDRLVA
GYLEALNDAARRGPIAVGGVSIGAAVAAAWALAHPDRAVAVLAALPAWAG
APEEAPAALAARYSAARLRADGLAATTIQMRASSPAWLADELTRSWGAQW
PHLPDAMEEAAGYVAPSRDELAGLTAPLAVAAALDDPIHPLQAGRDWVAA
APRAALRTVTLDQIGADPAALGAACLAALAEL
41408909NP_961745.1 hypothetical protein MAP2811c [Mycobacterium avium subsp. paratuberculoMARGNQEVYGVRWHKWKRRGLSALSGVAMGAQGYLRRLTRRLTEDPEQRD
SEELSDEVASTGAQRAIDCERGQEVTMVGTLRSVECNGRACAGGVRAELF
DGSDTVTLVWLGQRRIPGIDSGRTLRVRGRLGKLENGTKAIYNPHYEIQR
41408908NP_961744.1 hypothetical protein MAP2810c [Mycobacterium avium subsp. paratuberculoMTANRINPERLLAQAGGVSGVIYSSLPVVVFVIASSVSGLVAAIAAALGV
AALVLLWRLVRRDSPQPAISGFFGVALCALIAYVVGESKGYFLLGIWMSL
LWAVVVAASVLIRRPLVGYAWSWAGGRGDGWRSVPRAVYAFDVASLCWVL
VFAARFVVQGLLYDADRTGWLAAARIGMGWPLTVLAALPTYAAIKSAQRA
IAAVELASGAAGE
41408907NP_961743.1 TrkB [Mycobacterium avium subsp. paratuberculosis K-10]MKVAVAGAGAVGRSVTRELLANGHDVTLIERNPDHVDVDAIPAAHWRLGD
ACELSLLESVQLQEFDVVVAATGDDKANVVLSLLAKTEFAVPRVVARVND
PRNEWLFTDAWGVDVAVSTPRMLASLIEEAVAVGDLVRLMEFRKGQANLV
EITLPDDTPWGGKPVRRLQLPRDAALVTILRGPRVIVPEEDEPLEGGDEL
LFVAVAEAEEELQKLLLG
41408906NP_961742.1 hypothetical protein MAP2808 [Mycobacterium avium subsp. paratuberculosMRVVVMGCGRVGSSVADGLSRIGHDVAVIDRDSTAFNRLSPEYAGERVLG
QGFDRDVLLRAGIEEADAFAAVSSGDNSNIISARLARETFGVKRVVARIY
DAKRAEVYERLGIPTIATVPWTTDRLLNALLRETQTAKWRDPTGTVAVSE
VVLHEDWIGHRVTDLEQATGARVAFLIRFGSGVLPEPKSVIQAGDQVYVA
AISGRAAEAAAIAALPPSEDL
41408905NP_961741.1 hypothetical protein MAP2807c [Mycobacterium avium subsp. paratuberculoMSKLSTATRRLLIGRPFRSDRLSHTLLPKRIALPVFASDALSSVAYAPEE
VFLMLSVAGVSAYALTPWIGLAVAAVMLVVVASYRQNVHAYPSGGGDYEV
VTTNLGETAGLVVASALMVDYVLTVAVSTASAMANIGSAVPIVAEHKVFF
CVAAILLVMALNLRGVRESGVAFAIPTYAFIIGVLTMIGWGLFRIFVLGN
PLRAESAGFEMHAQHGQIVGFALAFLVARSFSSGCAALTGVEAISNGVPA
FQKPKSRNAATTLLMLGGIAVTLLMGIIVLAEKIGVKLVEDPATQLSGTP
PGYYQKTLVTQLAQAVFGGFHIGFLLIATVTALILVLAANTAFNGFPVLG
SILAQHSYLPRQLHTRGDRLAFSNGILFLSGAALLAIIAFRGEVTALIQL
YIVGVFISFTLSQIGMVRHWTRLLRTETDPAARRKMMRSRAVNTVGLLST
GAVLLVVLVTKFAAGAWIALFAMSLLFGIMKMINRHYNTVNRELAEQAAD
QDDVVLPSRNHAVVLVSKLHLPTLRALAYARATRPDVLEAVTVSVDDAET
RDLVHKWEEADISVPLKVIASPYREITRPVLEYVKRAREESPRTVVTVFI
PEYVVGHWWEQVLHNQSALRLKGRLLFTPGVMVTSVPWQLSSSERRKTLE
PHMAPGDARRGIFD
41408904NP_961740.1 hypothetical protein MAP2806c [Mycobacterium avium subsp. paratuberculoMTRPGPPPVGELTLTTGSPANGGSCVAHHEGRVVFVRYALPGERVRVRVT
ADRGSYWHAEVLDVIEAADGRIESLCPIAGVDGAGCCDLAFVRPEAARAL
KAAVVANQLERLGGHRWAGEAEPLGNTGPTGWRTRVRLDVGADRRPGFHR
YHSEELVTDLRCAQLPPGMLDGIAETQWPSAAQLHVAVDDDGARHVVRTL
RQGRRTATKVIEGRYEAVQRVSGRSWRVPVTAFWQAHRDAAATYRALVLD
WAQPGAGMTAWDLYGGAGVFAAALGEAVCASGRVLSVDTSRASTRAARAA
LADLPQVQVVTDSVRRALAAQRTPALQADVAVLDPPRAGAGREVIDSLAA
AGPASSTSVVR
41408903NP_961739.1 hypothetical protein MAP2805 [Mycobacterium avium subsp. paratuberculosMSVIAIAVFVVAYALIASDRVNKTFVALAGAAVVITLPMIRSDDVFYSRE
TGIDWDVIFLLLGMMIIVSVLRQTGVFEYVAIWSAKRARGSPLRVMILLV
LVTALASALLDNVTTVLLIAPVTLLVCDRLAITAAPFLMAEVFASNVGGA
ATLVGDPPNIIIASRGGLSFNDFLVHLAPIVVIVVGVLIALLPRLFPGAF
TVDPERVADVMSLEEKEAIRDPRLLVTCGVVLLAVFAAFIAHGPLHLEPS
LVALLGAGILVVASRLQPADYLSGVEWDTLLFFAGLFVMVGALVKTGVVK
HLARLAITATGGNTLTATMVILVASVVISGIVDNVPYAATMAPVVADLVP
ALGDHANPAVLWWSLALGTDFGGNLTAIGASANIVLLGIARRADNPISFW
EFTRKGVVVTAVSVALSALYLWLRYFVWG
41408902NP_961738.1 hypothetical protein MAP2804 [Mycobacterium avium subsp. paratuberculosMINVAGARRIVLGMRAAELAEDFPVVSVDSDALDATRLLAEHRLPGIVVT
DASGKPFAVLPASQVVRFIVPRYVQDDPSLAGVLNESVADRCAEKLRGKT
VRDVLPDHLVDVPPADADDTIIEVAALMARLRSPLVAVVKDGRLIGVITA
SRVLGAALRP
41408901NP_961737.1 1-deoxy-D-xylulose-5-phosphate synthase [Mycobacterium avium subsp. parMLEQIRGPADLQHLSTHQLRELAAEIREFLIHKVAATGGHLGPNLGVVEL
TLALHRVFDSPHDPIIFDTGHQAYVHKMLTGRAHEFESLRKKGGLSGYPS
RSESEHDWVESSHASAALSYADGLAKAFELSGHRNRHVVAVVGDGALTGG
MCWEALNNIAASGRPVIIVVNDNGRSYAPTIGGVADHLATLRLQPAYEQA
LQRGRDALRALPLVGKFAYRVMHSVKAGIKDSLSPQLLFTDLGLKYVGPV
DGHDERAVEAALRHARGFGRPVIVHVVTRKGMGYAPAEDDEADQMHSCGV
IDPVTGQATKVAGPGWTATFSDALIGYARKRRDIVAITAAMPGPTGLTPF
GQQFPDRLFDVGIAEQHAMTSAAGLAMGGMHPVVAIYSTFLNRAFDQIMM
DVALHRLPVTMVLDRAGITGSDGASHNGMWDLSILGVVPGMRVAAPRDAA
RLREELGEALDVDDGPTALRFPKGDVGEDIPAIERRGSGLSGVDVLALPA
SGCNHDVLLIGVGAFAPMALAVARRLADQGIGVTVVDPRWVLPVSDSILE
LAARHKLVVTCEDNGVNGGVGSAVSAALRRAELDVPCRDVGLPQRFYEHA
SRGELLADLALTDQDIARRITGWVAALGSGVAEAEIREHLD
41408900NP_961736.1 hypothetical protein MAP2802 [Mycobacterium avium subsp. paratuberculosMGEPSAEGPGSGVPAPIPLPHPSEGVPPISASVPDIEDAARRLDRGRGPF
AVDAERASGFRYSNRAYLIQIRRAGAGTVLIDPVSHGADPVRALRPVAEV
LGSDEWILHSADQDLPCLAEVGMRPPALYDTELAGRLAGFERVNLATMVE
RLLGFGLAKGHGAADWSKRPLPAEWLNYAALDVELLIELRAAIADVLAEQ
GKTDWAAQEFDYLREAGSKEPGPAARRDRWRRTSGIHRVRDQRGLAAVRE
LWLTRDRIAQRRDIAPRRILPDSAIIEAALANPTTIEELVALPVFGGRNQ
RRSAATWLAALDAARQSENPPVDSEPPNGPPPPARWSRRKPEAAARLEAA
RAALAEVSERVHVPTENLVAPDLVRRLCWDWEPTPDPFAAVDAFLCAGHA
RPWQRELVDPVLARALQQPLPAVADDDG
41408899NP_961735.1 hypothetical protein MAP2801 [Mycobacterium avium subsp. paratuberculosMTRAVTMQNGRDEQERRQVTSSEPAPFREAVAAMNAVVMRPEIELGPIRP
PQRLAPHSYALGAEVKHPDREIIPERSDGDAFGRLILLYDPEGADAWDGT
IRMVAYIQADLDPSEAVDPLLPEVAWSWLVEALESRMEHVVALGGTVTAT
TSVRYGDISGPPRAHQLELRASWTATSPAVGAHVQAFCEVLEHAAGLPPA
GVTDLSSRSRA
41408898NP_961734.1 enoyl-CoA hydratase [Mycobacterium avium subsp. paratuberculosis K-10]MPVSHPPVDYHDFPSLRCELGDDGVLTVVLDSPGLNSVGPQMHRDLADIW
PVIDRDPAVRAVLVRGEGKAFSSGGSFDLIDETIGDYQGRVRIMREARDL
VHNMINCDTPVVSAIRGPAVGAGLVVALLADISVAGRTAKLIDGHTKLGV
AAGDHAAICWPLLVGMAKAKYYLLTCETLLGEEAERIGLVSLCVDDDDVL
STAAGIAGKLAQGAQHAIQWTKRSLNHWYRMMGPTFETSVGLEFLSFSGP
DVQEGLAAHREKRAARFTGGSAT
41408897NP_961733.1 uroporphyrinogen decarboxylase [Mycobacterium avium subsp. paratuberculMNSSARTRRDLPESPYLAAVNGRKPHRVPVWFMRQAGRSLPEYRALRAQH
DMLSACFDAELVCEITLQPVRRHDVDAAILFSDIVVPLLGAGIDLDIVAG
VGPVIASPVRTAADVAAMKPLERQRVQPIADAVRLLVSALVEVPLIGFAG
APFTLASYLIEGGPSRHHARTKAMMLADPDSWHALMEKLTDITVGFLRVQ
LDAGVDAVQVFDSWAGALSLANYRSYVQPHSARVFAALADYGVPMTHFGV
GTAELLGAMSAALKPAPATVVGVDWRTALADAATRVMPGTALQGNLDPVV
LLAGWPVVETAARAVVDDGRRAVDAGAAGHVFNLGHGVLPETDPGVLTEL
VSLVHSL
41408896NP_961732.1 protoporphyrinogen oxidase [Mycobacterium avium subsp. paratuberculosisMTARSYCVVGGGISGLTAAYRLRVAAGDDAVITLLDPAPQLGGILRTEPV
GGVPMDLGAEAFVLRRPELPALLSEVNLTGRQRVSTGARPLIYSRGRLHP
LPTGTVVGIPSSAASMARLVDEATLARIDAEPRRPLHWRPGSDPAVADLV
GDRFGEQVVSRSVDPLLSGVYAGSAATIGLRAAAPTVAAALDRGAASLTD
AVRRALPPATGAPVFGALDGGYRVLVDELVARARPRRVRAAAARLEPAGP
GWAVVDDAGARRHADAVILAVPAREVARLLAGIAPRSAAAAGRVVAASSV
VLALAVPGDTAFPDCSGVLVATGERLRAKAITLSSKKWGTRADVQLLRLS
FGRFGDQVAARTPDEELRGWALADLAAVFGLDVRPVDVRVQRWLDAMPQY
GPGHAELVGELRAGLPPTLAVAGGYLDGIGVPACVGAAGRAVEALQAEVA
P
41408895NP_961731.1 hypothetical protein MAP2797c [Mycobacterium avium subsp. paratuberculoMAKLDYDALNSAIRYLMFSVFAVRPGALGDQRDEVVDDASRFFKQQEERG
VVVRGLYDVAGMRADADFMIWTHAETVEALQATYADFRRTTALGRVCSPV
WSSVALHRPAEFNKSHIPAFLAGEEPGAYICVYPFVRSYEWYLLPDEERR
RMLAEHGMAAREYKDVRANTVPAFALGDYEWILAFEAPELHRIVDLMREL
RATDARRHTRAETPFFTGPRVPVEQLVNSLP
41408894NP_961730.1 hypothetical protein MAP2796c [Mycobacterium avium subsp. paratuberculoMTASFDPADPARFEEMYRDQRTSHGLPAATPWDIGGPQPVVRQLVALGAV
KGEVLDPGTGPGHHAIYYASQGFSATGIDGSAAAIERARANARKAGVSVN
FELADATKLDGFDGRFDTVVDCAFYHVFATEPELRSSYARALHRATKPGA
RLYMFEFGEHDVNGFKMMRSLSENDFRDVLPAAGWEISYLGPTTYQVNLS
AETIQMMAARNPDMADEAAKLLERFRAMEPWLQGGRVHAPFWEVHATRVD
41408893NP_961729.1 hypothetical protein MAP2795 [Mycobacterium avium subsp. paratuberculosMDDAFVGSDAVRRGTLSRHRLRAQFRAIYPDIYLPAHAARSLRTRSVAAW
LWSGRRGVLAGLAAAALHGSSWIDDDEPIELIWRNPHPPAGVITRNQRLE
PDEITRVAGLPVTTPARTAFDLARQRPRGEAVARLDALMRATPFSTAEVL
MLAERRPRARGLRKLRAALPLVDPGAASPKETWLRLLLIDAGIPVPATQI
PVQQNWRLIAVLDMGWEDYLVAAEYDGDHHRTNRRQYARDQARLRTLQKL
GWIVVRVIAEDKPDDVVRRTRDALTRRGYRDT
41408892NP_961728.1 hypothetical protein MAP2794 [Mycobacterium avium subsp. paratuberculosMTSPKVQLTDDEWRQRLTPEEFHVLRQAGTERPFTGEYTDTKTEGVYQCR
ACGAELFRSTEKFESHCGWPSFYDPANSDAVILRPDHSLGTTRTEVLCAN
CHSHLGHVFTGEGYPTPTDQRYCINSICLRLAPS
41408891NP_961727.1 hypothetical protein MAP2793 [Mycobacterium avium subsp. paratuberculosMYGALVTAAESTGLRDWIQAAFRPRTSAPSVATVLRSALWPIAIFSVLHR
SIVVTTNGNITDDFKPVYRAVLNFRRGWDIYNEHFDYVDPHYLYPPGGTL
LMAPFGYLPEYPSRYLFILINTVAILIAWYLLLRLFGYTLSSVAAPALLL
AMFCTETVTNTLVFTNINGCVLLAEMLFLRWLLDGRVGRQWWAGVAIGLT
LTLKPVLGPLLLLPLLNRQWRALVPAFAIPILINAAAWPLVSDPMDFVTR
TLPYIGGVRDYFNSSIEGNGVYFGLPTWLIVFMRILFTLIAIGALWLLYR
YYRTRDPRFWFTNSAGVLLLWSWLVLPLAQGYYSMMLFPFLMTVVLPNSL
IRNWPAWLGIYGFMTLDRWLLFNWMRYGRALEYLKITYGWSLLLIVVFSV
LCYRYLDAKAEDRLDRGIDPAWLTAGRE
41408890NP_961726.1 hypothetical protein MAP2792 [Mycobacterium avium subsp. paratuberculosMLATVVGMSRPHPCATILVAVTALLAGCVPGLAADPRFATNSGARPQGAA
TSKPAPGGPPPLAAPKNDLAWHDCTSRVFADAAVPPAPGIQLDCANYDAD
LDPVNGGGGALSIGVVRARSNQTPRDAGPLVFTTGSDLPSSAQLPVWLSR
AGADVLAAHPIVAVDRRGIGMSSPIDCRDKFDRQQMRDQSQFQAGDDPVA
NLSEVANTATTNCTDAIAPGASAYDDAHAASDIERLRSTWDVPALALIGI
GNGAQVALAYAGSRPDKVARLILDSPVALGVNAEAAAEQQVKGQQAALDA
FAAQCIAVNCALGPDPKGAVSALLADARAGKGPGGVSVAQVANAITVALG
FPSGGRVNATTDLANALASARSGDTNALNNLINHANAMQDSDGQFVNVCS
DAVNRPTPDRVRELVVAWGKLYPQFGTVAALNMVKCVHWPTGSPPPSPKS
LKVDVLLLGVQNDPIVGTDGVAATAAGIINANAASKRVMWQGIGHGASIY
SGCAVPPLIGYLGSGKLPNTDTYCPA
41408889NP_961725.1 hypothetical protein MAP2791 [Mycobacterium avium subsp. paratuberculosMALPETPLSLLGSVREVDDGELPGLYDYPDGHAGTWVRANFIASVDGGAT
ADGSSGAMGGPGDRFVFNLLRELADVIVVGAGTVRIEGYSGAQLGVAQRQ
QRQARGQSEVPPLGIVTKSGHLNRDMAVFTRTEVPPLVLTCAAAADQTRR
LLSGLCEVLDCSAGDPERVDEATMLALLGKRGMRRILTEGGPTLLNSLLE
RQLLDELCLTIAPYLVGGHARRIATGPGQLLTRMRCAHVLTDDAGYLYTR
YVRC
41408888NP_961724.1 hypothetical protein MAP2790c [Mycobacterium avium subsp. paratuberculoMHGSGSASASAGVAHLVDRHPTVSPQRLIAQLRPPPTFADVSFATYQPDP
AEPTQATAVAACREFCRQAVQRRAGRRKLLGRREILPGVGLYLDGGFGVG
KTHLLASAYYELPGDGPVRSPDGPAPKAFATFGELTQLAGVFGFAECVDL
LADYTAVCIDEFELDDPGNTTLVARLLSSLVERGVSVAATSNTLPEQLGE
GRFAAQDFLREINTLASIFTTVRIEGPDYRHRDLAPAPPPLSDAQVAARA
AVVPGATLDDFDALCAHLATMHPSRYLTLIEGVTAVFLTGVHRIDDQNVA
LRLVSLTDRLYDAGVPVLASGEKLDTIFSAEMLSGGYRKKYLRAMSRLLA
LTAGANEAYGS
41408887NP_961723.1 hypothetical protein MAP2789 [Mycobacterium avium subsp. paratuberculosMTPAPATHAVRIITTESVDVQQLADLAARTFPLACPTSAAREDIAAFIDA
NLSAECFARYLADPHRAILAAELDGRIVGYAMLIHDLAGDAAELSKIYVA
PEQHGAGTAAALMRLAVDTAGRWGVSRVWLGVNQKNQRAQRFYAKHGFTV
SGTRTFQLGAGREDDYLMSRTLR
41408886NP_961722.1 hypothetical protein MAP2788 [Mycobacterium avium subsp. paratuberculosMRRWLRVVSAFLIGFPVAAAGVGAVPLPRAWAGDAPIGHIGDTLRVDNGT
FIADVTVSSVAPCDPPPGFGYTREGTYKGFPGSTVDRADVTIRAIRVPNP
YILATVFSFNGVTPNADAYKPRASDAPDALDNVLVNAPNGAIVRGGVYWD
AYRDPVSNVVLLDKKTGYHLAQWNL
41408885NP_961721.1 ClpX' [Mycobacterium avium subsp. paratuberculosis K-10]MSEPIRIVHPVRLDELIDAIKTTHPDVLDQLADAVLAAEHLGEVADHLIG
HFVDQARRSGASWTDIGKSMGVSKQAAQKRFVPREATILDPGQGFQRFTP
RARGAVVAAQNAAHQAGNREITPDHLLIGVLSDPAALATVLLRLQHVDTD
ALRDAATAAIAALRADGDPPALIPFSGPARKVLELTVREALRLGHNYVGT
EHQLLALLELEDGDGPLHRGGVDKERVEVDLIRALESLGNGKNVGAGEDG
41408884NP_961720.1 hypothetical protein MAP2786c [Mycobacterium avium subsp. paratuberculoMKLFLIVAGFAAVIGLAVPARADSTDDAFVASLDKAGIKYGDADKAAGAG
KWVCTTLQGGKQMSDVVSTLQSKNSNLSDDHANTFAAIAVNAYCPDQASS
ITPATPTDTPPSTS
41408883NP_961719.1 hypothetical protein MAP2785c [Mycobacterium avium subsp. paratuberculoMHPAGNCRKRCESFAVRRRRQFPRQALPRAGARRDADRRRVWDNRCAMRL
FLGLCALAATIGLAAPAHADIDNDQDFLKDLRDAGITYQDAGNAITIGKS
VCELLDDGQSDAKIVTDLRNQNPAFQGASAAKFTYLSAAHYCPKYITGED
RGPKPEGAVGN
41408882NP_961718.1 hypothetical protein MAP2784 [Mycobacterium avium subsp. paratuberculosMHVINGVRDPAASFPLDTATDDAGERRQANRAVAVSAAGLALTGLVELVI
AVVSGSVALLGDALHNLSDVSTSALVFVGFRASRKLPTERYPYGYERAED
LAGIGVALVIWGSAVVAGFESVTKLLRHGGTGHVGWGIAAAVVGVVGNQL
VARYKLVVGRRIRSATMVADAKHSWLDALSSAGAVLGLIGVALGWGWADA
VAGIVVTGFICHVGWEVTADIAHRLLDGVDPDIVTTAEAVAVSVPGVTHA
HARARWTGRTLRVEVEGFLDAATSLSDSDRIGRSVAAPWPRGCRRCRASP
GRHARPENPSRPAGFEVSPGRSARAAAGRSPTTGPTRRRRRHRVTRPRRV
RRRPRRRAPARRGTWPASAAARTATRPDPRGSTAHRRRWFGPAAGRGPRP
GAAQRNTTHRSAIPAR
41408881NP_961717.1 hypothetical protein MAP2783 [Mycobacterium avium subsp. paratuberculosMAADPPLPADALHDGNPPAEPHGDGDRFPRGLRPRRVAAAAGGVHGGAEN
LPPLARRAVRLRAGQVGAPGGGGGLAPGPKHVGALAIPRGAVR
41408880NP_961716.1 hypothetical protein MAP2782 [Mycobacterium avium subsp. paratuberculosMTATASSPPRTGALLIGTERITAASGGSHQHRYPGTGVPNATIPLAGHSE
VDRAVHSAREAQREWISYPVDRRRDLLFGLADLLRDHFAELTELNVHDYG
VPISVAGNSVLTERFVRYYAGYPDKLTGASTPVSGAFDVNIVEREPYGVV
AVIAPWNGPLVVAGAAVAPALAAGNAVIFKPSELASLAPLRFGELCLEAG
LPPGLVNVLPAGPEGGEALVRHPGVGKVHFTGGHATAQQVLRAASDNVTP
VTAELGGKSAYLVFADADLDTAAVIAAHQGPLTQAGQSCACASRILVEAS
VYVSFVEKLVAQVQAATIGDPLRPDVMLGPVITEAAADRILGVIDRAVAE
KAGDLVTGGRRLGGELASGYFIEPTIFSNVDNRSSLAQTETFGPVASVMP
FADEAQAVSLANDSRYGLNAFVATANLERAHRVARRLQAGSVWVNRHSDI
EPQGPYGGYKQSGFGRTGGVEGLHEFLQVKNIRIGMS
41408879NP_961715.1 hypothetical protein MAP2781 [Mycobacterium avium subsp. paratuberculosMRTFAEVMTFDPPDDASPCASGLIDFVFGEVWSRPGLSRRDRRFVTLACV
AAADAQAPLEQHVYAALNSGDLSITEMREAVLHFAVYAGWPKASRFNIVV
DQQWARIAAERGEPAPDPEPLLPLVTAADPEQRLRGGERSFKDINCLPFA
PPRDNPYSGAGILNFVFGEMWLRPGLGMKERRLITVACVAFQDAEIPIMS
HVYAALKSGDVSFREMDEVALQFAAYYGCAKADHLNQAIAEQKQRVIAEN
HSDATPVG
41408878NP_961714.1 hypothetical protein MAP2780 [Mycobacterium avium subsp. paratuberculosMATDGATGRVAGKRVLITGAARGMGRSHAVRLAEQGADCILVDICCTPTG
LDYPLATEEDLNETVRLVEKHGSRAVPKIVDVRDEAAMKAAVDAAVDELG
GLDGAVANAGVLTVGTWDTTTAEQWRLVLDVNLIGAWNTCAAALPHLIGG
GGGSLVNISSSAGIKGTPLHLPYTASKHGIVGMTLALANELAAQNIRVNT
VHPTGVATGMAPPGMHALIAEQRPDLVPIFLNALPAPLIEASDVSNAVLY
LISDESRYVTGLELKVDAGVTIR
41408877NP_961713.1 short chain dehydrogenase [Mycobacterium avium subsp. paratuberculosis MGSLDGKVAFITGVARGQGRSHAVRLAREGANIIGIDICADIAANGYPMA
CRAELDQTVALVEEAGGKMLGTVADVRDFGQVKAALDAGVEQFGRLDIVL
ANAGIAPLAFRQLSIEEELAQWRAVTGVNLDGAYHTAWAAIPHLLAGNRG
GVIIFTSSTAGIKGFGGLQGGGLGYAASKHGIVGLMRTLADALAPLNIRV
NTVHPTAVNTMMATNDDMIEFLQKNPGAGPHLQNPMPVGMLEPEDVSAAI
AYLVSDEARYVTGVTFPVDAGFCNKV
41408876NP_961712.1 hypothetical protein MAP2778c [Mycobacterium avium subsp. paratuberculoMVTVTAKGPGAPIVSGDPILGIVVDMLDTGGYEAVQLREVARRARVSMAT
IYKRYRTRDELIVAALEGWMDANRYARLPSLIDELPGESMYSDLMHVMRT
IFEPWERHPLMLRSYFQARSGPGGKRLIRRGVEAVVPVAKSVLAQADPGF
VNDLELILTGVVFGFLTRFAQGEIEVTEIVPGIERTVYWLTQAYQNADAG
RQPHISGGGISQPSEGSTSSLYCGQ
41408875NP_961711.1 hypothetical protein MAP2777c [Mycobacterium avium subsp. paratuberculoMLRRQRGLLGQPQRQHRHVGVGVDARAHAVAHGDRVVVVEHGDPALGQAG
EERVIGFVRGGRCRAQQRGGGQDDRAGGRPRGTTGLGVSHGLPWVRWAES
RRLIETIDEFWVTSPRRTPARGHDEQCVALIRPFGAPSLARASESALAAS
GPEPPRNRPEPRSKATDAAVAGARDHFAGVAGFGGAVRKGELVRLVLTVR
GRPAGGASAAHRHRQGDEVVVGPGGLGRPQRRGRASDRDDDDGDE
41408874NP_961710.1 hypothetical protein MAP2776c [Mycobacterium avium subsp. paratuberculoMDRYIVISTDTHAGADLYGYKPYLPARLHDEFDAWAKAYASPFDDLIVAT
ANRNWDHELRIGEMDADGVAAEVLLPNTVPPFFPTTPNITISLPRTRAEF
EKRWAGVQAHNRWQVDFCSLAPDRRRGLIQIFPNDVELAMEEIRWGARQD
CFGGVLIPPVSPGDSQVAPLFHTHYEPLWALCAELDLTVVQHAGAGSPEM
PMDQPASNAVLITEMALWAQRTLGHLILAGVFERYPTLRFVPTEQGTLWV
PAQLGVLDAMVPTMKSDAHNRTYGMFGGSSVDALTLTPSEYVQRNCYLAS
ELMPYDGAMIDFMGPDHIMWGSDYPHEEGFAPHSKLAIRWALHDRPEDAC
RKILGGNAARLYRFDLDKLIPVAAKIGPTVEEVRTPVPDTGYRAPAAFGY
RPFEGGLALKRLAPQRG
41408873NP_961709.1 hypothetical protein MAP2775 [Mycobacterium avium subsp. paratuberculosMAARPSPQTERVVNLFELLAADGSAGITLAEVSRRLHVHKASCHSMLSEL
LRAGWLLRDPVRKTYHLGPALVRLGREAAARYPAPVLARSVMDELAAATG
AHCVAFSVSEDYSTVVDQVRSRRGGGHPMPIGTQFPHRPPYGASTVAWAG
TEDRERWLAALPDEVRDRYREAIAAARQRGYAVGLHLLPDLRLQELALLV
RSAEVRSTRLSQLAQALTDELIHQEEWFPISLAPDRSYEVSHIDSPILGP
GPSIALMLSLVPSAEPMSGAAVTRLGTQLAAATRRLSEALADESG
41408872NP_961708.1 hypothetical protein MAP2774c [Mycobacterium avium subsp. paratuberculoMWCSVRPCDDGHTMTDLQGKVAVITGGAGGIGRALGRRLGHEGMKVVLAD
VLADPLQEATRALADEGIEAAGVVTDVTDYSSVEALAKEALRRFGAVDVV
CNNAGTGAVSEGYLWEHDLADWRWGIDVNVLGVIHGLKAFVPILLERGEG
HVVNTCSGNGGFAPIARGAMGGPATAVYPMTKAAVLCLTESLYTHLEMTG
TRVRAHVLFPGGFLNTGIWESWRHRPPRYAPTQQRRTPEQTLDKVVARFE
AAGARVEFTPLETVADLVVDGIAADRFWMMGPPAPSDDVVRRKAASILSR
GAPDYLVDILGRSAGGNSENQGENQ
41408871NP_961707.1 hypothetical protein MAP2773c [Mycobacterium avium subsp. paratuberculoMSSNVIRYGPRPPEAQVDHEIDATKAPIATEAVTVIYLTEPDIVAAVLPK
PLQPADEPLVRIQLQRVRIEGMAPFGSAVFSVTARHGDRYGDYPLFMPQS
TEQSVTGGRETFGEPKKLAQITVERDGDRVTAGVDRLGYRLIRLSGQVSG
RAELPPDQMNTEFYFKFLRAPDGSGITDPHLVYGEYHRHYELLENIDGTL
ELGESPLDPVADIVIRQVTSITWCRRRTVQVGRIAARVPQEWLLPYVHQR
YDDVALLAAPRPEPARA
41408870NP_961706.1 hypothetical protein MAP2772c [Mycobacterium avium subsp. paratuberculoMDRYTVISADCHAGADLLDYRDYLDPQYRDEFDGWAKTYVNPFGDLSEPD
AERNWNSARRNCELDTEGIAGEVIYPNTVPPFFPHASLAAPPPETARELE
LRWAGLRAHNRWLADFCSLSPERRAGVGQILLGDLDEAVAEVGQIAKLGL
RGGVLLPGIAPGTGIPPLYAEHWEPLWAACAEAGVVVNHHGGNAGPSPTD
GWGSSFAVWVYETHWWAHRALWHLIFSGALDRHPDLTVVFTEQGAGWIPA
TLASLDVAAARYARANSAIARFAGPTAGSLSLKPSQYWARQCYVGASFMR
PVECAERHGIGVEKVMWGSDYPHYEGTAPYTREALRHTFSDVPPDEVAAM
VGGNAARVYGFDLDALAPLVDRIGPSVAEVAEPLAAVPADASSTVFEPDP
IRTW
41408869NP_961705.1 hypothetical protein MAP2771c [Mycobacterium avium subsp. paratuberculoMTDVDPYIIISADTHAELPTERYREYVDPEYREDFETYLAEKTAAAQAGG
FIDEEFAQEWFSEHGEGIAGGWDVALRDKELDGDGVVGEVIFPDADAVTG
VAGAPFGAGLGQSGDLDPGRAMAGARAHNRWLAELCSHSPERRAGVAVVP
ILADVDAAVAEITRAAESGLRGGILIPARWVGYPPYHDRRYDKVWAACQD
LQMPVHTHSGPAPQEEYGGHLGIYVTEVRWWGARPLWFALWSGVFERFPG
LRWGVTECGAFWANDLLWLMDTRYLREHSAKKMSHLMEGDLTMPPSAYFD
RNCFIGATTTERRELARRYEIGVSNILWGNDFPHPEGTWPHTRDWLRRSF
WDIPVEETRQMLGLAAAELYNFDLGALAPLAARIGPVPADLGQDDAVSIP
KWEAARRTGRHWLTDAEPMPDLVQS
41408868NP_961704.1 hypothetical protein MAP2770 [Mycobacterium avium subsp. paratuberculosMRYLQPVTRPARMSTLAAALALTACLTAPGATADPTPQQSPFPTGKSGTT
IHVTEYSTATADVTLNSATWVSSGCPGGGGCNVIELTIAGKSDKPFTYSQ
ASITAASTPWRQDPYRDTQGGSSLADYQQLNKTPPLRVGSVTNGQTAHGF
IAYDGAIRQGDVYIEFNDPDAPAAPTPLAGWKVHT
41408867NP_961703.1 hypothetical protein MAP2769c [Mycobacterium avium subsp. paratuberculoMNAGKPKFCLLPRWRGLGIATDALYVAIDAGISLRCRSADERSEGHAGRR
RGRGETHAGIMPRSPRLTTTNRRLKYANSTPTCLCAIRRPHRCTRWRATE
PW
41408866NP_961702.1 hypothetical protein MAP2768c [Mycobacterium avium subsp. paratuberculoMARDADAKRDKRAFGNIRKLPSGRFQVRYTGPDGSYITAPKTFAAKIDAE
AWLTDRRREIDRGLWDVASAKQPERVTFGAYAAGWLAGRQVAGRPIKART
REHYQAILDDHLLPAFGSRQLTSITPKDVREWYSGTLTNRPTMRSHAYSL
LRTIMGSAVNDELIDANPCRIVGAGRAKRVHKIRPATVEELPILTEAMPE
RLRLMVALASWCALRFGETIELQRGDIDLADEVIRIRRAAVRTHGGTFEV
TTPKSDAGIRDVAIPPHLVSAIEAHLAKYVGKKRDSLLFPNERGRHLQPS
TLNRHWGTKRGPQPAATICVGTTYGTPAQSWPPPPAPASPNSWPG
41408865NP_961701.1 hypothetical protein MAP2767c [Mycobacterium avium subsp. paratuberculoMADDNLDYLLPEQREWWLTNAAMPPTLVLRCGIGGCGICVGIVKSDKTDP
GVAIALMHHKSGKTTVPHYEPIDDERLAALGLPPATELYDASGITLAEHI
QRRQREVDSLTIRSVDKTRRVSRRHADPSVAMPLEWIGYIVCPDHGTVAL
PDPATTVAAMRGQLIPTTHAKRRTFRIFRGTSV
41408864NP_961700.1 hypothetical protein MAP2766c [Mycobacterium avium subsp. paratuberculoMTQNRNGPPIEVEGRAPHHRDRPSTSKVGSHATAYNRTTELTAPSAETPG
TTNSRQVSWWETHQFIEALITQANTGPLPPAGTPAWSALADGDPRKLLAL
AVAGEHHVLRVETAQTAMAEASQAVSAAADWTRIGRRNRDHEDIHRQRPW
LRRKAPRC
41408863NP_961699.1 hypothetical protein MAP2765c [Mycobacterium avium subsp. paratuberculoMVAAQGSSMLTAADFAAQWADVPPWEPPDEPPQRNGQRQQQASAEPTTWE
AFDLGPYLRGEIERPHPGIGISRSDGQRSLYPGREHAIVGETESGKTWFA
LGCAAAELNAGNDVVYIHYEEPDATSTVEKLCLLGVDPAVIKARFRFVAP
SRPVREEWLNALLDPSPTLVIHDGVNEAMALHGDEIKAVEGAAAFRRRLI
LPCLRVGAATLACDHLPMVRDGSRRDAYGSVHKGNALDGARFVLENSAPF
GRRLRGVSYVFVTKDRPGHLRANGRATKSPGKTFMGTLVVDDSQAFGPDF
TMRFFAPRDDDVPESDPNAELADAVFRVVAAAPDHAVGSMRLLFAELRNV
DIQFRDDDVRDVVDDLVVSGRLVEISGKRGAKGFRAVVEDADGDST
41408862NP_961698.1 hypothetical protein MAP2764c [Mycobacterium avium subsp. paratuberculoMFAVSGRRPLPRMVQRPTRQTPAARRRSGPAPHPTARPTQKATPHPPQPE
RHTMTTDNPTPSDDQALAALYATALGVLLAGLVNDGRLTTEIERIIAAGE
KVTAGVLGFLTAAAANAYEYEHGSREAAIDAVTADLATVLLAAGEGQPS
41408861NP_961697.1 hypothetical protein MAP2763c [Mycobacterium avium subsp. paratuberculoMVRRNAGTTSHVVTPRNSVSKAAKSGDALTALTALRDVLAAAIDECGSKR
DLAALLRQFTAVLAQIEAARVRPPQRRIADEIAARRTARQAAAAADAKSA
DR
41408860NP_961696.1 hypothetical protein MAP2762c [Mycobacterium avium subsp. paratuberculoMSDELRQRYKVIFDAVRVSEIEITPDLARCLVHWLGDYIRLKQQPGQPGV
PEGLVAAQTALAEAYAAVTHSPRSERDRPIGAGFVFSAHDAWVGTAEAAE
MLGIKAGSVGWLCRESHLEHRKVGRQYMISTASIEDYKRRKAERSA
41408859NP_961695.1 hypothetical protein MAP2761c [Mycobacterium avium subsp. paratuberculoMVNVPRAELARLVGVSPDVDDLTLQQAIDSKLAQNEAEKHAHAVSAAEQR
ARADDRRIVIAAYNEGRIPQSRIDFWCEAMQRDRAGNRAILAALAPGLAP
PEKLPTDPQIEHVHAKVLARMGIRPPASAPTSQTVAASSPPPSPGVDDLG
IPIAPLPPPVRIVHGKDPATWSKEERDNALLYGLGPRFAAAAAARGIPRP
PGGSGYYQPTGIEPYEPVDLGGGQIEWRAKPDYRPRGD
41408858NP_961694.1 hypothetical protein MAP2760c [Mycobacterium avium subsp. paratuberculoMAYRMSPRVEMLAVKDQNGIIWHHYQRPVGGARNLGPIIAWIGPDYRDRW
LRMGLIEEIPDDAAAALSQPPPSDAVAGPNTDLVDECIAALDRFDVPADA
GAPTARKALRDRGQAWGNETIAAAVRARKARAAPSGTPAGS
41408857NP_961693.1 hypothetical protein MAP2759 [Mycobacterium avium subsp. paratuberculosMTKTDWVITFTFDVDPPIETMDEWESRLDGFDASVARIPDRGVDLTVYAP
GDLSMFDALNKTINEVAHVVQSGPPIGLEVVTEREHTRRAEAPSMPELMS
AAEIADELGVRRQRVHQLRATSAFPAPLAELRGGAVWDAAAVRKFAQDWQ
RKPGRPRNSAVDSQQRDYALGH
41408856NP_961692.1 hypothetical protein MAP2758 [Mycobacterium avium subsp. paratuberculosMNSDIADIAKWARSQGWTVFDDSKGYTRFYNPQGEYITNYPATPSRPNRR
MADLKVDLKKAGLPIPPPSKKEQRAQRKKGDTK
41408855NP_961691.1 hypothetical protein MAP2757 [Mycobacterium avium subsp. paratuberculosMIAGMPSGIEHLRAMTEEELIAAHDNINSNRALPSSYFLDELRRREAERA
ELASYKLAAESHNLARRVFWLTVVSTVFAGFAAIVAIIALFLR
41408854NP_961690.1 hypothetical protein MAP2756c [Mycobacterium avium subsp. paratuberculoMVGIPVYLDVESRIDQRALMATSRALVDHFARVGNDISHGLGGSLSKAFA
AVDGTAARRDLLALQQEWRRAADVEADAAARMIRDQRRLAEATVKYGDDS
SRTAAAQAMLARSQRDHIDAMIAAEAAHGRLAKAGNETADSVSRMQKLGA
NPIFNAAGIGSVAAMGIGLVSATDAAGNFQQSLQRLHTVAEESPANLKAI
SDGVLKLSSVVGYAPQKLMDAALGVEKAGYRGSDAIKVLTASAQLASEEG
ADLGETISAVTTTMHDYHIPVEQAANVTSKLNVAVGLSKVSLQDFAGALH
NVEPVAAGVGESVNDLYASLAMLTQSGMGADQATQNMTHAITSLAKPTQQ
MSQEMGQLGLDARDIQEHFGERGLIGTANLLYDTIQSKLGPSGMVTLDAW
FKSKQVADSANEMFSKLPAQAQAVATAIQNNAEAYKQFRKDRGGLSVEEA
NLVEQWWNQEKALTGFNNQLKSGKGDVQSMIQALALMVGGQDNLRTVLQL
VGENGPKAAAAVKEVSQAQADGAGNTKGFTESQETYNAKMKDFKGALSAA
RIEIGQDFLPAMTEVVGVLGESAHWLTEHKPLLDAVTVGVGAMGTAWLAI
KGYNIASTILSPIGTGLGMLKDKLFSVETQATTASTAMRNMGPAAMAGEA
EVLAAADAEVAAEGRVTAAAGEANAALSGGRTGGAGLAAAAGPLGIAAAG
SMAANDIFGSLDRRFHTNLFTKLGEIPGSGAWVAGQLFGHAEGGPLHAPG
PKGHDSALFWGADGEHVLTHHEVQKMGGHSGVYKFRSDLMNGRIVLGRAG
GGALGYGGMAPDVAVASSLAGTPYSQGARDDCSGMVGRVILGAMGLPATN
LPTTKNMGQWLAALGFQPGIGGPGSISVGWYDHGPNPNDGHAAMTLSNGE
NAEAGGSHGNFVIGAGAAGAASSQFDHHMFLPTLYGEGAATGMPGFAAGM
GAGGFGGMGGGIPPGATPGTGPGGQPGYYTANPQRVAAAEERLRHLDAEI
DNAEKRRSELKATAKQSERDRLDEEIRHLKAERTQEQQRLAEAERGTFHA
MHGHRGAGGGENPFLPVPLADQFGLSKGLPGLAEWTVGFLEDLVLGPLET
AAWAAIGQAPPGAGGTGGGFGGLSAPGGLGAARFGFPNPAPLAAPPGAAG
ADDAAAAGLDTARGNTTGQAPSSGGGAGAGGGSEFEFVKSPSKPGLPLGP
LARPPAPDSAPPPADYKSWYGQGASDSFYRTWYPTPLGPVPTPSPNAYGP
PSHGSDWRWGPVHVAPPAPPGPMKSPLEQQQSMLGGAGSGGPLPSGPKPL
PMGPFIGGDPRWGTAHFASGGPSGTDTIPAWLSPHEYVEPSEAVDKYGPG
FMDAIRQGRIDPTSVRYYAPGGEVTDQPEPPPQQQAPAQQPQNMVKAPGA
PGGPAIEPPPGAPKPGDNASIHEPTGPGAVSPGSKQGLSDTATPGADVQQ
PGTGQGALPGIGFSGGIIGGLEGAATQAAAMGADMGTFGGAGGAVSSAMN
IGFQELNRAAAYGAQDVGIGVEGLLEALIPNSDATGADWSKTIPGRLLMG
VTGVRTAGQQNTAGQTQQPFASNASSDQYANVGNTQPQAPIQIMGPVHVQ
ANDPKQLHEGLNSQAAMANSANMIGTQFRGTAGGTG
41408853NP_961689.1 hypothetical protein MAP2755 [Mycobacterium avium subsp. paratuberculosMTTDHPDQPRRELPNTLAGHNLVFIYDDDDDDWDDEDFDADHGDCAFCLG
REAAHRGESEDQNPYSKTGARPGSTEWYETDYGLWLLGHDVGTKIDPEMS
41408852NP_961688.1 hypothetical protein MAP2754 [Mycobacterium avium subsp. paratuberculosMGKSLEDRLAAIGDAAEAGEADQTDRPIPAHVKVTRGNPRSKVLQVRLNP
EELAALEAIAERRDLPVSTVAREQLLPLVAEELNR
41408851NP_961687.1 hypothetical protein MAP2753 [Mycobacterium avium subsp. paratuberculosMATNDDQDDGKPPITAAAGGDETAIGAAADETELVAPLTVPASELAWSHE
DSDAGDYSWGRAAERASIIVLACAAVAVVIGLLTWLALHLHDQAKPTAGP
TAARPVTIEPAAALPTVTAVQAPAAAPPATVTVTPPPAPPATVTVQAAPA
PAPTVVKPAPALPPPGGTTVFSICPDGHEGVVGGHTSCAFAENVRRTFYA
SGMADTFTAFSPVTGDAYEMTCAGRYPAYFEDGSTKVSTRCYGGNNAEVV
IW
41408850NP_961686.1 hypothetical protein MAP2752 [Mycobacterium avium subsp. paratuberculosMSAALRLVTDTGTGTSDGELPPLQRYEIWMKGRGLSARTITDSMLTLRRL
ERVTRRPAHAVAALAISRFLADEALGPRSRYTYHVQLAGFFRWLANEDGA
PNIMAQIPRPRLPRSVPRPITTGQLQALLAVRMHKRTRVMILLAAFAGLR
AHEIAKVRGQDVDPDARTLHVVGKGGHAATIPLHPVLVEAAETMPRHGWW
FPANSRRPGQHVLSRGVVDAIGDAMRRAGIPGGTAHRLRHWYGTTLVASG
TDLRTAQTLLRHSNLASTAIYTEVYDDRRIEAIDRLTIPLPGEAERAQDD
RLRRQVDRCKQSIIRLLGGLEPGEHMSRTKLSQALRSDVRPHINEAIDEL
TAGGMLVTVIAGHGRHYRLDSGWTDRPEFHG
41408849NP_961685.1 hypothetical protein MAP2751 [Mycobacterium avium subsp. paratuberculosMNTSSSLPVDTLDVTAPPDATEVYGWAAHPDGLAARAFEAAVRDCAGYRV
RVRGAQRSNVTCRRWVAIEAAPGADEQALEPEAVRQLAPQMSVTPTTRRT
AEMLDDAAFDAIVAVFSQRARCEMQTLSGGKCPRAARWRIDLHGCEQAIV
CGQHKKAWLQEALANLWRGIQPRCAHCGRVFNSFQDAVRITAI
41408848NP_961684.1 hypothetical protein MAP2750c [Mycobacterium avium subsp. paratuberculoMSKVTLTTELPIPVETASALARKPEMMRHVLSPVLRIYRLDVPKRIEVGT
QGSARFWLFGVIPAWTHHLTIKRLDPTEIYTNEHGGPVRTWNHRLTFEPI
DEGSCRYTDEIETDDGLRGLPTRAFARVMFRHRHRRWRRLARILH
41408847NP_961683.1 hypothetical protein MAP2749c [Mycobacterium avium subsp. paratuberculoMAGNQEGIGMLKLECPQHHPVGRILKDAPHQAVQFDPGAQVGPRRFWPDE
DEQPNFTTRCRFCDQPVGEATATLQAKLAEVVADAAATAATAALPYV
41408846NP_961682.1 hypothetical protein MAP2748c [Mycobacterium avium subsp. paratuberculoMRRDASAAAPTRKEPRGAEPHTARPPRPPEGDWLGTPYLRFERYGPIALC
TIDRPQARNALSPAMYFGIRYAVGRLNEDPDLAGLVLTGTGDVFAPGGDM
GGGGGADNWITFGSALGMDVTPFDAVRTSAKPIVSAVNGLCQGGGFQIAL
CSDLSVVSDRATFRVPELFRGYADTYYSQMLARVIGPVRTRDLMFTGRVL
TAVEALDWGLVTRVVPHENLLDAAKDLLAQCCRTAPRARGVIKSSLDNYL
GLYDRIGMTASLSDDEAIEGFRAFKQRRSPDWVHPDLRVDGRL
41408845NP_961681.1 hypothetical protein MAP2747 [Mycobacterium avium subsp. paratuberculosMPAAETRETLAGIVERHAQRRPDAIAIRYGERQWSWAEWSSRIRRAAGAL
RGAGIQRGQCVAFLDKNHPACLEVLIGGASVGAVTTVVNWRVIGDELVHV
LADSGARVLVVGAELRPAAEAAARRVPSLERIIEVGDEYESLLAAAEPAP
SDAGVDTDETALVIYSSGTTGRPKGVLLSQRALVNHAANLAPAFPFGDGD
ANLVAMPLFHVGGIGYALFGIRAGAPTIMTREPDAAALIGAVRAGATHAF
FVPPVIARFLDAGEAARASIAGLRYIVYGAAPMPLPLLHRALSTWPGTKF
VQVYGQTELCGAVTALSDDDHRDAARPQLQLSAGKAVQGCEIRIVDPNSC
AELPAGRSGEVWVRSNQNMSGYLNRAEATAETITADGWVRTGDVGRLDAD
GYVYIEDRLKDMIITGGENVYGPEVESVLIEHPAVVDAAVIGVPDDFWGE
SVKAIVVADGDVDAADVIEFCRRHLAGFKCPRTVDFVAELPRNASGKILK
TQLREPFWRDRDRRV
41408844NP_961680.1 hypothetical protein MAP2746 [Mycobacterium avium subsp. paratuberculosMAVVWAGAAPPGAPRVALVSGEAIAIAQGVSVTPAPGWTLGNRGPNWVAL
NNSDTTAQLRITVKPGAGTDAAALLQADVDQYTGGASAILTDVNRLGPPE
TTPLQGPNFQQQASLNYTATVVHPQGSIPVIGTFTELLNTSTGRSAFVDF
RQDSSATTQAAGEGAAMIASLQ
41408843NP_961679.1 hypothetical protein MAP2745c [Mycobacterium avium subsp. paratuberculoMTGMVNPDRARSRTFVVTGAASGIGLATARRLLAEGGTVVGADLADPPGG
LGPRFTFVPADVTDESAVAAVLAAVPGRLDGVFHAAGVAGGGPVHLLDRA
EWDRVIGVNLTGTFLVAKAALARMIDQSRVDGERGSLVTVASVEGLEGTA
GGSSYNAAKGGVVLLTKNIALDYGPSGIRANVICPGFIETPMAHNVFSIP
GMEAPLASITREHALQRLGRPEEIAAMAAFLLSTDASFVSGQAIAVDGGY
TAGRDHGVVELFGFPS
41408842NP_961678.1 hypothetical protein MAP2744c [Mycobacterium avium subsp. paratuberculoMSGGLTPDQAIDAIRGTGGAQPGCRALHAKGTLYRGTFTATRDAVMLSAA
PHLDGSTVPALIRFSNGSGNPKQRDGAPGVRGMAVKFTLPDGSTTDVSAQ
TARLLVSSTPEGFIDLLKAMRPGLTTPLRLATHLLTHPRLLGALPLLREA
NRIPASYATTEYHGLHAFRWIAADGSARFVRYHLVPTAAEEYLSASDARG
KDPDFLTDELAARLQDGPVRFDFRVQIAGPTDSTVDPSSAWQSTQIVTVG
TVTITGPDTEREHGGDIVVFDPMRVTDGIEPSDDPVLRFRTLVYSASVKL
RTGVDRGAQAPPV
41408841NP_961677.1 hypothetical protein MAP2743c [Mycobacterium avium subsp. paratuberculoMSPFQMFVICLAGLAAGAINALVGSGTLITFPTLVALGYPPVTATMSNAT
GLVAGSVSGTWGYRAELRGQWDRLRWQLPASLAGAGLGAYLLLHLPEKVF
AEIVPVLLVAALVLVVTGPRIQAWTARRAEQAGRSPEHVPPGRMATLVFG
TFAVGVYGGYFTAAQGILLVGLMGALLPESVQRMNAAKNLLALVVNVVAA
VAYTSVAFGRISWAAAGLIAAGSLVGGLLGARYGRRLSGGALRAIIVVVG
LIGLYRLLAVA
41408840NP_961676.1 hypothetical protein MAP2742 [Mycobacterium avium subsp. paratuberculosMNSVIVEPMSATHLTLSTKLVYELGDPNSTLRATTARSGSAVLIYAGGEI
DACNEDTWRHLVSEAAGVVTTPGPFVVDVTGLEFMGCCAFAVLTDEAKRC
RQRGIDLRLVSCEPIVGRIIDACGLSDILPIYPTVDSALSGADRW
41408839NP_961675.1 hypothetical protein MAP2741c [Mycobacterium avium subsp. paratuberculoMTTPDAGSSGASARERVLTAAYELFSRRGIRAVGTDEVIARAGVARATLY
RHFATKNDLVLAVLQRREELWTYGLIEEQSRLRGATPEEQLLAIFDVMDE
WFRQGDRYEGCSFINVLLELGPEHPAGKACIAHIDRVRDIVRRRAVAAGL
TDVEDFASSWHILMKGAIVLAAVGDLDAARRARRMARTLIEEHRPPLVSD
TGEAV
41408838NP_961674.1 hypothetical protein MAP2740 [Mycobacterium avium subsp. paratuberculosMNVEPLLHSIPPLAVYLVVGGVVGIESLGIPLPGEIVLVTAALMSSHHDL
AVNPLGVGVAAVIGAVIGDSIGYAVGRRFGMPLFERLGRRFPKHFGPGHV
ALAEKLFNRWGARAVFLGRFIALLRILAGPLAGALKMHYPRFLTANVSGA
ICWAGGTTALVYFAGVAAERWLERFSWIGLVVAVVAGLTAAILLRERTSR
AIAELEAEHYRKTGNTATDPV
41408837NP_961673.1 hypothetical protein MAP2739 [Mycobacterium avium subsp. paratuberculosMARRLAHAWLAWLHGNQSPARLRVILGFVSGAIHPGYRRYVAIGDSQTEG
LWDGDDGTGLLGFADRLAAMLDSAYPGLQYANLAIRGKRIGHVLAEQVPA
ALAMRPDLITVCAGMNDVIQPGRSFGPALTDLDHIYAALAGSGATVVTTT
FPNVAQFLPLGRLVAGRLTRINAVIRAAANRHGFRLVDLYSAPSMRELNT
WAVDRVHASTKGHILFAAAAAEALNLPESSHDWALGGQQRARRSVAAGAY
EQWRWTQDSFVPWVWRRLRGLSSYDGREPKRPRLQGVGSASGILDA
41408836NP_961672.1 hypothetical protein MAP2738c [Mycobacterium avium subsp. paratuberculoMPAKRARVAGPAAAAPAADALAPQYPIESVDNALKLLLLLGEQPEIRLSE
ATRYLGVASSTAHRLLAMLAYRGFVRQDPVSKAYLPGPSLTGVAFAIFGR
LDIARSAAPLMRALSEQLRETVHVGMLDGASVRFVAAVEGPAAVRVASRL
GRALPAHCTSTGKVMLAQLSAAELRALLPRERLKRITAHSIGSRAALEAE
LAAIRERGYATNREESEEGVASVAVPIPTRAPGLRLALNAAAPQNRLDAA
RYPAVAAALVAAAKEIGDQLG
41408835NP_961671.1 hypothetical protein MAP2737 [Mycobacterium avium subsp. paratuberculosMSGRLDEQRALVAQGCRMAAARGLVDGILGHVSLRIDDERLLVRCRSDTD
DGVAFTRPGDIRLVRFDGTAGAPGELDGYRVPNELPIHVETMLADPRHTA
VAHLHPPAVVAADLAGITLRPIYGAHDIPGARLARGGVPVYERAVLIRDS
RLAGDMVAAMRGRPVVVCRGHGITSAAATVPQAVLQAISVDALARMSLRV
RAAGGTLRDIADVDWDDLPDLGPAFTAEAAWRHEVARIEG
41408834NP_961670.1 2-3-dihydroxy-2-3-dihydrophenylpropionate dehydrogenase [Mycobacterium MTGWLDGKRALVVGAGSGIGRAVVDAFAAEGAKVAALERDSDKCDRLRRQ
LPEVAVAEGDATTRQANERAVALAVDTFGGLDTLVNCVGVFDFYRGVADI
DAGALADAFDEMFRTNVLSHLQSVKAALPALRAAGASSIVLTESASSFYP
GRGGVLYVSSKFAVRGLVSALAHELAPGIRVNGVAPGGTLGTDLRGLASL
GLQGTRLDDAPDRAAEVAARTPLRVALSGADHAWSFVFLASDRSRGITGE
TVRPDGGFGLGTPR
41408833NP_961669.1 3-phenylpropionate dioxygenase subunit beta [Mycobacterium avium subsp.MGRLSAGRRRMRKPLTCLPFDDARHLQAHQFLVDEAYLLDAQHYQAWLDT
LTDDVRYVMPVRVTTARGAGFDTSPGMAHFDEDKYSLSQRVARFATEHAW
TEDPPSRLRHFVTNVRTFVEDDRHLLVESAELLFRSRGDVNESALVSCGR
EDVLRWSEDRWKLARRSIFVDESVLRMQNLAVFL
41408832NP_961668.1 hypothetical protein MAP2734 [Mycobacterium avium subsp. paratuberculosMPGVLENVRRGMIPAHIYNDPELFALEKRRLFARAWTFVGHESEIPHDGD
YMVRRVLDDSFIITRGSDGRVRAVFNMCLHRGMQVCRAELGNASNFRCPY
HGWTYRNDGRLTGLPFHREAYGGDDGFVKDQTLLPAPNFAGYDGLLFISL
DPAAPPLQDFLGDFRFYLDYYTRQSAGGVELRGPQRWRIRANWKIGAENF
AGDMYHTPHTHASIVDIGLFREPKAQKRKDGATYWAHRGGGTTYKLPPGG
FEERMRYVGYPDEMIGRIKQVWTPRQQRVVGEDGFMVSAATCFPNLSFVH
NWPKVRDGRDDETLPFISIRLWQPISENETEVCSWFAVDSAAPAQYKQDS
YKAYLMCFGSTGMFEQDDVENWVSLTTTAGGSMARRLLLNSRMGLYDDGR
PVVEALAPSAFHGPGRAQVGYNEHNQRALLAMWADYLQEGDACENR
41408831NP_961667.1 hypothetical protein MAP2733c [Mycobacterium avium subsp. paratuberculoMVGRPRAGRLQKVGSKVVAAIGRQEWMDRPSYRFEHLLSFAYNGLGSARN
TVTNALNGVWLGHPVHPPLASLTSGALGTTVALDALSVLPGQPASEVVGA
SRFATRALGVGILASLGSAVTGVTDWQHTHEEDRRVGAVHGLLNVAATAL
YVQSWFDRRRGRHGRGILLTALGYGITVAGSYLGGALVFESGIGIDQSGP
RLRTSAWTPVLPASSLNGKPVRVEVDGVGLVVCQTKPGEVAAYGEFCPHL
AAPMADGWLDRGRLVCPWHGSWFAAESGEVVRGPAAAPLPCYQARVVDGV
VEVRGEQQPAPGGAVGIAKGGAS
41408830NP_961666.1 hypothetical protein MAP2732c [Mycobacterium avium subsp. paratuberculoMNAYDVLKEHHIVIKGLGRKISEAPVNSEERHALFDDLLIELDIHFRIED
DLYYPALKEASKLIAVAHAEHRQVVDQLSVLLRTPQSAPNYEDEWNSFKT
VLEAHADEEERDMIPAPPQVHITDAELEELGNKMAAKMEQYRGSALYKMR
TKGRAALVRSL
41408829NP_961665.1 PcaH [Mycobacterium avium subsp. paratuberculosis K-10]MDPECVASQGDITAEIARIAAQYRADDGGAGQPLLDYPPYRATILRHPKQ
PLVAVDPEAAELWAPCFGRDDVDPLDADLTAGHRGEPIGERVVVAGRVVD
EAGRPVAGQLVEIWQANAAGRYRHQRDRHSAPLDPNFTGAGRCLTGPDGW
YRFLTIKPGPYPWRNHHNAWRPAHIHFSVFGTAFTQRLITQMYFPGDPMF
ELDPIFQSILDPAARRRLIAHYDHDLTQPEYATGYRWDIVLAGGGRTPTG
AGND
41408828NP_961664.1 PcaG [Mycobacterium avium subsp. paratuberculosis K-10]MTETACTPGQTVGPFLDLGLPYPGDARLVDDGDPRAVRLHGTVYDGVGAA
VPDALVELWQPDGAGRIVRQAGSLRRDPAVFTGWGRCATGEDGGYGFTTL
APGSVIDGRTPFFALTVFARGLLNRLFTRAYLPGAGPDTDPLLARVAPER
RTTLLCVAENGGRAYRFDIRLQGPGETVFLAYRTDER
41408827NP_961663.1 PcaB [Mycobacterium avium subsp. paratuberculosis K-10]MTNLLWPGEHRAGEHMTDAALLDAMVAVESAWLAALTGAGLAPADCAAAD
LRNLVADNDFETLAVGAEDGGNPVIGLVRLLRERADPAVAPWIHRGLTSQ
DVLDTTLMLGVRALADDLIAELREQIRVLSALTDRHRATPMVARTLTQHA
APTTFGGKAAGWLNGVIDAFDNVIALVTPVQIGGAAGTLAASTELAALRT
GTADPAAVSVELARCTAAALGLAPRPPWHTARAPITAAADALVGCTDSWG
RIAADVVTLARPEIGELGEPATATRGGSSSMPHKRNPVLSILIRRAAIAG
PPLAATLHTAAALAGDERPDGAWHAEWDTLRILGRRTAVAASQCTELLAG
LSVHTARMAENLAAADVLGEQRAIAELAGGAPSPTYFGAVDRVIDETLRR
AARVRPER
41408826NP_961662.1 hypothetical protein MAP2728 [Mycobacterium avium subsp. paratuberculosMNSPKWMVHWPQRRPTATIYQLTDRLHRGHVARVPAHQITATVSAWLADL
GADSPLVDELERAVRGGDWAAAHALGECLSIEIAVAD
41408825NP_961661.1 hypothetical protein MAP2727 [Mycobacterium avium subsp. paratuberculosMAANELRTGSEPPLPGSHRADEAVAGHWLLARLGKRVLRPGGVELTRTLL
SHAQLTGADVVELAPGLGRTATEIVARAPRSYVGAEADPDAANVVRGVLG
DLGAHNAAVRVADAADTGLPDASGDVVIGEAMLTMQGDAAKRAIVAEAAR
VLRPGGRYAIHELALTPDTVSEEVSTDIRRALARAIKVNARPLTVAEWSA
LLAEQGLVVDHVATAPMALLQPRRLVSDEGLFGALRFARNVLVHRDARKR
VLTMRRTFRKHRRQLAAVAIVAHKPTASQTG
41408824NP_961660.1 FdxA [Mycobacterium avium subsp. paratuberculosis K-10]MTYVIGKPCIDVMDRACVDECPVDCIYEGGRALYIHPDECVDCGACEPVC
PVEAIYYEDDLPEDLKPHLADNEAFFAEPLPGRDAPLGSPGGAAKLGPLG
VDTPLVASQPSAAHSDGS
41408823NP_961659.1 hypothetical protein MAP2725c [Mycobacterium avium subsp. paratuberculoMGDPLTKSRKLLAPSAGESAGRRRAVLRLLRASPEPMSIAGIADVLGVHP
NTVRFHLDSLVADGQVEHVELDRKGPGRPPLMFRAVRQMDRGGTRHYRLL
AEILAKAFAAETDPAPKALAAGRAWGQQLDAERRRLPRDAAGAEQAIAQL
VDVLDELGFAPERRVIDGEQQVGLRHCPFLELAENSSNVVCPVHLGLMQG
AMETWGAPVSVDRLDPFVEPDLCLAHLTLQGAGR
41408822NP_961658.1 hypothetical protein MAP2724c [Mycobacterium avium subsp. paratuberculoMSTGTAIAVALTFVWLGMVLAISFLEAPLKFRAPNVTLQIGLGIGRLVFR
ALNTVEVVFALVIGAIVVAGPTRAGVAVAIGVAVAALAVQLVAVRPALTR
RSDRVLAGDDGPRSRAHYGYVALEAVKVVALIAAGILLLSG
41408821NP_961657.1 hypothetical protein MAP2723c [Mycobacterium avium subsp. paratuberculoMDSVSLTDLAAEKLAEAKQSHSGRAAHTIHGGHTHELRQTVLALLADHDL
SEHDSPGEATLQVLQGHVRLTTGGDAWEGRAGEYVAIPAERHALHAVEDS
VVLLTVLKTIPSAH
41408820NP_961656.1 hypothetical protein MAP2722c [Mycobacterium avium subsp. paratuberculoMLSTPWSAGFGLRVPIVNAPMGGVAGGRLAAAVTAAGGLGMVGMGSVATR
RLLAEQLQYVDGRFGIGLVDWVMRNEAGLLEDALAARPALLSVSFGTDWS
WVAKAHDAGIPTVTQVYDSLGARQAVDAGVDILVARGSEGGGDGEVKLGL
LPLLDAALDAVSVPVLAGGGVASARSLAAVLAAGASGAWVGTRLSACPEA
LTADGNRRALVEAAETDTAVTRAFDVAKGLPWPARFPSRVLANDFVERWT
GREETLDAGACEELAAAIAAGDCRVAPVDAGQGVGMIRNDATVAEVIDEM
CSGAEQLLSRWGS
41408819NP_961655.1 hypothetical protein MAP2721 [Mycobacterium avium subsp. paratuberculosMDLRALEELPLTYSEVGATASGDLPAGYHHQHVERQIGTGAERFEQAAGA
VLRWGMQRGSGLRVQASSEVAVVDAVVVVRLGFVPAPCRVVYVVDEPDIR
GFGYGTLPGHPESGEERFVVRHDPATSAVYAEVTAFSRPATWWARAGGPV
LRVGQRVIARRYLRAV
41408818NP_961654.1 hypothetical protein MAP2720c [Mycobacterium avium subsp. paratuberculoMPRRGARRGSAGTVGGVSAPQTIAQASGTLTLGGDLTVNRLGFGAMRLTG
AGVWGPPADRDECVRVLRRAVELGVNFIDTADSYGPYVSEEIIREALHPY
DGLVIATKAGLLRTGPDIWIPLGNPSYLRQECEMSLRRLGTDTIDLFQLH
RIDPNFPLQDQVGELLTLKNEGKIRHIGLSEITPDQLAAAQQITEIVSVQ
NMYNVTARRAEPLLDAATRQGIAFIPWFPLAAGPLAAPDGPLQRIAAEHD
ATPSQLALAWLLKRSPVMLPIPGTSKVAHLEENVAAARITLSDEEFEALS
TAGTQQTV
41408817NP_961653.1 hypothetical protein MAP2719c [Mycobacterium avium subsp. paratuberculoMVVAEHQRHPGGGFNPPEPTTKGGPDYGRFIDAVRALQDHARAVDAPDEV
ITQAADQLEKVSALLAPFDADEWASPSGRRMDLPMRGNILTIPMSAQKGA
DGRMHGQARFARFHLGRNGAVHGGSLGMLFDTVLGLTASVLTGSRRQRTA
YLKIDYRSIVPIETELQFDAGVDRVDGRKIFVSGRLTHGERLLTEADALF
VRLKPGQP
41408816NP_961652.1 hypothetical protein MAP2718c [Mycobacterium avium subsp. paratuberculoMTGSASPCGPVLAGLPGIRGWQEDLYRDLHRHPELSHQEHRTAAAVAERL
RGFGYDVHEGVGGTGVVGVLRNGTGPAVLLRADMDALPVREDTRLPYASA
VTATDPHGDERPVMHACGHDVHVTCLLGAASLLAGAREHWRGSLVAVFQP
AEELGDARAPHGRRRAGEAGRSRRRRPGPARAAVSGRPDRHPIGALHGHR
RQHAGHRVRPGRPRVDAADDRRSRRAGRHDRDPVADRRLARGGAHRDRGA
DDRQDRVGRQEQRDRRPRGAGAEPAHLQRPDPRPDARRGPAHRHRRMPGV
RVAAGPRVRADEPLPGHRQRPGGHRAGAGGVRRAFRRPGDGDSRADRKRR
LQRHRQRARRAVQLLGFRGSRPRRVSARRGGRSAGRGRPRQPLREVRPRH
PAHPRHRHRGADRRRAGLAGP
41408815NP_961651.1 hypothetical protein MAP2717 [Mycobacterium avium subsp. paratuberculosMLSGRPNGEQGRRVATVRSGTMRSMGAQTALTLLLAAIAVIVLVDWISER
TRLPSATLLVLVGIGQALLPGPTIGLEPDVVMTCILPPLLYHAALESSLV
GIRRNLRTVVSLSVVLVLLTAASVGVAFSLLVGGATLAVGMVLGAAVAPT
DPVAALAVARKEGLPLNIVTLIEGEGLLNDATALTTLAVAVTVARGAAFS
APSAIREFVLAAVGGLVVGQVFAYARRLLRRWRHDVLTANAISLATPFLT
YLVAEKLSASGVLAVVVCGLIVGHDSPRVESGASRLQTRAVWRLVNFLLE
GVVFLLIGHQVPVILDELGGYALSTILVAVGVTVAVVLLVRPLWLLLTQA
LPRSLHTRLGNVDDSATDSAEPRPERTRERLSGREIVVLSWAGTRGVVSL
AAIFAVPVLTEGNAPFPDRDLLLFCTLVVVLVTLIGQGVTFGPLVRALGL
RAKTTDELRLRNRARAAALRAALDRLDSLDPEDGADVDPRVIDGVRQQLS
AQLERYEHRLTLLSDVDELPAAPAYEAAVGLRRVAIDAQRDELVRWRDAG
MLPDQSLRAIERELDHEESMLPMGLPRSPRRSQKR
41408814NP_961650.1 threonyl-tRNA synthetase [Mycobacterium avium subsp. paratuberculosis KMTVPATDSCPAPIRVPAGTTAAAAVRDAGLPGRGAPDAVVVVRDASGTLR
DLSWVPDTDAEVVPVAANTDEGRSVIRHSAAHVLAQAVQELFPQAKLGIG
PPITDGFYYDFDVPEPFTPEDLDKLEKRMRQIVKEGQLFSRRVYESKEQA
RAELAGEPYKLELVDDKSGDPDIMEVGGDELTAYDNLNPRTRERVWGDLC
RGPHIPTTRHIPAFKLTRSSAAYWRGDQNNASLQRIYGTAWESQEALDDH
LRLIEEAQRRDHRKLGSELDLFSFPDEIGSGLAVFHPRGGVVRRELEEYS
RRKHIEAGYEFVNTPHITKAQLFHTSGHLDWYADGMFPPMHLDAEYDDDG
TVRKPGQDYYLKPMNCPMHTLIYRSRGRSYRELPLRLFEFGTVYRYEKSG
VVHGLTRARGFTMDDSHIFCTREQLHGELASLLRFVLELLGDYGLTDFYL
ELSTKDPDKFVGSDEVWEQATTSLADVAAESGLELVPDPGGAAFYGPKIS
VQARDALGRSWQMSTIQVDFNFPERFELEYTASDGTRQRPVMIHRALFGS
IERFFGILTEHYAGAFPAWLAPVQAVGIPVADEHVPYLESVAAQLKSYGV
RVEVDASDDRMAKKIVHHTAQKVPFMLLAGDRDVAAGAVSFRFGDRTQIN
GVPRDSAVDAIVKWIADRENSVPSAELVKVSSGE
41408813NP_961649.1 hypothetical protein MAP2715c [Mycobacterium avium subsp. paratuberculoMSDPEQAEQDAERTILDRGVGEQDHLQRLWTPYRMTYLAEAPMKRGPNSS
GKSEQPFTDIPQLTDEDGLVVARGELVYAVLNLYPYNPGHLMVVPYRRVS
ELEDLTDAESAELMSFIQKAIRVIKNVSRPHGFNVGLNLGTSAGGSLAEH
LHVHVVPRWGGDANFITIIGGSKVIPQLLRETRQLLATEWAKQS
41408812NP_961648.1 hypothetical protein MAP2714c [Mycobacterium avium subsp. paratuberculoMSKVPFLSRAAFARLTTPTARACLRLGLTPDVVTVAGTIVAVAGALILFP
IGELFVGTLVVWFFVLFDMLDGAMARERGGGTRFGAVLDATCDRVSDGAV
FGGLLWWVAFGLHDEPLAAATLICLVTSQVISYIKARAEASGLRGDGGII
ERPERLIIVLVGAGLSDLPGYPLPWALPVAMWALAAASLVTCAQRLHTVR
TSPGATDRGSDAP
41408811NP_961647.1 lipid A biosynthesis lauroyl acyltransferase [Mycobacterium avium subspMMPTPPGMRAITAPGRLAGRLVGGVGADWAYATGWMAVRAMPEFAARNAF
DAAARYAARGGGPDQLRKNLARVLRVPPADVPDALMRASLASYARYWREA
FRLPSMDLTELGRRLQDSVRGEDNLDAALRAGRGAVIALPHSGNWDMAGV
WLAQSHGTFTTVAERLKPESLYRRFIAYRERLGFEVLPLSGGERSPFEVL
CDRLRANRVVCLMADRDLTRTGVQVDFFGEATRMPAGPAKLAIATGAALL
PVHVHFEGEGWRFLIYPALDCSSGDVGAITQVLADHFEKNIAAHLEDWHM
MQPQWLADLPDSTRARLRDS
41408810NP_961646.1 hypothetical protein MAP2712c [Mycobacterium avium subsp. paratuberculoMRIGMVCPYSFDVPGGVQSHVLQLAEVMRCRGHDVSVLAPASPHAVLPGY
VVSAGKAVPIPYNGSVARLRFGPATHRKVKKWLVDGDFDVLHLHEPNAPS
LSMLALNIAEGPIVATFHTSTTKSLTLTVFQGILRPMHEKIVGRIAVSDL
ARRWQMEALGTDAVEIPNGVDVASFASAPRLDGYPRAGKTVLFLGRYDEP
RKGMAVLLDALPRLVERFADVQLLVVGRGDEDQLRTQAGELVKHIRFLGQ
VDDAGKASAMRSADVYCAPNLGGESFGIVLVEAMAAGTPVVASDLDAFRR
VLRDGEVGALVPVGDGDALADALIAVLEDDGLRDGYVAAGQAAVQRYDWS
VVASQIMRVYETVAATGAKVEVAS
41408809NP_961645.1 hypothetical protein MAP2711c [Mycobacterium avium subsp. paratuberculoMTWLMVGIAILVAVLAVVGVWAYRTANRLDRLHVRYDLSWQALDGALARR
AVVARAVAIDAYGGASEGRRLAALADAAEAAPRAAREARENELSAALAAV
DPASLPAGLIAELADAEARVLLARRFHNDAVRDTLALAERRLVRLLHLGG
TAALPSYFEIVERPHALAHGDHGVLNHRTSARVVLLDDRGAVLLLRGSDP
ALAGQQAPKWWFTVGGEVQPGERLAEAAARELAEETGLRVAPSELVGPVW
RRDEVFEFNGSLIDSEEFYFVYRTQRFEPSRTGRTELEHSYIHGHRWCDA
ADIAQLVAAGETVYPLQLSGLLTDAAALASGRTPGPLLSIR
41408808NP_961644.1 pyridoxine biosynthesis protein [Mycobacterium avium subsp. paratubercuMNTAHSPDGSGRTGTARVKRGMAEMLKGGVIMDVVTPEQAKIAEGAGAVA
VMALERVPADIRAQGGVSRMSDPDMIEGIISAVTIPVMAKARIGHFVEAQ
ILQSLGVDYIDESEVLTPADYTHHIDKWKFTVPFVCGATNLGEALRRINE
GAAMIRSKGEAGTGDVSNATTHMRAIGGEIRRLMSLSEDELYVAAKELQA
PYELVVEVARAGKLPVTLFTAGGIATPADAAMMMQLGAEGVFVGSGIFKS
GDPAQRAAAIVKATTFYDDPDVLAKVSRGLGEAMVGINVEQIAQPERLAE
RGW
41408807NP_961643.1 TesB2 [Mycobacterium avium subsp. paratuberculosis K-10]MSIEQILDLEQLEVNIYRGGVFSPDSGYFQRTFGGHVAGQSLVSAVRTVD
PRYQVHSLHGYFLRPGDAKERTVFIVERTRDGGSFATRRVNAIQHGEIIF
SMGASFQTDQEGIHHQDAMPAAPPPDGLPGLDSIKVFDDAGFKQFEEWDV
CIVPREKLQLTPGKASQQQVWFRHRDPLPDDPVLHICALAYMSDLTLLGS
AQVTHLDVREHLQVASLDHAMWFMRAFRADEWLLYDQSSPSANGGRSLCQ
GKIFTQSGEMVAAVMQEGLTRFQRGYRQ
41408806NP_961642.1 hypothetical protein MAP2708c [Mycobacterium avium subsp. paratuberculoMSAPRIGVLALQGDTREHLAALREAGAESMPVRRRGELEAVDGLVIPGGE
STTMSHLLKDLDLLEPLRGLLADGLPAYGACAGMILLASEILDAGAGGRE
ALPLRAIDMTVRRNAFGRQVDSFEGDIAFAGLDGPVRAVFIRAPWVERAG
DGVEVLARAAGHVVAVAGIEPDA
41408805NP_961641.1 hypothetical protein MAP2707c [Mycobacterium avium subsp. paratuberculoMNHLLVLSGAVADGAPHHTGPDFGKASPVGLLIVVLLLISTLFLLRSMNR
QLRKVPESFDPQHPEPDQAADEGTDAVDAEDAPDADPGPDHANGSPRPPG
SDDEPG
41408804NP_961640.1 hypothetical protein MAP2706c [Mycobacterium avium subsp. paratuberculoMSPADPSATNTLGRATSPYLRQHADNPVHWQQWTPQALADAAARDVPILL
SVGYAACHWCHVMAHESFEDPDVAAAMNSGFVCVKVDREERPDIDAVYMN
ATVALTGHGGWPMTCFLTPDGRPFFCGTYYPKDAFLQLLSAVSATWRERR
GEVEEASDRIAGELRKMTSGLPAGGADLATALCDEAVAAILADRDTVHGG
FGGAPKFPPSALLEALLRSYERTGSAAVLQAVAHTGAAMARGGIYDQLGG
GFARYSVDNAWVVPHFEKMLYDNALLLRLYAHWARRTCDPLAARVTAETA
RFLLDDLADGDMFTSSLDADADGREGSTYVWTPAQLTEVLGPDDGRWAAA
VFGVTETGTFEHGSSVLRLPADPPDTPRFDRVRAALLAARRGRIQPGRDD
KVVTSWNGLAITAFTEASVALDDPGLADAARRCARSVLDLHVVDGRLRRA
SLGGVVGDSAAILEDHAMLATGLLALYQLSAEDSWLTAATDLLDTALAHF
ADPQRPGRWFDTADDAERLMLRPADPLDGATPSGASSVTEALLTAAHLVG
GERAERYLRAATDALRAHAVLLERAPRTAGHWLAVAEAAVRGPLQIAVAC
DPARSALLADARRLAPGGAIVVGGPRDSSELLAGRDRVAGADAAYVCRGR
VCDLPVTRTPELAAALGAPSP
41408803NP_961639.1 hypothetical protein MAP2705c [Mycobacterium avium subsp. paratuberculoMPNDAKTDAIRNTVHRYIELVAKGGADDLVELYADDATVEDPVGGEVHIG
RQAIHGFYSALDNLQRECELLTLRVAGNEAAFHFRLTVTAGEHRMVIEPI
DVMVFDGNGKVAAMKAYWSPDDDVSRP
41408802NP_961638.1 hypothetical protein MAP2704 [Mycobacterium avium subsp. paratuberculosMSSQTSTAPNPEPDHEAIVPGNTVEQLFEGAAQVLGKPRMRGWIHFYSAW
LAVITGATLVSVSWAAASPRAGHSTLIYAAATVALFAVSATYHRVKWKTE
AARTRMKRLDHSMIFVFIAGSYTPFARLVMPQNTGVVVLCIVWGGALAGI
ALKVCWPTAPRWLGVPLYLLLGWVAIWYAPTILHQAGVAAMVLLAVGGVL
YSVGGIFYALRWPDPWPSTFGYHEFFHALTAIAAILHYIAMWFAVFYTGD
HAWLATP
41408801NP_961637.1 hypothetical protein MAP2703c [Mycobacterium avium subsp. paratuberculoMFVEIIPPRLKEPLYRIYEMRLRQELGAAKADLPRHIAVLCDGNRRWARD
AGYDDVSYGYRMGAVKIAEMLRWCQAAGIEMTTVYLLSTENLQRDPDELA
GLIEIITDVVEEICAPANRWSVRTVGDLELLGEEPARRLRGAVESTPVEA
SFHVNVAVGYGGRREIVDAVRSLLSKELANGATAEELIDAVTVDAISENL
YTSGQPDPDLVIRTSGEQRLSGFLLWQSAYSEMWFTEAHWPAFRRVDFLR
ALRDYSQRHRRYGK
41408800NP_961636.1 hypothetical protein MAP2702c [Mycobacterium avium subsp. paratuberculoMAALSAVVFTLSAWLGLYLAARDPRKPVLVLAAIGLCGFALVVGLDAVRT
ASPAHAPLLSRVEIYLTAVPGVAWFAVLVELSRPPDGWRSRTREVLLVAG
VAALTLLGAALAGSVDGPLRPGHWLMMAAISVSTLGAMAVALRRPRRPRP
AVGLAVTATLFFALANAILIIPLGLVPSWLALASTSCDVLGLGVAVALWD
AFDEGHALRADMLRSFAGSVAVAVLFGGQALIGLAVTRADPGARTALTVL
LFTSLAIAITVQVLADPLAGLLDRLAFSKSPALRADRAALRHTGAALPLR
QEHPLDGVDDVTFARLTRRALGHYGDLTKLVASPLTALPVIDERLAARGA
PDQPIERATELKAVLADAIARLKPRDGGDFGTTEEWRHYNSLYFPYVVGV
RAYAQNATASGLDPTARQAWQWFVTEVPQRSLHNWQNAAARLIAADLRGR
VPVPSE
41408799NP_961635.1 hypothetical protein MAP2701c [Mycobacterium avium subsp. paratuberculoMSTVSGVSGVTVRPLYDSTDSLLRFAVRADATLTGLCGLAVAVAADPLSS
LTGLTSFQEYIGGAFFVLYGLVVFSLGALPDLRRAGISIVAANAVFTLAA
IVAAGVLPLTGAGVALTLASAAYTAAFAAVQYAGVRRLETA
41408798NP_961634.1 pantothenate kinase [Mycobacterium avium subsp. paratuberculosis K-10]MPRLSEPSPYVEFDRKQWRALRMSTPLALTEEELVGLRGLGEQIDLLEVE
EVYLPLARLIHLQVAARQRLFAATAEFLGEPQQNPDRPVPFVIGVAGSVA
VGKSTTARVLQALLARWDHHPRVDLVTTDGFLYPNAELDRRNLMHRKGFP
ESYNRRALMRFVTSVKSGSDYACAPVYSHLKYDIIPGAKHVVRHPDILIL
EGLNVLQTGPTLMVSDLFDFGIYVDARIEDIEQWYISRFLAMRSTAFADP
ESHFHHYAALNDTKAVAAAREIWRSINRPNLVENILPTRPRATLVLRKDA
DHSINRLRLRKL
41408797NP_961633.1 serine hydroxymethyltransferase [Mycobacterium avium subsp. paratubercuMSAPLADIDPDIAGLLGQELGRQRDTLEMIASENFVPRAVLQAQGSVLTN
KYAEGLPGRRYYGGCEYVDVVENIARDRAKALFDADFANVQPHSGAQANA
AVLHALMTPGERLLGLDLANGGHLTHGMKLNFSGKLYDVGFYGVDPTTHL
IDMDAVRAKALEFRPKVIIAGWSAYPRVLDFAAFASIADEVGAKLWVDMA
HFAGLVAAGLHPSPVPHADVVSTTVHKTLGGPRSGLILGKQEYAKSINSA
VFPGQQGGPLMHVIAAKAVALKIAGTEEFADRQRRTLSGARILAERLSGA
DVAAAGVSVVSGGTDVHLVLVDLRNSELDGQAAEDLLHEIGITVNRNAVP
NDPRPPMVTSGLRVGTPALATRGFGGAEFSEVADVIATALAGGRGADLAA
LRDRVTRLARDFPLYEGLEDWALVGR
41408796NP_961632.1 DesA2 [Mycobacterium avium subsp. paratuberculosis K-10]MAERPVANALTLELEPVVEANMDRHLSTEELWFAHDYVPYDRGENFAFLG
GRDWDPSSATLPRPLTDACEIMLLLKDNLAAHHRELVEHFILEDYWGRWL
GRWTAEEHLHAIALRNYLVVTREVDPTANEEARVQYVMKGYRADTYSQVE
TLVYMAFTERSHAVFCENLSAKLEEPILSGLVDRISRDERRHELFFSNLV
AHCLEYTRDETIAAIAARAAELQVPGADIDAYQDKLRNVAEAGVFTENDL
RQVISDRIRAWGVADEPALKPFVIG
41408795NP_961631.1 PhoH2 [Mycobacterium avium subsp. paratuberculosis K-10]MTDIRTYVIDTSVLLSDPWACSRFAEHEVVVPLVVISELEAKRHHHELGW
FARQALRLFDDLRLLHGRLDQPIPVGTQGGSLHVELNHTDPAVLPAGFRS
DSNDSRILSCAANLAAEGKRVTLVSKDIPLRVKAAAVGLAADEYHAQDVV
ASGWSAMHELETAAEDIDALFTEGEIDLAEARDLPCHTGIRLLGGSSHAL
GRVNPDKRVQLVRGDREAFGLRGRSAEQRVALDLLLDESVGIVSLGGKAG
TGKSALALCAGLEAVLERRTQRKVVVFRPLYAVGGQELGYLPGSESEKMG
PWAQAVFDTLEGLASPAVLDEVLSRGMLEVLPLTHIRGRSLHDSFVIVDE
AQSLERNVLLTVLSRLGTGSRVVLTHDIAQRDNLRVGRHDGVAAVIEKLK
GHPLFAHITLLRSERSPIAALVTEMLEEIAGPH
41408794NP_961630.1 hypothetical protein MAP2696c [Mycobacterium avium subsp. paratuberculoMAKRPDTLAWRYWRTVVGVLAAVAVLVIGGLTGHVTRADDLSCSVVKCVA
LTFDDGPGPFDERLLQILKDNDAKATFFLIGNKVAANPAGAKRIADAGME
IGNHTWEHPNMTTIPTEDIAAQFTKANDAIHAATGRTPNLYRPAGGLSNP
VVRQTAGQLGLAEILWDVIPFDWANDSNTAATRYMLMTYIKPGSVVLFHN
TYSSTVDLVYQFIPVLKANGYRLVTVGELLGPRAPGSSYGSRENGPPVNG
LRDIPASDIPKLPDTPSPKPMPNFPITDIPGQNSGGPNNGA
41408793NP_961629.1 hypothetical protein MAP2695c [Mycobacterium avium subsp. paratuberculoMPSTRAAAEERKSARRWLFRYGLDMSLSYVLAVGEAAAILIPLRGHTSVG
VNADFARQNTGPVLALIALGIIGVAVAGALSLAPTLRWYVAGEEPTPQQR
DAVMKLAGRQSAILVTAWAVSGGIFLLLNVAGGARLLLPIALGALLGGSA
AAGTGMLLAQRTLRPIMRAATLGAEPRLAVPSVYARLVLLWFLCSAFPIA
VIAALVVLRSYGWLVEKSASLDVPILVVSLAALVLGLPTMILTSRSISDP
IGEVVDAMAEIEHGRMETYVGAYERSQIGRLQTGFNRMVAGLAERDRLRD
LFGRHVGADVAQRAIEEGASLSGDVVEAAVLFIDLVGSTQLAESRPPQEV
AEVLNDFFRIVVNAVDEHHGLVNKFAGDAALAVFGVPLPTNQPASAALAT
ARTLGTQLRQLPVDFGIGVSAGRVFAGNVGAENRYEYTVIGDAVNEAARL
ADLAKTADRRILCSAAAIEAAGEAERGHWAECYSTVLRGRSETTHVSAPT
G
41408792NP_961628.1 hypothetical protein MAP2694 [Mycobacterium avium subsp. paratuberculosMTAVDDSKDGFSMTAPPGGIYGPGSYGSNPYGQEPNWGGQPPGGQPPGGQ
PQGGPYPQPGQYPAGGPYPYPPPGGGYPYPGGPYPGGPYPGAPYPGPGQP
FGPGGPYSPGPPPGGPGSKLPWLIVAGLVVLAVIALVATLVVMKGGHGSK
PSGATPSSTSTSVSQPKNSAQNATDCTPNVSGGDMPRSDSIAAGKLSFPA
NAAPSGWTVFSDDQGPNLIGALGVAQDVPGANQWMMTAEVGVTNFVPSMD
LTAQATKLMQCLANGPGYANAMPTLGPIKTSPITVDGTKAVRADADVTIA
DPTRNVKGDSVTIIAVDTKPVSVFIGSTPIGDSASAGLIGKIIAALKVAK
S
41408791NP_961627.1 fumarate hydratase [Mycobacterium avium subsp. paratuberculosis K-10]MATDDGDTDYRIERDTMGEVRVPAKALWRAQTQRAVENFPISGRGLERTQ
IRALGLLKGACAQVNKDLGLLAPEKADAIIAAAAEIADGRHDDQFPIDVF
QTGSGTSSNMNTNEVIASIAAANGVTVHPNDDVNMSQSSNDTFPTATHIA
ATEAAVRHLIPALQVLHDALASKAREWHTVVKSGRTHLMDAVPVTLGQEF
SGYARQIEAGIERVRATLPRLGELAIGGTAVGTGLNAPDGFGAKVVETLI
ASTGLSELRTATNSFEAQAARDGLVEASGALRTIAVSLTKIANDIRWMGS
GPLTGLAEIALPDLQPGSSIMPGKVNPVIPEAVTQVAAQVIGNDAAVAVG
GLSGAFELNVYIPMMARNILESFKLLTNVSRLFAERCISGLSANVEHLRE
LAESSPSIVTPLNSAIGYEEAAAVAKQALKERKTIRQTVIDRGLIGDKLS
LEELDRRLDVLAMAKVKPQD
41408790NP_961626.1 fructose 1-6-bisphosphatase II [Mycobacterium avium subsp. paratuberculMTVEGDRSSAATGRAPAQGRPRGEAPDRNLALELVRVTEAGAMAAGRWVG
RGDKEGGDGAAVDAMRELVNTVSMRGVVVIGEGEKDHAPMLYNGEEVGNG
DGPECDFAVDPIDGTTLMSKGMPNAISVLAVADRGAMFDPSAVFYMNKIA
VGPEAAHVLDITAPIAENIKAVAKVKALSVRDMTVCILDRPRHAKLIDEV
RETGARIRLITDGDVAGAISACRPHSGTDMLAGIGGTPEGIIAAAAIRCM
GGAIQAQLAPRDDEERQKAIDAGYDLDQILTTEDLVSGENVFFCATGVTN
GDLLKGVQYYPGGCTTQSIVMRSKSGTVRMIEAYHRLSKLNEYSAIDFTG
DSSAAYPLP
41408789NP_961625.1 hypothetical protein MAP2691c [Mycobacterium avium subsp. paratuberculoMVADCPRSGSVRENWDTWRMTEQPSLNASSPGESAAAAGPVPRPEKPRLL
QDGRDMFWSLIPLVIGCVVLAGLLGMCSLQLHNRPGPIPPYDAAAALRAD
AATLGFPVRQPALPAGWQANSGHRGGIQNGRTDPSTGQRLNAPTSVVGYI
SPTGMYLSLTQSNADEDKLINSIHPSAYPTGTVDVAGTSWVIYQGSGQSG
ADAEPVWTTRLTGAGGATQIAITGAGSAEQFRTLASATQSQPPLPVR
41408788NP_961624.1 hypothetical protein MAP2690c [Mycobacterium avium subsp. paratuberculoMTAPEADLSGWSVAPFSGGGYTHDVYRKGVGPGVVLIPELPGIHPGVLAL
GNHLVDNGFTVAMPSLFGEPGKPVSPGYLVAGMTRACVAREFAAFATNKQ
RPVSLFLRALARDLNASTPGDGVGVIGQCFTGGFALAAAVDESVLAPALS
QPSVPFPLGATRRRDPGVSEAELATVADRCANEGLCAMGLRFSEDWTSPR
ERFTALKQRLGDAFEVIEIDSRPGNEHGFGKTAHSVLTLEVREVDGHPAY
EARKRVVEFLTQRLGAR
41408787NP_961623.1 hypothetical protein MAP2689c [Mycobacterium avium subsp. paratuberculoMAVDDLVVETGYGPVRGVAADGVKAWKGIRYAAPPIGDLRFRAPQPPERW
TEVADATVFGPACPQPVFPNMPLDLGAPQGEDCLRLNVWASADTQPGDAK
PVMVWLHGGAYVLGSSSQTLYDGRRLVSHGDVVVVTVNYRLGALGFLDLS
SLNSAGRSFDSNVGLRDVLAALKWVRDNITAFGGDPRRVTLFGESAGAGI
VTTLLASPAAAGLFAAAIAQSSPATSVYDRDRAGRVAEAFLGKLGITASE
SRRLIDMPMAAILAASQQVFDEVPVRNPGTLAFVPIVDGDVLADYPVKVA
QQGGSHPVPLIIGTNQHEAALFRLMRSALMPITPHAITSMFNQIAAEQPD
LQLPTEKQIGSAYSRFRRRARYLSIATDVGFRMPSVWLAEGHARVAPVYL
YRFDYSTPLLRLLMVKAAHATELPYVWGTLGAPKDPTLKLGGSKTAKAVS
KRVRTRWINFAAHAKPAGPAGSPEWAPYQEQDRACLIIGKNDVLAHDVDA
KARAAWGSEMVSFR
41408786NP_961622.1 hypothetical protein MAP2688 [Mycobacterium avium subsp. paratuberculosMIGPMGDPSLTAELGRVLVTGGSGFVGANLVTTLLERGYQVRSFDRAPSP
LPAHPHLEVLQGDITDAGVCAAVVEGIDTIFHTAAIIDLMGGASVTEEYR
QRSFAVNVGGTENLVRAGQAAGVQRFVYTSSNSVVMGGQNIVGGDETLPY
TDRFNDLYTETKVLAERFVLGQNGVDGMLTCAIRPSGIWGRGDQTMFRKL
FESVIAGHVKVLIGRKSARLDNSYVHNLIHGFILADQHLTPGGTAPGQAY
FINDAEPINMFEFARPVVEACGVNWPRVRVNGPIVRAAMTGWQRLHFRFG
IPAPLLEPLAVERLYLDNFFSIAKASRDLGYQPLFTTEQAMSECLPYYVG
MFEQMKRQALAGKASA
41408785NP_961621.1 exodeoxyribonuclease VII small subunit [Mycobacterium avium subsp. paraMANNKKDEQAAAATPISRLGYEACRDELIEVVRQLEQGGLDLDASLNLWE
RGEQLAKRCEEHLAGARKRIEDALAAGEADDD
41408784NP_961620.1 exodeoxyribonuclease VII large subunit [Mycobacterium avium subsp. paraMTRAATSEPNSAENPFPVRAVAIRVAGWIDRLGTVWVEGQLAQVSLRPDS
KTVFMVLRDPAADMSLTVTCPRDLVLNAPVKLAEGTQVVVCGKPSFYTGR
GTFSLRLSEIRAVGVGELLARIERLRRLLDAEGLFDPRLKRPIPFLPNMI
GLITGRASAAERDVKTVAAGRWPAVRFAVRNTAVQGPNAVAQIVEALREL
DRDPEVDVIVLARGGGSVEDLLPFSDETLCRAIAACRTPVISAVGHEPDN
PLCDLVADVRAATPTDAAKKVVPDTAAEQRLIDDLRRRSAQALRNWVSRE
QRALAQIRSRPVLAEPLRALTARAEEVHRARSAIRHDVTRLTAAETERIG
HLRARLATLGPAATLARGYAVVQTVGAGGPHVLRSVGDAPAGTRLRVRVA
DGAVAALSEGPTDGE
41408783NP_961619.1 hypothetical protein MAP2685 [Mycobacterium avium subsp. paratuberculosMATAPYGVRLLVGAATVAVEETMRLPKTILMYPMTLASQAAHIVMRFQQN
LAELVIKGDSTLESIFPPKDEKPEWATFDEDIDDAADGYANPADGSEGER
RAEGRFALYSVADAHDDASALTRSARPSAKPAAEASVPTPAVVTELDYSA
LTLAQLRARLQSLSVDELEALLAYEQATKGRAPFQTLLANRITRATAK
41408782NP_961618.1 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Mycobacterium aviumMPPTVDMGIPGASSSVAVNPTRKRVLLAEPRGYCAGVDRAVETVERALEK
HGPPVYVRHEIVHNRHVVSTLEKAGAVFVEETDEVPEGAIVVFSAHGVAP
TVHAAAAERNLHTIDATCPLVTKVHNEARRFARNDYDILLIGHEGHEEVV
GTAGEAPDHVQLVDGVAAVDNVRVRDEDKVVWLSQTTLSVDETMEIVERL
RQRFPKLQDPPSDDICYATQNRQVAVKAMAPECDLVIVVGSRNSSNSVRL
VEVALGGGAGAAHLVDWADDIDPAWLEGVTTVGVTSGASVPEVLVQGVLE
RLAECGFDVVQPVTTAQETLVFALPREIRSAR
41408781NP_961617.1 hypothetical protein MAP2683 [Mycobacterium avium subsp. paratuberculosMSAQRASSTVESAHHSIHPNIPGLPWYAAVLVAVTATAIGYGIDAGHKEL
THVFAGFYIAGCVAAVLAVRQDGIFTTIIQPPLILFCAVPGAYWLFHDAK
VGRLKDLLINCGYPLIERFPLMLGTAGAVLAIGLVRWYFGHGQRSTTAAG
SDDAAAGPSVDVQSLVGGLVAKVRAALHPDSDGDTTEESAQRRRTRRSGS
SSRTRRTARSTRSSASSSRTRSRHARPPLDDAAEPAERPERQRRATRRSA
ASARNYDTAGRNYDAAEPPRRTRRRPRPDADPELRGQTPREPRREPRPRR
SPYERPVPRSSRFDGYDPPSGPENLGRYDSRYDTPEPPYEPRRRRPASTG
ANGTHHPISQVRYRGAAAPGQPREPHTERRTRSRTPGRTQGRPPTESWEY
DA
41408780NP_961616.1 translation-associated GTPase [Mycobacterium avium subsp. paratuberculoMSLSLGIVGLPNVGKSTLFNALTRNNVVAANYPFATIEPNEGVVPLPDPR
LDKLAEMFKSERIVAAPVTFVDIAGLVKGASEGAGLGNKFLAHIRECDAI
CQVVRVFADDDVTHVAGQVDPRSDIEVVETELILADLQTLERAVGRLEKE
ARTSKERRPVYEAALAAQETLNGGKTLFSAGTDTSLLRELNLLTTKPFLY
VFNADESVLTDPARIAELRELVAPADAVFLDAAIESELIELDDESAAELL
ESIGQTERGLDALARAGFHTLRLQTFLTAGPKEARAWVIHQGDTAPKAAG
VIHSDFEKGFIKAEIVSYDDLIAAGSMAVAKAAGKVRMEGKDYVMADGDV
VEFRFNV
41408779NP_961615.1 hypothetical protein MAP2681c [Mycobacterium avium subsp. paratuberculoMEAFVTIVLIGLAAIVLYRVILYILKERYFASEEFLAHKKKIASVVAEHN
EVADYVSEIRSGGSFRLGASSAGAQAHLASFQNTSHWNYRRDRNVANYEA
PDVHNCSLQVVRNAKADPLKYVMKYFGIKADEAHLAEVENLGDSITRLED
AVNNLAQREASITKSFNPPAFILKHYFGEFMKHVGVELSPIRVPYPVYVF
EYVSAGGNSSQRTTVTLDTPAIDALIETLSQKIRWRKSAAGQRALMTSRL
RNSIKVRDHYTCRYCSVSLAAEPHLLLEVDHIVPISKGGMSTPDNLQTLC
WRCNRTKSNKVATA
41408778NP_961614.1 hypothetical protein MAP2680c [Mycobacterium avium subsp. paratuberculoMILVDTSVWIDHLHVADKRLIEFLTNDAIGCHQMVIEELALGAIRRRADL
LRLLSNLRAFPLLTHAEVLHLVECHRLWGRGLSAIDVHLLGSVALVDGAR
LWTRDKNLKAAGWDVGIAIVDEL
41408777NP_961613.1 hypothetical protein MAP2679c [Mycobacterium avium subsp. paratuberculoMSFVEEKLLPQVLRVHDTVYRKTNGWIGHRTLWIPSLLLHTVGAKTGKPR
TTSLTYARDGENYLVVASKGGAPEAPGWYPNLKAKPEAEINVGPKRFAVT
ARIVPPGDADYARLWEIVNKNNQNRYAEYQKRTSRPIPVVVLTPKS
41408776NP_961612.1 hypothetical protein MAP2678c [Mycobacterium avium subsp. paratuberculoMAPFIAAAVEISDPQHPARVRAREYKTSVAARLSETAREAGAADPELLAE
QLALLLDGASVRTRALGTDAFRTAAGIAAALVERAIPPTAR
41408775NP_961611.1 hypothetical protein MAP2677c [Mycobacterium avium subsp. paratuberculoMKFVSTRIITADVQRLVGFYEMVTRVSAVWANELFAEIPTPAATLAIGSD
QTVPLFGAGSAEPAANRSAIVEFIVDDVDAEYERLREQLTEVVTEPTTMP
WGNRALLFRDPDGNLVNLFTPVTPEARAKFKV
41408774NP_961610.1 hypothetical protein MAP2676c [Mycobacterium avium subsp. paratuberculoMAAEHWAEPPEESERRSDALDQREKALARREADVRRREWLAGRRDRVADQ
REQIADERERLADEREQLADEREGTVAERERARLRRIDERVKRTRARANR
EQAEVDREIAESERDDA
41408773NP_961609.1 hypothetical protein MAP2675c [Mycobacterium avium subsp. paratuberculoMSLINQVSGTPYISGGDSPAGTDCSGLASWIANAATDRPVFGDRFNTGNE
EAALLARGFQYGTAPNALVIGWNGGHTAVTLPDGTAVSSGEHGGVHVGGA
GAYQAGFTHHMFLPMPPEDGGAPPPPDAPPPPPDAPAPPPDAPPAPPEAP
AVLIDAPAPVPPPPPGP
41408772NP_961608.1 hypothetical protein MAP2674c [Mycobacterium avium subsp. paratuberculoMPPRAEEGNLWFEWSRSLDDPAEYVLVEAFRDGDAGSAHVNSDHFKRAMQ
ELPQALKSTPKIISQTVEATGWSRMGEMTVD
41408771NP_961607.1 hypothetical protein MAP2673 [Mycobacterium avium subsp. paratuberculosMQTIPDLVGGVGPAFPLVADHQHAAGDDAGRTGQPEPLPHAAHATRLGVV
VIDWIPAWPYPREAGRGGGDVGENCSGRRAYTMLTLNQALEETRTGDLWL
FRGGSGPDRAIQTLTNSPVNHVGMTVAIDDLPPLIWHAELGDKLVDLWTG
TNHRGVQLNDLHQSVLQWTQRYRQRCWLRQLTPPATREQENRLLRVIARM
DGTAFPTTMRLTGRWLRGRLPTAYDWARGIPVVDKKIRETMRRRKERQRL
GLEAAYCAETVAITYEEMGLLTTEKYSNWFDPGSFWSGDKLPLTPGYALG
DEIEIAVDR
41408770NP_961606.1 hypothetical protein MAP2672 [Mycobacterium avium subsp. paratuberculosMLAGGREAVKTVWNTANLVRKEGFGAAVRSSIEELADWAEVERPDLARVT
PDGRVVILFTDIEESTALNERIGDRAWVKLISSHDKLVSDLVRRQSGHVV
KSQGDGFMVAFARPEQAVRCGIELQRALRRNANRKRHEEIRVRIGIHMGR
SVRRGDDLFGRNVAMAARVAAQAAGGEILVSQPVRDALSRSDGIRFDDGR
EVELKGFSGTYRLFAVLASPDPD
41408769NP_961605.1 glucose-6-phosphate 1-dehydrogenase [Mycobacterium avium subsp. paratubMADDDSHPSDLLVIFGITGDLARKMTFRALYRLERREELEHPIIGVASDD
ITLDQLLDRAREAIKATGETFDDAVFDRLAGRLSYLSGDVTDAGLYSELA
KKIGGDSRPLYYLEMPPSLFAPIVENLAKADLLERARVAVEKPFGHDLES
ARDLNARLRAVLDEDQILRVDHFLGKQPVEELQYLRFANNALAKLWDRDS
ISEIHITMAEDFGIEDRGKFYDAVGAVRDVVQNHLLQVLALVAMEPPVGA
GADDLNDKKAEVFRAMPSLDPEHCVRGQYRGYTEVPGVAKDSTTETYVAL
RAEIDNWRWAGVPIFLRAGKALPHKVTEVRMFLHHVPGFSFLPNRRPPEP
NQIVLRIDPDPGMRLQLSAQVGDSWHDVHLDSSFAVDLGEPVRPYERLLY
AAFNGDRQLFAREDAIEETWRIVQPVLDKPSRIHQYEQGSWGPEAAQALV
HGRHAWQQPWLPQSTSTKR
41408768NP_961604.1 6-phosphogluconate dehydrogenase-like protein [Mycobacterium avium subsMQLGMIGLGRMGANIVRRVVKGGHECVVYDHNPDAVKAMAGEEKTTGVSS
LQELAAKLSAPRVVWVMVPAGTITTGVIEELATTLEPGDIVIDGGNSYYR
DDIRHSKTLSEKGIRLLDCGTSGGVWGRERGYCLMIGGDEEAFAHAEPIF
ATVAPGVDAAPRTPGRDGEVTRSEQGYLHCGPSGAGHFVKMVHNGIEYGM
MASLAEGLNVLRNADIGKHAQEGDAETAPLSNPEFYQYDFDIPEVAEVWR
RGSVIGSWLLDLTAIALHESPELKEFSGRVSDSGEGRWTSIAAIDEGVPT
PVLTTALQSRFASRHLDDFANKTLSAMRKQFGGHAEKPAN
41408767NP_961603.1 BpoB [Mycobacterium avium subsp. paratuberculosis K-10]METHRVVGPRKSAYATYVTSEPMSTVSSSPETVEFAGVDGITLVADEWNR
GSDGAGRPSILMLHGGGQNRFSWKNTGQTLADEGLHVVALDSRGHGDSDR
SPQADYQIETLTADVLRVLDAIGRPVTIIGASMGGLTGILAAHRAGPAKV
TRLVLVDVVPRFEKDGSARIRDFMISGLDGFDSLEQAADAVAAYLPYRSK
PRSPEGLKKNLRLRDGRWYWHWDPAFMTKPGDDPELRTESFEQAAKNLSI
PVLLIRGKLSDVVSPEGVRHFLATVPRAEFVELSNAGHTAAGDDNDAFSD
AVVAFVKRR
41408766NP_961602.1 hypothetical protein MAP2668c [Mycobacterium avium subsp. paratuberculoMPSITPSLWFDDNLEEAATFYTSVFPNSHIEGFNRTTEAGPGEPGTVLSG
SFVLDGSRFIGINGGPHFRFSEAVSFTVHCKDQDEVDYYWDRLSDGGEES
QCGWLKDRFGLSWQIVPDRLFELIGDPDRSRAAAATQAMYGMRKIVIAEL
ERAAASS
41408765NP_961601.1 EphC [Mycobacterium avium subsp. paratuberculosis K-10]MKMAEPGWIDVTGPAGDLKALTWGPPDGPLALCLHGFPDTPYGWRKLAAR
LADAGWRVVAPFMRGYAPSAIPSDGSYHVGALMDDALRVRAAAGGTDNDV
VIGHDWGAIAATGLAAMPDSPFAKAVLMSVPPSAAFRRRGGSAAERGRLA
AHLARQVFRSWYILYFQLPWLPERSASWVLPLLWRRWSPGYRAEEDLRHV
DAAIGAPESWRAALGPYRATIRNTAPPAQYATLHRLWTEEPVLPCLYLHG
RDDGCMTSAFAHQVEKVLPPGSEVDIVEHAGHFL
41408764NP_961600.1 hypothetical protein MAP2666c [Mycobacterium avium subsp. paratuberculoMTGHRMAAVDAQFYWMSAKIPNDEFLLYAFDGEPADYPAAADQLRRRADA
EPALSIRVRDRGRLRYPHWVPAAVAPEQVVRHELAEHSWDGCLAAVAGLA
DDQLDLRRMAWRLHVFGPVHGIPGVRGPGTVAVLQVAHALADGARAAALA
ARLFGRAAPVPEVPVPRPGWLPWRAAVAARTHCQLVRDTRAGRLAPGAGP
RPLLPTNARPAGVRSLRTLVRHRAQLPGPTATVAVLGAVAQALSDLLGDQ
ADSLGAEVPMAKPGAPQAYNHFGNVVVDLHPRLGAQARAERIAAGLAAGR
RRFEHPATRAADRAFAAVPAALLRWGVDQFDADQRPDQVAGNTVVSSVNR
GPADLSFGGARVVLTAGYPALSPVMGLTHGVHGIGDTIAISVHAAASAVP
DVDAYLALLDAAL
41408763NP_961599.1 hypothetical protein MAP2665 [Mycobacterium avium subsp. paratuberculosMTELAVLQAIRLKGRVSRADLAATLGTDPDEIAGTVERLSAAGLVTGDAT
LWITPAGSARLTALLAEERRGIDAAAMAAVYDDFRAINADFKRLVTDWQL
KDGAPNRHDDAEYDDAVLARLDDAHARVTPVIEAAAAQLPRLNRYAAKLA
AALDKVRAGDTAWLTRPLIDSYHTVWFELHEELIVAVGLTRQEAARSGDA
Q
41408762NP_961598.1 pyruvate phosphate dikinase [Mycobacterium avium subsp. paratuberculosiMPESAATPRRGCTTARTAPGSGAHRNASRDRDAAPTEQSVVLLDGTSSHP
RELLGNKGHGIEVMRRHHLPVPPAFCLTTAVGLRYLADPAATMDAVWDDV
LDRIGWLQAQTSRTFGRGPHPLLVSVRSGATQSMPGMMDTLLNLGINDSV
EQALAAEHGPAFARDTHRRFREMYRRIVGVERPVPSDPYTQLRAGIEAVF
ASWNSPRARAYRAHYGFADRHGTAVVVQAMVFGNHGPNSGAGAFFSRNPI
TGDDEPFGEWLPGGQGDDVVSGSVDVEPIAALRDEQPAVYDQLMAAARTL
ERLDRDVQEIEFTVEDGALWLLQTRAAERSAQAAVRSALQLRREGLIDDA
ETLRRVTPAHVRSLLMPALQPEIRLAAPLLAKGLPACPGVVSGTAYADVD
EALHAAERGEPVILVRDHTRPEDVSGMLAARGIVTEVGGAASHAAVVSRE
LGRVAVVGCGAGVAAMLAGRRITVDGAEGEVREGELSLSAWSENDTPELR
ELAEIARLISPLRAHSGGDHPRLDDDSESAVRAALAAGQTDVVSPTPLLV
MLTALRQGAP
41408761NP_961597.1 hypothetical protein MAP2663c [Mycobacterium avium subsp. paratuberculoMTPYDVGLLILRLVLGVTLAAHGYNKFFGGGRIPGTARWFESIGMKPGKF
HATVAASTEMAAGLGLAAGLLTPIPAAGFVSLMLVAAWTVHRPNGFFIVK
EGWEYNLVLAASAVVVATLGAGRLSLDWLVFGKNWMDGWNGLLISLLLGL
AGAIGQLVIFYRPPAKQTG
41408760NP_961596.1 hypothetical protein MAP2662c [Mycobacterium avium subsp. paratuberculoMGFLKPELPQLDMAEWSKGTRSDKIRPMAKHWAEVGFGTPVALHLFYVVK
ILLYILGGWLFASATRGLGGFTHVASWWSEPIVFEKVVLYTMLFEVIGLG
CGFGPLNNRFFPPMGSILYWMRFGTIRLPPWPDRVPFTAGTKRKPVDVAL
YALFLLLTLAALFADGTGPVPELGTTIGLLPAWKIVLILLVLAVLGLRDK
VIFLAARGEVYASMAVTFLFGAPDMIVGSKVVFLVIWMGAATSKLNKHFP
FVISTMMSNNPLVRPRWLKRRFFEKFPDDLRPGRLSRWIAHLSTAIEMLV
PLPLFFCHGGWPVTVAAVVMVCFHLGILVSIPMGVPLEWNVFMIFGVLSL
FVAHTGIGLGDLRHPVVVAVLFVVIAGIVVLGNMFPRKISFLPGMRYYAG
NWDTTLWCIKPSASEKISRGIVAIASMPQAQLERFYGSPEAAQIPLYMGY
AFRGFNTHGRALFTLAHRAMAGQNEDDYVITDGERICSTAIGWNFGDGHM
HNEQLIAALQERCHFEPGEVRVVLLDAQPIHKQTQAYRLVDAATGEFERG
IVRVADMVVRQPWDDDVPVQVVSDDAPSVTPE
41408759NP_961595.1 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase [MTPQAFTATVVGSPRIGPKRELKRATEGYWAGRTGRAELEKVAATLRRDT
WAGLAAAGLDSVPVNTFSYYDQMLDTAVMLDALPERARQVSDDLDRYFAA
ARGNSDVAPLEMTKWFDTNYHYIVPEIAPTTKFALNPDKVLSELKEALAQ
GIPARPVVIGPITFLLLSKGVDGAGAPIERLEELVPIYAELLSLLADNGA
QWVQLDEPALVTDMCADAPALAEAVYNKLGSASNRPAIYVATYFGDPGAS
LAGLARTPVEAIGVDLVYGPDTAVAAVPELAGKTVVAGVVDGRNVWRTDL
AAALDKLTTLLGSAARVAVSTSCSTLHVPYSLEPETDLDDALRSWLAFGR
EKVAEVVTLARALRDGREAVADEIAASNAAVASRKSDPRLHNDRVRARID
SIVASGSHRGDPAQRRASQDARLHLPPLPTTTIGSYPQTSAIRKARAALR
SGEIDQAEYERRMKKEIADVITLQEQLGLDVLVHGEPERNDMVQYFAEQL
EGFFATQNGWVQSYGSRCVRPPILYGDVVRTHPMTVEWISYAQSLTDKPV
KGMLTGPVTILAWSFVRDDQPLADTANQVALAIRDETVDLQAAGIAVIQV
DEPALRELLPLRRADQDEYLRWAVGAFRLATSGVADSTQIHTHLCYSEFG
EVIGAIADLDADVTSLEAARSHMEVLDDLNAVGFSNSVGPGVYDIHSPRV
PSTAEIAESLRAALRAVPAERLWVNPDCGLKTRNPDEVSASLKNMVAAAH
EVRAGV
41408758NP_961594.1 hypothetical protein MAP2660 [Mycobacterium avium subsp. paratuberculosMARVVIVGGHGKVALQLSAILTQRGDAVTSLFRNPDHADDVAATGAKPVV
ADIERLDTDALAGHDAVVFSAGAGGGNPARTYAVDRDAAIRVVDAAARSG
VKRFVMVSYFGAGPDHGVPQDDPFFPYAESKAAADAHLRVSDLDWTILGP
GRLTLDPPTGRIAVGRGKGEVSRADVASVAAAALADDSTIRRTIDFNNGD
VPIAVALAG
41408757NP_961593.1 hypothetical protein MAP2659 [Mycobacterium avium subsp. paratuberculosMTIVDRLRYDGKRALVVGGATGMGAAAAKSAAELGAEVIVLDYAPVTYDV
AKSIQVDLRDPASIDAALEQLDGPVHAVFSAAGIAEGTTDLMAINFLGHR
YLIERLLERNQLPSGSAICFISSVAGMGWENDLDLLNEFLATPDFATAQE
WVKAHEPEGIIHYGFSKKVVNAYVATQGYPLLKKGIRINAICPGPTDTPL
AQANADLWLTFAQDYRDETGSKVHTPEQMGDVMAFLNSAAAFGINGITLL
VDYGHTMASLTGAYPPGKPIIDIIMGRVKL
41408756NP_961592.1 hypothetical protein MAP2658 [Mycobacterium avium subsp. paratuberculosMAKAESLRAGSTADSPTRRAEILATAASLIASSGLRTSLQEIADAAGILP
GSLYHHFESKEAILVELTRRYQEDLERIGRAAQARLDEPDSRPVPEQIIE
LGSAIANCAVEHRAALQMSFYEGPGTDPELTKLTRQRPVAIQEAMLQTLR
AGRWSGYIKPDIDLPTLADRICQTMLQVGLDVMRHTASADPVAELLCRII
LQGLASRPPSDTALDRSKAFAAANEVIETWSDDSDADPGDKAALVRAVAR
AEFGRRGYEVTTIRDIAAAAGLGTGTVYRVIGSKDELLDSIMRSFGKKVE
AGWVSVLRSDATPTEKLDALSWVNVNALDQFSDEFRIQLAWMRLSPPTAN
PGWSYATRLRQMKSLLSEGLRTGEIAIAAPSTAMLARCLIALQWIPENIL
AEIGKRPALLHVRDTVLRGVAVRGAAVDN
41408755NP_961591.1 hypothetical protein MAP2657 [Mycobacterium avium subsp. paratuberculosMMNVEYLLTATPSARKSLDLDAPVDPGDIRECLRIGLQAANGSNAQSWRW
LVVGDPALRARIAELYRDAYLRRVGGRLLAGLMPAGTPESRIMSSTEWLV
ENLARVPMLVIPCYEPYLPRIDGDESFHLATLYGSIFPPVWNFQLALHTR
GYGTCITTLHLHHEDEVAQLLGIPPTYVQGCLLPVGRLRAGRTFRPARRR
PIQEVIACDRWDAPPL
41408754NP_961590.1 hypothetical protein MAP2656 [Mycobacterium avium subsp. paratuberculosMNLELTDEQVALRDTTRRFLAEKAPIAHHVRRLLDDPTGIEPAVWRGLAD
LGCTGLLVPEQHGGAGMTMVEAGIVAEELGAALYPGPWLSTAVAAPRALI
RLCAGGDTAAGLLRGIADGTTHVAVCFLDTPPMAATREGETTALHGQARA
VPDAAAADVLLALAEDAGDTALFAVNTGSAGVAVTPEHHIDPTHKQSRVT
FDAAPARRLATASADDVAAVVDDVLIAACADALGAARAVMDLAVEYAKTR
TQFGQPIGSFQAVQHLCVDMYETVELARSGVIHALWVSDAPDGDERHLAA
LRAKAFAGRLAGVADTAIQVFGGIGYTWEHDAHLYLKRLLGYSAFLGGPD
RYLTEVGARLAKRGSP
41408753NP_961589.1 hypothetical protein MAP2655 [Mycobacterium avium subsp. paratuberculosMSGKMDFCYPAEVERFRTELRDWLSDNLTDELVKARRSGGRDDAAFEMLR
AWNQTMADAGWAAVSWPREYGGRGATVLEQLVYTEETTRARAPLPLNVIG
LNNIAPAIMQYGTEAQKQRLLPRMMRADDIWCQGMSEPDAGSDLAALRTR
AVRDGDDFVVTGQKIWTSLGHRADWCQLYVRTDPDAPKHKGISCLIVDMT
LPGIEARPRVTLGGDADFAEVFFHDVRVPADALLGPLNAGWQVATTTLSH
ERAGAARLYAEMQVRLEELVDDLAAAGTGALDDPVTLRRLGELAVRIKYL
EVLCQRSISATLHGGSELVALGSASLAKTVWGEIGQDLAALAFDVLGSRD
DGRAWANYRLTSRSLTIAGGTTQINKNITAQRVLGLPRK
41408752NP_961588.1 hypothetical protein MAP2654c [Mycobacterium avium subsp. paratuberculoMTAVQPDSTVGTDIWSTSRRLSMGDDACADQWQALGMLASALAGRAVAVA
GLPPGEPAWTDGQTIYVDAGAPGALKSLAVQASMIAAGSLRPDVVGRLLR
HRKLAQRYLTVEGHRALVANAPVLPRVLASLGDRGVAGRSDSPRASLALA
AARVALPDPAPEFGVIRAGKVLAACGRAARPDQPDDKAAPAHVPRRDGAA
DLAELDDAAVDDSDDPDLFTSPVGGGGALGKWLKKLLSSARKTGTGGGPP
GADSPTHRTDSGKRGAYAVASLASAPADEGNDEDPADGVRYPEWDVARGS
YRPAWCTVREVEPAITARATLAVDDAIAVRRPLARLGMGLHRRHRQPQGD
DIDIDAAVEARVEVRAGSVPDEAVYLDSLRRRRDLSVLLLLDVSGSAAEP
GTVGRTVHEQQRAAVADLAVALHDLGDRVALYAYYSQGRRAVSMVPVKRF
HDQLNAQVIRRLNSLEPGAYSRLGAAIRHGSAILEARGGTSRRLLVVLSD
GLAYDHGYERAYGAADARRALTEARRRGTGCVCLTVGAGTDVQSLRRVFG
TTAHATMARPDQLAGVIGPLFRSALRAAEVRRRTAANARAGTATSRRPHT
SAHVGAG
41408751NP_961587.1 NirQ [Mycobacterium avium subsp. paratuberculosis K-10]MPVPRHPAGRTHRRTWAPANRREAMVDQSGLAYVHAAEARPYYRAVGSEE
AVFKAAYRQGLALVLKGPTGCGKTRFAEAMAYDLGRPLITVACHDDLTTA
DLVGRYLLRGDETVWVDGPLTRAVREGAICYLDEVVEARQDTTVVLHPLA
DHRRQLPIERLGITLDAAPGFGLVVSYNPGYQSVLKDLKDSTRQRMVAIE
FDFPAADVEEGIVAHEAGVDAATAAELVRFGQAIRRLETAGLREVASTRV
LIAAGRLVAEGLSLPEAARAAIAGPLTDDVAVGKALGEMIGIYFGSGGSL
GSDD
41408750NP_961586.1 hypothetical protein MAP2652c [Mycobacterium avium subsp. paratuberculoMSYESSAEPIKVGYLMDFALPPGFPEEMKADFTRCFDLVFAEAAEQGVLD
RPVQMIYREVEGLPKGSVKAVIDAFGELVDEGCLVVFGPHITDNCVPTRE
AIEERFKVPALSVTGTDDWLGEWTFSFPQGSMTDEPIFIADLVAKRGLSE
IGVLVEQNLIGESYLKNLRSACRRKGIRIVAEAAIAQIAQDINEAVRTLH
DAKSEAIVHLGFGFGIVFINPALQAVDWDPPRFTTTAFQNAWVNPIMWNA
FMGWVGVDQYDEDNRIGQDFLDRYAAKYGGRRPEYCVPVVNCDVAATLVR
AFADAHPLSPRGVKEALERVKMMPAASGAPGTRVSFGKWTRRAWMGAGYL
VARTLDADGVNSHLVDRFGEEG
41408749NP_961585.1 hypothetical protein MAP2651c [Mycobacterium avium subsp. paratuberculoMSTEQTTSPAAQRESAAPRRTGTRGWGGWVAGAGLAAFALFFIANCRVAL
DPRVADPNVQGRPRPVKFIFGLDYMTFIQISTVVMLIVLVVVFVRGWRRN
PGSPAMLMFLCTTLIVWQDPIMNWAPFAVYNPDLIHWPESWPLVSLSPTV
EPFVVFGYVTFYFGPYFPAVWILRRLQAKYGPQSFFARHPLVSLGVLTCA
IGFVFDAWLEIQLVHMGMYIYSQVIPWGSVFTGTTFQFPLIWESFSVTFV
MVPAAILCYRDDTGKSVAEKLAAKAKLFPARPVLGTFLVMFVIINVSYFA
YGAWFAVIKATKAATSVACPWPYPEAKVYDPQGFYEKAGAQGPYSVGIWS
TWMSGQPHGRPDVQPPPPGAGACATTAVGHG
41408748NP_961584.1 hypothetical protein MAP2650c [Mycobacterium avium subsp. paratuberculoMAEPRSVVITGASRGLGFASALRMYREGWRVVAAMRTPDQGMPLLRRAIR
DGTGQDPDDDRLIGVQLDLTDSASVAAAAKAIEEAVGAPSAIVHNAGISA
AGMVEETDTALWQRMFATSVLGPVALTQALLPSMRAAGRGRIVLVSSAAG
VRGQPGTAPYSAAKGALERWGESLAGEIAPFGLGVTVLVAGTYDTEIITD
AGTTDDRNFSGPYARLHTTMNTRGRLAVSFARRPERFTDGLYKALDDRAP
FRRRGVGPDASVLLAANRILPASGMHHLSRVVLGIPRQGSMRDGAWPLTH
GQRAMVLVARVLPQPVLQRLAALAGRFSSPKSAARQGDQEG
41408747NP_961583.1 hypothetical protein MAP2649c [Mycobacterium avium subsp. paratuberculoMEQLFDDLEDFGAFDDAVSGDVRDPYTELARLRREEPIQRLDTSGMPHEE
SKPVFIVYRHEDAQQMLRDNETFSSAAVIAAFGPVLGERVMLGIDEPVHG
RLRSLVSKAFSQKALARWEDELVGRVGNSLIDRFAGNGKADLVKEFTFDY
PSRIIAGLLGLPEQDYPQFQRWSISLLSWILNPERGLAASAALCDYFAPI
LAARRAEPKDDLISGLAQAEIDGEKLEDEEIYSFLRLLLPAGVETTYRAL
GSLLLALLSDPEQLDAIRGDRSLLPQAIEEGVRWEPPLLTITRVATRDTE
LGGVPIPAGSTVMPMLGAANRQEDRYPDPDRFDIFRAPKSHLGWGHGVHV
CLGMHLARLEMRTAVNLLLDRLPNLRLDPDADDPHIRGQVFRSPTSVPVL
FDPQ
41408746NP_961582.1 hypothetical protein MAP2648c [Mycobacterium avium subsp. paratuberculoMTDMTEAVKVRFEPKMMIDGKLVDGQAGTFTNINPATEEPLGEVADASKE
DMHRAIDAARRAFDETDWSTNRELRKRCLLQLHEAIESEKEELREELILE
VGSPRAITFGPQLDAPLEDGLKYPARLIDEYAWETDLGDKVISLTGTLTT
RKVWREPVGVVGAIVPWNFPFEVTLNKLGQALGTGNTVVLKPAPNTPFNA
TRLGRLIAEKTDIPAGVVNVVTASDHFVGEELTLSPKVDLISFTGSTVVG
QRIMEKGAATMKRLFLELGGKSATIVLEDADFGMACAIGIAPCMHAGQGC
ANPTRMLLPRSRYDEGVAILKGIYENVTCGDPQDPGPFAARSFRRCSATA
41408745NP_961581.1 hypothetical protein MAP2647c [Mycobacterium avium subsp. paratuberculoMGYIRKGVEEGATALVGGPDAPTGFDKGYYVRPTLFTDVDNSMTIAQEEI
FGPVLCVIPFDDEEDAIRIANDSKYGLAGNVMSGSLERSLSVARRIRAGF
MGVNGGAPYGADTPFGGYKYSGVGRQNGVAGFDQYTEIKSVAYPAG
41408744NP_961580.1 FadA6_3 [Mycobacterium avium subsp. paratuberculosis K-10]MAEAVIVEAVRSPIGKRNGGLSGVHPAELSAQVLNGLVDKAGVDPGIVDD
VIWGCVMQAGEQALDIGRTALLTAGWPETVPGVTVDRQCGSSQQSIHFAA
AGVIAGHYDVVVAGGVESMSRTPMGASLANGGRPYPQAFLDRYQGQIPNQ
GIGAEMIAEKWGFDRTALDEFSLASHEKAAAAQDSGAFDDQIVGIKDQDG
NVVLKDEGIRRGTPMEKMASLKPAFKEDGVIHAGNSSQISDGSAAILFMS
AEKAKELGLKPIAKVHTATLAGADPVIMLTAPIPATQKVLKKSGLSIDDI
GVYEVNEAFAPVPMAWLKDIGADEKKLNPNGGAIALGHPLGGSGARIMTT
LLYHMRDKGIRYGLQTMCEGGGQANATIVELL
41408743NP_961579.1 EchA1_1 [Mycobacterium avium subsp. paratuberculosis K-10]MTDAPGALAERRGNVMVITINRPEARNAINAAVSIGVGDALEEAQHDPEV
RAVVLTGAGDKSFCAGADLKAIARRENLYHPDHPEWGFAGYVRHFIDKPT
IAAVNGTALGGGTELALASDLVVADERAQFGLPEVKRGLIAAAGGVFRIA
EQLPRKVAMRLLLTGEPLSAAAARDWGLINEVVEAGSVLDAALALASAIT
VNAPLSVQASKRIAYGVDDGVVVGDEPGWDRTMREMRALLKSEDAKEGPR
AFAEKREPVWQAR
41408742NP_961578.1 hypothetical protein MAP2644 [Mycobacterium avium subsp. paratuberculosMMAYDADLLVVGGGPGGLATALHARRLGLSVIVAEPREAPIDKACGEGLM
PGGLAALTALGVDPAGMPFQGIAYLSEHRRAQARFRDGPGRGVRRTTLHA
ALAARAKEQDTEWIRARVSSVAQDAHGVSAAGVRARWLVAADGLHSTVRR
AVGIAATAGTPRRYGVRWHYRVPAWSEFVEVHWSRWGEAYVTPVEPDLVG
VAILSRGRPDLGWFPGLAARLRAAERGRPRGCGPLRQVVSRRVAGRVLLV
GDAAGYEDALTGEGISLAVKQAAAAVRAIVDERPASYEAAWHRITRDYRL
LTRALVLASTPRAVRRAIVPAGALLPGAFRAGVNILAR
41408741NP_961577.1 hypothetical protein MAP2643 [Mycobacterium avium subsp. paratuberculosMYCLLVLAVGLERVAELLVSTRNARWSFTQGGKEFGRSHYPVMVFIQTAL
LAGCLVEPWALHRPFLGWLGWPMLAVVAASQGLRWWCITTLGRRWNTRVI
VLPQAPLVRDGPYRWLHHPNYVAVVAEGLALPLVHTAWLTAAVFTLANAA
LLRVRLRVENSALGYT
41408740NP_961576.1 hypothetical protein MAP2642 [Mycobacterium avium subsp. paratuberculosMGESPSITGVAVKFPPNRYTQSEAIRALTDIAGPEFRRFAHSSGVEFRNT
ALRLPRYRELSGFSEANDAYLEVALDLGEQALVAALDRGKVKPSEVDIVF
STTVTGLAVPTLEARLATRVGLRPDVKRVPLFGLGCVAGAAGVARMHDYL
RAFPDQTAALLAVELCSLTIQRHDTSIANLVATSLFGDGAAAVITEGARR
AGAEHTGPRILATRSRIYPDTEEVMGWKIGGDGFRIVLSADVANIAEKYL
GEDVRDFLADHGLAPRDVTTWVCHPGGPRVIEAVESVLDLPADALDHTRN
SLRENGNLSSVSVLDVLAANLADPPAPGSIGLMIAMGPAFCSELVLLAF
41408739NP_961575.1 hypothetical protein MAP2641c [Mycobacterium avium subsp. paratuberculoMIHVPVTTGPRRWFKRASPRRARNATAGIRPENRPDVTDAVGTPPTRAVG
TPPTRAVGTPPPYAVGTPARRRAGLGSGVMRVLVTGATGYVGSRLVTALL
AGGHDVLAATRNPLRLKRFGWFEEITPVPLDAADPASLRSAFAGCGPVEV
VYYLVHAIGQPGFRDADKAAAANLAAAAKDAGVRRIVYLGGFVPAGEVLS
EHLTSRAEVAEALAVPDGPELVWLGAAMIIGAGSTSFEMMRYVGDRFPLM
PIPSWMDNPIDPISIRDVLHYLLAAADRDLVPAGAYDISGPDTTSYRRLL
KTYARLSGRWHTGLPVGRVDTGLASLVTGVALPVPPGLAGDLVESLDHPM
VASGSDLRQRVPDPPGGLLGVDDAIARALDDRSYRRPRPVNALADPHHLA
DTDPGWAGGDARRIRQLAGRVTPAIARPTLGLVNKVPGPVAGAVRTGLDI
LIALTPKVRPA
41408738NP_961574.1 hypothetical protein MAP2640c [Mycobacterium avium subsp. paratuberculoMSQSTSPYHTSVFAELRRAITNVAVPHNEPPTIVRRRRVVVAITLVLGAA
VLGYSLRRHPGESSFYWLTLGLAAVWTVGALSSGPLHLGGICWRGRNQRP
VITGTTVGLLLGGAFVVGGLIAREIPAVSALITRVLLFAHHGWLPLVVAI
TVINGIAEELFFRGALYTALGRYHPVLISTLLYTAATMAAGNPMLGFAAV
ILGTVCALERRASGGVLAPVLTHCGWGLIMVLALPPVFGL
41408737NP_961573.1 enoyl-CoA hydratase [Mycobacterium avium subsp. paratuberculosis K-10]MPSSAIATLAPVAGLDVTLSDGVFSVTINRPDSLNSLTVPVITGIADAME
YAATDPEVKVVRIGGAGRGFSSGAGISADDVSDGGGVPPDEIILEINRLV
RAIAALPHPVVAVVQGPAAGVGVSIALACDVVLASENAFFMLAFTKIGLM
PDGGASALVAAAVGRIRAMQMALLPERLPAAEALAWGLVTAVYPADEFEA
EVDKVIARLLSGPAVAFAKTKLAINAATLTELDPALQREFDGQSVLLKSP
DFVEGATAFQQRRTPNFTDR
41408736NP_961572.1 Mcr [Mycobacterium avium subsp. paratuberculosis K-10]MAGPLQGLRVVELSGIGPGPHAAMILGDLGADVVRIDRPSGAPGGVVKDA
MSRNRRIVTADLKSDQGRELVLKLVAKADVLIEGYRPGVTERLGLGPQDC
AKVNDRLIYARMTGWGQTGPRSQQAGHDINYISLNGILHAIGRANERPVP
PLNLVGDFGGGSMFLLLGILSALWERQSSGKGQVVDAAMVDGSSVLVQMM
WQMRASGMWTDARGTNLLDGGAPYYDTYECADGRYVAVGAIEPQFYAAML
AGLGLDGADLPGQNDVSRWPELRAALTEKFASRDRDHWAKVFADSDACVT
PVLAFGEVQTEPHITERNTFYEVDGGLQPLPAPRFSRTAPQTPRPAAPVT
DATAILDEWV
41408735NP_961571.1 hypothetical protein MAP2637c [Mycobacterium avium subsp. paratuberculoMEIKDAVAVVTGGASGLGLATTKRLLDRGAQVVVIDLRGEDAVRELGDRA
RFVQADVTDEAAVGKALDTAESMGPLRINVNCAGIGNAIKTLSKDGPFPL
DAFKKVVGVNLIGTFNVLRLAAERIAKTEPIGPGTSPERGVIINTASVAA
FEGQIGQAAYSASKGGVVGMTLPIARDLARELIRVVTIAPGLFKTPLLGS
LPEEAQASLGKQVPHPARLGDPDEYGALAVHIVENPMLNGEVIRLDGAIR
MAPR
41408734NP_961570.1 hypothetical protein MAP2636 [Mycobacterium avium subsp. paratuberculosMVAHTLSVMWIDDTSADVIKVDFEALYHGDVLVEGETSEQFDELQAAS
41408733NP_961569.1 hypothetical protein MAP2635c [Mycobacterium avium subsp. paratuberculoMSRTIQRPAQWGAPAAEGLTMLQKIARVAIAAPRRIIALGVLVFLAAAVF
GIPVAKSLSPGGFQDPDSESARAIGVLTDKFGQSGQQMLILVTAPGGSNS
DPARRVGTELVGQLQRSPLVYNVSSPWTAPPQASADLVSRDGKSGLIVVN
LKGGENFVQNNAQTLADQFVHDRDGVTVRAGGAAMQYAQINTQNQADLLV
MEMIALPLSFLVLIWVFGGLLAAALPMALGALAVVGSMSVLRLITFTTEV
SIFALNLSTALGLALAIDYTLLIVSRYRDELAEGHDRDQALIRTMATSGR
TVLFSAVTVALSMSATVAFPMYFLKSFAYAGVATVAFVATASIVITPAAI
VLLGDRLDALDVRRLLRRALRRAQPVRKPVEQLFWYRSSKFVMRRWAPVG
LIVVGLLLLLGLPFFSVKWGFPDDRVLPRSASAHQVGDRLRSGFAHDSAT
SVPVVIPDAAGLSPADLDDYAAALSRVPDVSAVSALGGTFTGGTRVGPPA
GATGLGDGSAFLTVSSTAPLFSTANDVQLKRLHEVPGPAGRSVEMGGVAQ
VNRDSVDAVTDRLPLVLGLMAAITFVLLFLLTGSVLLPAKALACNFLSLT
AAFGALVWIFQDGHLGALGTTPSGTLVANMPVLLFCIAFGLSMDYEVFLL
SRIREYWLASGAARPARPTPKRAHAANDESVALGVARTGRVITAAALVMS
MSFAALIAAHVSFMRMFGLGLTLAVFADATLVRMVVVPASMHVMGRWNWW
APKPLAWLHDRFGISEAADEEPRLAEPALGPVGSVGLPGGAVAEPVPNIG
41408732NP_961568.1 hypothetical protein MAP2634c [Mycobacterium avium subsp. paratuberculoMHTGMTTVVVDNPFFARIWPVVATHETAAVRALRRENVAGLTGRVLEVGA
GIGTNFPLYPETVDEVIAVEPEPRLADRARAAAQVVPVRVVVTGETAEAV
GGDEPFDAVVCSLVLCSVRDPQGVLRRLYSLLRPGGQLRYLEHIASACAR
GRFQRFVDATLWPRLFGNCHTHRDTERSIVEAGFDVDASRREWTLPAWSP
MPVSELLLGRAHRPA
41408731NP_961567.1 NAD-dependent deacetylase [Mycobacterium avium subsp. paratuberculosis MRIAVLSGAGISAESGVPTFRDDKNGLWARFDPYELSSTQGWRDNPQRVW
GWYLWRHYLVADVAPNAGHRAIAAWQDHAEVSVITQNVDDLHERAGSRPV
HHLHGSLFEFRCARCAKPYTGELPAMAEPALEVQPPVCGCGGLIRPDIVW
FGEQLPDEPWRRAVEATESADVMVVVGTSAIVYPAAGLAELALSRGAAVV
EVNPEVTPLSASATLSIRETASQALPGLLQRLPALLN
41408730NP_961566.1 hypothetical protein MAP2632c [Mycobacterium avium subsp. paratuberculoMELGDWLRVDMKAGKPLFDQLRTQVIEGVREGALPPGTRLPTVRELAGQL
GVAVNTVARGYRELESAAIIETRGRFGTFVARYDPTDAAMAAAAREYVRV
ARGLGLDKADAVRYIESVPDE
41408729NP_961565.1 hypothetical protein MAP2631 [Mycobacterium avium subsp. paratuberculosMVVTGPGWWNRGMTEYAAFLRGVNVGGVNLKMADVKKALTDAGFTAVRTV
LASGNVLLQSKAGAAAVRAKAEAALRERFGYDAWVLVYDLDTVRRVVDGY
PFEREVDGYQSYVTFVADAAVLDELAALPAGPDERIRRGPDPLGVLYWQV
PKGSTLDSTIGKTMGKPRYKSSTTTRNLRTLVKVLS
41408728NP_961564.1 hypothetical protein MAP2630c [Mycobacterium avium subsp. paratuberculoMGRQVFDDKLLAVISGNSLGVLATIKRDGRPQLSNVQYHFDPRSLVIQVS
ITEPRAKTRNLRRDPRASILVDADDGWSYAVAEGTAELTPPAAAPDDDTV
QGLIALYRNIAGEHPDWDEYRQAMVTDRRVLLTLPISHVYGMPPGMR
41408727NP_961563.1 hypothetical protein MAP2629c [Mycobacterium avium subsp. paratuberculoMAASSAREGSQSSKSSGGAGSSKSDDDTKRRFREALDRKMAKSTGGSEHK
DGAGKQSRAHGPVESRREFRRKSG
41408726NP_961562.1 hypothetical protein MAP2628c [Mycobacterium avium subsp. paratuberculoMPKLQLVQEPAADALLDENPFALLVGMLLDQQVPIETAFAGPKKIADRMG
GLDAATIADYDPDKFAALCSERPAIHRFPGSMAKRIQALAQLLVDRYGGD
AAALWTAGEPDGKELLRRLKGLPGFGEQKARIFLALLGKQYGVTPPGWRE
AAGEFGKAGTYLSVADIVDARSLGQVRSYKKQMKAAAKAAK
41408725NP_961561.1 hypothetical protein MAP2627c [Mycobacterium avium subsp. paratuberculoMKTHITCPCGEAIVGKDEDELVELTQAHLASVHPGLEYDRDAILFMAY
41408724NP_961560.1 hypothetical protein MAP2626 [Mycobacterium avium subsp. paratuberculosMATTWILSKGLAAVVTASVAALGLCPGAAADPAAAPQPAPPPNAAPQLPG
LPALSQLSPLIQQAATDPQQATQLLMAAAQAFSHNPTAPTESKNVAAAVN
QFVAEPGSPVPNGVTPPDGAPVQHVPATGIEPGLQAHLPTGIDPAHAAGP
APAAAAPSAPAPVAAPAATPPSAPAPAAAPAPGPVQPATVPAAAPVPPPP
APAAAAPATPGAPDAAPAPAAAPGFGADAPPTQDFMYPSIGTNCLADGSS
AIATALSVAGPAKIPAPGPGPGQTAYVFTAVGTPGPAEEQKLPLNVTWVN
LTTGKSGTVALKPRPDINPDGPTTLSAIADTGSGSIMSTIFGQVTTKERQ
CQFMPTIGSTVVP
41408723NP_961559.1 hypothetical protein MAP2625 [Mycobacterium avium subsp. paratuberculosMPTIWTYLRAAAVVVGSSAALLTGGIAHADPVPTPPVPNIPQQLISSAAN
APQILQNLATALGATPPAPPATPGISFPGVPAAGSPVTASSPAAVPSIPG
LPQAAAPSAPSTATGGIPGMIQGLTGAQPSAAAPAAPASSSIPGLPAIPG
LSAPAAPATPPAPQLPQAQVNMPAMPAGLPVSVPAQVTLPKDLPALASGQ
APGAPAAPAAPAAPAPAASPAGPVAPLLAALP
41408722NP_961558.1 mannosyltransferase [Mycobacterium avium subsp. paratuberculosis K-10]MKTGHLGTEATAARAPIAKVGRIDTTSAAPAAPSTRRAADALAVAAPLLL
VASVAARLAWTYLVPNGANFVDLHVYLGGAAALDHPGTLYSYVYADQTPD
FPLPFTYPPFAAIVFYPLHLLPFGLVALGWQLATIAALYGAVRISQRLLG
VPAGAHGRRVAMVWTAVTIWIEPLRSTFDYGQVNVLLMTAVLWAVYSTRW
WLSGLLVGLAAGIKLTPAVTGVYLAGARRWAATMFSAVIFLATIGISVLV
VGDQTRYYFTELLGDAHRVGPIATSFNQSWRGGLSRILGHDVGFGPLLVT
AVAGTAVLAVLAWRALDRSDRLGRLIVVEVFGLLLSPISWTHHWVWLVPL
MIWAIHGPVRAWRGARLVGWGWLALTVIGVPWLLSFAQPNIWQIGRPWYL
AWAGLVYIVAAVATLVWIAAAGRRAGHQVTAPSVTPA
41408721NP_961557.1 pterin-4-alpha-carbinolamine dehydratase [Mycobacterium avium subsp. paMDRAPLPQKRLEDRAMAVLTDEQIDAAMPDLDGWERADGALRRSIKFPSF
LDGIDAVRRVAEHAESKDHHPDIDIRWRTVTFALVTHSEGGITQNDVDMA
RDINGIVGS
41408720NP_961556.1 hypothetical protein MAP2622 [Mycobacterium avium subsp. paratuberculosMASDGIPSARTPPALPAQRTQFPCRTTTLLRFRGDRGILDGGRCGLCQAL
LQNGGWHMITEPATAFSRVFRGYDPAAVDAYVEALLAKQKLLIDEVQNLR
AQRNESGDQLAALRIEVACLKDEVAHLSDTSPTPYAIQHRMTKMLRRTLE
EISRMQAEAQAEAESMIAAAAAQVEASHREHQELLADMAAQREALETERE
DAKKELEAELATMRAEAQAAIDEARQEAERECARLLAEAKQKADDLDERA
RRTVEEANQQRIMILEELMDVARDLQGLPASLQSAYQERTSPSEASVVVP
LDPKNQAPGPAVAS
41408719NP_961555.1 hypothetical protein MAP2621c [Mycobacterium avium subsp. paratuberculoMPTQIVVAGALIRGSRLLVAQRARPPELAGRWELPGGKVAPGETERDALA
RELAEELDLRAGDIAVGDRLGGDIAVDGGMTLRAYRVRLLRGRPDARDHR
ALRWITAAQLHDLDWVPADRGWLGDLARVL
41408718NP_961554.1 NarG [Mycobacterium avium subsp. paratuberculosis K-10]MTATPHVGGVLEELLERSGRFFTPGEFSADLRTVTRQGGREADVFYRDRW
SHDKVVRSTHGVNCTGSCSWKIYVKDGIITWETQQTDYPSVGPDRPEYEP
RGCPRGASFSWYSYSPTRVRYPYARGVLVEMYREAKARLGDPVLAWADIQ
ADPERRRRYQRARGKGGLVRITWAEATELIAAAHVHTIKTYGPDRVAGFS
PIPAMSMVSYTAGSRFFELIGAPMTSFYDWYADLPVASPQVFGDQTDVPE
SGDWWDAAYLMMWGSNVPITRTPDAHWMAEARYRGTKVVTVSPDYADNTK
FADEWMPCAAGTDGALAMAMGHVILSECYVQKQVPFFTDYARRYTDLPFL
IKLEERGDMVPGKNLTAADLGEAVENAALKPALLDETTNSVAVPHGSLGF
RYGESGVGKWNLDLGDLVPALSVRAAPTEDGDTALVHLPSFDTVDGEGTT
VARGVPVRRVGKHLVCTVFDLMLAQYGVERPGLPGEWPTGYDDATQQNTP
AWQEAITGVSAAQAIRVAREFARSAEESGGRSMIIMGGGICHWFHSDAIY
RAVLALLMLTGSMGRNGGGWAHYVGQEKVRPLTGFQTMAMATDWVRPPRQ
VPGASYWYAHTDQWRYDGYGADKLASPVGRGRFAGRHTIDLLASAVAMGW
SPYYPQFDRSSLDVADEARAAGRDVAEYVAEQLGRRNLKLAVTDPDNPVN
WPRVLTVWRANLIGSSGKGGEYFLRHLLGTDSNASAVPPEDGVRPVDVTC
EGDIPEGKLDLMMSIDFRMTSTTLVSDVVLPAATWYEKADISSTDMHPYV
HAFSAATDPPWETRSDFDAFGAIARAFSTMAKEHLGARTDVVLTALQHDT
PDAMAYPDGAEHDWLRSGATPVPGRTMGKLTVVGRDYAAVYDKWRTLGPL
VDKFGLTTKGVTVHPFREVEELAARFGVLKSGVAAGRPAITTAARMADVL
LLLLSGTTNGRLAVEGFHELEKRTGQRLVHLAEGSEDKRISYADTQARPV
PVVTSPEWSGSETGGRRYAPFTINIENLKPFHTLTGRMHFYLAHDWVEEL
GEHLPVFRPPLDMARLFGQPRLGACEDGVGLTVRYLTPHSKWSFHSTYQD
NLYMLSLSRGGPTMWMSPGDAAKIQVRDNDWVEAVNANGIYVCRAIVSHR
MPDGVVYVYHVQERTVDTPRTETNDKRGGNHNALTRVRIKPSHLAGGYAQ
HAFAFNYLGPTGNQRDEVTIVRRRSQEVVY
41408717NP_961553.1 NarH [Mycobacterium avium subsp. paratuberculosis K-10]MKVMAQLAMVMNLDKCIGCHTCSVTCKQAWTNRSGTEYVWFNNVETRPGQ
GYPRTYEDQERWRGGWIRDKRGRLRLRDGGRFQKLLRIFANPKLPVIGDY
YEPWTYDYENLTTAPAGDTFPTAAPKSLISGEPMKVSWGPNWDDNLAGSP
EILAEDPILKKVSEEVKLSLEQTFMFYLPRICEHCLNPSCVASCPSGAMY
KRSEDGIVLVDQDRCRGWRMCVSGCPYKKVYFNHKTGKAEKCTLCYPRME
VGLPTICSETCVGRLRYLGVVLYDMDRVLEAASVENDTDLYRAQCDILLD
PNDTDVIAGARAQGIPDEWIEAAQRSPVYALIHTYRVALPLHPEYRTMPM
VWYIPPLSPVVDAVSRDGHDGEDLGNLFGALDALRIPMQYLAELFTAGDT
AVVEGVLRRLAAMRSYMRDINLGRETQPHIPHSVGMTEEQIYEMYRLLAI
AKYEERYVIPTAFAPQARDLEQMGCSLTGDGGPGMYESEPVAVETFHALK
QRGGPTEAEPGSTRPRVNLLNWDGGQVPAGMFPEAQRR
41408716NP_961552.1 NarJ [Mycobacterium avium subsp. paratuberculosis K-10]MQDRLVWQAASLLLAYPDDGFGGRLDTVEELLGHVSGPAGTLLGQTAAAL
HGREPMAAAMDYVATFDMRRRATMYLTYWTAGDTRNRGREMLAFATAYRE
AGVQPPSNEAPDHLTVVLEFAATVDPDAGRRLLIAHRVPIDVLRCALADA
KSPYEPAVAAVCQTLPAATDQEARRAERLARQLLEAGPPAEAVGLQPFTL
TVPPRAEGTPGV
41408715NP_961551.1 NarI [Mycobacterium avium subsp. paratuberculosis K-10]MFSNVLFWDISPYVTLSVLIVGTWWRYRYDKFGWTSRSSQIYESRLLSIA
SPIFHFGILAVFAGHVMGLFIPPRVTHMLKMSDHLYHMQAVIAGSAAGFA
TLAGVGLLIYRRFTRPAVSAATTRSDKVMYVVLVLAIVVGLYCDLIGTGP
HGGEFHYRYTVGLWFRRIWILQPHGEVMVNAPLDYQLHALIGMVLFTLWP
FTRLVHVFSAPVVYLFRPYIVYRSREVAAKDQLVGTAPRRRGW
41408714NP_961550.1 hypothetical protein MAP2616c [Mycobacterium avium subsp. paratuberculoMQPGRRHADGARPGCTLKRPGFTLDERTRAARVIQPVRYRWPRAARISDV
PFRNVAIVAHVDHGKTTLVDAMLRQSGALHHRGDDTQERILDSGDLEKEK
GITILAKNTAVHRHHPDGSVTVINVIDTPGHADFGGEVERGLSMVDGVLL
LVDASEGPLPQTRFVLRKALAAHLPVILVVNKTDRPDARIAEVVEASHDL
LLDVASDLDDEAAKAAEHALGLPTLYASGRAGVASTEQPADGEVPAGENL
DPLFDVLLEHIPAPSGDPEAPLQALVTNLDASTFLGRLALIRIYNGKLRK
GQQVAWMREVDGLPVITSAKITELLATEGVERSPTDEAIAGDIVAVAGLP
EIMIGDTLADPDHAHALPRITVDEPAISVTIGTNTSPLAGKVPGHKLTAR
LVRNRLDQELVGNVSIRVVDIGRPDAWEVQGRGELALAVLVEQMRREGFE
LTVGKPQVVTRTIDGQLHEPFEAMTIDCPEEFVGAITQLMAARKGRMEEM
TNHAAGWVRMDFIVPSRGLIGFRTDFLTITRGTGIANAVFDGYRPWAGEI
RARHTGSLVSDRAGTITPFAMIQLADRGQFFVEPGQDTYEGMVVGINPRA
EDLDINVTREKKLTNMRSSTADVSETLAKPLELDLEQAMEFCAADECVEV
TPEIVRVRKVELDATSRARSRARAKARG
41408713NP_961549.1 LpqW [Mycobacterium avium subsp. paratuberculosis K-10]MVGRAAVRLLDTLISVPRRVRRVFMVLGGLVSVVGLVLSACTVNPPPAPQ
STDTPHNSVPPPPRVSQIIMGIDSIGAGFNPHLLSDLSPVNAAISALVLP
SAFRPVPDPNTPTGSRWEMDPTLLVSAEVTSQNPFTVTYKIRPEAQWTDN
APIAADDFWYLWHQMVSQPGVVDPAGYDLITGVQSLEGGKQAVVTFSEPY
PAWKELFNNILPAHIVKDVPGGFAAGLARALPVTGGQFRVESIDPQRDEI
LIARNDRYWGPPAKPGLILFRRAGAPAALADSVRNGDTQVAQVHGGSAAF
AQLSAIPDVRTARIVTPRVMQLTLRATQPKLADTQVRKAILGLLDVDLLA
AVGAGSDNTVTLDQAQIRAPSDPGYEPTAPPAMTTPAALALLEGAGYKVE
PNTSASPATPAPGPPNTGPPEVIRGRISKDGQQLSLAIGVAANDPTAVAV
ANTAADQLRNVGIAATVLALDPVTLYRDALNDNRVDAIVGWHQAGGNLAT
RLAARYGCPALQSTQVPASTEPTPTSPAPGGPAPSTGPATRSATPTSTAP
PSRPADPNALVQAPSNLTGICDRSIQSNIDAALNGTKNINDVITAVEPRL
WNMSTVLPILQDTTIVAAGPSVQNVSLSGAVPVGIVGDAGQWTKTGP
41408712NP_961548.1 hypothetical protein MAP2614 [Mycobacterium avium subsp. paratuberculosMKRTLPAAVVRLLRREAADRNAHGYYQEMPQLTDRTGSRSRRRGEVLERA
LYEATLAELTEVGYGGLTMEGIAARAHTGKAALYRRWDTKCELVHAALVF
ALPPVPELRSGRSARENLLAMFTAQRDLLAGKTAFPGIEVIQQLLHEPEM
RAIFADAVVRPRLKIVESILQSAVQDGDLDPKSITPLTARIGSALINQHF
LLNGSPPNRRELALIVDTVIPPRDSDRAAD
41408711NP_961547.1 hypothetical protein MAP2613c [Mycobacterium avium subsp. paratuberculoMAETPRLLFVHAHPDDESLGTGATIAHYTAAGADVRVVTCTLGEEGEVIG
ERWAELAVDRADQLGGYRIGELTAALRELGVGEPCYLGGAGRWRDSGMPG
TPRRRRQRFIDADEREAVGALVAIIREQRPHVVVGYDPAGGYGHPDHVHV
HTVTTAAVAAAGAGNFPGEPWAVPKFYWSVFATRPFEAAVQALTPEDLRP
GWSMPSAEQFTFGYADEHIDAVVAAGPHAWAAKRAALAAHATQVVVGPTG
RACALSNNVALPILDEEHYVLVAGAAGARDERGWETDLLAGLEFGAAPRR
41408710NP_961546.1 hypothetical protein MAP2612c [Mycobacterium avium subsp. paratuberculoMAGPARQPAVGYRLDTLQHRQRSDLTETKPRVASGEDSGATDPAIRFVVL
ALLAVDGVLSALAGALLLPLYIGTVPFPISGLISGLLNAALVWAAGRWTR
SPRLVALPLWTWLLTVAVISMGGPADDVILGGRGVMAYGALLLLVLGVAP
PVWVLWRRGRGG
41408709NP_961545.1 FO synthase [Mycobacterium avium subsp. paratuberculosis K-10]MLLTPGEEPTALPDPVVPARASSRATPKATASALRRVLRRARDGVALNID
EAAVAMTARGDDLADLCASAARVRDAGLQSAGRRGPGGGLPITYSRKVFI
PVTHLCRDNCHYCTFVTVPGKLRARGAGLYLEPDEILDIARRGGELGCKE
ALFTLGDRPEDRWPEAREWLEARGYDSTLSYVRAMAIRVLEETGLLPHLN
PGVMSWSEMARLKPVAPSMGMMLETTSRRLFETKGLAHYGSPDKDPAVRL
RTLTDAGRLSIPFTTGLLVGIGETPAERADTLHAIRKSHKEFGHVQEVIV
QNFRAKEHTAMAAVPDAGIEDYLATVAVARLVLGPGMRIQAPPNLVSRDE
CRALIAAGVDDWGGVSPLTPDHVNPERPWPALDELAAVTAESGYELVQRL
TAQPKYVQAGAAWIDPRVSGHVRALADPVTGLARDVNPVGLPWQEPDDVG
SSGRVDLNAAIDTQGRNSETCSDIDSAFGDWESIRAHVHELAAQGARAPE
RLDSDVLAALRSAERDPAGCTDSEYLSLATADGPALEAVAALADSLRRDT
VGDDVTFVVNRNINFTNICYTGCRFCAFAQRKGDADAYSLSTEEVADRAW
EAHVAGATEVCMQGGIDPELPVTGYADLVRAVKARVPSMHVHAFSPMEIA
NGVTKSGLSIREWLISLREAGLDTIPGTAAEILDDEVRWVLTKGKLPTSL
WIEIVTTAHEVGLRSSSTMMYGHVDNPRHWVGHLNVLRDIQDRTGGFTEF
VPLPFVHQSSPLYLAGAARPGPTHRDNRAVHALARIMLHGRISQIQTSWV
KLGVQRTQVMLNGGANDLGGTLMEETISRMAGSEHGSAKTVAELTAIAEG
IGRPARQRTTDYTPLAA
41408708NP_961544.1 hypothetical protein MAP2610c [Mycobacterium avium subsp. paratuberculoMDGARRRRPPGRKRRGAGPGARRSPGGRAGGHPRFRGAGRPAARPERRRP
VGRAGRPDGHPQRGRGGRRSHPRRHRRGLDRPHHEGAVVRRAHARRTRPA
RLGHHRGLRQRRGLPGGAGRAVDDHAQRARGRPAAAGEGGQATATRRAGR
SPAARRRHRRRGAGRRSGADQHRVRRAAGPGHPGNRRGRAGAAAVGAQAR
RPVTHPQPRRTAGPGTGALPARRLLNGFRRPGALRSCYR
41408707NP_961543.1 hypothetical protein MAP2609 [Mycobacterium avium subsp. paratuberculosMRLSLSKLGVAVGSAAVALTAAAGVASADPMDAIINTTCNYGQVIAALNA
SDPAAAQQLNSSPMAQSYIQRFLASPPAKRQQMAQQIQGMPAAQQYINDI
NQVAVTCNNF
41408706NP_961542.1 hypothetical protein MAP2608 [Mycobacterium avium subsp. paratuberculosMSHRNAPLSETGRLRLARCVVDEGWSLRRAAERFQVSVTTAERWARRYRE
LGEAGMADRSSRPHHSPNRTPTRTERRIIKVRVIRRWGPARIGYLLGIHP
STVHRVLTRYALAKLRWLDRSTGRIIRRMEPAGCGDLVHVDVKKLGKIPA
GGGWRMLGRAIGGHNSNADKSSGVFSKHRNPIRGYHYLHTAIDGYSRLAY
SEVLDDEIKETAAEFWTRANAWFAECGISVRKVLTDNGSCYRSRVFAQAL
GDIEHRRTRPYRPQTNGKVERFHRTLADEWAYARLYRSDTERCEEFTTWL
HTYNHHRGHTALGGQPPASRVPNLSGQYN
41408705NP_961541.1 FdxC_2 [Mycobacterium avium subsp. paratuberculosis K-10]MTYTIAEPCVDIKDKACIEECPVDCIYEGARMLYIHPDECVDCGACEPVC
PVEAIYYEDDVPDQWSQYTQINADFFAELGSPGGAAKVGLTENDPQVVKD
LPPQGEGD
41408704NP_961540.1 N-succinyldiaminopimelate aminotransferase [Mycobacterium avium subsp. MPHQLRKRRPAVSAALPEFPWDTLAEAKALAGSHPDGIVDLSVGTPVDPV
APVIQQALAAAGSASGYPATAGTARLRDSAVAALARRFGVVGLTEASVLP
VIGSKELIAWLPTLLGLGPADLIVVPELAYPTYDVGARLAGAWVLRADSL
TQVGPQSPALYYLNSPSNPTGRVLGVDHLRKVVAWARDRGCLVASDECYL
GLGWDAQPLSILHPQVCDGDPTGLLAIHSLSKSSSLAGYRAGFVAGDAEL
IAELLAVRKHAGMMVPTPVQAAMVAALDDDAHERTQRQRYERRRAALLPA
LRSAGFAVDHSEAGLYLWVTRGEPCRDTITWLARRGILAAPGEFYGPRGA
QHVRVALTADDERIAAAVRRLA
41408703NP_961539.1 hypothetical protein MAP2605c [Mycobacterium avium subsp. paratuberculoMLVTSSTGNLRIPLSFGDVAKRVFLGKPLITEDIASEKLSNGVALGALSP
DAVSSVAYGPEQILIELLPHAGLAAFLLLLPITGVILLILVLVAASYRQV
VMAYTRAGGSYIVARDNFGPRVAQIAAAALLIDYVVTVAVQSAAGTVAVV
SAIPVLGPYSLAITVGVVLVICYANLRGLREAGMPFAVATYSFIVMVGLT
IVIGVVRAVIGNLPIYDPAHLAGTVPVHQGNGLVLGATILVLLRAFANGG
SSLTGVEAISNTVDYFRKPQGRNARRVLTAMASILGFLLAGVAYLAHVTH
ATPYLTEYPSVLSQIGHAVYGGGVVGDIFFVMVQASTAAILFTGANTSFN
GFPALASFVAEDRFLPRQLTKRGHRLVFSNGIITLTALSVALLVATGGSV
NALVPFYAIGVFSGFAMAGYGMTKHHLTHREAGWRHRLTINLSAAVLSTI
VVGIFAVAKFTEGAWLVVVVFPLLVFVLTRLNREYRAEAAILEMFRTDRP
ELVKYARHKVLVFVDSVDLAVIEALRYGRGLRADELVAVHFMVDPAHAAQ
LRNRWDHFSLDTPLRIVDCPDRRISRSAQLMVAKVRDEHPNTNVTVLLPR
RTFARLLGRLLHDRTADKVARAVSQIPDAAATIVPYDVESRIREAYPDTF
EQRIAKELDKIQAWVSQDEDQKVAAYEHPARSSAVIMVAGLISGQRATIE
GRVSEVEDVAERGGTRRRIVVGDSSGEITVIFHHGHGGADIQPGQLLRIS
GKARQAGQRELSMVDPAYEVIEDPAREAEESGDSEESGDSQRADKK
41408702NP_961538.1 hypothetical protein MAP2604c [Mycobacterium avium subsp. paratuberculoMPAATATPVAVIGMACRLPGGIDSPQRLWEALLRGDDLVGEIPADRWDAD
LYYDPEPGVPGRSVTRWGAFLDDVGGFDCDFFGMTEREATAVDPQHRLLL
ETSWDAIEHAGLDPASLAGSQTGVFVGLTHGDYELLSADCGAAEGPYGFT
GTSNSFASGRVAYTLGLHGPAVTVDTACSSGLMAVHQACGSLGGGESDLT
LAGGVVVTLEPRKSVSGSLQGMLSPTGRCHAFDVNADGFVSGEGCVMLLL
KRLDDARRDGDRILAVLRGTAANQDGRTVNIAAPSETAQVAVYRKALQAA
DIDATTVGLVEAHGTGTPVGDPIEYSSLAAVYGTDGPCVLGSVKTNFGHL
QSASGPLGMMKAILALQHGVVPRNLHFTRLPDEMARINTELFVPQENTQW
PSNGHHPRRAAVSSYGMSGTNVHAILEEAPAPEAAGSAAPEAVGPLLFPL
SSTSAEQLRVTAARLAAWLDEQAGDALAGPTGWGLRDLGYTLTRRRAHRP
VRTVVSASGFAELRTELRAVADGDIPYQPAVGQGDRGPVWVFSGQGSQWS
QMGAELLDKEPVFAATIAAVEPLIAAESGFSVTRALSAPPAVTGIDKVQP
TIFAMQVALAETMKSYGVRPGAVIGHSLGECAAAVVAGGLSLGDGVKVIC
RRSRLMARIAGRGAMASVELPGQQVLSELSIRGISGVALSVVASPTSTVV
GGGAEAIRELVAAWQQQDVMAREVAVDVASHSPQVESILDELVEVLAELE
PTAPEVPYYSATL
41408701NP_961537.1 hypothetical protein MAP2603c [Mycobacterium avium subsp. paratuberculoMRFAAAVQAALKDGFRVFGELAPHPLLTHAVEQNAASLDVPIAALAAMRR
EQELPLGLRGFVGDLHSAGALVDFSVQYPAGRLVDAPLPTWSHRRLMLRR
ESVQRAHGSSVQAVHPLLGAHVHLREEPERHVWQGEVGTDAHPWLADHQI
HGVAAFPGAGYCEMALAAAAATLGERAEVRDVTFEQTLLLAGRTEVSSTA
TVTGPGRLEFTVDTHEDGERIRRAGAVLHALPPEHGGETGPPAHDVATLI
ADHPSRIEGAELRKAFGAIGIQYGPAFSGLAAVLVGDRDVGTVLAEVALP
GAIRSQQSGYGAHPALLDACLQSVIAAPELQRAAAGGLLLPVGVRRLRNY
HSTRNAHYCLTRITSSRPGECEADVDVLDQSGTVLLTVEGLRLAGAASEH
EHAQRLLDERLLTIEWEARELPEAPQGEPGSWLLLSACDAASNGDDALTT
QLADVLKTDGAQCRTVSLPPGAVGTEELRSLLSGGEPGGNGHRPLQRLTG
VVVVAAASEAGHPAAPRRGRDYVSHLATVARELSELPGESPRLFVLTRNA
AVVVAGDAPNLTQAGLRGLMRVIDAEHPHLSATQIDVDDATDPGHVARQL
QSRSGEDETAWRDGQWYTARLRPGPLRPADRRTTVVDHGRDGMRLHIRTP
GDLESLELTAFDRVPPGPGEIEVAVASSTINFADVLVAFGRYPMFEGYQQ
QLGGDFAGVVTAVGPGVTEHRVGDRVGGLSGNGCWGTFVLADARHAVTLP
PEIPLRDAAAVPTASATAWYGLHDLARIAPTDKVLIHSGTGGVGQAAIAI
ARAAGCEIFATAGSPQRRQLLRDMGIEHVYDSRSLEFAEQIRRDTDGYGV
DVVLNSLPGAAQRAGIELLALGGRFIELGKRDIYRDSQLGLFPFRRNLSL
FAVDLALLTHSHPHTVRRLLTTVYQRTAAGELPMPRTTHYPLQDAAAAVR
LVAAAGHTGKVVLQVPRTASSVAALPPEKVRPFRADGAYIITGGLGGLGL
FLAGEMACRDGDVGAGRIVLNSRSQPGEQARRAIERLRAAGADIAVECGD
IAEPDTAERLVTCATATGLPVRGVLHAAAVVEDATLTNVTDDLIDRCWAP
KVYGAWNLHQATAGQPLEWFCLFSSAAALVGSPGQGAYAAANSWLDAFAR
WRHARGAPATAIAWGAWSQVGRATALAEDAGVAITPAEGFRAFETLLRHD
RPYAGYAPIMGTPWLTSFAQRSPFAEAFRSAGQGRPDAGKFLAELRALPR
EEWPSAIRRLVSGQLSLLLRRTIDPDRPLSDYGLDSLGNLELRTRIETET
GVRISPATITTVRGLAEHLCDELADLPAAPPAGAPR
41408700NP_961536.1 hypothetical protein MAP2602 [Mycobacterium avium subsp. paratuberculosMAICDTCGNDYDKAFTVTWTDGRSATFDSVECAAVELAPTCEHCECRILG
HGVESGGAMFCGAHCARQAGNHDVSDRGAAG
41408699NP_961535.1 hypothetical protein MAP2601 [Mycobacterium avium subsp. paratuberculosMAEKGSPMLDFGALPPEINSARMYSGPGSGPLTAAAAAWEELAAQLESYA
AGYSATLAELRGPAWSGDAAAAMAAAVEPYVAWATGTAARAGQAAAQARA
AAAAHEAAFAATVPPHVVAANRIQLATLIATNFFGQNAPAIAATESCYAE
MWAQDATAMYGYAAASSAATTLTPFTHPPRTTTAHGQAAQAAAVSHAADS
QPPGWSSLVDSVSGFNTVVTTPGQSFFAAARTLLGWGQFGTGLNLANIQA
AKAAAGAVRLPAAVAGPSVSGGLGRAATVGRLSVPPAWPAANPVAPLGET
VMRQPGGMVRLVSGSAPDSPAGPGIPPALRTADRSAGVPVLRNGRRAFRM
PRPAYGG
41408698NP_961534.1 hypothetical protein MAP2600 [Mycobacterium avium subsp. paratuberculosMLDYGALPPEINSTRMYAGPGSAPLIAAAAAWDVLANALETAARGYSAVI
TRLHGESWSGSASVAMAGAAAPYFAWLAEAGTQAEEAAGQARAAAAAYEA
AFGATVPPAVVTANRALFAQLVASNILGQNTAAIGEAEGAYAEMWAQDAA
AMYGYAAASSGATRLRPFDEPPRTTNADGPGAQAAAVARSATGSAANQSH
ASLSRAMSAVPHQLQTLSGAGSSGSSSSSSGSSALSAVDNFNTLTAPVNL
GDGISRTVTSGGTFGTGLFRSNLQSAGEAFKAVPGAAAAAGTSTAAGVPG
PAVAGAGTATTVGRLSVPQSWAATNPAAGTVAEPLWLSDAELDGGPSWHE
GPAAGMWNGAPAAGASSSLLSRPSVNNVLRVAPRQFKMPRPSAGG
41408697NP_961533.1 hypothetical protein MAP2599c [Mycobacterium avium subsp. paratuberculoMSNNITWHEHKISRGEREQLNGHKGCVIWFTGLSGSGKSTVANVVEQKLY
ERGIRSYLLDGDNVRYGLNAGPDLLEERHGPEFAQRFGLGFSAQDREENI
RRIGAVAKLFCEAGIIALTAFISPYVRDRDAIRATLDDGDFQEIFIDTPI
EICEKRDPKGLYKKARAGEIKGFTGIDDPYEAPPRPELRLDGAAKDAETL
AEEVIAHLERVGVIATDGLAHTRGRDEVTA
41408696NP_961532.1 sulfate adenylyltransferase [Mycobacterium avium subsp. paratuberculosiMNYTGHNGKPLVERVSTENAAARIEGLPRVPISKATAHEVISLSYGFFTP
LTGFMGRREVDATLDEFALPDSTLWSIPIVFDMSADDIAERDVKEGASVV
LDYLGVPMAILDVTEIYEYDLERMAEKTYGTTDPRHPGVKKTLGYHNRFI
GGDITLINEPVFNEPFKSFWLTPRQHQDALAAKHWHRVVAHQTRNVPHTG
HEALMKQAWLAANEDQPVDSLNTGVLVNAIIGQKRVGDYIDEAILLAQNA
LRTSGYFRENVHMVSFTLWDMRYAGPREAIFHAILRTNLGCTHHMFGRDH
AGVGDFYHPYDSQNILKQYRNQLGIKPVFLRENWYCPVCLEVTNSALCGH
EAQAQSFSGSLIRSILTDEVKPTQKVMRHDVFEVVMECAAKHGQGSPFVT
EEYLANRLPVFTLNQLEGS
41408695NP_961531.1 hypothetical protein MAP2597c [Mycobacterium avium subsp. paratuberculoMSSDHDNNGKAIKINVWINEERLEALANAGMAELANEAFAGMKLLEIHTT
EEQKNIVLQRFPGAKYDSPTTRSIELLPKQAKDRLLELSIAMHSTGPDVM
GRFLEETEPA
41408694NP_961530.1 acyl-CoA synthetase [Mycobacterium avium subsp. paratuberculosis K-10]MHGSSVVSLMRERAGLQPDDVAFRYTDYEQDWAGVAETLTWAQLYQRTSN
LAREVARHGDTGDRAVILAPQGLSYIVAFLAAIQAGLIAVPLSVPQPGSH
DERVSAVLADTGPAVVLTTAAAAATVTEYLRRPDTGPAPAVVEIDSLDLD
EPNSSSIRISAAPDIAYLQYTSGSTRLPAGVMVSHRNLQVNFQQLMAAFF
PDFDGVAPRNTVCVSWLPFYHDMGLVQGVIAPILGGYPADLTSPVAFLQR
PARWIQAMSRADPVFSAAPNFAFELAVRKTTDADLAGVDLGNIISIVSGA
ERIHPATLRRFCKRFAPYNFHEHMMQPSYGLAEATVYVASRAEAGGPEVV
HFEPEKLSAGSAQRCPAQTGSPLLSYGAPTSPTVRIVDPDTNTERADGTV
GEIWVNGENVAQGYWRKPEETRRTFGGVLVNPSPGTPRQPWLRTGDLGFI
SAGELFIVGRMKDLLIVYGRNHYPEDIESTVQAVTGGRVAAISVPADETE
KLVTIIELKRRGDSDEDARRKLDAVKNEVTAAISNSHGLNVADLVPVAPG
SIPTTTSGKIRRAACVEHYLRGAFIRLDG
41408693NP_961529.1 hypothetical protein MAP2595 [Mycobacterium avium subsp. paratuberculosMTAPIWMASPPEVHSSLLSAGPGPGPLLAAAAAWSSLSVQYAESADELVT
LLGAVRAGDWDGPTAGAYLAAHAPYLAWLARASTDSAAVAAQQEVAAAAY
TAALAAMPTLPELAANHAAHAVLTATNFFGINTIPIAVNEADYARMWVQA
ATVMGTYQDVAAAALAATPHTEPAPRVMAAAAPAARAAQSSSYPPDTQDQ
WLDWLEKTGFVDFYNRYIQPLIDQLMNNPFFRSLFSGFDPWLPSLGNPLS
FLNPFNIAFALGYPMDFGSYFGYLAQMFSFVAADLAAAFASGNPATIAWT
LLFTTIEVIGTVITDTIALIKTLLEQMIVLIPAILPLLTVSVVPLVVPTL
VGGLAGLTGLAGLHAIPVPPFVPAPNARPGGAGTESAARAGTGPVPRAGA
GPDVRGGARRGRTRRAAAHPVGAAGGHPAQPRLPGRRPDRGRAAGRERRR
PQTRGGRARKRRGPRGGAAGGRVDAAAPPPGRGQTARPRLRVSGSRAVDD
RLAAGCADAGVRRNRGQTRGRRTGGTKRAGARRVRRRPARADDAGHLGWI
ETVTCTTLLACTSLRCPGPHARPARRRAGAKTPER
41408692NP_961528.1 hypothetical protein MAP2594 [Mycobacterium avium subsp. paratuberculosMAGVGLGQLLLALDATMVSLVDAPRGLDQPVASAALIDSDDVRLGLAAAA
GSADVFFLLGVGDDEALRWIDTQARDRVPVAVFVKEPSDALVGTAVAAGS
AVVAVDPRARWERLYQLVNHVLEHHGDRADAADDSGTDLFGLAQSLAERI
HGMVSIENAQSQVLAYSASNDEADELRRLSILGRAGPPEHLEWIGQWGIF
DALRSGTQVVRVAERPELGLRPRLAVGIHQPDPDARRPPVFAGTIWVQQG
AQPLADDAEQILRGAAVLAARIMARLAARPSTQARRLQQLLGVTDSETLA
PVDLTAIAAELGLAADGCAALIGWAAAEGASRHTRLTDVIALSASAFRHD
AHVAGHGSRTYVLLPQPPNRSVSSWVRGTIAALRAELGVQLRAVIAAPVP
GLSAVAAARAEVDRVLDSAERHPLSFGQVTSLAEARTTVLLDEIVTLVGR
DERLVDPRIVALHDREPVLAQTLRTYLDAFGDIAAAAHALRVHPNTVRYR
VRRIEKLLSVSLADPEVRLLFALALRVAER
41408691NP_961527.1 RocA [Mycobacterium avium subsp. paratuberculosis K-10]MDAITGISEVPVPANEPVHDYAPRSAERARLRAELAALAGHPIDLPHVIG
GRHRMGDGERIDVVQPHRHAAKLGTLTNAVHADATAAVDAAMAAKSDWAA
MPFDERAAVFLRAADLLAGPWREKIAAATMLGQSKSAYQAEIDSPCEQID
FWRFNVAFARQILAQQPISGPGEWNRSDYRPLDGFVYAITPFNFTSIAGN
LPTAPALMGNTVVWKPSITQTLSAYLTMQLLEAAGLPPGVINLVTGDGFA
VSDVALADRRLAGIHFTGSTATFQRLWYQVGTNIGHYHCYPRLVGETGGK
DFIVAHASARPDVLRTALIRGAFDYQGQKCSAASRAFIAQSVWRRMGDEF
LAETAALRYGDVTDLTNFGGALIDRRAFVKNVDAIERAKGAPHVTLAVGG
EYDDSEGYFVRPTVLLSDDPADESFATEYFGPLLSVHVYPDDDYQRILDV
VDTGSRYALTGAVIADDRAAVLAAQDRLRFAAGNFYVNDKPTGAVVGRQP
FGGSRGSGTNDKAGSPLNLLRWTSARTIKETFVPATDHTYPHMAAD
41408690NP_961526.1 hypothetical protein MAP2592c [Mycobacterium avium subsp. paratuberculoMAGLFAHTLRPAILAAGRRPGLRRAAEALPVTRRVVHRFIAGETIDSALD
SVTALRDSGRCVSVDHLGEDVSDADDADAAVRVYLELVDRLGCLGDGAAV
RPLEVSLKLSALGQSLDRDGEKIARENAWAICAAAQRAGVWVTVDAEDHT
TTDSTLRIVRDLRREFDWLGVALQAYLRRTLGDCEEFAAAGARVRLCKGA
YDEPASLAYRDPAAVTDSYLRCLRVLMAGSGYPMVASHDPAIIEAAPSLA
RESGRGTGEFEYQMLYGIRDDEQRRLAEAGHTVRVYVPFGTQWYGYFMRR
LAERPANLTFFLRALAARRH
41408689NP_961525.1 hypothetical protein MAP2591 [Mycobacterium avium subsp. paratuberculosMSTDATPATDTRELIVAAAFTCFGRQGLQKATIVDIAKQAGVSRSTIYEY
FSDKAAIVEACAEHASERFYREMAKAMDRGGTLEERLCAAAVFVTQARRV
IASEKYFDEDAISLLLTKDAAVLLRECVEFFAPYLAAARLTGEVRKDLDV
EAAGEWFARILFSLFSTPSPTLNLDDPDVTAEFVRAHVVRGFASERPRRR
41408688NP_961524.1 lipid-transfer protein [Mycobacterium avium subsp. paratuberculosis K-1MSSILPGAAAIVGIGQTEFSKESGRSELQLACEAVSAALDDAGLTSSDVD
GMVTFTMDSSDEIDIARNVGIGDLSFFSRVHHGGGAAAGTVVHAAMAVAT
GVADVVVCWRAFNERSGFRFGGSGRNMAETPLFMAHYAPFGLLTPAAWVA
LHAQRYMSTYGVTNEDFGRIAVVDRKHAATNPDAWFYQRPITLEDHQNSR
WIVEPVLRLLDCCQESDGGVALVVTSVERARDLRRPPAVIAAAAQGAAAD
GEMMTSYYRDDITGLPEMGVVARQLWRDSGCKPQDIQTAFIYDHFTPFVF
VQLEELGFCGRGEAKDFATVERLSLGGEFPINTNGGLLGEAYIHGMNGIT
EAVRQVRGTSHNQVADVEHVLVTSGTGVPTSGLILAPAG
41408687NP_961523.1 hypothetical protein MAP2589 [Mycobacterium avium subsp. paratuberculosMTRTANRTLRWQDISVGEEVTPLEIPITTTMIVAGAIATRDFMPVHHDRD
YAKKQGSPNLFMNILTTNGYCVRFLTDWAGPEAMVKKLSIRLGVPCFPDD
PLRFTGSVTGKTRGPAGPPPAENFVEVTFKASNSLGDHVSGTAVLSLLDG
AGS
41408686NP_961522.1 hypothetical protein MAP2588 [Mycobacterium avium subsp. paratuberculosMDFSFTEEQETIGKLARDLFERRATPERLTELEVGDTRHDAALWEELAAA
DLLGAALPEAVGGSCASGGGFVELGVLLAEVGYGVAPVPAYATLVLGADS
IARHGSSEQQQRVLPGVIAGSRILTAGLAEPGRSDPARPATTARRDGPNW
RLDGAKELVPAAQLADTMLIPAVLDDGDVGLFLLAADAAGVEIRPVPTTN
REPHADVFLAGARVSETDRIAGIGLVESLLTRALVALCAIQLGVVERALR
IAAKYTTGREQFGRPIGSFQAVQQRMADAFIDVEAIRWTTWQAAWLVAHG
RPADRAARIAKFWAAEAGARVAATAQHVHGGIGIDVTYPLHRYFLWAKHN
ELTLGPASAQLAHLGATYSEGHA
41408685NP_961521.1 hypothetical protein MAP2587 [Mycobacterium avium subsp. paratuberculosMAARLAPAITADTEFFWNGLRENKLLIQRCSGCGQLRHPPRPMCPHCRSL
DWEAVESSGRGTVYSYVMPHEPKFPFFEYPYIVVLVELEEGVRLVSNLTG
IDPAEVTPGLPVEVYYQTFDGSQNLVLHQFRPSA
41408684NP_961520.1 hypothetical protein MAP2586 [Mycobacterium avium subsp. paratuberculosMTDSETVSAKVRALVGQPTGGTGKPSLAPDPVNQPMIRHWAYAMADMNPV
YLDPEFAASSRFGGIVSPPVMLQTWTMPSPKLEGIGERGGAPVEIDSSPT
AFLDEAGYTSTVATNSEFEIERYPRLGDVISATTVYESVSDEKKTALGTG
FFLTWLTTYTDQNGEVLGRQRFRVLRFRPAG
41408683NP_961519.1 FadE26_2 [Mycobacterium avium subsp. paratuberculosis K-10]MDLEYTPEQQQLRAEIRATLQTVMTPERVAAVSEQMDGGPAVRECVRALA
AANLLGVGWPKEYGGRGFSAIEQFIFAEEARRVSAPIPLVTLNTAGPTLM
HYGTDEQKRRFLPAILDGTVEFAIGYSEPGAGSDLASVHTTAVRVGDEYV
INGQKMFTSGAAYADYIWLAVRTDPDAKKHKGISILIVPTSSPGFSWQPL
HTMPGISTFYTFYDDVRVPVSALVGAENQGWQLITTQLNFERAALGNLGA
LEPLFDKTLDWALSTELDGGRVIDQPWVRSALARVEAQVAAYKLVNLRVN
AAMTKGALNMGEASAAKVFGTELTQQVARELLEVLDGNGVRRGAEAPLRG
ALESAYRQAVINTFGGGANEIQRDIIAMAALGMPRAPRDLRAAN
41408682NP_961518.1 hypothetical protein MAP2584 [Mycobacterium avium subsp. paratuberculosMQTHPPLRSPSFPLHSPDFYAGNPYPAYRELRATAPVCWNDVTNFWALLK
YEDIRFVSSNPALFTSTRGITIPDPQLPNPVQQGSLIFTDPPRHRQLRKL
INSGFTRRRVSVLEPKIRKIVRGILDGIERGAVHEFAEQIAAPLPTRMIA
ELIGAPPDDWEQFRAWSDAATGTADPEIELDPAVAAGQLYEYFQRLIAAR
RARPRADLLSVLAEAEIDEHRLTDEDLLNFAFLLLVAGNETTRNLIALGT
LALIAHPDQYRLLVEEPARIPLAVEEMLRWNSPVVHMARTATADVEIRGQ
RIRAGEVVVMLYGSANRDEDVFGPDSEEFDVTRHPNPHIAFGCGEHSCVG
AQLARLEATVFFEELLRRYPRIELVGEVDRMRATMVPGVKRMPVRMGA
41408681NP_961517.1 hypothetical protein MAP2583c [Mycobacterium avium subsp. paratuberculoMADPPALVQTYQLYIDGQWVEPQDGRYDDLSPSTEAVIATAPDASVAQVD
DAIAAARRAFDSGPWGRMSAEQRARCLNQLGEALTKHADDFFALSQTEWG
CIGNERIMQIDGAGFMSLHAAQLATQLVDQEVAGISAGTTLLRHVPLGVV
AVLTPWNFPHCLNVMKLNHALAAGNTVVLKPSPLTPLAGLALARLIDEHT
DIPPGVVNVVTPSGVEAAKLLTTDPRIDMVSFTGSSAVGRQVMSAAGDTI
KRILLELGGKSASIVLDDANVTDEMLEQMLFQSCSLHAGQACILHSRLLL
PDSLHDDVVDRLAALAREVKVGDPTDPDVQMGPLISAAQRDRVEAHIAGA
RSDGATLVTGGGRPAGLDVGYYVEPTILSGVEPNSTIAQEEVFGPVLSVL
RYRDDDDAVAIANNSRYGLSGAVWGDDVDRAVGVARRIRTGQIAVNGISP
AGAPFGGFRLSGLGREGGGIGGLHQYMEPMAIGVPA
41408680NP_961516.1 hypothetical protein MAP2582c [Mycobacterium avium subsp. paratuberculoMTAPLAGLHVVEIASEISGPYATKLLVDLGAEVIKIEPPAGDPLRRWGPF
ASGVVDPDRSGLFEYINAGKHAATLDFSETADVAAARELIARAHLLIDDS
GPATLQGYGLGPDDLQRINPNLVLLRISGFGQTGPFRRRPATPLTLQAAS
GWISSRDPQRPPVQVGARIAEYVAGAYGALGALTALRSHPAGHVTEVDVS
QLESLLSTLPYPMLMAQRMRRLGLPANLRSAPMLGVVRAADGWVGINCLT
GQHWLDVCAMLGLPEFGEHQLAIMLGGPERADFFAKAEPVLAGQTVAEIV
ELAQALRIPAAPVNDGATVLDCPQYAERGFFVDTGSFRRPGPPFRFSKTP
VPQPRPAPLSGASRTTWTGDGRALHRAPGPLPFAGLRVLDLTTYWAGAYL
TCYLGAFGADIVKVESIQRPDGHRYSGAFAYEGDDWYERSPIWQGTNLNK
RDLTLDLTSPRGLDLARRLAARADIVVENFSPRVVENFGLDYDSLTALNP
DVIVVRMPGYGLHGPWRDYVGWALNFEQTAGMSAVTGFPDGPPCNPQGPA
DPIVGVHAGVALLAALEHRNRTGAGQLVEVAQIEVAAAVTATPVIEYSMT
GVVRPREGNRRRGCLQGVYPTNEEEVWVALSVPGRPIDHDAFDELVAAWT
RTQTAAAIVETLQAQGIAAERVITGDQMYDPELIGAQLDVRGYYEELEHR
ITGPHRYPGWPFRIAPGPRRHHRTAPPTLGQHNDEVLRELGLSEAEIADL
RQQRVIGERVLNA
41408679NP_961515.1 hypothetical protein MAP2581c [Mycobacterium avium subsp. paratuberculoMAIEIARPKLEGNVAVGEDRQIGFAEFGDPQGRAMFWLHGTPGARRQIPV
EARLYAENHKIRLIGLDRPGIGSSTPHRYQNIRAFGEDLRTIADTLGIHK
MAVIGLSGGGPYALASAAVLPDRVVAAGILGGVAPFLGDEGITSGLMNLG
KRVAPLLKLGGDPLRIGASLVVRAIRPVANPALYLYAAISPEGDRRLLTR
PEFGAMFLDDLLNGSRKQLAAPFNDIILFTQDWGFRLDQVKVPVRWWHGD
SDHIVPFAHGQHVVSLLPDAELFVLPGESHLGGLGRGEEILSTLTKIWDE
QN
41408678NP_961514.1 acyl-CoA synthetase [Mycobacterium avium subsp. paratuberculosis K-10]MLLTSLNPSAVTATDIPDAVRIDGTVLSRADLLGAATSVAERVAGAGRVA
VLATPTAATVLAVTGCLIAGVPFVPVPADVGAAERRHMLADSGVRAWLGP
LPDEPDGLPHVPVRLHARSWHRYPEPSPDATAMIIYTSGTTGLPKGVVLS
RRAIAADLDALAEAWQWTADDVLVHGLPLFHVHGLVLGLLGSLRIGNRFV
HTGKPTPAGYAQARTDFGGTLFFGVPTVWSRVVADDAAARALRPARLLVS
GSAPLPVPVFDRLAGLTGHQPVERYGASESLITISTRADGERRPGWVGLP
LTGVQTRVVDDDGNPVPHDGETVGKLLVRGPMMFDGYLNRPDATAEAFDA
DGWYRTGDVAVVDDAGMHRIVGRESVDLIKSGGYRIGAGEIETALLGHPG
VAEAAVVGMPDEDLGQRIVAFVVPAGRVNPDDLIDHVAQQLSIHKRPREV
RVVDALPRNAMGKVLKKQLLSDG
41408677NP_961513.1 hypothetical protein MAP2579c [Mycobacterium avium subsp. paratuberculoMGEPSVRATTPGTPMRRIAAACLVGSAIEFYDFLIYGTAAALVFPAVFFP
RLGPTVATIASMATFATAFLSRPLGAAVFGYFGDRLGRKKTLVATLLIMG
ASTVSVGLVPSTASIGIAAPLLLTVLRLLQGFAVGGEWAGSVLLSAEYAP
TDRRGWYGMFTLLGGGTAGILASLTFLAVNLTMGEHSPAFMHWGWRVPFL
ISSGLIGIALYVRLNIDETPIFVEEKARHLVPKAPLTELLRLQRREIILV
AGSFVGGMGFIYLGNTFLVMYAHNHLGYSRSFIWGIGALGGLTSMACVAC
SAWISDRVGRRRVMLWGLVACLPWAFVVIPLIDTGRPVCYVVAVLGMFGT
AAVANGPTAAFVPELFATRYRYSGAAVAMNLAGIVGAAVPPLLAGTLLAT
YGSWAIGLMMASLVLASFVSVYLLPETRGAALDAAAAAEKVAAR
41408676NP_961512.1 hypothetical protein MAP2578 [Mycobacterium avium subsp. paratuberculosMTTAAGAAGVGLATLAADGSILDTWFPAPELTGPGTSGTSRLALSDVPPE
LTALIGRDDDRGTETVAVRTVIGSLDDVAADAYDAYLRLHLLSHRLVAPH
GLNAGGLFGVLTNVVWTNRGPCAIEGFEAVRARLRRHGPVTVYGVDKFPR
MVDNVLPTGVRIADADRVRLGAHLAPGTTVMHEGFVNYNAGTLGASMVEG
RISAGVVVGDGSDIGGGASIMGTLSGGGTEVISIGKRCLLGANAGLGISL
GDDCVVEAGLYVTAGTKVITPEGKQLKARELSGGNNLLFRRNSLTGAVEV
VARGGTGITLNEDLHAN
41408675NP_961511.1 hypothetical protein MAP2577 [Mycobacterium avium subsp. paratuberculosMTVTEVVVAQPVWAGVDAGKADHYCMVINDDAQRLLSQRVANDEAALLEL
IAAVTTLADGGEVTWAIDLNAGGAALLIALLIAAGQRLLYIPGRTVHHAA
GSYRGEGKTDAKDAAIIADQARMRHDLQPLRAGDDIAVELRILTSRRSDL
VADRTRAINRMRAQLLEYFPALERAFDYNKSRAALILLTGYQTPDALRSA
GGARVAAFLRKRKARNADTVAATALQAANAQHSIVPGQQLAATVVARLAK
EVMALDTEIGDTDAMIEERFRRHRHAEIILSMPGFGVILGAEFLAATGGD
MAAFASADRLAGVAGLAPVPRDSGRISGNLKRPRRYDRRLLRACYLSALV
SIRTDPSSRTYYDRKRTEGKRHTQAVLALARRRLNVLWAMLRDHAVYHPA
TTTAAA
41408674NP_961510.1 hypothetical protein MAP2576c [Mycobacterium avium subsp. paratuberculoMSFVTTRPEALLAVASMLEGLGSSMDAQNAAAAAPTTSIAPAAADEVSAL
QAAQFSAYGTWYQQVSAQAKAIHQTLVQNLDTNADSYGATEAANRVNTSA
AALQGLAPNVIPNAAPAADPPPAGTTSLGTSIGWAQNVGAAASDFITLGE
GQFAPVPGAAGIPNFNPGLTAATTAGPPAPAAPAAAAGAPVLASMGRGPS
IGGLSVPPSWAPGGVAPAANATPAQLVGAGFTSAAPDTAPVTAVPGGVPS
MATAGRGGYGLGAPRYGVKPTVMPKPAI
41408673NP_961509.1 hypothetical protein MAP2575c [Mycobacterium avium subsp. paratuberculoMTFDFGALPPEVNSTRMYTGAGAAPMMAAAAAFSNLADELSTTAAATQSA
IANLTGEEWMGPSAAAMVTAVQPYVQWMHTTAGQLQQAAAQAMASAAAYE
TAFAMTVPPALVAANRAQLAALIASNVLGQNAAAIAATEAQYGEMWAQDA
AAMYGYAASSATAGKLSPLTSPAPTNQPGGLGAQAAAVSGATATSAQTSG
LQGTVANVPNVVRTLAAPADPPGLTALDNLLGNPVVNNVGNAGFDVVSWN
VFNTIVSNILYNHTLDTAAAAGVAGEVGGAVGGGALVGAAAPATAGVGAA
PVLASMGSAATVGELSTPATWSAPTPEPAATTVGATEWASPAEEPHTAWA
TGMPAVASAGRGGYGMGPRYGVKPKVMPTRLPV
41408672NP_961508.1 dipeptidase [Mycobacterium avium subsp. paratuberculosis K-10]MLDLTGDPVALTAALVDIPSESRDEARLADEVEAALRSQTSGFEIVRNGN
AVLARTDRGRRSRVLLAGHLDTVPVAGNLPSRREDGDLYGCGTADMKSGD
AVFLHLAATVADPAHDLTLVMYDCEEIDAAANGLGRIQRELPDWLSADVA
ILGEPTGGYIEAGCQGTLRVVVSAAGTRAHSARSWLGDNAIHKLGAVLQR
LAGYQARSVDIDGCTYREGLSAVRIDGGVAGNVIPDAAAVTVNFRFAPDR
SPAEALQHVRDVLDGLDVHIEQTDAAAGALPGLSQPAAKALVEAAGGRVR
AKYGWTDVARFAALGIPALNFGPGDPNLAHRRDERVAVAAITAAADLLRG
YLSG
41408671NP_961507.1 hypothetical protein MAP2573 [Mycobacterium avium subsp. paratuberculosMPIRWNVPRQATAAERLDAALADTAAAAGAVVLGPDGIGKSTLARVAAER
FAAAHPGTRVRWVTGTPTERAVPFGAFSHLVRIAEIGKPAALLRAARASL
GDAGLLLVVDDAHQLDVLSATLVYQLARAGAARLIVTARADGAPDAIAAL
WDDGLLTRIDVEAPDAPTSPGEIDAFLAELTPPAHAVLEYLAVAEPLSVT
DLNALAGDGAVAEAQRWGAAETRMRGGTSDDPVVYTAHPLFAERVRAALD
PDDARQRRTELVTVLERHPSDRLSDRLRLVSLALDSDAPPRAADVVDAAR
QALRLGDLALGERLARAALRRSGGLAARLAPGACAGLAGPRPGGRRAAGR
GRLHRLDRGRADGLGPAAGGEPVLDAQRAGAGHRLPAHRPQPRRGPRPAH
HPGRAQRHLRDERGQRRARRQGRRRGARLARRRRPGGGLVGQRGRVVRGA
AGAVRRRRAVGAASVGRRTSRAAALHHRAGADHHAVAGGPARAGPRTRAA
VHRFRRAAAAGPRDRRGAAGARAARRGRIRFCGRVIGSGRGHLGAHRLLV
GAVVADPAGHRAGPAGRHRRHGKGIEPGRNPAWHQVGAVRARARGGAGAS
AGPDA
41408670NP_961506.1 hypothetical protein MAP2572c [Mycobacterium avium subsp. paratuberculoMPAERDSSAAWAVCVYCASGPQHPELLGVAAELGEAIAERGWTLVWGGGR
VSAMGAVASAARARGGRTVGVIPTVLMRREIADADADELIVSDTLHERKQ
IMEDRADAFIALPGGIGTLDEVLDAWTTGFLGLHAKPIVLLDPIGHYEGL
WLWLSGLLDSGYITQAAMDRVVLVDKVGAALEACAPG
41408669NP_961505.1 acyl-CoA synthetase [Mycobacterium avium subsp. paratuberculosis K-10]MSDRDGGARTAVKLTDIAARVPTVLADLPVIARGTLTGLLAQPGSHKSIG
TVFQDRAARYGDRVFLRFGDQQLTYRDANAAANRYAAVLAARGVGHGDVV
AIMLRNSPNTVLAMLAAVKCGAVAGMLNYHQRGEVLAHSLGLLDAKVLIA
ETDLVSAVAECGGSGSTETLTAEDLERFAVSAPATNPASASAVQARDTAF
YIFTSGTTGFPKASVMTHLRWLKALAAFGGIGLRLKSSDTLYCCLPLYHN
NALTVALSSVINSGATLALGKSFSASKFWDEVIANDATAFIYIGEVCRYL
LNQPAKPTDRAHRVRLIAGNGLRPEIWDEFTQRFGIARVCEFYASSEGNA
AFINVFNVPRSTGIFPLPLAYVEYDPDTGAPLRGDDGRVRRVPPGQPGLL
LSPVNRLQPFDGYTDPESSEKKLVRNAFRDGDCWFNTGDVMSPQGLGHAA
FVDRLGDTFRWKGENVATTQVEAALASDGSVEDCTVFGVEVPRTGGRAGM
AAIKLRDGAEFDGRSLARTVYEQLPVYALPLFVRVVDSIEQTTTFKSRKV
ELREQGYGPEVKDPLYVLAGRDEGYVPFYDEYPDEVAEGKRP
41408668NP_961504.1 FolP2 [Mycobacterium avium subsp. paratuberculosis K-10]MRPGPARPRPTRHHRPVQSTFCGRPVAGDRALIMAIINRTPDSFYDRGAT
FSDDAARAAVHRAVAEGADVIDVGGVKAGPGQDVDADTEIARLVPFIEWL
RDAYPDQLISADTWRAEVAKVACAAGADLINDTWGGVDPALPEVAAEFGA
GLVCSHTGNALPRTRPFRVSYGTSTRGVVDDVIAQVTAAAERAVGCGVAP
DRVLIDPTHDFGKNTFHGLLLLRHVGDLVNTGWPVLMALSNKDFVGETLG
VELTERLEGTLAATALAAAAGARMFRVHEVAPTRRVLEMVASIQGTRPPT
RTVRGLA
41408667NP_961503.1 hypothetical protein MAP2569c [Mycobacterium avium subsp. paratuberculoMTTSDLVAGELAGDGLRDTRPGDTWLADRSWNRPGWTVAELEAAKAGRTI
SVVLPALDEEDTIGSVIDSISPLVDGLVDELIVLDSGSTDDTEIRAVAAG
ARVVSREQALPEVPIRPGKGEALWRSLAASRGDIVVFVDSDLINPHPMFV
PWLVGPLLTGDGVHLVKSFYRRPLNVGDAGGGAGATGGGRVTELVARPLL
AALRPELGCILQPLGGEYAATRELLTSVPFAPGYGVEIGLLVDTFDRLGL
DAIAQVNLGVREHRNRPLAELGAMSRQVIATLLSRCGIPDSGVGLTQFVA
DGPEGQSYTQHTWPVSLADRPPMQAIRPR
41408666NP_961502.1 hypothetical protein MAP2568c [Mycobacterium avium subsp. paratuberculoMALVLLYLVVLVLVAIVLFGAASLLFGRGEQLPPLPRGTTATVLPAYGVT
GSDVDAVKFTQVLRGYKTSEVDWVLDRLARELEALRGQLAAAHAAAGEQQ
SGGQSAEPDDGADRQD
41408665NP_961501.1 TagA [Mycobacterium avium subsp. paratuberculosis K-10]MSDDEPIRCGWATARSGPDFELYRDYHDREWGQTVRDGVALFERMSLEAF
QSGLSWLTILRKRENFRRAFSGFDIDAVAGYTDADVQRLMADPGIVRNRA
KIEATIANARAAAELGGGTQLAELLWSFAPAPRSRPADASEIPSATAEST
AMAGELKRRGFRFVGPTTAYALMQATGMVDDHIRGCWVPAAVR
41408664NP_961500.1 hypothetical protein MAP2566 [Mycobacterium avium subsp. paratuberculosMSWGFGDDCWVQGRSDDQRELLDAESVAGHLLKADSMFAFLAAHRSQLFP
EEMFADLFPSQRGRPSVPAEVMASVITLQALHGFSDNETVDAVTFDLRWK
AACGLPITAGAFHSTTLTYWRRRLAASDRPNRIFEAVKTVVAETGVLAGK
TRRALDSTVLDDAVATQDTVTQLIAAIRRVRREVPGAAAVIEAHCSAHDY
DDPGKPAIAWEDKAARDRLVDGLVGDAHRVLGYLPDQELAPRAAEAVALL
ALIAGQDVEPVEGSDGTDGHWRIAQQVSGDRVISTVDADTRHAHKTVHRR
QDGFKAHLAVEPDTGIITDCALTKASGADNHEAVVGLSLLEGEHTPGAGP
GRFGVWHRGRPGGTGRRRPCRGDQTATATLAGSGWLHQRRFPHRFRRPHR
DLPGWTRNADPSQWRSHLRKILSLMPVGVPVHDRHARTQTHPSYPRAIIA
RCSRRGPRPRLASRIPPTPAHGGTLNGLAHSRQPQGPLPRNRQKQPLAAP
PRRSTEPTSAAHHGPDPHRHHLGHRLTRPHTKALPQPPTAATLNNGGAIS
FLSTHRV
41408663NP_961499.1 hypothetical protein MAP2565 [Mycobacterium avium subsp. paratuberculosMRVAMMTREYPPEVYGGAGVHVTELVTQLRRLCAVDVHCMGALRPGAAGV
QVHQPDPRLQGANPAMSTLSADLMMANAAAQASVVHSHTWYTGMAGHLAA
LLHDIPHVLTAHSLEPLRPWKAEQLGGGYRISTWVEHTAVLAAHAVIAVS
SAMREDILRVYPALDPSAVHVIRNGVDTDVWYPAGPVQTGSMLAELGVDP
ARPLVVFVGRITRQKGLAHLVAAAHRFSPEAQVLLCAGAPDTPEIADEIR
DAVAALARGRTGVFWIREMLPIGELREILSAASVFVCPSVYEPLGIVNLE
AMACAAPVVASDVGGIPEVVADGVTGSLVHYDPRDPAGYQAGLAEAVNEL
IADREKAQRYGRAGRQRCVEEFSWAHVAEQTLEIYRKVCA
41408662NP_961498.1 glucose-1-phosphate adenylyltransferase [Mycobacterium avium subsp. parMREAPHVLGIVLAGGEGKRLYPLTADRAKPAVPFGGAYRLIDFVLSNLVN
ARYLRICVLTQYKSHSLDRHISQNWRLSGLAGEYITPVPAQQRLGPRWYT
GSADAIYQSLNLIYDEDPDYIVVFGADHVYRMDPEQMVRLHIDSGAGATV
AGIRVPRSEATAFGCIDSDESGRIRKFVEKPLDPPGTPDDPETTFVSMGN
YIFTTKVLIDAIRADADDDHSDHDMGGDIIPRLVDDGMAAVYDFSDNEVP
GATDRDRGYWRDVGTLDAFYDAHMDLVSVHPVFNLYNKRWPIRGESENLA
PAKFVNGGSAQESVVGAGSIISAASVRNSVLSSNVVVDDGAIVEGSVIMP
GARVGRGAVVRHAILDKNVVVGPGEMVGVDLERDRERFAISAGGVVAVGK
GVWI
41408661NP_961497.1 hypothetical protein MAP2563 [Mycobacterium avium subsp. paratuberculosMPPTRMTALDRPWRRPGALRYALNRIRGVAKPPVTVTDPPADLHVERDVA
VPTRDATVLRINVFRKPDAGPRPVILSIHPYGKDNLPKRRGNRWTFSAQY
RILRQPRPVTFSALTGWEAPDPAWWTAQGFVVVNADSRGCGRSEGTGNLL
SHREAEDTYDLVQWIAGQPWSDGNVVMLGVSYLAISQYAVAALQPPALRA
ICPWEGFTDAYRDLMFPGGVRELGFIRMWSRNVRRDTRQAYDLQDMQDRH
PLRDEFWRSLVPDLSAITVPMLVCGSFSDNNLHSRGSLRAFTHSSSTHAR
LYTHRGGKWATFYAEEALAEQLSFFRGVLDGAPAARSVRLEVREDRDTVT
AVREESEWPLARTRWRALHLGDAGVLRTDPAAQPGRVTFGTRSRAACFTW
NVPDDVELTGPMAARLWVELHGCDDANLFVGVEKWRPGRFRDRFVAFEGS
YGYGRDRVSTGWQRVSLRALDSRLSRPGQPVAACTDPQPVAAGEVVAVDV
ALGPSATLFRAGEHLRLVVAGRWLCPTNPLTGQIPAAYQNSPRGRVSLHW
GPRRDAHLLIPEIP
41408660NP_961496.1 hypothetical protein MAP2562 [Mycobacterium avium subsp. paratuberculosMMKTGLRVTATSVWGILSWILILLLPAGTLHYWQAWVFIAVFTVATIVPA
AYLARTNPAALQRRMRAGPRAEPRTAQKFIITGSFLGLFAAMVFSALDHR
FGWSSVPAWLSLLGDVLVATGLGIAMLVVIQNSYAAATVTVEAGQTVVSS
GLYRFVRHPMYTGNVIMMIGIPLALGSYWGLLFVVPGTALLALRMFDEEK
LLLQELPGYPDYTQKVRYRLAPYLW
41408659NP_961495.1 hypothetical protein MAP2561 [Mycobacterium avium subsp. paratuberculosMSATTLNRPSASASPAPLGGSHFSGTLQMLRLYLRRDRISLPLWVLLLSV
PLSTVYVGSIEKVYPTAAARAGFAASIMASPAQRALYGQVYSDSLGAVGI
WKAGMFHVLIAVAVILTVIRHTRADEENGRTELVDSTAIGRYAGLTAALT
LSFAASIATGAIGAAGLLGTDVPAGGSLAFGAALAWSGLVFTAVAAVTAQ
LSPSARFARGAAFAVLGTAFTVRAVGDAGPGGLSWLSPLGWSLLVKPYAG
DRWWVLVLHLVTTAGLTVLAYRLLAGRDVGAGLIAERPGPATAAPRLGNA
FGLAWRLDRAALLLWTAGLALYGLLIGSVVHGIGDELGDSGQARDIVARM
GGTSALEDAFIAVAFAMMGMVAATFAVSLTLRLHQEESSQRAETVLAGAV
SRTRWLASHLVIALAGSGVAMLASGTVAGLVYGIAAGDVGGKLAMVVASA
AVQLPAVWLLSAVTVCVFGVAPRFAPVAWGVLIGFVALYLIGSLAGFSQW
LLHLEPFAHIPRVGADFTAVPLLWLLAIDIGLTILGAMAFRRRDLRC
41408658NP_961494.1 hypothetical protein MAP2560 [Mycobacterium avium subsp. paratuberculosMKADGGTVRLLGGDPWTQAVELHRQIAYVPGDVTLWPSLTGGEIIDLLAR
MRGGIDKKRRAELIERFDLDPHKKARTYSKGNRQKVSLISAFSSRARLLL
LDEPSSGLDPSMENVFQQCVAQARDRGTTVLLSSHILAETEALCERVTII
RAGKTIESGSLSSMRHLSRTSIKAEMTGDPGDLRRIKGVEDISIEGNTLR
AQVDSESLGELIRVLGDARVRSLVSQPPTLEELFLRHYDTSGTDGQRRAH
EAEVSLS
41408657NP_961493.1 hypothetical protein MAP2559 [Mycobacterium avium subsp. paratuberculosMRSADLTAAARIRDAAIEQFGEHGFGVGLRRIAEAAGVSAALVIHHFGSK
EGLRKACDDHIAEQIRESKTEALQTNDPAVWFGQLAEIEEFAPLIAYVLR
SMQTGGDLAKMLWRQMIENAEGYLEEGVRAGTIKPSRDPRARAKYLGITG
GGGLLLYLQMHDNPTDLRAVLRDYSRDMILPALEIYTEGLMADRTMYDAF
LAAEDQGDSPWQLTVLRPSRSAGSPRTSVRCGHWTVSTSPCGREKSTVSW
GPTAPASRPRSASCWDW
41408656NP_961492.1 hypothetical protein MAP2558 [Mycobacterium avium subsp. paratuberculosMSAGSGSGAPVGLRGELEYAAGMDGTDAEAPGQTAPSRAESLVAHAEASI
SEDALLAAARERAVDIGAGAVTPAVGALLSLLTKLSGGKAIAEVGTGAGV
SGLWLLSGMSDDGVLTTIDIEPEYLRLAKQAFAEAGIGPSRTRLIGGRAQ
EVLTRLADEYYDLVFIDADPIDQPDYVVEGVRLLRPGGVIVVHRAALGGR
AGDPAARDAEVVAVREAARLIAEDERLTPALVPLGDGILAAVRD
41408655NP_961491.1 RNA polymerase sigma factor SigE [Mycobacterium avium subsp. paratubercMDRGARETGNTEWQLPVAANDEMPLIGMPNSEELIITTLLSPSSMSHAHD
PSADGWAEPSDGLQGTAVFDATGDKTAMPSWDELVRQHADRVYRLAYRLS
GNQHDAEDLTQETFIRVFRSVQNYQPGTFEGWLHRITTNLFLDMVRRRSR
IRMEALPEDYERVPADEPNPEEIYHDSRLGPDLQAALDSLPPEFRAAVVL
CDIEGLSYEEIGATLGVKLGTVRSRIHRGRQALRDYLAAHPDHDALRASS
A
41408654NP_961490.1 hypothetical protein MAP2556c [Mycobacterium avium subsp. paratuberculoMNGKELAMPDRGHVFRRAFSWLPAQFASQSDAPVGAPRQFGSTEHLSVEA
IAAFVDGELRMNAHLRAAHHLSQCAQCAAEVDDQSRARAALRDSRPIRIP
ANLLGMLAEIPYESPDTPDRLADRDARDRRRRP
41408653NP_961489.1 hypothetical protein MAP2555c [Mycobacterium avium subsp. paratuberculoMTSDPGYDQAKDSANRLAPRPISRPPVDPASRREFGRPAGLRGSFVAERV
RPKKYREQSEFRPSEQPADPVLQEAFSRPDGSPETLQRHPVDSGALAAEK
DGVEPDHADDPWRDPGAPAALGTPAVAPSPSRSALGYGGKLGVRDVLFGG
KVSYLALLVLLLIALVIGLIGGVVGRKTAEVAEAFTTSKVTLSTNGNGEA
PAGRFAKVAAATAGAVVTIESKSDQEGMQGSGVVIDGRGYIVTNNHVISE
AANNPSQFKTTVVFNDGKEVPANLVGRDPKTDLAVLKVDNVDNLSVARLG
DSDKVRVGDEVLAAGAPLGLRSTVTHGIVSALHRPVPLSGEGSDTDTVID
AVQTDASINHGNSGGPLIDMNSQVIGIDTAGKSLSDSASGLGFAIPINEA
KEVAQTLIRDGKIVHPTLGVSTRSVSNAIASGAQVANVKAGSPAQKGGVL
ENDVVVKVGNRKVADADEFVVAVRQLTIGQDSPIEVVRDGRHVTLTVKPD
PDGS
41408652NP_961488.1 sec-independent translocase [Mycobacterium avium subsp. paratuberculosiMLGSLSWEHMLVLVVVGLVVLGPERLPGAIRWTSNALRQARDYLSGVTTQ
LREDLGPEFDDLRVPLSELQKLRGMTPRAALTKHLLDGDDSFLTGAFDRP
VNGAAAQPPPAPAPPPEPHRSGQTPFDADAT
41408651NP_961487.1 hypothetical protein MAP2553 [Mycobacterium avium subsp. paratuberculosMMSRHDSSDSAADLSAAVRAALGKVIDPELRRPITELGMVKSIDTEPDGA
VHVAIYLTTAACPKKTEISDRVTRAVADVPGTGAVKVTLDVMSDEQRTEL
RKQLRGDAREPVIPFAQPNSLTRVYAVASGKGGVGKSTVTVNLAAAMAAR
GLSVGVLDADIHGHSIPRMMGTTDRPTQVESMILPPIAHDVRVISIAQFT
QGNTPVVWRGPMLHRALQQFLADVYWGDLDVLLLDLPPGTGDIAISVAQL
IPNAEILVVTTPQLAAAEVAERAGSIALQTRQRVVGVVENMSGLTLPDGS
TLQVFGEGGGQQVAERLSRAVGAEVPLLGQIPLDPALVEAGDSGTPLVLS
APDSPVGKALRAVADSLSSRRRGLAGVSLGLDPTRR
41408650NP_961486.1 hypothetical protein MAP2552 [Mycobacterium avium subsp. paratuberculosMRIGGSRGADPAAATVRQRALRNTRKPIFGIAMITPLVFAGAVSATGPSL
PVRTPPVHAAVTPVAAVSPTFPDLAGPAVVAIDRGPTAFHVAEPALSAPP
PAAIVNAPGALGIPSIALAAYRNAEQKMAVAAPGCGVSWNLLAGIGRIES
GHAGGGAVDARGTAITPIYGPSLDGTLPGNEVIIQSAAGNRVTYARAMGP
MQFLPGTWARYASDGKGDGVADPQNLFDSTLAAARYLCSGGLNLRDQSQV
LTAILRYNNSMPYAQNVLGWAAAYATGVVPVDLPPMTGPPPPLGDAHLEH
PEGLGPNLPMNINGLPLDDPLARVPLIDLSSPALGSPQPMFPWMTPTPQQ
APTQVPGCTVICISSQGSPPAGPPPFGAPPPFAPPPSGPPPFAPPPSGPP
PFGPPPPDAGPVPAPPAGVAPQAAPSPPAGPAPQAPSPAAAGPAPNAPKK
PGPV
41408649NP_961485.1 hypothetical protein MAP2551 [Mycobacterium avium subsp. paratuberculosMSKSTAVRRLYTPRTSRRYSPRLDPETVGQITESIARFFGTGRYLLLQTI
VVAVWIVVNVFAVRLRWDPYPFILLNLAFSTQAAYAAPLILLAQNRQENR
DRVALEEDRRRAAQTKADTEYLARELAAVRLAVGEVVTREYLRHELDDLR
ELLAELRPQSADGEPVSDADNREQTAKKSR
41408648NP_961484.1 hypothetical protein MAP2550 [Mycobacterium avium subsp. paratuberculosMGSVNRVYIARLARILVLGPLGESVGRVRDVVISISIVRQQPRVLGLVVD
LATRRSIFIPILRVAAIDPNAVTLSTGSVSLRHFEQRPGEVLAIGQVLDT
VVKVNDPELPELAGVDVVVTDLGIEQTRTRDWMVTRVAVRPQRRLRRRGP
VHVVDWRNVQGLTPSALALPGQAVAQLLEQFEGRKPVDVADAIRGLPPKR
RYEVLKALNDDRLADILQELPELDQAEVLSQLGTERSADVLEEMDPDDAA
DLLGVLNPTDAEMLLKRMDPGDSASVRRLLTHSPDTAGGLMTSNPVVLTP
DTAVAEALARARDPDLTAALSSMVFVVRPPTATPTGRYLGCVPLQRLLRE
APAELVGGIVDSDLLTLRPETPLVAVTRYLAAYNLVCGPVVDDENHLLGA
VTVDDLLDHLLPPDWRVDMQELDTAGRLEGLGGSG
41408647NP_961483.1 hypothetical protein MAP2549c [Mycobacterium avium subsp. paratuberculoMTSPFQPGQVPGAPPPGAGGRRGVPGLPTPPRGWPVGSYPTYAEAQRAVD
YLSDQQFPVQQVTIVGVDLMQVERVTGRLTWPKVLGGGVLSGAWLGLFIG
LVLGFFSPNPWGALATGLVAGVFFGLITSAVPYSMARGTRDFSSTMQLVA
GRYDVLCDPQNAEKARDLLARLAI
41408646NP_961482.1 LpqY [Mycobacterium avium subsp. paratuberculosis K-10]MVIGRGRVRRAGAVALATLTIAAASSACVAGPRGLVISFYTTATDGATFA
AIAQDCTRQFGGRFAIQQISLPRAPGEQRLQLARRLTGRDRTLDIMSLDV
VWTAEFAEAGWALPLSDDPAGRAEADATVDTLPGPLSTARWHDRLFAAPV
TTNTQLLWYRPDLVLQPPRTWDAVVTEAARLHAAGRPSWIAVQANEGEGL
VVWFNTLLASGGGRVLSEDGRRVTLTDTPAHRAATVNALRILKSVATAPG
ADPSITRTDEGTARLAVEQGRAALAVNWPYALASMLDNAVKGGVPFLPLN
RDPRLAGSINDVGIFVPTDEQYRIAYQASQKVFDFAPYPGAAPGLPAKVT
IGGANLAVASTTRHRAEAFEAIRCVRSLQHQKYVAIQGGLPPVRTSLYSD
PQFQTKYPMYTIIRRQLTDAAVRPATPVYQTVSIRLAATLSPITGIDPER
TADQLSVEVQKAVDGKGLLP
41408645NP_961481.1 SugA [Mycobacterium avium subsp. paratuberculosis K-10]MTATLGETRPTPTSSAAPSVLGRTSEQRLALVLVAPAAILMLAVTAYPIG
YAVWLSLQRNNLAAPHDTAFVGLSNYATILSDRYWWTALAVTLGITVVSV
SAEFVLGLALALVMHRTLIGKGLVRTAVLIPYGIVTAVASYSWYYAWTPG
TGYLANLLPHGSAPLTAQIPSLAIVVLAEVWKTTPFMSLLLLAGLALVPE
DLLKAAQVDGAGAWRRLTRVTLPIIKPAVVVALLFRTLDAFRIFDNIYVL
TNGANNTGSVSMLGYDNLFKGFNVGLGSAISVLIFGCVGLIALVFVKVFG
AAAPGGDVDGR
41408644NP_961480.1 SugB [Mycobacterium avium subsp. paratuberculosis K-10]MLWAVIDTLVVVYALLPVLWIFSLSLKPTSTVKDGKLIPSAISLENYRGI
FRGDFFSSALINSVGIGLITTAVAVLLGAMAAYAVARLDFPGKRLLIGAT
LLITMFPAISLVTPLFNIERFLGLFDTWPGLILPYITFALPLAIYTLSAF
FREIPWDLEKAAKIDGATPAQAFRKVIVPLAAPGVVTAAILVFIFAWNDL
LLALTLTATKAAITAPVAIVSFSGSSQFEEPTGSIAAGAVVITVPIILFV
LIFQRRIVAGLTSGAVKG
41408643NP_961479.1 SugC [Mycobacterium avium subsp. paratuberculosis K-10]MAEIVLDHVSKSYPDGATAVRDLNLTIADGEFLILVGPSGCGKTTTLNMI
AGLEDISSGELRIGGERVNEKAPKDRDIAMVFQSYALYPHMTVRQNIAFP
LTLAKMKKPEIAQKVAETAKILDLTDFLDRKPSQLSGGQRQRVAMGRAIV
RHPKAFLMDEPLSNLDAKLRVQMRGEIARLQKRLGTTTVYVTHDQTEAMT
LGDRVVVMHSGVAQQIGTPDELYENPANLFVAGFIGSPAMNFFPATLTPI
GLKLPFGEVMLTPEVQQVIAEHPEPDNVIVGARPEHLSDAALIDGYQRIR
ALTFEVKVDMVESLGADKYVYFSTAAWAAHSTQLDELAAEADAHENQFVA
RVPAESKAAIGQTVELALDTTKLMVFDADSGVNLTVAPSGSP
41408642NP_961478.1 hypothetical protein MAP2544c [Mycobacterium avium subsp. paratuberculoMTEPTAEIADPVRGPRAEIVLRLRDPGPVTGIARSLAILAASPAVEGAVL
VAGALIDLGSPLWASPSARVPFTAVLLGRSDIPDLPLPPPRDPVQFLSAT
PITATEAAWVRLKGAEAMRQAWDNDGVDVLDPNRPAAQPD
41408641NP_961477.1 hypothetical protein MAP2543 [Mycobacterium avium subsp. paratuberculosMATTSQLLTAVSRKQLAGLVKSGMLIRVCHGVYAPNVPDVSDALDAAQLR
VGRPVVACMGTAAALYGFDTERTTRIHVLDPGIRMRPSPKIMVHQRIGAP
LRRVKGHLATMPAWTAIEVARALRPARALATLDAALRVGACTAAELDAAA
REQHGRRGIVKVRELLAYADGRAESPMESEARLLFIGSGLPMPELQYSIT
DRHGRRWRADFAWPAHDPVGLIARINGHLAAPRVAG
41408640NP_961476.1 hypothetical protein MAP2542 [Mycobacterium avium subsp. paratuberculosMFQGFDALPEVLRPIAHQPHPQPAPEAPPARATLVDCAVYDDGNRLPGVF
GYADALDKVREIESQGREGFVWVGLREPNQTEMQEVADVFGLHALAVEDA
VCAHQRPKVERYDDTLFLVLKTVNYVPHESVVLAREIVETGEIMVFVGRD
FVVTVRHGEHGGLSEVRKRMDGDPEQMRLGPFAVMHAIADHVVDHYLEVS
SLMLADIDSIEGLAFAPGSKIDVEPIYLLKREVVELRRCVNPLSSAFHRI
QTENKDVISKEVRRYLRDVADHHSEAADQIASYDDMLNSLIQAALARVGM
QQNNDMRKMAAWAGILAVPTMIAAIYGMNFHFMPELNWTWGYPAVMAGMA
VVCLVLYFQFRNRNWL
41408639NP_961475.1 malate dehydrogenase [Mycobacterium avium subsp. paratuberculosis K-10]MSASPLKVAVTGAAGQIGYSLLFRLASGSLLGPDRPIELRLLEIEPALKA
LEGVVMELDDCAFPLLSGVEIGADPNKIFDGANLALLVGARPRGPGMERS
DLLEANGAIFTAQGKALNEVAADDIRVGVTGNPANTNALIAMSNAPDIPR
ERFSALTRLDHNRAISQLAKKTGAKVTDIKKMTIWGNHSATQYPDIFHAE
VKGKNAAEVVGDQNWIENDFIPTVAKRGAAIIDARGASSAASAASATTDA
ARDWLLGTPAGDWVSMAVISDGSYGVPEGLISSFPVTTKDGDWTIVQGLE
IDEFSRSRIDKTTAELADERNAVTQLGLI
41408638NP_961474.1 hypothetical protein MAP2540c [Mycobacterium avium subsp. paratuberculoMKRVSELLESIQSRAEQGAITDAEIFAAHVGGKLSVSLTSPLDTQRALSI
AYTPGVAQVSRAIAADHRQAAHYTWANRLVAVVSDGSAVLGLGDIGPAAS
LPVMEGKCALFQAYGGLNAIPIVLDTKDPDEIVETLVRLRPTFGAVNLED
ISAPRCFEIERRLIEALDCPVMHDDQHGTAIVVLAALMGASKLLGRDMSS
LKVVVSGAGAAGVACTNLLMAMGVSDITVLDSRGILHAGRDDMNDVKAAL
SRRTNPAGLTGSLAEAIRGADVFLGLSGGVVPEEMIAAMAPNGIVFALSN
PDPEIHPQIAAKYATVVATGRSDFPNQINNVLAFPGVFRGALEAGARRIT
EKMMVAAAEAIFSVVSDDLAPDRIVPSPLDTRVGDAVATAVALATEVSDA
PAG
41408637NP_961473.1 LpqZ [Mycobacterium avium subsp. paratuberculosis K-10]MRIGRLVAPLLTALLAVTGCTTDTGDRRAHAEVVVGSRPDASSTLLAGIY
VAALRSYGFAARPATAGDPTAQLDSGAFTVVPAFTGRVLQSLQPGATAMS
DKDVYRAMIAALPEGIVAGDYTTAAEDKPVLLVSRATAQAWGGSDVSADL
STLPRHCDGLVVGTVAGHPAPPAVGSCRLAAPHEFPDGATMFAAVRAGQL
TAGWTTTADPGTPADLVALADGKPALIRAENVAPLYRRNALSERQLLAIN
EVAGVLDTAALVDMRRQVDTGADPQAVAGGWLAEHPLGR
41408636NP_961472.1 hypothetical protein MAP2538 [Mycobacterium avium subsp. paratuberculosMQGFAGKVAVVTGAGSGIGQALAVELGRAGAKLAISDVDTAGLAQTAEQL
AAIGAPVKADRLDVTEREAFLAYADAVNEHYGRVNQIYNNAGITFIGSIE
DSRFKDIERVVDVDFWGVVNGTKAFLPHLIASGDGHVINISSALGLFSAP
GQAAYVSAKFAVRGFTEALHQEMLRAGHPVRVTTVHPGGIKTAFARNATG
VEGLDHAELASLFEEQQAKTTPQRAAQLILDGVRRNKARVLVGPDVKAMD
LLVRAAGPNYERLLAGPVMGRVKEFVTRLLPKR
41408635NP_961471.1 hypothetical protein MAP2537 [Mycobacterium avium subsp. paratuberculosMQGFAGKVAVVTGAGSGIGQALAVELARSGAKVAISDVDLEGLAHTEEQL
KAIGAQYKADRLDVTEREAFLAYADAVKEHFGKVNQIYNNAGIAFTGDVE
VSQFKDIERVMDVDFWGVVNGTKAFLPHLIASGDGHVVNVSSVFGLFSVP
GQAAYNSAKFAVRGFTEALRQEMAAAGHPVAVTTVHPGGIKTAIARNATA
AEGLDQAELAKLFDKRLAKTTPQRAAQIILDAVRKKKARVLVGSDAKALD
ILVRLTGSGYQRLFGPVMSRLLPN
41408634NP_961470.1 alpha-ketoglutarate decarboxylase [Mycobacterium avium subsp. paratuberMSNISSPFGQNEWLVEEMYRKFRDDPSSVDPSWHEFLVDYNPEPTGDSVL
AAPASTDGPSAPAPAAPQTAQPALPAQTAPPAQTAQPARPAPQPAAAPGN
GASTRPAKPATPPPAEGDELQTLRGAAAAVVKNMSASLEVPTATSVRAIP
AKLLIDNRIVINNQLKRTRGGKISFTHLLGYALVQAIKKFPNMNRHYAEI
DGKPTAITPAHTNLGLAIDLQGKDGKRSLVVAGIKNCETMRFAQFVTAYE
DIVRRARDGKLTAEDFAGVTISLTNPGTIGTVHSVPRLMNGQGAIIGVGA
MEYPAEFQGASEERIAELGIGKLITLTSTYDHRIIQGAESGDFLRTIHEM
LLSDGFWDDIFRELSIPYLPIRWSTDNPDSIVDKNARVMELIAAYRNRGH
LMADIDPLRLDGSRFRSHPDLEILNHGLTLWDLDRVFKVNGFAGAEYKKL
RDILGLLRDAYCRHIGVEYTHILDPEQQEWLQQRVETKHVKPTVAEQKFI
LSKLNAAEAFETFLQTKYVGQKRFSLEGAESVIPMMDAAIDQCAEHGLDE
VVIGMPHRGRLNVLANIVGKPYSQIFSEFEGNLNPAQAHGSGDVKYHLGA
TGVYLQMFGDNDIQVSLTANPSHLEAVDPVLEGLVRAKQDLLDHGADDQG
DEKAFSVVPMMLHGDAAFAGQGVVAETLNLTHLPGYRVGGTIHIIVNNQI
GFTTAPEHSRSSEYCTDVAKMIGAPIFHVNGDDPEACAWVAKLAVDFRQK
FKKDVVIDMLCYRKRGHNEGDDPSMTNPAMYDVVDIKRGVRKSYTEALIG
RGDISMKEAEDALRDYQGQLERVFNEVRELEKHGVGPSESVEADQMLPAG
LATAVDKALLARIGDAFLALPEGFTAHPRVQPVLEKRREMAYEGKIDWAF
AELLALGSLVAGGKLVRLSGQDTRRGTFSQRHSVIIDRNTGEEFTPLQLL
ATNPDGTPTGGKFLVYDSPLSEYAAVGFEYGYTVGNPDALVLWEAQFGDF
VNGAQSIIDEFISSGEAKWGQLSNVVLLLPHGHEGQGPDHTSARIERFLQ
LWAEGSMTIAMPSTPSNYFHLLRRHALDGIKRPLIVFTPKSMLRNKAAVS
DIKDFTEIKFRSVLEEPTYEDGIGDRGKVSRVLLTSGKLYYELVARKNKD
NRDDVAIVRIEQLAPLPKRRLGETLDRYPNVREYFWVQEEPANQGAWPRF
GLELPELLPDKLTGLKRISRRAMSAPSSGSSKVHAVEQQEIIDTAFA
41408633NP_961469.1 hypothetical protein MAP2535 [Mycobacterium avium subsp. paratuberculosMRARRNRFPNRFFSTSSAAARTDSGRPKVSARALAQVIERSSRIQGPAAE
AYVTRLRNAHPDAGPAEILAKLQKRYLAIVTAGGVAVGAAATIPGIGTLS
ALSAAAAETVTFLEATAFLVLAAAVVYDIPADHRERRRALVLAVLVGDNS
ERAVAQLIGPGRTQGGWVSESLAALPLSSMSRLNSRLLKSWVRRYTLRRG
ALLFGKLLPVGIGVVVGAVGNYLAGKKIIRNANRAFGAPPARWPRALHLV
PPIHEAG
41408632NP_961468.1 hypothetical protein MAP2534c [Mycobacterium avium subsp. paratuberculoMTTATPRTPGGGRRAPSGPAPGAHRWDLITRSSAHSQNPWNPLWAMMIGF
FMIMVDSTIVAIANPTIMADLHIGYDTVVWVTSAYLLGYAVVLLVAGRLG
DRFGTKNLYLIGLAVFTVASVWCGLAGSAAMLIAARVVQGVGAGVLTPQT
LSTITRIFPPERRGVAVSVWSATAGAASLVGPLAGGVLVDGLGWQWIFFV
NVPIGVLGLALAYWLVPVLPTQSHRFDLVGVGLSGVGMFLIVFGLQQGQA
AHWQPWIWALIVAGVGFVTVFVFWQSVNVREPLIPLVIFADRDFSLCNIG
VAIISFAATAMMLPLTFYAQAVCGLSPTRSALLIAPMAIANGVFAPFVGK
IVDRYHPRPVLGFGFSLLAIALTWLTFEMSPATPIWRLVLPFFAMGVGMA
FVWSPLTATATRNLSAQLAGAGSAVYNSVRQLGAVLGSAGMAAFMTWRIG
AEMPGQPAGGGEDSAGPVLPEFLRGPFAAAMSQSVLLPAFIALFGIVAAL
FLVGFRPWAHRDGGTDAFGPDDYGGDYDDDYDDDDAYVELILVREPEPEA
QQRAGQPRRPQPAPAPPADVRRRDPVESRRSVLDERPAQVQPIGFAHNGS
HVDGGKRLRQVAVRRAPKPGPPADRFTRPPRRHHPGPAGHHLGEGESLRG
QHHRPDPDDDPTGYGRHSSGN
41408631NP_961467.1 hypothetical protein MAP2533 [Mycobacterium avium subsp. paratuberculosMAEVFVTGDSIVYSASDLAAAARCEFALLRDFDAKLGRGPAVTVEDDLLI
RTATLGAEHERRELARLRERFGDAVAVIGRPAYTPAALTAASEATRRAVA
DRAPVIYQAAMFDGRFLGFADFLVRDGERYQVVDTKLARSEKVTALLQLA
AYADALAAAGVPVAPEAELRLGDGTAVRHRVCDLVPVYRSARARLQRLLD
EHRAGGAAVRWDDENVTACFRCAVCVEQLRATDDVLLVAGMRVSQRDKLF
DAGISTVAELAAHRGPVPELAARVVAKLTAQAKLQVRERETGVPQVEIVD
PQPLALLPEPDPGDLFFDFEGDPLWTADGREWGLEYLFGVLEAGPSGRFR
PLWAHNRAEERKALTDFLALVANRRRRRPNMHIYHYAPYEKTALLRLAGR
YGVGEDQVDELLRSGTLVDLYPLVRRSIRVGADSFSLKALEPLYMGSRLR
AGEVTTAAGSITSYARYCELQADGRADEAVAVLKEIEDYNHYDCRSTQEL
RNWLMLRAYESGVLPVGAQPVGDGNTVDDRDELAATLSAFTGAAGIDERT
PQQTAVALLAAARGYHRREDKPFWWAHFDRLNFPIDEWADNTDVFVAEQA
SVCVDWQTPARARKPQRRVRLRGELARGELRTEVFALYDPPAPPGMTDNP
DRRAAGRATVVEADDPALPTEVVVLERVTSDGKPFHQLPFALTPGPPIPT
TALRDSIEATVAAVAAGLPRLPDSAVVDVLLRRAPRTRSGAALPRSADTV
ADIASALTDLDSSYLAVHGPPGTGKTHTAARVIVRLVAEHRWRVGVVAQS
HATVENLLDCVIDAGLDPRRIAKKRYDRQAPRWQEIDGNAYAAFLADTPG
CVIGGTAWDFANANRIPPGSLDLLVIDEAGQFCLANTIAVAPAAANLLLL
GDPQQLPQVSQGTHPEPVDTSALDWLVVGQRTLPDERGYFLDRSYRMHPA
VCAAVSALSYEGRLHSDACTAARRLDGCPPGVRLLSVDHQGNSTESPEEA
DAIAAAVTGLLGASWTDEHGTRALTASDVLVLAPYNAQVALLRRRLGSAG
LDGVRVGTVDKFQGGQAPVVFISMTASSVDVVPRGISFLLNRNRLNVAVS
RAQYAAVIVRSPTLTEYLPGTPAGLIELGAFLALTQPDLR
41408630NP_961466.1 hypothetical protein MAP2532 [Mycobacterium avium subsp. paratuberculosMTGLYYDPWNREIDADPYPIYQRLRNEAPLYYNERHDFWGLSRYDDVDAA
LRDPLRLSSAKGDILDVVKADPVMPPGVFINEDPPLHTIHRALVARAFTP
KKMRTLEDKIRAFCVASLDMVADSDRFDFVEDLGAELPMRTIGMLLGIPD
ADQPSVREHARATLQNDTGGPMPIRKDHYFDGDMFSDYVEWRKRPEWEID
MDNARRSRTSTVRGWDSMPAIVT
41408629NP_961465.1 hypothetical protein MAP2531 [Mycobacterium avium subsp. paratuberculosMTTTDIDLEALRRDLQYVKDKIEIRDLIHTQARGHDRHDVSLMTSVYTDD
GVDEHGPTVKAAADYGDWANAAHSAAFDQHSHNITTHSCEIDGDVAHSES
YVIVQARRGNALIMMGGRYIDRLERRDGTWKIALRRCTVEWTLQGDGSAL
KSGNFTGFIKGSWDTNDVSYARPLTQDDTNIERW
41408628NP_961464.1 hypothetical protein MAP2530 [Mycobacterium avium subsp. paratuberculosMSDRFALTDRVAVITGAGTGIGRASALVLAEHGADIVLAGRRPDPLQATA
KEVEALGRRALIVPTDVTETHQCQDLVDATLADFGRLDILVNNAGGGETK
GITRWTEEEWHDVVDLNLGSVWFLSRCAVKPMMTQGSGAIVNISSGASLI
AMPQAAIYAAAKAGVNNLTGSMAAAWGRKGIRVNCIACGAIRTDGLLADA
AKGGFDVDQLGAMNAMGRIAEPDEIGYGVLFFASDASSYCSGQTLYIHGG
PGPAGI
41408627NP_961463.1 hypothetical protein MAP2529 [Mycobacterium avium subsp. paratuberculosMSRVTPLRFRDWPPEMRDAMAALMPPNPRHPAPVTKDRPKAGNALGTLAH
HPSLARAFCTLQGHLLMGTTLSMRHREMLILRTAAVRGSAYEWTHHNFIA
PDGGISTEDVARIAFGPTAPYWSDFDAALLRSVDELIHDGQMSDATWATL
SSEFGTQQLLDTMFTVTSYDALMRMLKTCQVRLEDDVRELRAQAGLSVDG
DGA
41408626NP_961462.1 hypothetical protein MAP2528 [Mycobacterium avium subsp. paratuberculosMDVPMAGKVEGKVAFITGAARGQGRSHAITLAREGADIIAIDVCKQLDGV
KLPMSTPDDLAETVRQVEALGRRIIASQVDVRDFDAMQAAVDDGVTQLGR
LDIVLANAALASEGTRLNRMGPKTWRDMIDVNLNGAWITARVAIPHIMAG
KRGGSIVFTSSIGGLRGAENIGNYIASKHGLHGLMRTMALELGPRNIRVN
IVCPSSVATPMLLNEPTYRMFRPDLENPTVEDFKVASRQMHVLPIPYVEP
ADISNAILFLVSDDARYITGVALPVDGGALLK
41408625NP_961461.1 hypothetical protein MAP2527c [Mycobacterium avium subsp. paratuberculoMDMAASPRRVGAETSQTRDALLEAVAQMMLEEGYASVTYRALAAKAGVTP
SLVQYYFPSLDDIFVAAIRRYSERNLQWLTEELQRRADDPLHALWESGWH
ESTSALMTEFMALGNHRKSIRSEIAAVTDSMRRVQVEALVAKFGNDARLL
ADLSFDAVVLLINGVPKLLGLEESVGVDTAHAELIAACERFLDAVEPRAK
PRRRSKKAPTRRR
41408624NP_961460.1 hypothetical protein MAP2526c [Mycobacterium avium subsp. paratuberculoMSRVAVVTGGGSGIGRAIVERLAHDRHRVAVLDVNEEAAEKVAARVAADG
AHAIAVPTDVAESASVAAAFESVRRALGPVQVLVTSAAITGFKPFGEITI
EDWNRHLAVNLTGTFLCLQAALPDMVEAGWGRVVTISSTAAQTGSPRQGH
YSASKGGVIALTRTIALEYAVHGITANTVPPFSVDTPMLRAAQEAGNLPP
VKYLAKASPVGRLGTGEDIAAACAFLCSDEAGYITGQIIGVNGGAVI
41408623NP_961459.1 hypothetical protein MAP2525c [Mycobacterium avium subsp. paratuberculoMSVEVAGSGSRKAPQFHFDRHTPEYRERFLDVTQEMHQRCPIAWTDTYGG
HWVAAGAGAVFELARCPHVSNDHDVNNERRGYRGVTIPLTTESDQIRGGM
LEMDDPEHRIYRSLLNPYLSPAAVSRWQPFIDDVVRACLDERIESGRIDF
VDDLANVVPAVLTLAMLGVPLRKWTMYNEPVHAMVYTPPGSPEAAKVHDM
WVSVVVDLFANLTEIREHPRPGIINALAQLRIDGEPAPDMEIIGMLTLLI
GGGFDTTTALTAHALKWLSEHPDQRARLHGELDVLLNPATEEFLRYFTPA
PGDARTISADMELDGIRFAEGERVWLSWAMANRDPSLFDNPNELMLARKA
NRHFSFGIGVHRCIGSNVARTVFKSMLTAVLERMPDYRCDRVNTVHYDTI
GIIQGMRNLPADFTPGKRLGPGLDETLDRLQSVCDSQGLARPITEYKEQA
RLPG
41408622NP_961458.1 hypothetical protein MAP2524c [Mycobacterium avium subsp. paratuberculoMRIGLTGGASSTDKIVEQAQAAEAEGFTSLWYASTVAGDPLVAMALAGRA
TTSIELGTAVLQTYPCHPLLQANRVAATANAMGRPGFTLGLGPSHEPLVS
GVLGLSYDHPGRNTEEYLRIISALLRGEEVDYSGQDWTTRSPAGVVRLDY
EVPLLLSALSPRMLRIAGRFADGVVLWMASASVIESRIAPALRHATTEWG
RPPPRIVAGLPVAVHDDPVEARAATAAMSTMYAGMTNYQRVIEAGGGATP
ADVAIIGNEESVRKQLQDLLDAGATDIWAQPIGVGDERAQRTASAQRTRE
LLSELARLG
41408621NP_961457.1 hypothetical protein MAP2523c [Mycobacterium avium subsp. paratuberculoMTKKLRVIQWTTGKVGKLSLRGVLDDPRLELVGVYAFSEEKAGSDAGALC
GRPDTGVLATTDIDALLALKADTVIYTPFMADIDDVVRLLESGLDVISTN
LFLNVGGIQGETKQRLAAACQRGGSSLYITGVNPGWINTMVTAMTAVCRD
VEMVSVSESADVSVYESPETWQSQGFSLSEAPPAVIETAKMWLSTFRDSV
QRMAVALGFELDDMEFFIEHATASERVDLGWWVIEKDTIAAMRAGWNGKV
NGKTVVQSNVAWYMTKLLNEGWQFDDDHYHVVIKGEPGVDTRIRFLPPDS
WGNHEWDTMTAMPAVSAAVDVAAAPAGILTLKDVGLPCAPAGLWLEG
41408620NP_961456.1 LprE [Mycobacterium avium subsp. paratuberculosis K-10]MTVRCVDVWSPPCRTEPLTGSAAVALIAVTLTGCGSGDSTVAKTPQARTT
SETPSITAPATPSAAAAQPGVGQPADPCAVNLAAPTIAKVVSELPRDPRS
QQPWNPEPLAGNYNQCAQLSAVIVKANTNAISPSTRAVLFHLGQFIPQGV
PDTYGFNGIDPAQTTGDTVALTYPGGLSGLSTDVKFHWNGNAVELIGNTP
AH
41408619NP_961455.1 DeaD [Mycobacterium avium subsp. paratuberculosis K-10]MTLPDSSTEAASPTFADLQIHPSVLRAIADVGYETPTGIQAATIPALMAG
SDVVGLAQTGTGKTAAFAIPILSKIDAASTATQALVLAPTRELALQVAEA
FSRYGAHLPKINVLPIYGGSSYAVQLAGLKRGAHVVVGTPGRVIDHLERG
TLDLSHVDYLVLDEADEMLTMGFAEEVDRILSETPEYKQVALFSATMPPA
IRKLTAKYLHDPLEVSTKAKTTTAENISQRYIQVAGPRKMDALTRVLEVE
PFEAMIVFVRTKQATEEVAERLRARGFSAAAINGDIPQGQRERTVAALKD
GGIDILVATDVAARGLDVERISHVLNYDIPHDTESYVHRIGRTGRAGRSG
TALLFVSPRERHLLKAIEKATRQPLTEAELPTVEDVNAQRVAKFADSITA
ALGAPGIDLFRKLVQDYEREHDVPMADIAAALAVQSRDGEEFLMAPEPPR
ERRERHTERRERTEKPRSTRPLATYRIAVGKRHKIGPGAIVGAIANEGGL
HRSDFGHIAIGPGFSLVELPAKLPKSTLKRLEQTRISGVLINLQPDRAAA
KARGRDGGKPRRKYGG
41408618NP_961454.1 hypothetical protein MAP2520c [Mycobacterium avium subsp. paratuberculoMTLSEEQDAQGGLEQTSRVDRVASLTGVRAVAALLVVGTHAAYTTGKYTH
GYWGLVGSRMEIGVPIFFVLSGYLLFRPWVKSAATGGPPQSLSRYAWHRV
RRIMPPYVITVLFAYVLYHFREAGPNPGHSWLGLARNLTLTQIYCNGYLG
KYLHQGLTQMWSLAVEASFYVILPLLAYLLLVLICRRQWQPKLVLGPLAG
LALISPAWLVLVHTDHWFPDGARLWLPTYLAWFLAGMMLKVLQEMGARAY
GFVAIPLAVVSYFIVSTPIAGAPTTSPATLSEALFKTCFYAVIAALAVAP
LALGDHGWYSRLLASRPMVWLGEISYEIFLIHLITMEFAMDYIVGARVYT
GSMLNLFVATLVLTIPLAWLLHRFTRVRD
41408617NP_961453.1 hypothetical protein MAP2519 [Mycobacterium avium subsp. paratuberculosMPGARRSTDWLSGHRNEAAVDRILDAAQELYTQRDSESIGMNEIARAAGC
SRATLYRYFENREALRTAYVHREANRLGRAIMEQIDGIDEPRQRLTASIT
TTLRMVRGNPALASWFAVTRPPIAGELAEHSEVITALAAAFVGSLGPEEP
AVVERRARWVVRVITSLLLFPGHDEADERAMIEEFVVPIVTPVSARG
41408616NP_961452.1 hypothetical protein MAP2518 [Mycobacterium avium subsp. paratuberculosMSHNVPVAFELPNADTWADPWPMYRALRDHDPVHHVVPPKRPEHDYYVLS
RHADVWAAARDHETFSSAKGLTVNYDDLELIGLQDNPPFVMQDPPVHTEF
RKLVSRSFTPRQVEAVEPKVRDFVVERIERLRAAGGGDIVAELFKPLPSM
VVAHYLGVPEEDRAQFDGWTEAIVAANTADGGVAGALGSAGDAVTSMMAY
FTGLIERRRTDPEDDTISHLVSAGVGADGDIAGTLSVLAFTFTMVTGGND
TTTGMLGGSMPLLHQRPDQRQRLVDEPELIPDAVEELLRLTSPVQGLART
TTRDVTIGRTTIPAGRRVLLLYGSANRDERQYGPDAGELDVARCPRNILT
FSHGAHHCLGAAAARMQSRVALTELLARCPDFEVDESGIVWAGGNYVRRP
LSVPIRVKS
41408615NP_961451.1 hypothetical protein MAP2517 [Mycobacterium avium subsp. paratuberculosMSSEALASLIADLPDGTVVTDPTVTEGYRQDRAFDPSAGKPLAVVRPRRT
EEVQTVLRWASAHGVPVVTRGAGSGLSGGATALDNGIVLSTEKMRDITVD
PVTRTAVCQPGLFNAEVKKAAAEHGLWYPPDPSSFEICSIGGNIATNAGG
LCCVKYGVTTDYVLGMQVVLADGTAVRLGGPRLKDVAGLSLTKLFVGSEG
TLGVITEVTLRLVPKQNTSSVVVASFATVEDAVGAVLGVTGRLRPSMLEF
MDSVAINAVEDTLRMDLDRGAAAMLVAGSDERGRAGSEDAEIMAKVFAEN
AATEVFSTDDPDEGEAFVVARRFCIPAVEAKGSLLLEDVGVPLPALGRLV
TGIAAIAAERDLMISVIAHAGDGNTHPLIVYDPADADMTERAHLAFGEIM
DLAVGLGGTITGEHGVGRLKRPWLAGYLGPEVMDLNRRIKQALDPQGILN
PGSGI
41408614NP_961450.1 hypothetical protein MAP2516 [Mycobacterium avium subsp. paratuberculosMPDTSRGPALLILFATLLATAGTGISIVAFPWLALQHRHSATDASIVAAA
MTLPLVLATLIAGTAVDSFGRRRVSLVCDWLSGAAVTAVPLTAWIFGAAA
IDVAELAVLAFCAAAFDPAGMTARQSMLPEAAARAGWSLDRTNSSYEAML
NLAFIVGPGLGGLLIATLGGINTMWVTAGCFALSFLAIGALRLDGAGKPP
RATRPVGLVTGIAEGVRFVWNLRVLRTLGLIDLAVTALYLPMESVLFPKY
FADQHQPAELGWALMALALGGVAGALGYAVLSARLRRRTAVLTATLTFGA
TTAGIAVLPPLPVILGLCAVTGVVYGPIQPIYNFVMQTRAPHHLRGRVVG
VMAGLTYAAGPLGLLVAGPLADAAGLKATFLTLAVPILAIGVVACGLPSL
RELDRAPQFADDPGP
41408613NP_961449.1 hypothetical protein MAP2515c [Mycobacterium avium subsp. paratuberculoMRTRSKGPGRGSCQAWGSRGECNRIPWAAATEFRGGRPRMQDVGVLEHPR
TGQAFDSPVPAGSGWPGDPATPQTPVAADADQVIALARHAGAIPELDALV
SVCRACPRLVEWREEVAVVKRRAFADQPYWGRPVPSWGSARPRLLIVGLA
PAAHGANRTGRMFTGDRSGDQLYAALYRAGLVNQPTSVDAADGLRTKHIR
IVAPVHCAPPANVPTPVERDTCWPWLQAEWRLISEHVRVVVALGGFGWQI
ALRLPGVPAARKPRFGHGVVAELAPGVRLLGCYHPSQQNMFTGRLTPAML
DDVFRDAKGLAGIK
41408612NP_961448.1 hypothetical protein MAP2514c [Mycobacterium avium subsp. paratuberculoMSDVLVSGASVAGTAAAFWLGRHGHSVTVVERHRGPRPGGQAIDVRGPAL
GVLERMGLLAAAAKRRTQIRGSSVVDRDGNELSRDTEAAISGPTGGPIEG
PDIELLRDDLVELLYGASQWTAEYLFDDTITALDDRGAAVRVTFERAAPR
DFDLVIGADGLHSNVRRLVFGPEDEFIERLGTHAAIFTVPNFLGLDYWQM
WHYGDSTMAGVYSARDNAEARAMLGFMDAELRLDYRDTEAQFAELERRMA
GEGWVRPQLLEYMRTAPDFYFDEMSQIKMDRWSRGRVALVGDAGYCCSPL
SGQGTSVALLGAYILAGELKAAGEDHEAGFANYHREFADYVQRNQWLVVD
NIPGGAPIPQEVFERIVASIALKDY
41408611NP_961447.1 hypothetical protein MAP2513c [Mycobacterium avium subsp. paratuberculoMRLSVLDLVPVRTDQTTGDALAATVALAQAADRLGFTRYWVAEHHNMPSV
GATSPPVLLAYLAPQTTRLRLGSGGVMLPNHAPLAVAEQFALLEAAAPGR
IDLGIGRAPGSDPVTSYALRGGRGDEDIQRFPDYLDDVAALMSARGVVVP
LRSGDYRLRATPAAAGEPRLWLLGSSMYSAHLAAAKGLPYVFAHHFSGKG
TEEALEVYRSRFRPSALTPEPLTFLTVNAVVAETRDEATALMLPNLQMMA
KLRTGQPLGPVPLVEEAEHAELTAEQRRIVDSGLRRAVLGGPAEAAEQVR
ALAERFGVDEVMVNPVASARRGTDPATAPARVATLELLAKELF
41408610NP_961446.1 hypothetical protein MAP2512 [Mycobacterium avium subsp. paratuberculosMTPPVGPPRGIRAALGMLAIGVVAFSVSSVAHPDAGHGIFSATALYSALN
AVAAGLIALRACRIPADRWAWALIAAGMACSAVGDVVYAVWVPDGRSPSV
ADPEYLAYYPFVYAGLLLLMRARLKRLPIAVQLDSVVCALTLTAVAAALT
AGPLHQAAVHAPKTVWVGLAYPWCDLMLLALAAGMLPILGWRNEIRWALL
VAGLVLFAVADGAYLFQTAAGSYRVGSLLDVCWPASSVLIAMASWAPPPA
TATQARRRFSPYVTPVASTIVALGVIVLAHHSRSAATLAALSLVVGAGRF
SLTFRDVSLLHSHDRHAMTDELTALPNRRQLVTALQGLPASASPGAGSMP
SRANPRRALLLLSLSDFHEITESIGRQFGDELLCHIANRLAGSVRRDDLL
ARVGDDQFAVLLADGANLTAASAQAGRLLEALSEPIALDPITIQVDGRIA
IALCPDHCDHPRELLSRAETALAHAKSARSKIAVYDSAFEAHRDNDTNLI
EELRTALFDTDELKLHYQPKIDGRDGSIHSVEAVLRWQHPTRGTLLPEEF
LPVAERAGLMRKISNRTLSMALQQVRSWREEGLRLTVAVNLSTTNLLDIE
LVGTVERLLANYDLPADALILEITESALVDSVRSRNTVTALQRLGIRISI
DDYGTGWSSLARLQEVSVDELKLDRIFVARLAHDARSVAIVRSTVALADN
LGADLVAEGVENEDTLDALRRYGCNITQGFVHTPPLPPDELRAWIASHAP
DPSQSRG
41408609NP_961445.1 hypothetical protein MAP2511 [Mycobacterium avium subsp. paratuberculosMAGAAMKRWAVNPWRRSGVPARVGWLLAGGYGTAALLVLLSSVRGWRGPY
GTRPVDDLVMFVCLAVAAICAARAARAASGRRRYGWLALTTALLGWAVGE
IIWAVYDVRPEFEHAAHPAAAELVLLLFPVGAMTSLVLLSQLSRHSPRRL
LLDGLIVATSLFVISWVFVVEAQLREHTGTQVATLAEVFNDIVLMTTAIL
MLSRARPGDRPSRSLLACGIATISVTDIAMVFYTGIGSYHTDDIGDLARV
AGVGTLALAGLASVYEQPAPGSPDEIEFRTRLWLPYLPLILAAAVGWGHA
AGKAIHEPMLAALGSWWPPCWRGSSWSWSTTRICCRRSRGRPSATT
41408608NP_961444.1 hypothetical protein MAP2510 [Mycobacterium avium subsp. paratuberculosMSCVFCAIVAGEAPAIRIYEDDDYLAILDIRPFTRGHTLVLPKRHSVDLT
DTPPETLAGMVTLGQRIARAARSTELADATNIAINDGSAAFQTVFHIHLH
VLPRRNGDKLSVAKGMLLRRDPDRDATGQILRLALARIDANQPD
41408607NP_961443.1 amidase [Mycobacterium avium subsp. paratuberculosis K-10]MNDLAFAGAAAQARMLANGDLSAPELLEVYLERIARLDSQLRCYRVVLAD
RARREAAAAQSRLDAGERLPLLGVPVAIKDDVDVAGEVTTFGSGGHGPAV
SSDAEVVRRLRAAGAVIIGKTNVPELMMMPYTESLTFGATRNPWDPRRTP
GGSSGGSAAAVAAGLAPLALGSDGGGSIRIPSTWCGLFGLKPQRDRVSLE
PHDDAWYGLSVNGPIARTVIDAAVFLDATSTVPGPEGEFVAAATREPGRL
RIALSTKVPTPLPVRVGKPELAAVQQAGALLRDLGHDVVTADPEYPAAAI
LGNYLPRYLRGICDDADSLAHPERLETRTRNMARMGSFFSDRRMAAIRAG
EGPLIARIQAIFDDVDVVVTPGTAAGPSRVGAYQRRGAVSTLLRVGQCVP
YQQIWNLTGQPAAVVPWDFDADGLPMSVQLVGRPYDEATLLSLSAQIEAA
RPWALRRPPVC
41408606NP_961442.1 hypothetical protein MAP2508 [Mycobacterium avium subsp. paratuberculosMSTPLLRGFPPVVDERARTLILGSFPSAQSLLTGQYYANPRNAFWSITGE
LFGFDAAAPYPRRLAQLRRHRIALWDVLHACRRAGSADSAIEPNSLVVNG
FGEFFAEHPGITRVYFNGAKAAELYRRLAMAPDHVCFQRLPSTSPAHVMA
PGAKLAAWAVLRNSA
41408605NP_961441.1 hypothetical protein MAP2507c [Mycobacterium avium subsp. paratuberculoMTSHDGLPALYVDDVHDGDDRDIEDLLDGLQGTARTERAELVRWLLAQGI
TAEEIRTTNPPLLLATRHLIGDDGTYVSTREISETYGIDMALLQRVQRAI
GLVRVDDPDAAVHMRADGEAAAFTQRFVDVGLDPDQVVLVAQVLAEGLSR
AAEVMRYSALSAIMRPGATELEIAKASKALVTQIAPLLGPMIQQMLFMQL
RHMMETEAVNAAERAAGKPLPGARQITVAFADLVGFTRIGEAVSPEELGQ
LANRLAILARDVTVPPVRFVKTIGDAVMFVCPEPRPLLDVVLKLVEAVDT
DNEFPRLRAGVASGTAVSRAGDWFGSPVNVASRVTAVARPGTVLVADSVW
DVIGDNGEFSGSFAGARRLKGIKNEVKLFRVRRGG
41408604NP_961440.1 hypothetical protein MAP2506c [Mycobacterium avium subsp. paratuberculoMKAHHAHRRYGRPGGWQQAQQPDASDAAEWFAGRLPEQWFDGDPTVIVDR
EEITVIGKLPEPADAEKEASEARAAGRASRFREETRSERMRIADEAQDRY
GRKVSWGVEVGSKTGTERILFTHIAVPVMTRLKQPERQVLDTLVDAGVAR
SRADALAWSVKLVGEHAEEWLAQLRDAMSAVDDLRAQGPDL
41408603NP_961439.1 hypothetical protein MAP2505 [Mycobacterium avium subsp. paratuberculosMIRPKPEPPQAAPLTSDRLGALLLSASEVNAVMGSSTMEPGKPITATDSS
SVTVSVPDCQGALYTTQDPVYAGSGYSAVNGLVSSEPGDNYDHWVNQAVV
LFPSADKAKSFLQTSLQKWKGCAGQTVTVTNKSKTYRWTFAQVQGAPPKI
TLMHTQEGADGWECQRALSVANNVIVDINACGYRITDQGDQIADKIVAKI
DNE
41408602NP_961438.1 hypothetical protein MAP2504 [Mycobacterium avium subsp. paratuberculosMSDERSSKVGSMFGPYHLKRLLGRGGMGEVYEAEHTVKEWTVAVKLLNES
FSSDPVFRERMKREARTAGRLQEPHVVPVHDYGEIDGQMFLEMRLVEGTD
LDSVLKRFGPLPPPRAVAIITQIASALDAAHAAGVMHRDVKPQNILVTRD
DFAYLVDFGIASATTDEKLTQLGTAVGTWKYMAPERFSDAEVTYRADIYA
LACVLFECLTGSAPYRADSAGVLVSAHVMDPIPAPSARRPGVPKAFDAVI
ARGMAKKPEDRYASAGDLALAAKEALSTPDQDRAATILRRSQEAALPPRG
SATPGPARCWRHRLPSTPGSPVPLRHKLAGAGRRRAARSQPPGSPGRRTT
RAATPIGPLRQHNSPGRRRGAGRRPNGGCGRSSPRSSPCSSSSRAGWASG
W
41408601NP_961437.1 EmbR_2 [Mycobacterium avium subsp. paratuberculosis K-10]MAKRLEFGLLGPLEMTVDGDLVPLGTPKQRAVLAMLLMNRNNPVGIDRLI
TGLWDESPPSGARASLHSYVSNLRKLLSNAGVDPRTVLVAAPPGYRLNIP
DDRCDLGRFITEKTAGVQAAASGRFEQAGAHLAAALAQWRGPVLEDLTEF
RFVGTFATSLVEEKILTHIAQAEAEIACGRAFSVITELESLTREHPYREQ
LWAQLMTAYYLTDRQSDALAAYRRVQKSLADDLGIDPGQNLRMLNDRILR
QEPLDAKKNAMTTAAVTVTVLEHYTLASGRNAGALLHDAAGRAFPLRGST
TIGRLDDNDIVLDSPKVSRHHAVIVDTGTSYIINDLRSSNGVHVQDQRIH
SAAVLQDGDRIRICEHEFTFRLAEENQHAG
41408600NP_961436.1 hypothetical protein MAP2502 [Mycobacterium avium subsp. paratuberculosMSWGFGDDCWVQGRSDDQRELLDAESVAGHLLKADSMFAFLAAHRSQLFP
EEMFADLFPSQRGRPSVPAEVMASVITLQALHGFSDNETVDAVTFDLRWK
AACGLPITAGAFHSTTLTYWRRRLAASDRPNRIFEAVKTVVAETGVLAGK
TRRALDSTVLDDAVATQDTVTQLIAAIRRVRREVPGAAAVIEAHCSAHDY
DDPGKPAIAWEDKAARDRLVDGLVGDAHRVLGYLPDQELAPRAAEAVALL
ALIAGQDVEPVEGSDGTDGHWRIAQQVSGDRVISTVDADTRHAHKTVHRR
QDGFKAHLAVEPDTGIITDCALTKASGADNHEAVVGLSLLEGEHTPGAGP
GRFGVWHRGRPGGTGRRRPCRGDQTATATPAGSGWLHQRRFPHRFRRPHR
DLPGWTRNADPSQWRSHLRKILSLMPVGVPVHDRHARTQTHPSYPRAIIA
RCSRRGPRPRLASRIPPTPAHGGTLNGLAHSRQPQGPLPRNRQKQPLAAP
PRRSTEPTSAAHHGPDPHRHHLGHRLTRPHTKALPQPPTAATLNNGGAIS
FLSTHRV
41408599NP_961435.1 hypothetical protein MAP2501 [Mycobacterium avium subsp. paratuberculosMATMFSRRIITVLTTAAAIGLAAVGLAGPAAARTVQTGDEMFLAQMRSLG
VSFPSPQEAVREGHQVCAELSAGKTPTAVTVAVFRQTNLTPPQAAGLVTA
ATQAYCPQFSGQPG
41408598NP_961434.1 hypothetical protein MAP2500 [Mycobacterium avium subsp. paratuberculosMTTTTRPAPPAPAGRSRDFWGPAARLVKQLAPQRRTAIAVITLGIAGTVI
GVIVPRILGHATDLLFNGVVGRQLPAGISKAQAVAAARSRGQNTFADLLS
GMNVVPGRGVDFGAVARTLALALLLYLVSALFIWMQARLLNRTVQRTMVA
LRSAVEDKLHRLPLAYFDGRQRGELLSRVTNDIDNIQSSLSMTISQLLTS
VLTVLTVLAMMLSISPLLAGITLLTVPLSLLATRVIVRRSQRLFVAQWTS
VGRLNAHIEETYSGFTVVQTFGHRAAARDRFRALNDEVYRASFGAQFFSG
LVAPATAVIGNLGYVAVAVLGGLQVATGQITLGNIQAFIQYVRQFNSPLS
QLAGMYNTLQSGVASAERVFALLDEPEEPPEEKPAAPGPAGRDAGGSGRV
EFAHVSFAYRPGIRVIDDLSLVAEPGSTVAIVGPTGAGKTTLVNLLMRFY
DVDAGRISIDGVDIATMDRRALRSRIGMVLQDTWLFDGTIAENIGYGRPG
AGDDEIVAAARAAYVDRFVQTLPDGYHTRVSGDGGNLSAGERQLITIARA
FLARPQLLILDEATSSVDTRTEALIAHATRELRRDRTSFIIAHRLSTIRD
ADRIAVIEAGRIVEQGTHAELLARHSVYYAMTQA
41408597NP_961433.1 hypothetical protein MAP2499 [Mycobacterium avium subsp. paratuberculosMLLALLRQYIQPYRRLVAVLMALQVISNLASLYLPTVNAAIIDEGVAKGD
TSTIVRLGVVMLGVTAVQALCAVGAVYFGSRTGMGFGRDLRAAMFEHVIT
FSERETARFGAPTLLTRSTNDVRQIQYLVQITATVLVTAPIMCLGGIVMA
IHQEAALTWLLLISVPVMAVTNYWVMSHMLPLFRRMQALIDGVNRVMRDQ
LSGVRVVRAFAREDFERDRFGRANAALSNTALAAGNWQALMLPVTTLTIN
VSSVALIWFGGLRIDHGQMQVGSLTAFLAYFTQILMAVLMATMTLVVLPR
ASVCAERITEVLSTGAAVADPASPKSPPGAITGIVRLDRATFTYPGADRP
VLQDISLTARPGTTTAIVGSTGSGKSTLISLICRLYDVTGGAVQIDGIDV
RDYRTERLWSAIGLVPQRGYLFSGTIADNLRYGRADATEQQMWEALRVAA
ADDFVGAHPDGLHMRVAQGGINFSGGQRQRLAIARAVIRRPAIYLFDDSF
AALDARTDSRVRAALREITCDATVIVVTQRVSIAATADQVVVIDDGKVAG
AGTHDALLTDCAVYAEFADSQSVGAVPSGHTGGTP
41408596NP_961432.1 LprB [Mycobacterium avium subsp. paratuberculosis K-10]MRRNTRALALVASALTILIPATAACSDSGGSKPGATTSSAPQNGQGNHGP
MFPQCGGISDQTVAELTKVSGLINTARNSVGCQWLAGGGILGPHFSFSWY
RGSPIGRERKTEELSRASVDDININGHSGFIAVGNEPNLGDSLCEVGIQF
SDDFIEWSISFSQKPFPPPCDIAKELARQSIANSK
41408595NP_961431.1 LprC [Mycobacterium avium subsp. paratuberculosis K-10]MMAMMRPGPRRSTARAAATVLFLALLVLTGCSRSIAGNAVKAGGNVPRNN
NSQQQYPNLLKECEVLTSDILAKTVGADPLDIQSTFVGAICRWQAANPAG
LIDITRFWFEQGSLSNERKVAEFLKYKIETRNIAGIDSIVMRPDDPNGAC
GVASDAAGVVGWWVNPQAPGIDACGQAIKLMELTLATNS
41408594NP_961430.1 hypothetical protein MAP2496 [Mycobacterium avium subsp. paratuberculosMRHAKSDYPDGVADHDRPLAPRGIRQAGLAGDWLRAGAPAIDAVLCSTAT
RTRETLRNTRIEAPVRYSERLYASTPGIVIDEINTVGDDVSTLLVIGHEP
TMSALALGLGGGSGANPAAAERISNKFPTSAIAVLAVPCRWTELELGAAT
LTDFVVAR
41408593NP_961429.1 hypothetical protein MAP2495 [Mycobacterium avium subsp. paratuberculosMSSGGIIDRDAISAAFDALDAALDGVAALGFDGLTPRECLALLGRCEKAR
RRLPVAEHQLINALARDATPAELGGRLSHAIAEATLISRAEAARRVHTAA
DLGPRVGLTGEPLPPLLAATAARQREGSLGLEQVAVIRKFCHQLPGWIDQ
ATRERAEADLAREATRYRPEQLAALAGTLADCLNPDGLYRDEDRARRRSL
TLGNQQADGMSELRGWLSPELRATLEAVLAKLAAPGMCNPLDESPCVEGT
PSQHAIDGDARSAAQRNHDGLLAGLRALLASGNLGQHNGLPASIIVTTTL
ADLETAAGRRLTGGGTLLPMSDVIRLSRHAHHYLAIFDQGKALALYHTKR
LASPAQRIVLYAKDRGCTAPGCTIPGYYSEVHHCTDYATCHTTDINDLTF
ACGPHHRLLQPGAWTTHKNAKGETEWIPPPHLDRNQPRTNTFHHPEKLLQ
GEDDDGEVDGEQEADQGDDHAA
41408592NP_961428.1 hypothetical protein MAP2494c [Mycobacterium avium subsp. paratuberculoMRFLHTADWQLGMTRHFLAGDAQPRYSAARRDAVAGLGALAAEVGAEFVV
VSGDVFEHNQLPPKVVGQSLEAMRAIGIPVYLLPGNHDPLDASSVYTGAL
FTAERPHNVTVLDRAGVHQVRPGLQLVAAPWRSKVPTTDLVGEVLDGLPE
TDDTRILVGHGGVDVLDPDRDKPSLIRLAKLEDALTRGAVHYVALGDKHS
LTQVGSSGRVWYSGSPEVTNFDDVEADSGHVLIVDIDETDPRRPVSVTAR
RVGCWRFVTLHRQVDSSRDIADLDMNLDLMTNKDRTVVRLALTGSLTVTD
RAALDACLDRYARLFAHLRTWDSHTELAVIPADGEFSDLGIGGFAAAAVE
ELVATARQQDSDTAADAQGALALLLRLADRGAA
41408591NP_961427.1 hypothetical protein MAP2493c [Mycobacterium avium subsp. paratuberculoMKLHRLTLTNYRGIAHREIEFPDHGVVVVCGANEIGKSSMIEALDLLLEA
KDRSTKKEVKQVKPTHSDVGSEVSAEISCGPYRFVYRKRFHKKCETELTV
ITPYREQLTGDEAHERVRAMLAETVDSDLWHAQRVLQAASTAAVDLSGCD
ALSRALDVAAGDSGGLCGTEPLLIERIDAEYGRYFTPTGRPTGEWAAAIA
RLADAEVAVAECAAAVAEVDERVSRHAALTEQVADLSQRRIAAGPRVTAA
RQAADRIAELTAQRREAQLVAEAAAATKAAAAQAHSGRLQLLADIDTRAA
VVTQTHAQVQQAAADHAAAQADAQACDTALQHATEALAELERRVQEAQRT
VERLAGREEADRLAARLDKIDAIQRDRERISAELSTIAVTEELLRRIEDA
AAAVDRIGDQLASTSAAVEFTAVADIHLVIGDQQVSLPAGQSWSITAAGP
TAVEVPGVLTARVIAGATTLDVQAKHAAAQQELAAALTAGAVADLAAARS
ADQRRRELQGTRDQLGATLAGLCGDEPLDELRSRLARLRAEHPEQPAEPT
GGAADLAAARTELEALAQARACASAECDTRRQAATAAAARLAETATAATV
LQNRLDTLRAELDAATGRLAAERASVGDEELAASADAALRAEQAAERRVA
ELADALAAASPDAVAAELADATQESESLRERYEEAAGALREVTIELSVFG
SEGRQGKLDAAETEREHAASEHSQVGRRARAAQLLRSVMTRHRDTTRQRY
VEPYRAELQRLGRPVFGPTFEVDIDSDLCIRSRTLNGITVPYESLSGGAK
EQLGILARLAGAALVAKEDAVPVVVDDALGFTDPDRLAKMGQLFDSVGSH
GQVIVLTCSPDRYDGVKGAHRIDLSA
41408590NP_961426.1 hypothetical protein MAP2492c [Mycobacterium avium subsp. paratuberculoMSRHDDAGADLPPEAMTVNQVVDDVAAVLDDARVDSAVVYGASYGTYIAS
GVGVRHPARVHGMVLDSPLLSRHDIVIVRRAIRRLLLRGDSPETASLAPK
MRKLVDAGVMTATATQVVATIYGYGGARLLERQLDLLLDGRKLLWWTLSR
FTTLGNLPFRYEEDLVSRIALRELDYAAEPDGLPLDPAVAEREVRTQTAA
FEDEPYDLPAEMPNFDWPTAVVSGGRDLITPPAVAERVASLLPHAVLLSL
PDMAHSALDFHEAVALASADAVLRGDLAGLAARACTLNALPPRPEVRLLW
ALIAAAAIIEGALPIPAPLRRRLSCG
41408589NP_961425.1 hypothetical protein MAP2491 [Mycobacterium avium subsp. paratuberculosMLAVAGCSPAINLVPETGQNARIGTTSDINPRDPATLQDGGNLRLALTDF
PPNFNILHIDGNSADVSAMMKATLPRAFVIGPDGSTTVDTDYFTSVELTG
TAPQVVTYTINPKAVWSDGTPITWEDIASQIHALSGADKTFEIAGSSGAE
RVASVTRGVDDRQAVVTFAKPYAEWRGMFAGNGMLLPKSMTATPEAFNKG
QLEGPGPSAGPFIVSSLDRTTQRIVLSRNPKWWGTRPRLDSITYLVLDDA
ARLPALQNNTIDATGVGTLDQLTIAEHTAGISIRRAPAPAWSHFTFNGAP
GSILADRALRVAVSKGIDRQTIAKVVQYGLTSNPVALGNHIYVAGQQGYQ
DNSTTVPYDPAAAGRELDALGWKLHGRFREKDGRQLVIRDLFYDAQGSRQ
FAEIAQHSLAQIGVRLELVARAGSGFFTNYINVGAFDMAQFGWLGDAFPL
SALTQIYKSDGESNFGNIGSPQIDAAIERTLQELDPDKARALANDLDKLI
WAEGFSLPLTQSPGDVAVRSTLANFGAAGLGDLNYTAIGFTRS
41408588NP_961424.1 OppD [Mycobacterium avium subsp. paratuberculosis K-10]MSPLLQVTDLAVTFPAGDAPVTAVRGVSYRIEPGEVVAMVGESGSGKSVS
AMAVMGLLPEHARVRGSVRLHDTELLGLGDDAMSRLRGRAVGMVFQDPMS
ALTPVYTVGDQIAEAITIHQPRVGRKAARDRAVELLELVGIAQPQRRARA
FPHELSGGERQRVVIAIAIANDPDLLICDEPTTALDVTVQAQILEVLKTA
RDITGAGVLIITHDLGVVAEFADRALVMYAGRVVESAAVASLYRDRRMPY
TVGLLGSVPRLDAAQGTRLVPIPGAPPSLAGLDPGCPFAPRCPLAIDECR
SQEPELLPVGPDHRAACIRTDQVDGRSAADIYGVRTQPHPGEPADSPVVV
RVRELSKTYRLTKGVLRRSAGEVRAVDRISFQLRQGRTLGIVGESGSGKS
TTLHEILELVAPQSGSIEVLGTDVAALSPAGRRSLRRDIQVVFQDPVASL
DPRLPVFELLAEPLRANGFDKDRTNARVAELLETVGLPRADAARYPAEFS
GGQKQRIGIARALALQPKILALDEPVSALDVSIQAGIINLLLDLQAQFQL
SYLFVSHDLSVVKHLAHDVAVMYAGSIVEQGDSSQVFGNPQHEYTRRLLD
AVPQPNPGSRG
41408587NP_961423.1 hypothetical protein MAP2489 [Mycobacterium avium subsp. paratuberculosMAGFASRRTLVLRRFGRNRLAVASLTLLVLLFVGCYTLPAVLPYSYQDLD
FDALLQPPNARHWLGTNALGQDLLAQILRGMQKSMLIGVCVAVISTGIAA
TVGSIAGYFGGWRDRVLMWLVDLLLVVPSFILIAIVTPRTKNSANILMLV
LLLAGFGWMVSSRMVRGMTMSLREREFIRAARYMGVSSRRIIVGHVVPNV
ASILIIDAALNVASAILAETGLSFLGFGVQPPDVSLGTLIANGTQSATTF
PWVFLFPAGVLVLILVCANLTGDGLRDALDPGSGPARGGRR
41408586NP_961422.1 hypothetical protein MAP2488 [Mycobacterium avium subsp. paratuberculosMTRFLARRLLNYLVLLALASFLTFCLTSVAFKPLDSLLQRSPRPPQAVID
AKAHSLGLDEPIPIRYAHWASHAVRGDFGKTVTGQPVGASLGRRVGVTLR
LLVIGSLIGTVAGIAAGAWGAIRQYRLSDRVVTMLALLVLSTPTFVIASL
LILAALRVNWALGVQVFDYTGETSPGVTGGAAALVDRLRHLVLPSLTLAL
AAAAGYSRYQRNAMLDVLGQDFIRTARAKGLTRRRALVKHGLRTALIPLA
TLFAYGVAGLVTGAVFVEKIFGWHGMGEWLVQGVATQDTNIVAAITLFSG
AVVLLAGLLSDVFYAALDPRVRVS
41408585NP_961421.1 hypothetical protein MAP2487c [Mycobacterium avium subsp. paratuberculoMAVTDDYLAHNAGYASSFEGPLPMPPSKHVAVVACMDARLDVYRILGLRE
GEAHVIRNAGGVITDDVVRSLAISQRLLGTREIILIHHTDCGMLTFTDDD
FKRGIQEETGIKPPWAAEAFADLAEDVRQSLRRIEANPFVTKHVSARGFV
FDVATGKLDEVKP
41408584NP_961420.1 hypothetical protein MAP2486 [Mycobacterium avium subsp. paratuberculosMTSSTSSASESAAAPSGRDVIAQFLPQSPFVVKLGIVAERLDEDEVRLRL
PWDPSNVTIGDMVHGGAIATLADLTVMAAAWCGAQAPPQLRGVTVSMALD
FMAPARASDVIGVGRVLRRGRSLVNCEAEIVDPQGTLVAKALATYKVG
41408583NP_961419.1 sulfate adenylyltransferase subunit 2 [Mycobacterium avium subsp. paratMPKEAMTADLQTAPAAGQYELSHLRSLEAEAIHIIREVAAEFERPVLLFS
GGKDSIVMLHLALRAFRPGRLPFPVMHVDTGHNFDEVIATRDELVKQHGL
RLVVASVQDDIDAGRVVEPKQGRNPIQTVTLLRAIRENKFDAAFGGARRD
EEKARAKERVFSFRDEFGQWDPKAQRPELWNLYNGRHHKGEHIRVFPLSN
WTEFDIWSYIGAENIALPSIYYAHRRKVFRRDGMLLAVDRNMQPNPDEPV
FEATVRFRTVGDVTCTGCVESQAATVDEVIAETAVSRLTERGATRADDRI
SEAGMEDRKRQGYF
41408582NP_961418.1 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinaMAAPTTLLRLATAGSVDDGKSTLIGRLLYDSKAVMEDQWAAVEQTSKDRG
HDYTDLALVTDGLRAEREQGITIDVAYRYFATPKRKFIIADTPGHIQYTR
NMVTGASTAQLVIVLVDARHGLLEQSRRHAFLASLLGIQHIVLAVNKMDL
IGWDREKFESIRDEFHAFAARLDVHDVATIPISALHGDNVVTKSDQTPWY
EGPALLSHLEEVYIAGDRNLVDVRFPVQYVIRPHTHEHQDHRSYAGTVAS
GVMRPGDEVVVLPVGKRTRITAIEGPNGPVQEAFPPMAVSLTLADEIDIS
RGDLIARTHNQPRIAQDFDATLCWMADNTTLEPGRDYVIKHTTRTTHARV
TGLDYRLDVNTLHRDKTATALKLNELGRISLRTQVPLLLDEYTRNPSTGS
FILIDPHTNGTVAAGMVLRDASAQAASPNTVRHKSSAIAAARPRGKTVWF
TGLSGSGKSSVAMLVEQKLLEKGAQAYVLDGDNLRHGLNADLGFSMADRA
ENLRRLAHVAALLADCGNVVLVPAISPLAEQRELARKVHADAGFDFIEVF
CDTPIEECEKRDPKGLYAKARAGEITQFTGIDSPYQPPANPDLRLIPDGT
VEEQAQRVIDLLESRG
41408581NP_961417.1 hypothetical protein MAP2483c [Mycobacterium avium subsp. paratuberculoMRMSAKAEYAVRAMIQLATVPDGTLVKTDDLAQAQGIPPQFLVDILTNLR
TDRLVRSHRGREGGYELARPGKDISIADVLRCIDGPLASVRDIGLGDLPY
SGPTAALTDVWRALRASMRSVLEETTLADVATGSLPKHVAQLADDYRKQE
SQRHGTARTGD
41408580NP_961416.1 hypothetical protein MAP2482 [Mycobacterium avium subsp. paratuberculosMTISFNHTIVASRDKRESAEFLAELFDLPGPKPFGHFMVVELDHGASLDY
ADAPDGADIPRQHYAFLVSEQEFDTIYGKIRARGLEHWADPGARRPGEIN
HNDGGRGVYFLDPSGHAMEILTRPYGSGAAN
41408579NP_961415.1 hypothetical protein MAP2481c [Mycobacterium avium subsp. paratuberculoMRDGGVGQTHSPHGSTEGPNVKHARIPVVRVAMTMPVMEPDLDATVLETW
ARTIDEGPFSSLCWGERIAFDNPDSLTLLGALAAWTERVRLLTTLIVPQL
HDPVLLAKGLATGDLLSGGRLSVGIGVGGRQEDYHAVGADPATQTMRGMA
ERVAVMKRVWAGEKLTESVLPVGPAPVQPGGPPLFVGSIGPKTIRSAAAW
ADGLAGTTLDLDVAKQRELFDVTRDAWARAGKPAPHLITSFWFAFGSPRT
AREQIHRHLRRYMNWIPADYGDAMAPTTGWAGDEDELAEVLRKFAEIGAD
EVQLIPTSSDVGQLRRAADVAARL
41408578NP_961414.1 hypothetical protein MAP2480c [Mycobacterium avium subsp. paratuberculoMLGPDHLSTLTARHLLASRQQAALSSLAEWSQLFADEQRVWGADHENTLV
AREKIAEKRWEIGDFVGAMAEGEQVLAARRRVLGADHTDTLGTQLMLSIW
RGRAGDVPAAVAELEPLIGELREKLGDDHAHVLMARHMFTLWAPERAGVT
DAVAAWEALVEEESRVLGDEHPVTLAARQELAGWCARRDGQAGGAGAQGS
LDWSAS
41408577NP_961413.1 hypothetical protein MAP2479 [Mycobacterium avium subsp. paratuberculosMRDDSPRMSPRRHIIVSGDDVLATTIAEELNRAGATIVKLPSEELAGADL
ARASAIVCAGRDDAKNLEIALLARKTNPHVRVVARLGNDVLRGAVAADNG
PGAILDVADLAAPSVVEACLSSSTHPVRAAGIDFLVSGAEAPRDATLREI
YGDLAPVAVIHGNDGATPGEVVPCPGRDHRVRAGDWTAMIGSADELAARG
IRTPRPPATRSRQTWLRRVLDAARAMRDDVNPMLFPAILLALTLLLVSTV
IVHFSYTKPRLSWLDALYFTAETITTVGYGEFTFAHQSAWLRIFAVGLMF
AGVTTTALLVAFLADLLLSRRFLQSAGLRRARHLRNHIIVVGLGSFGSRV
VADLTAAGYDVAVIERDENNRFLSTAAELDVPVIFGDATLRQTLESARVD
RARAVAVLTQDDMVNIEIGIVLREMLGPRVMPEVNRPDVPIVLRIYDRTL
GDAVAKRFGFENVRSTVDLAAPWFIGAAMGLQVLGTFSVGQRSFMVGAMH
VAAGSELDGLRMFEMSTQTRVIAITRRDTPVELHPRRDAWLRAGDTVYLV
GPYRELLETLRKGQPPQQPTNEERPADKATT
41408576NP_961412.1 hypothetical protein MAP2478 [Mycobacterium avium subsp. paratuberculosMPSAEAITDTVNRYLALVATGTADDIVTLYAADATIEDPIGADIRRGHDA
IRAFYAGFQDAKKDTELAELRVSGSEAAFLWYLTLDAGDTRTRISPISTM
SFDEDAKITAMRAFWSPTDVQVL
41408575NP_961411.1 hypothetical protein MAP2477c [Mycobacterium avium subsp. paratuberculoMGTLLLAVSGVVFVAILGGVTFIERLASREIYRNPWMVLREDDIRRPDGS
AGIYSVVDKPSYALVMPYDGRRFGLVEQFRYPIGERRWEFPQGTAPELAD
ADPVELARRELREETGLRATTFEPLGRLDVAPGMSSQRGWVFLATGIVEG
EADREHEEQDMRSAWFSRDDVEQMIRTGVIADAQSIAAYGLFLLRPESTG
APVTDQGQ
41408574NP_961410.1 hypothetical protein MAP2476 [Mycobacterium avium subsp. paratuberculosMNGRAVARQRDCHHRTLALLTAPLDGHECVCAVCAVPRATRRHSPHTEPV
APHRKKEPRIMSVCGLRMLCIPAVVAAALTVGSGIAVADDDGYLAQLKKI
GVAWQPGGDTTLIQLGHAICSDRAAGKTPDELAADVHSGLNSSFNYADAT
AIVSAAESNYCP
41408573NP_961409.1 hypothetical protein MAP2475 [Mycobacterium avium subsp. paratuberculosMGVRVVTKGAGRWLAVAASLVISAAMIHAQGTKPRCCPAPPAAAPTPNAT
ASSAAANPPPAGAPRTASPAEVESLTALAPPAPSAGQQFQLALPHSVGSE
DRLQVKTIWAARAISVLFPQITTIYGYREDPLPWHPNGLAIDVMIPNYHT
PEGIELGNQIAGYALANAKRWGINHVIWRQKIYPGVGGGNWMADLGSETA
DHYDHVHIATDGGGYPSGHETYYIASMTPTPPD
41408572NP_961408.1 hypothetical protein MAP2474c [Mycobacterium avium subsp. paratuberculoMMRRFASTTAGVALLRPTAHNLDRLVAKATGGRSSFAGLATGIPVIMLTT
TGAKSGEPRTVPVYGIPHPEGLALIASNFGGAKHPAWYFNLKAHPEATVT
VGRDSWPATARLATPDERDQIWAKGVELYPGWRKYEVRAGDRHIEAFILS
RAPA
41408571NP_961407.1 hypothetical protein MAP2473 [Mycobacterium avium subsp. paratuberculosMINLKRAVLLLPVYIAAMIAVDVVFKSAHIAPSKPLPVWIVAGFIASAIV
VVAVGIWYITQRRSSKVTRKREHAYIAIMAGVAVSGFVGDTVSGLAGLFM
GGKSLWVMVPSYALAYVVLLWTIAFTAKALDGGAGNVNKRSGSAH
41408570NP_961406.1 hypothetical protein MAP2472 [Mycobacterium avium subsp. paratuberculosMPATLSQILAWSTEHLIEAAGYWTQTADRWEDGFLTMRNQAQSIAWRGAG
GDALRERTQADLSVVSAKADLLRQAAGIARNGASDISAAQRRVLFGVEDA
QNAGFTVGEDLSVTDTRSTSPAERPARQAEAEAFAADIRLRAEQLDGADT
KVAAQLTAATAGLGGSGFAPASSPNSNHGAAAADRTTPGSNRNGVRLVDF
KQDGGPQPQPQPQPGAPQPPQQPSFLDQYKQALTSPGQPAQPAATPMPAF
GPRPDPGPQPAPGPMPTVPPQPSFGQCVGGQVKANVGKDMVKGGFETGIK
GAIVGAAGGGIATPEFAGAGALPGAVLGFVGGFAKGVEEAPVKAALEGTA
ECADVPIPGWMK
41408569NP_961405.1 hypothetical protein MAP2471 [Mycobacterium avium subsp. paratuberculosMGQDSLQVVPAELVATAAQWQALSSQFIGAPPSPGPSFEATTAAVNALNA
AIGATAASFVARTQETVGGVTTASGGYLSQEATSAAAMNDVTNVRVV
41408568NP_961404.1 arginyl-tRNA synthetase [Mycobacterium avium subsp. paratuberculosis K-MTPADLAELLRNTAAAVLAERGLDAAALPATVVVERPRNPEHGDYASNLA
LQLGKKVGANPRELAGWLAAALAETDGIASAEVAGPGFINLRLEASAQAV
VVTNVLDAGDRYGHSDAQSTHNINLEFVSANPTGPIHIGGTRWAAVGDAL
GRLLSTQGAGVVREYYFNDHGAQIDRFASSLIAAAKGEPTPEDGYAGSYI
NDIAAQVLRQAPDALSLPEPQLRETFRAIGVDLMFTHIKESLHEFGTDFD
VYTHEDSMHTSGRVDQAIARLRETGNIYEKDGATWLRTSAFGDDKDRVVI
KSDGKPAYIAGDIAYYLDKRQRGFDLCIYMLGADHHGYIARLKAVAAAFG
DDPATVEVLIGQMVNLVRDGQPVRMSKRAGTVITLDDLVEAIGVDAARYS
LIRSSVDTPIDIDLALWSSASNENPVYYVQYAHARLSALARNAAELGLIP
DTAHLELLSHDKEGTLLRTLGEFPRVLKTAASLREPHRVCRYLEDLAGDY
HRFYDSCRVLPQGDEQPTDLHTARLALCQATRQVIANGLAILGVTAPERM
41408567NP_961403.1 LysA_2 [Mycobacterium avium subsp. paratuberculosis K-10]MNVHPAGPRHAEETRHPESPPRPQSPEELLLLAPNVWPRNATRNEAGVAT
IAGVAVTELAREYGTPLFVVDEDDFRSRCREIASAFGGGNNVHYAAKAFL
CSEVARWIDEEGLSLDVCTGGELAVALHADFPPERITFHGNNKSVAELTA
AVKAGVGHVVLDSMTEIERLDAIAADAGIVQDVFVRLTVGVEAHTHEFIS
TAHEDQKFGLSVASGAALAAVGRVFDTEHLRLVGLHSHIGSQIFDVAGFE
LAARRVIGLLHDAVEQFGVEKTAQIATVDLGGGLGISYLAADDPPPMGEL
AGKLSAIVQHESAAVGLPTPRLVVEPGRAIAGPGTITLYEVGTVKDVDVS
ATAHRRYVSVDGGMSDNIRTALYDAQYDARLVSRVSDAPAELARVVGKHC
ESGDIVVRDTWVPGDLRPGDLIGVAATGAYCYSLSSRYNMVCRPAVVAVR
DGRARLVLRRETVDDLLSLEVR
41408566NP_961402.1 homoserine dehydrogenase [Mycobacterium avium subsp. paratuberculosis KMPRDEKPVGVAVLGLGNVGSEVVRIIEDSAGDLAARIGAPLVLRGVGVRR
VADDRGVPVELLTDDIEGLAARDDVDIVVELMGPVEPSRKAILCALEHGK
SVVTANKALLSTSTGELAQAAESAHVDLHFEAAVAGAIPVIRPLTQSLAG
DTVLRVAGIVNGTTNYILSAMDSTGADYDTALAEASDLGYAEADPTADVE
GYDAAAKAAILASIAFHTRVTADDVYREGITKITPADFASARALGCTIKL
LSICERITGDDGQERVSARVYPALVPLSHPLATVNGAFNAVVVEARASGR
LMFYGQGAGGAPTASAVAGDLVMAARNRVLGSRGPRESKYAQLPVAPMGF
ISTRYYVSMNVADKPGVLSSVAAEFAKREVSIAEVRQEGVADEGGRRVGA
RIVVVTHTATDAALSETVHALADLDVVQSVTSVLRLEGTSL
41408565NP_961401.1 threonine synthase [Mycobacterium avium subsp. paratuberculosis K-10]MSAQRTAVHQPWPGLIEAYRDRLPVGDDWTPVTLLEGGTPLIPARRLSEK
TGCTVHLKVEGLNPTGSFKDRGMTMAVTDALARGQQAVLCASTGNTSASA
AAYAARAGITCAVLIPQGKIAMGKLAQAVMHGAKIIQIDGNFDDCLELAR
KMAADFPTISLVNSVNPVRIEGQKTAAFEIVDVLGAAPDVHALPVGNAGN
ITAYWKGYTEYHHEGLIEKLPRMLGTQAAGAAPLVHGEPVKNPETIATAI
RIGAPASWTAAVDAQQQSHGRFLAATDDEILAAYHLVAESEGVFVEPASA
ASIAGLLKAVEDGWVARGSTVVCTVTGNGLKDPDTALRDMPAVTPLPVDP
VLVVEKLGLA
41408564NP_961400.1 homoserine kinase [Mycobacterium avium subsp. paratuberculosis K-10]MVTSMLPAGLVASAVVSASSANLGPGFDSIGLALSLIDEITVETTDSGLV
VQVEGEGADQVPLGPEHLVVRAVECGLRAVGVRAAGLVVRCRNAIPHSRG
LGSSAAAVVGGLAAANGLVAQANCQPLSDAALIQLSSEFEGHPDNAAAAV
FGGAIVSWIDRGGQHPRYAAAPLRLHPDIHLYCAIPQERSLTAETRVLLP
AQVSHEDARFNVSRAALLVVALTERPDLLMAATEDVLHQPQRAPAMPASA
EYLRLLRRHNVAATLSGAGPSLIALTTASALPPEVMEYGAANGFTLAEMT
AGEGVRWSPGVTVVG
41408563NP_961399.1 hypothetical protein MAP2465c [Mycobacterium avium subsp. paratuberculoMEPGSHRRRLIHSVAGGFACFRQGWGLSSEPSSNRSICICIHTALPLGQH
QFFLWTRFAVYSADPGDHRCKVDDWAHSAIWLNATNPLYELISGGRKEIR
D
41408562NP_961398.1 transcription termination factor Rho [Mycobacterium avium subsp. paratuMTDTDLFTAGENTDANQLSTAVTTDTPDAKTHAPVGALTTMVLPELRALA
NQVGVKGTSGMRKNELIAAIKEVRGQANGAAPAEQANGAEPAEDSGKPDA
KDAKDDTTPDTKDANDHTGAQSAAEAPAPSEQNGATAEAPRRERRSASRD
AGAAGRGSDDADRETDGREQSKQDSREQSKQDGGDQDQQSSGGQQGRGSN
QQDDDGEGRQGRRGRRFRDRRRRGERSGEGGDAELREDDVVQPVAGILDV
LDNYAFVRTSGYLAGPHDVYVSMNMVRKNGLRRGDAVTGAVRVPKDGEQP
NQRQKFNPLVRLDSVNGG