Antigen browsing page


The page has been created to visualized all the protein sequence their gene ID and protein ID from NCBI from selected strain. The strain can be selected from the option given in the form and then click submit to display all the proteins and their corresponding information available in our database. The output will be presented in a tabular format where Gene ID is linked to display an antigen card. If you click on gene ID of a proteins, the number of epitopes mapped and/or predicted will be displayed in result page.

Please select a strain:

Selected strain is M_canettii_CIPT_140070017
Gene IDProtein IDProtein DetailsSequence
433637021YP_007270648.1 50S ribosomal protein L34 [Mycobacterium canettii CIPT 140070017]MTKGKRTFQPNNRRRARVHGFRLRMRTRAGRSIVSSRRRKGRRTLSA
433637019YP_007270646.1 Putative hemolysin [Mycobacterium canettii CIPT 140070017]MSLSRQSCGRVVRVTGRASARGLIFVIQVYRHMLSPLRPASCRFVPTCSQ
YAVDALTEYGLLRGSWLTMIRLAKCGPWHRGGWDPIPEGLTTGRSCQTDV
DGANDDWNPASKRGERESFV
433637017YP_007270644.1 Conserved protein of unknown function- similar to Jag protein [MycoMADADTTDFDVDAEAPGGGVREDTATDADEADDQEERLVAEGEIAGDYLE
ELLDLLDFDGDIDLDVEGNRAVVSIDGSDDLNKLVGRGGEVLDALQELTR
LAVHQKTGVRSRLMLDIARWRRRRREELAALADEVARRVAETGDREELVP
MTPFERKIVHDAVAAVPGVHSESEGVEPERRVVVLRD
433637015YP_007270642.1 Putative chromosome partitioning protein ParA [Mycobacterium canettMSAPWGPVAAGPSALVRSGQASTIEPFQREMTPPTPTPEAAHNPTMNVSR
ETSTEFDTPIGAAAERAMRVLHTTHEPLQRPGRRRVLTIANQKGGVGKTT
TAVNIAAALAVQGLKTLVIDLDPQGNASTALGITDRQSGTPSSYEMLIGE
VSLHTALRRSPHSERLFCIPATIDLAGAEIELVSMVARENRLRTALAALD
NFDFDYVFVDCPPSLGLLTINALVAAPEVMIPIQCEYYALEGVSQLMRNI
EMVKAHLNPQLEVTTVILTMYDGRTKLADQVADEVRQYFGSKVLRTVIPR
SVKVSEAPGYSMTIIDYDPGSRGAMSYLDASRELAERDRPPSAKGRP
433637013YP_007270640.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MSARITALRLEAFEQLPKHARRCVFWEVDPAILGKDDHLADPEFEKEAWL
SMVMLEWGSCGQVATAVPDERSHAEPPCLGYVLYAPPSAVPRAQRFPTAP
VSADAVLLTSMGIERGQADDDLPHSLIARVIEELVRRGVRALEAFGRTPA
ATDLQNPGAVTPDVRPVLEALGDCCVEHCIIDANFLMDVGFVVVAPHPYF
PRLRLELDKGLGWKAEVEAALERLLENARLQEPIAAGSTAGNTS
433637011YP_007270638.1 Thioredoxin TrxC (TRX) (MPT46) [Mycobacterium canettii CIPT 1400700MTDSEKSATIKVTDASFATDVLSSNKPVLVDFWATWCGPCKMVAPVLEEI
ATERATDLTVAKLDVDTNPETARNFQVVSIPTLILFKDGQPVKRIVGAKG
KAALLRELSDVVPNLN
433637009YP_007270636.1 Conserved alanine-rich protein of unknown function [Mycobacterium cMSAADNDPGKHGADADPPLTVELLADLQAGLLDDATAARIRSRVRSDPQA
QQILRALNRVRRDVAAMGADPAWGPAAPPAVVDRISAALRSARPNSSPGA
AHAARPHVHPVRMIAGAAGLCAVVTAIGVGAVALIDARPPAPSAPTTAQH
ITVSKPAPVIPLSQPQILDLLHHTPDYGPPGGPLGDPSRRTSCLSGLGYP
ASTPVLGAQPIDIDARPAVLLVIPADTPDKLAVFAVAPHCSAADTGLLAS
TVVPRA
433637007YP_007270634.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MRPSPREVPTASQRQPELSDAALVSHSWAMAFATLISRITGFARIVLLAA
ILGAALASSFSVANQLPNLVAALVLEATFTAIFVPVLARAEQDDPDGGAA
FVRRLVTLATTLLLGATTLSVLAAPLLVRLMLGTNPQVNEPLTTAFAYLL
LPQVLVYGLSSVFMAILNTRNVFGPPAWAPVVNNVVAIATLAVYLAVPGE
LSVDPVRMGNAKLLVLGIGTTAGVFAQTTVLLVAIRREHISLRPLWGIDQ
RLKRFGAMAAAMVLYVLISQLGLVVGNRIASTAAASGPAIYNYTWLVLML
PFGMIGVTVLTVVMPRLSRNAAADDTPAVLADLSLATRLTMITLIPTVAF
MTVGGPAIGSALFAYGNFGDVDAGYLGAAIALSAFTLIPYALVLLQLRVF
YARERPWTPIAIIVVITGVKILGSLLAPHITGDPQLVAAYLGLANGLGFL
AGAIVGCYILRRALRPDGGQLIGVGEARTVLVTVAASLLAGLLAHVADRL
LGLSELTAHAGSVGSLLRLSVLALIMLPILAAVTLCARVPEARAALDAVR
ARIRSRRLKTGPQTQNVLDQSSRPGPVTYPERRRLAPPRGKSVVHEPIRR
RPPEQVARAGRAKGPEVIDRPSENASFGAASGAELPRPVADELQLDAPAG
RDPGPVSRPHPSDLQNGDLPADAARGPIAFDALREPESSAPPDDVQLVPG
ARIANGRYRLLIFHGGVPPLQFWQALDTALDRQVALTFVDPQGVLPDDVL
QETLSRTLRLSRIDKPGVARVLDVVHTRAGGLVVAEWIRGGSLQEVADTS
PSPVGAIRAMQSLAAAADAAHRAGVALSIDHPSRVRVSIDGDVVLAYPAT
MPDANPQDDIRGIGASLYALLVNRWPLPEAGVRSGLAPAERDTAGQPIEP
ADIDPDIPFQISAVAARSVQGDGGIRSASTLLNLMQQATAVADRTEVLGP
IDEAPVSAAPRTSAPDSETYTRRRRNLLIGIGAGAAVLMVALLVLASVLS
RIFGDVSGGLNKDELGLNAPTASTSAASSAPPGSVVKPTKVTVFSPDGGA
DNPGEADLAIDGNPATSWKTDIYTDPVPFPSFKNGVGLMLQLPQATVVGT
VAIDVASTGTKVEIRSASTPTPATLEDTAVLTSATALRPGHNTISVKAAA
PTSNLLVWISTLGTTDGKSQADISEITIYAAS
433637005YP_007270632.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MSDGEQAKSRRRRGRRRGRRAAATAENHMDAQPAGDATPTPATAKRSRSR
SPRRGPNRMRTVHETSAGGLVIDGIDGPRDAQVAALIGRVDRRGRLLWSL
PKGHIELGETAEQTAIREVAEETGIRGSVLAALGRIDYWFVTDGRRVHKT
VHHYLMRFLGGELSDEDLEVAEVAWVPIRELPSRLAYADERRLAEVADEL
IDKLQSDGPAALPPLPPSSPRRRPQTHSRTRHADDSAPGQKNGRGPGP
433637003YP_007270630.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MEYCIAGDDGSAGIWNRPFDVDLDGDGRLDAIGLDLDGDGLRDDALADFD
GDDVADHAVFDVDNDGTPESYFIDDGSGTWAVAVDRGGQLRWYGLDGVEH
TGGPLVDFDGFGGLDDRLLDTDGDGLADRVLCAGEQRVTGYVDTDGDGRW
DVRLTDTDGDGTADGASSL
433637001YP_007270628.1 ESAT-6 like protein EsxE (hypothetical alanine and glycine rich proMDPTVLADAVARMAEFGRHVEELVAEIESLVTRLHVTWTGEGAAAHAEAQ
RHWAAGEAMMRQALAQLTAAGQSAHANYTGAMATNLGMWS
433636999YP_007270626.1 Conserved exported protein of unknown function [Mycobacterium canetMPRTRSWPAITVASIAAVVAVAALIVALTNARPTATPATTSPPTYSAADT
AAAQRQLCDTYKLAAQAVQIDTAGSDKALARIATTNGAVMLVMASANPAL
DSNDREAAHALAKTYITLTAKGSYGVATDAEYRAALDDLMGKDAAMKKIC
GDG
433636997YP_007270624.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MIMTGDQNPAPGPAPGVPIKVTPEILLQVLTTPPASGPAPFPAVPVDLPA
PADIANGALFAAGNSGVPGDVESSGLEDLDRRAHAADAVQKFSANEADAA
QQFQGVGAQAEAQGATQMMQQAVSGITGALGGAVGGVMGPLTQLPQQAMQ
AGQGAMQPLMSALQQTHGAEGLDVADGARLVDSIEGEPGFGGGPGAGDVG
AGGGGGGTTPTGYLGPPPVPTSSPPTTPAGAPAKSVTPAPVSGAPRASGP
AGMTGMPMVPPGALGAGAEGANKDKPVEKRVTAPAVPNGQPVKGRLTVPP
SVPVKSADDKPVVTKSTRRILVVPNDDKVKE
433636995YP_007270622.1 ESX conserved componant EccB2 [Mycobacterium canettii CIPT 14007001MPLSLSNRDQNSGHLFYNRRLRAATTRFSVRMKHDDRKQTAALALSMVLV
AIAGGWMMLLNVLKPTGIVGDSAIIGDRDSGALYARIDGRLYPALNLTSA
RLATGTAGQPTWVKPAEIAKYPTGPLVGIPGAPAAMPVNRGAVSAWAVCD
TAGRPRSGDKPVVTSIAGHLTGGGRATHLRDDAGLLVTFDGSTYVIWGGK
RSQIDPSNRAVTLSLGLDPGVTSPVEVSRALFDGLPATEPLRVPLVPEAG
SPSTWVPGSQVGSVLQAQTAGGGSQFYVLLPDGVQKISSFVADLLRSANS
YGAAAPRVVTPDVLVHTPQVTSLPVEYYPAGRLNFVDTAANPTTCVAWEK
ASTDPQARVAVYNGRGLPVPPSMDSRIVRLVRDDRAPASVVATQVLVLPG
AANFVTSTSGVITAESRESLFWVSGNGVRFGIANDEATLRALGLDPGAAV
QAPWPLLRTFAAGPALSRDAALLARDTVPTLGQVAIVTTTAKAGA
433636993YP_007270620.1 Conserved protein of unknown function- PE family- PE 36 [MycobacterMVWSVQPEAVLASAAAESAISAETEAAAAGAAPALLSTTPMGGDPDSAMF
SAALNACGASYLGVVAEHASQRGLFAGAQGLASGVYVTTEAARAAASALQ
G
433636991YP_007270618.1 ESAT-6 like protein EsxD [Mycobacterium canettii CIPT 140070017]MADTIQVTPQMLRSTANDIQANMEQAMGIAKGYLANQENVMNPATWSGAG
VVASHMTATEITNELNKVLTGGTRLAEGLVQAAALMEGHEADSQTAFQAL
FGASHGS
433636989YP_007270616.1 Putative ESX-2 secretion-associated protein EspG2 [Mycobacterium caMLTTTVDGLWVLQAVTGVEQTCPELGLRPLLPRLDTAERALRHPVAAELM
AVGALDQAGNADPMVREWLTVLLRRDLGLLVTIGVPGGEPTRAAICRFAT
WWVVLERHGNLVRLYPAGTASDEAGAGELVVGQVERLCGVAEAAPLRPVT
VDADELLHSVRDAGTLRSYLLSQRLDVDQLQMVTMAADPTRSAHATLVAL
QAGVGPEKSARILVGDSTVAIVDTAAGRICVESVTSGQRRYQVLSPGSRS
DIGGAVQRLIRRLPAGDEWYSYRRVV
433636987YP_007270614.1 ESX conserved componant EccD2 [Mycobacterium canettii CIPT 14007001MTAPHKVAFPARCAVNICYDKHLCSQVFPAGIPVEGFFEGMVELFDADLK
RKGFDGVALPAGSYELHKINGVRLDINKSLDELGVQDGDTLVLVPRVAGE
SFEPQYESLSTGLAAMGKWLGRDGGDRMFAPVTSLTAAHTAMAIIAMAVG
VVLALTLRTRTITDSPVPAAMAGGIGVLLAIGALVVWWGWRERRDLFSGF
GWLAVVLLAVAAACAPPGALGAAHALIGLVVVVLGAIAIGVATRKRWQTA
VVTAVVTVCGILAAVAAVRMFRPVSMQVLAICVLVGLLVLIRMTPTVALW
VARVRPPHFGSITGRDLFARRAGMPVDTVAPVSEADADDEDNELTDITAR
GTAIAASARLVNAVQVGMCVGVSLVLPAAVWGVLTPGQPWAWLALLVAGL
TVGLFITQGRGFAAKYQAVALVCGASAAVCAGVLKYALDTPKGVQTGLLW
PAIFVAAFAALGLAVALVVPATRFRPIIRLTVEWLEVLAMIALLPAAAAL
GGLFAWLRH
433636985YP_007270612.1 ESX conserved componant EccE2 [Mycobacterium canettii CIPT 14007001MTSKLTGFIPGSARRVAGVWTVFVLASAGWALGGQLGAVIAVVVGVALVF
VQWWGQPAWSWAVLGLRGRRPVKWNDPITLANNRSGGGVRVQDGVAVVAV
QLLGRAHRATTVTGSVTVESDNVIDVVELAPLLRHPLDLELDSISVVTFG
SRTGTVGDYPRVYDAEIGTPPYAGRRETWLIMRLPVIGNTQALRWRTSVG
AAAISVAQRVASSLRCQGLRAKLATATDLAELDRRLGSDAVAGSAQRWKA
IRGEAGWMTTYAYPAEAISSRVLSQAWTLRADEVIQNVTVYPDATCTATI
TVRTPTPAPTPPSVILRRLNGEQAAAAAANMCGPRPHLRGQRRCPLPAQL
VTEIGPSGVLIGKLSNGDRLMIPVTDAGELSRVFVAADDTIAKRIVIRVV
GAGERVCVHTRDQERWASVRMPQLSIVGTPRPAPRTTVGVVEYVRRRKNG
DDAKSEGSGVDVAIAPTPRPASVITIAQPGTSLSESDRHGFEVTIEQIDR
ATVKVGAAGQNWLVEMEMFRAENRYVSLEPVTMSIGR
433636983YP_007270610.1 Membrane-anchored mycosin MycP1 (serine protease) (subtilisin-like MHRIFLITVALALLTASPASAITPPPIDPGALPPDVTGPDQPTEQRVLCA
SPTTLPGSGFHDPPWSNTYLGVADAHKFATGAGVTVAVIDTGVDASPRVP
AEPGGDFVDQAGNGLSDCDAHGTLTASIIAGRPAPTDGFVGVAPDARLLS
LRQTSEAFEPVGSQANPNDPNATPAAGSIRSLARAVVHAANLGVGVINIS
EAACYKVSRPIDETSLGASIDYAVNVKGVVVVVAAGNTGGDCVQNPAPDP
STPGDPRGWNNVQTVVTPAWYAPLVLSVGGIGQTGMPSSFSMHGPWVDVA
APAENIVALGDTGEPVNALQGREGPVPIAGTSFAAAYVSGLAALLRQRFP
DLTPAQIIHRITATARHPGGGVDDLVGAGVIDAVAALTWDIPPGPASAPY
NVRRLPPPVVEPGPDRRPITAVALVAVGLTLALGLGALARRALSRR
433636981YP_007270608.1 ESX-1 secretion-associated protein B- Alanine and Glycine rich [MycMTQSQTVTVDQQEILNRANEVEAPMADPPTDVPITPCELTAAKNAAQQLV
LSADNMREYLAAGAKERQRLATSLRNAAKAYGEVDEEAATALDNDGEGTV
QAESAGAVGGDSSAELTDTPRVATAGEPNFMDLKEAARKLETGDQGASLA
HFADGWNTFNLTLQGDVKRFRGFDNWEGDAATACEASLDQQRQWILHMAK
LSAAMAKQAQYVAQLHVWARREHPTYEDIVGLERLYAENPSARDQILPVY
AEYQQRSEKVLTEYNNKAALEPVNPPKPPPAIKIDPPPPPQEQGLIPGFL
MPPSDGSGVTPGTGMPATPMVPPTGSPGGGLPADTAAHLTSAGREAAALS
GDVAVKAASLGGGGGGGAPSAPLGSAIGGAESVRPAGAGDIAGAGQGRAG
GGTALGGGGMGMPMGAAHQGQGGAKSKGSQQEDEALYTEDRAWTEAVIGN
RRRQDSKESK
433636979YP_007270606.1 ESX-1 secretion associated protein EspK- Alanine and Proline rich [MSITRPTGSYARQMLDPGGWVEADEDTFYDRAQEYSQVLQRVTDVLDTCR
QQKGHVFEGGLWSGGAANAANGALGANINQLMTLQDYLATVITWHRHIAG
LIEQAKSDIGNNVDGAQREIDILENDPSLDADERHTAINSLVTATHGANV
SLVAETAERVLESKNWKPPKNALEDLLQQKSPPPPDVPTLVVPSPGTPVM
PGTPVTPGIPVTPGIPVTPGTPITPGTPITPGTPITPGTPITPGTPITPG
TPITPIPGAPVTPITPTPGTPVTPVTPGKPVTPVTPVKPGTPGEPTPVTP
VTPPVAPATPATPATPVTPAPAPHPQPAPAPAPSPGPQPVTPATPGSSGP
ATPGTPGGEPAPHVKPAALAEQPGVPGQHAGGGTQSGPAHADESAASVTP
AAASGVPGARAAAAAPSGTAVGAGARSSVGTAAASGAGSHAATGRAPVAT
SDKAAAPSTRAASARTAPPARPPSTDHIDKPDRSESADDGTPVSMIPVSA
ARAARDAATAAASARQRGRGDALRLARRIAAALNASDNNAGDYGFFWITA
VTTDGSIVVANSYGLAYIPDGMELPNKVYLASADHAIPVDEIARCATYPV
LAVQAWAAFHDMTLRAVIGTAEQLASSDPGVAKIVLEPDDIPESGKMTGR
SRLEVVDPSAAAQLADTTDQRLLDLLPPAPVDVNPPGDERHMLWFELMKP
MTSTATGREAAHLRAFRAYAAHSQEIALHQAHTATDAAVQRLAVADWLYW
QYVTGLLDRALAAAS
433636977YP_007270604.1 ESX conserved componant EccD1 [Mycobacterium canettii CIPT 14007001MSAPAVAAGPTATGATAARPATTRVTILTGRRMTDLVLPAAVPMETYIDD
TVAVLSEVLEDTPADVLGGFDFTAQGVWAFARPGSPPLKLDQSLDDAGVV
DGSLLTLVSVSRTERYRPLVEDVIDAIAVLDESPEFDRTALNRFVGAAIP
LLTAPVIGMAMRAWWETGRSLWWPLAIGILGIAVLVGSFVANRFYQSGHL
AECLLVTTYLLIATAAALAVPLPRGVNSLGAPQVAGAATAVLFLTLMTRG
GPRKRHELASFAVITAIAVIAAAAAFGYGYQDWVPAGGIAFGLFIVTNAA
KLTVAVARIALPPIPVPGETVDNEELLDPVATPEATSEETPTWQAIIASV
PASAVRLTERSKLAKQLLIGYVTSGTLILAAGAIAVVVRGHFFVHGLVVA
GLITTVCGFRSRLYAERWCAWALLAATVAIPTGLTAKLIIWFPHYAWLLL
SVYLTVALVALVVVGSMAHVRRVSPVVKRTLELIDGAMIAAIIPMLLWIT
GVYDTVRNIRF
433636975YP_007270602.1 6 kDa early secretory antigenic target EsxA (Esat-6) [MycobacteriumMTEQQWNFAGIEAAASAIQGNVTSIHSLLDEGKQSLTKLAAAWGGSGSEA
YQGVQQKWDATATELNNALQNLARTISEAGQAMASTEGNVTGMFA
433636973YP_007270600.1 Conserved protein of unknown function PPE family- PPE68 [MycobacterMLWHAMPPELNTARLMAGAGPAPMLAAAAGWQTLSAALDAQAVELTARLN
SLGEAWTGGGSDKALAAATPMVVWLQTASTQAKTRAMQATAQAAAYTQAM
ATTPSLPEIAANHITQAVLTATNFFGINTIPIALTEMDYFIRMWNQAALA
MEVYQAETAVNTLFEKLEPMASILDPGASQSTTNPIFGMPSPGSSTPVGQ
LPPAATQTLSQLGEMSGPMQQLTQPLQQVTSLFSQVGGTGGGNPADEEAA
QMGLLGTSPLSNHPLAGGSGPSAGAGLLRAESLPGAGGSLTRTPLMSQLI
EKPVGPSVMPAAAAGSSATGGAAPVGAGAMGQGAQSGGSTRPGLVAPAPL
AQEREEDDEDDWDDEDDW
433636971YP_007270598.1 ESX conserved componant EccCb1 [Mycobacterium canettii CIPT 1400700MTAEPEVRTLREVVLDQLGTAESRAYKMWLPPLTNPVPLNELIARDRRQP
LRFALGIMDEPRRHLQDVWGVDVSGAGGNIGIGGAPQTGKSTLLQTMVMS
AAATHSPRNVQFYCIDLGGGGLIYLENLPHVGGVANRSEPDKVNRVVAEM
QAVMRQRETTFKEHRVGSIGMYRQLRDDPSQPVASDPYGDVFLIIDGWPG
FVGEFPDLEGQVQDLAAQGLAFGVHVIISTPRWTELKSRVRDYLGTKIEF
RLGDVNETQIDRITREIPANRPGRAVSMEKHHLMIGVPRFDGVHSADNLV
EAITAGVTQIASQHTEQAPPVRVLPERIHLHELDPNPPGPESDYRTRWEI
PIGLRETDLTPAHCHMHTNPHLLIFGAAKSGKTTIAHAIARAICARNSPQ
QVRFMLADYRSGLLDAVPDTHLLGAGAINRNSASLDEAVQALAVNLKKRL
PPTDLTTAQLRSRSWWSGFDVVLLVDDWHMIVGAAGGMPPMAPLAPLLPA
AADIGLHIIVTCQMSQAYKATMDKFVGAAFGSGAPTMFLSGEKQEFPSSE
FKVKRRPPGQAFLVSPDGKEVIQAPYIEPPEEVFAAPPSAG
433636969YP_007270596.1 ESX conserved componant EccB1 [Mycobacterium canettii CIPT 14007001MGLRLTTKVQVSGWRFLLRRLEHAIVRRDTRMFDDPLQFYSRSIALGIVV
AVLILAGAALLAYFKPQGKLGGTSLFTDRATNQLYVLLSGQLHPVYNLTS
ARLVLGNPANPATVKSSELSKLPMGQTVGIPGAPYATPVSAGSTSIWTLC
DTVARADSTSPVVQTAVIAMPLEIDASIDPLQSHEAVLVSYQGETWIVTT
KGRHAIDLTDRALTSSMGIPVTARPTPISEGMFNALPDMGPWQLPPIPAA
GAPNSLGLPDDLVIGSVFQIHTDKGPQYYVVLPDGIAQVNATTAAALRAT
QAHGLVAPPAMVPSLVVRIAERVYPSPLPDEPLKIVSRPQDPALCWSWQR
SAGDQSPQSTVLSGRHLPISPSAMSMGIKQIHGTATVYLDGGKFVALQSP
DPRYTESMYYIDPQGVRYGVPNAETAKSLGLSSPQNAPWEIVRLLVDGPV
LSKDAALLEHDTLPADPSPRKVPAGASGAP
433636967YP_007270594.1 ESX-1 secretion-associated protein EspH [Mycobacterium canettii CIPMVDPPGNDDDHGDLDALDFSAAHTNEASPLDALDDYAPVQTDDAEGDLDA
LHALTERDEEPELELFTVTNPQGSVSVSTLMDGRIQHVELTDKATSMSEA
QLADEIFVIADLARQKARASQYTFMVENIGELTDEDAEGSALLREFVGMT
LNLPTPEEAAAAEAEVFATRYDVDYTSRYKADD
433636965YP_007270592.1 ESX-1 secretion-associated protein EspF [Mycobacterium canettii CIPMTGFLGVVPSFLKVLAGMHNEIVGDLKRATDTVAGISGRVQLTHGSFTSK
FNDTLQEFETTRSSTGTGLQGVTSGLANNLLAAAGAYLKADDGLAGVIDK
IFG
433636963YP_007270590.1 Conserved protein of unknown function- alanine rich protein [MycobaMSKAGSTVGPAPLVACSGGALDVIEPRRGVVIIGHSCRVGTQIDDSRISQ
TQLRAVSDDGRWRIVGNIPRGMFVGGRRGSSVTVSDKTLIRFGDPPGGKA
LTFEVVRPSDSAAQHGRVQPSADLSDDQAHNAAPVAPDPGVVRAGAAAAA
RRRELDISQRSLAADGIINAGALIAFEKGRSWPRERTRAKLEEVLQWPAG
TIARIRRGEPTLPATNPDASPGVRPADGPASLIAQAVTAAVDGCSLAIAA
LPATEDPEFTERAAPILADLRQLEAIAVQATRISRITPELIKALGAVRRH
HDELMRLGATAPGATLAQRLYAARRRANLSTLETAQAAGVAEEMIVGAEA
EEELPAEATEAIEALIRQIN
433636961YP_007270588.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MYERDEFLRDRIRPHQPGTPRGYSPRPPSGDRCPAPPPGRHAAAATPPGP
PRLPSAPLRPLPDPAWPRQPEAPPPSTWADPALAPIRSTTRPGERGWRRM
VRLVTFGLVGLGRSGMQRQEAQFEAAIRTVLHGNHKVAVLGKGGVGKTSV
AACVGSILAELRQQDRIVGIDADTAFGRLSSRIDPRAAGSFWELTTDTNL
RSFTDITARLGRNSAGLYVLAGQPASGPRRVLDPAIYREAALRLDHHFAI
SVIDCGSSMEAAVTQEVLRDVDALIVVSSPWADGASAAAKTIEWLSDCGL
TGLLRRSIVVLNDSDGHADKRTKSLLAQEFIDHGQPVVEVPFDPHLRPGG
VIDMSHEMAPTTRLKILQIAATVTAYFASRPADAHGSPPR
433636959YP_007270586.1 Putative NADH-dependent glutamate synthase (small subunit) GltD (l-MADPGGFLKYTHRKLPKRRPVPLRLRDWREVYEEFDNESLRQQATRCMDC
GIPFCHNGCPLGNLIPEWNDLVRRGRWRDAIERLHATNNFPDFTGRLCPA
PCEPACVLGINQDPVTIKQIELEIIDKAFDEGWVQPRPPRKLTGQTVAVV
GSGPAGLAAAQQLTRAGHTVTVFEREDRIGGLLRYGIPEFKMEKRHLDRR
LDQMRSEGTEFRPGVNVGVDISAEQLRADFDAVVLAGGATAWRELPIPGR
ELEGVHQAMEFLPWANRVQEGDDVLDEDGQPPITAKGKKVVIIGGGDTGA
DCLGTVHRQGAIAVHQFEIMPRPPDARAESTPWPTYPLMYRVSAAHEEGG
ERVFSVNTEAFVGTDGRVSALRAHEVTMLDGKFVKVEGSDFELEADLVLL
AMGFVGPERAGLLTDLGVKFTERGNVARGDDFDTSVPGVFVAGDMGRGQS
LIVWAIAEGRAAAAAVDRYLMGSSALPAPVKPTAAPLQ
433636957YP_007270584.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MDPVTALRQIAYYKDRNRHDPRRVMAYRNAADIIEGLDDAARQRHGQANS
WQSLAGIGPKTAKVIAQAWSGREPDLLAELRADAEDLGGGAIRAALRGDL
HLHSNWSDGSAPIEEMMATAVALGHQYCALTDHSPRLTIANGLSPDRLRK
QLDVIDELREKFAPLRILTGIEVDILEDGSLDQEPELLDRLDIVVASVHS
KLSMDSAAMTRRMVRAVANGHTDVLGHCTGRLIAGNRGIRPESKFDAEAV
FTACREHGTAVEINSRPERRDPPTRLLHLARDIGCVFSIDTDAHAPGQLD
FLGYGAQRALDAEVPADRIVNTWPADTLLAWTGSH
433636955YP_007270582.1 Monooxygenase EthA [Mycobacterium canettii CIPT 140070017]MTEHLDVVIVGAGISGVSAAWHLQDRCPTKSYAILEKREAMGGTWDLFRY
PGIRSDSDMYTLGFRFRPWTGRQAIADGKPILEYVKSTAAIYGIDRHIRF
HHKVISADWSTAENRWTVHIQSHGTLSTLTCEFLFLCSGYYNYDEGYSPR
FAGSEDFAGPIIHPQHWPEDLDYDAKNIVVIGSGATAVTLVPALADSGAK
HVTMLQRSPTYIVSQPDRDGIAEKLNRWLPETMAYTAVRWKNVLRQAAVY
SACQKWPRRMRKMFLGLIQRQLPEGYDVRKHFGPHYNPWDQRLCLVPNGD
LFRAIRHGKVEVVTDTIERFTATGIRLNSGRELPADIIITATGLNLQLFG
GATATIDGQQVDITTTMAYKGMMLSGIPNMAYTVGYTNASWTLKADLVSE
FVCRLLNYMDDNGFDTVVVERPGSDVEERPFMEFTPGYVLRSLDELPKQG
SRTPWRLNQNYLRDIRLIRRGKIDDEGLRFAKRPAPVGV
433636953YP_007270580.1 Putative histone-like protein Hns [Mycobacterium canettii CIPT 1400MPDPQDRPDSEPSDASTPPAKKLPAKKAAKKAPARKTPAKKAPAKKTPAK
GAKSAPPKPAEAPVSLQQRIETNGQLAAAAKDAAAQAKSTVEGANDALAR
TASVPAPSHSPVPLIVAVTLSLLALLLIRQLRRR
433636951YP_007270578.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MGLFGKRKSRATRRAEARAIKARAKLEAKLSAKNEARRIKAAQRAESKAL
KAQLKARRDSDRAALKVAEAELKVAREGKLLSPTRIRRLLTVSRLLAPIL
TPVIYRAAMAARGLIDQRRADQLGVPLAQIGRFSGHGARLSARVGGAERS
LRMVQEKKPKDVETKQFVSAVTNRLTDLSAAVAAAEHMPARRRRTAHSAI
SSQLDGIEADLMARLGLT
433636949YP_007270576.1 Conserved membrane protein of unknown function [Mycobacterium canetMLAATLLSLGAVFLAELGDRSQLITMTYTLRYRWWVVLTGVAIATFTVHG
VAVAIGHFLGSTVPARPAACVSAIAFLIFAVWVWREDTASDSETSPTAAE
PRLALFTVVSSFALAELGDKTTLATVTLASDHHWAGVWIGTTLGMILADG
LAIGAGLLLHRRLPERLLQVLTGLLFLLFGLWLLFDDALGFRSVAIAVTA
AVVLAAATTAVSVRVAQTRRRRPTAAATPEDDSTRPERSSVAPGHPGSIL
LPLPEVSLRGRRPPSGSPDERCADPGSKGGSRRISVGCWLPGVGRIRPTR
SS
433636947YP_007270574.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MGTGSGGPIGVSPFHSRGALKGFVISGRWPDSTKEWAQLLMVAVRVASLP
GLLSTTTVFGAREELPDEPEPGTVGLVLAEGTVFGESAIQPGYFADHQPP
ALLMLHPPSETTPSLPECTGAASGCVLLPGLPYLGLEHRAAWVEAEADGT
ITSMVSRVGVDPISHPDTAILAMLLAA
433636945YP_007270572.1 Putative transposase [Mycobacterium canettii CIPT 140070017]MEARRKFDAQFKEGAVRIVRETGKPIAQVARELGISDGTLGSWVRQDERA
RDGGDGGLCESEREELKRLRAENAELAMERDVLKRSVALWVKEAMHR
433636943YP_007270570.1 Putative transposase [Mycobacterium canettii CIPT 140070017]MTAENPERSRRTLVGIDAAITARHHIAIRDDVGARSTRFSVEPTLAGLRT
LTDKLSGYDDIDATVEPTSMTWLPLTIAVENAGDTMHMACARHCARLRGA
IVGKSKSDVIDTEVLTRASEVFDLTPLTLPTPAQLALRRSVIRRAGAVID
ANRSWRRLMSLAR
433636941YP_007270568.1 Conserved membrane protein of unknown function [Mycobacterium canetMIQVCSQCGTRWNVRERQRVWCPRCRGTLLAPLADMPAEARWRTAARPQV
PTASDTRRTPPRLPPGFRWIAVRPGAAPPPRHGPRLRGPTPRYAGIPQWG
LTDHVDQAPVPASPKAGPSPAAVRTTLLVSLLVFSIAVVVFVVRYVLLVI
NRNTLLNSVVASASVWLGVLVSLAAIAAAGTTIVLLIRWLVARRAAAFMH
QGLPERRSARELWAGCLLPMVNLLWAPVYVIELALVEDRYTRLRRPIVVW
WIVWIVSNAISMFAIATSWVTDAQGIANNTAMMVLAYLCAAAAVAAAARV
FEGFEQKPVERPAHRWVVVNTDGRSAPASSVAVELDGQEPAA
433636939YP_007270566.1 Putative bacterioferritin BfrB [Mycobacterium canettii CIPT 1400700MTEYEGPKTKFHALMQEQIHNEFTAAQQYVAIAVYFDSEDLPQLAKHFYS
QAVEERNHAMMLVQHLLDRDLRVDIPGVDTVRNQFDRPREALALALDQER
TVTDQVGRLTAVARDEGDFLGEQFMQWFLQEQIEEVALMATLVRVADRAG
ANLFELENFVAREVDVAPAASGAPHAAGGRL
433636937YP_007270564.1 Putative prephenate dehydratase PheA [Mycobacterium canettii CIPT 1MVRIAYLGPEGTFTEAALVRMVAAGLVPETGPDALQRMPVESAPAALAAV
RDGGADYACVPIENSIDGSVLPTLDSLAMGVRLQVFAETTLDVTFSIVVK
PGRNAADVRTLAAFPVAAAQVRQWLAAHLPAADLRPAYSNADAARQVADG
LVDAAVTSPLAAARWGLAALADGVVDESNARTRFVLVGRPGPPPARTGAD
RTSAVLRIDNKPGALVAALAEFGIRGIDLTRIESRPTRTELGTYLFFVDC
VGHIDDEAVAEALKAVHRRCADVRYLGSWPTGPAAGAQPPLVDEASRWLA
RLRAGKPEQTLVRPDDQGAQT
433636935YP_007270562.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MSTDCRDCRAGLDHCHGTVIRHPLARPECTEPDCASPELQPHIFVLDCNA
ASCECTESATAPGSVRSAHRVSA
433636933YP_007270560.1 Conserved membrane protein of unknown function [Mycobacterium canetMLDAPEQDPVDPGDPASPPHGEAEQPLPGPRWPRALRASATRRALLLTAL
GGLLIAGLVTAIPAVGRAPERLAGYIASNPVPSTGAKINASFNRVASGDC
LMWPDGTPESAAIVSCADEHRFEVAESIDMRTFPGMEYGQNAAPPSPARI
QQISEEQCEAAVRRYLGTKFDPNSKFTISMLWPGDRAWRQAGERRMLCGL
QSPGPNNQQLAFKGKVADIDQSKVWPAGTCLGIDATTNQPIDVPVDCAAP
HAMEVSGTVNLAERFPDALPSEPEQDGFIKDACTRMTDAYLAPLKLRTTT
LTLIYPTLTLPSWSAGSREVACSIGATLGNGGWATLVNSAKGALLINGQP
PVPPPDIPEERLNLPPIPLQLPTPRPAPPAQQLPSTPPGTQHLPAQQPVV
TPTRPPESHAPASAAPAETQPPPPDAGAPPATQSPEATPPGPAEPAPAG
433636931YP_007270558.1 Transcriptional regulatory protein (probably AraC-family) [MycobactMSENSHHRLATTSLTLPPGARIERHRHPSHQIVYPSAGAVSVTTHAGTWI
TPVNRAIWIPAGCWHQHKFHGHTQFHGVALDPQRYRGGPATPTVLAVNPL
MRELIIACSQADRTDTDEHHRMLAVLQDQLPTTSIREPLWVPSPTDRRLR
HACALIADNLTQPLTLQQIGGRIGVSQRTLSRLFSDELGMTFPQWRTQLR
LQHALVLLAERHDVTSVASECGWATPSAFIDTYRQAFGHTPGQAARPMAA
TRLTRLRRARDRR
433636929YP_007270556.1 Conserved membrane protein of unknown function [Mycobacterium canetMVSLLVHAVLGVVVIGWIVSSNPKVFTRPAGGSWFSPLECVYYVVGIASI
ALGWYFNIRFVQQYAHGSANPLWGPGSWAEYIRLMFTNPAASSAGQDYTI
ANVILLPLFSITDGYRRGLRRPWLYFVSSLFTSFAFAFAFYFATIERQHR
HERSRATVGA
433636927YP_007270554.1 Putative dehydrogenase [Mycobacterium canettii CIPT 140070017]MIGYDATVIGAGHNGLTAAVLLQRAGLRTACLDAKRYAGGMASTVELFDG
YRFEIAGSVQFPTSSAVSSELALDSLPTVDLEVMSVALRGVGDDPVVQFT
DPTKMLTHLHRVHGADAVTGMAGLLAWSQAPTRALGRFEAGTLPKSFDEM
YACATNEFERSAIDDMLFGSVTDVLDRHFPDREKHGALRGSMTVLAVNTL
YRGPATPGSAAALAFGLGVPEGDFVRWKKLRGGIGALTTHLSQLLQRTGG
EVRLRSKVTEILVDNSRSSARVRGVRTAAGDTLASPIVVSAIAPDVTINE
LIDPAVLPSEIRDRYLRIDHRGSYLQMHFALAQPPAFAAPYQALNDPSMQ
ASMGIFCTPEQVQQQWEDCRRGIVPADPTVVLQIPSLHDPSLAPAGKQAA
SAFAMWFPIEGGSKYGGYGRAKVEMGQNVIDKITRLAPNFKGSILRHTTF
TPQTHGCDVRCPGWGLLPCPAAPGPDRPQQAWPERLYRPADPDSRVVPGK
CRLSRWAGNNVHPWI
433636925YP_007270552.1 Putative polyketide synthase Pks2 [Mycobacterium canettii CIPT 1400MGLGSAASGTGADRGAWTLAEPRVTPVAVIGMACRLPGGIDSPELLWKAL
LRGDDLITEVPPDRWDCDEFYDPQPGVPGRTVCKWGGFLDNPADFDCEFF
GIGEREAIAIDPQQRLLLETSWEAMEHAGLTQQTLAGSATGVFAGVTHGD
YTMVAADAKQLEEPYGYLGNSFSMASGRVAYAMRLHGPAITVDTACSSGL
TAVHMACRSLHEGESDVALAGGVALMLEPRKAAAGSALGMLSPTGRCRAF
DVAADGFVSGEGCAVVVLKRLPDALADGDRILAVIRGTSANQDGHTVNIA
TPSQPAQVAAYRAALAAGGVDAATVGMVEAHGPGTPIGDPIEYASVSEVY
GVDGPCALASVKTNFGHTQSTAGVLGLIKVVLALKHGVVPRNLHFTRLPD
EIAGITTNLFVPEVTTPWPTNGRQVPRRAAVSSYGFSGTNVHAVVEQAPQ
TEAQPHAASTPPTGTPALFTLSASSADALRQTAQRLTDWIQQHADSLVLS
DLAYTLARRRTHRSVRTAVIASSVDELIAGLGEVADGDTVYQPAVGQDDR
GPVWLFSGQGSQWAAMGADLLTNESVFAATVAELEPLIAAESGFSVTEAM
TAPETVTGIDRVQPTIFAMQVALAATMAAYGVRPGAVIGHSMGESAAAVV
AGVLSAEDGVRVICRRSKLMATIAGSAAMASVELPALAVQSELTALGVDD
VVVAVVTAPQSTVIAGGTESVRKLVDIWERRDVLARAVAVDVASHSPQVD
PILDELIAALADLNPKAPEIPYYSATLFDPREAPACDARYWADNLRHTVR
FSAAVRSALDDGYRVFAELSPHPLLTHAVDQIAGSVGMPVAALAGMRREQ
PLPLGLRRLLADLHNAGAAVDFSVLCPQGRLVDAPLPAWSHRFLFYDREG
VDNRSPGGSTVAVHPLLGAHVRLPEEPERHAWQADVGTATLPWLGDHRIH
NVAALPGAAYCEMALSAARAVLGEQSEVRDMRFEAMLLLDDQTPVSTVAT
VTSPGVVDFAVEALQEGVGHHLRRASAVLQQVSDECEPPAYDMASLLEAH
PCRVDGEDLRRRFDKHGVQYGPAFTGLAVAYVAEDATATMLAEVALPGSI
RSQQGLYAIHPALLDACFQSVGAHPDSQSVGSGLLVPLGVRRVRAYASVR
TARYCYTRVTKVELAGVEADIDVLDAHGTVLLAVCGLRIGTGVSERDKHN
RVLNERLLTIEWHQRELPEMDPSGAGKWLLISDCAASDVTATRLADAFRE
HSAACTTMRWPLHDDQLAAADQLRDQVGSDEFSGVVVLTGPNTGTPHQGS
ADRGAEYVRRLVGIARELSDLPGAVPRMYVVTRGAQRVLADDCVNLEQGG
LRGLLRTIGAEHPHLRATQIDVDEQTGVEHLARQLLATSEEDETAWRDNE
WYVARLCPTPLRPQERRTIVADHQQSGMRLQIRTPGDMQTIELAAFHRVP
PGPGQIEVAVRASSVNFADVLIAFGRYPSFEGHLPQLGTDFAGVVTAVGP
GVTDHKVGDHVGGMSPNGCWGTFVTCDARLAATLPPGLGDAQAAAVTTAH
ATAWYGLHELARIRAGDTVLIHSGTGGVGQAAIAIARAAGAEIFATAGTP
QRRELLRNMGIEHVYDSRSTEFAEQIRRDTNGRGVDVVLNSVTGAAQLAG
LKLLAFRGRFVEIGKRDIYGDTKLGLFPFRRNLSFYAVDLGLLSATHPEE
LRDLLGTVYRLTAAGELPLPQSTHYPLVEAATAIRVMGNAEHTGKLVLHI
PQNGKSLVTLPPEQAQVFRPDGSYIITGGLGGLGLFLAEKMAAAGCGRLV
LNSRTQPTQKVRETIEAIAAMGSEVVVECGDIAQPGTAERLVATAVATGL
PVRGVLHAAAVVEDATLANITDELLARDWAPKVHGAWELHEATSGQPLDW
FCLFSSAAALTGSPGQSAYSAANSWLDAFAHWRQAQGLPATAIAWGAWSD
IGQLGWWSASPARASALEESNYTAITPDEGAYAFEALLRHNRVYTGYAPV
IGAPWLVAFAERSRFFEVFSSSNGSGTSKFRVELNELPRDEWPARLRQLV
SEQVSLILRRTVDPDRPLPEYGLDSLGALELRTRIETETGIRLAPKNVSA
TVRGLADHLYEQLAPDDAPAAALSSQ
433636923YP_007270550.1 Integral membrane transport protein Mmpl8 [Mycobacterium canettii CMCDALTQPVRTPRPSTNLRAEPHRPTGDGGVFPRLGRLIVRRPWVVIAFW
VALAGLLAPTVPSLDEISQRHPVAILPSDAPVLVSTRQMTAAFREAGLQS
VAVVVLSDAKGLGAADERSYKELVDALRRDTRDVVMLQDFVTTPPLRELM
TSKDNQAWILPVGLPGDLGSTQSKQAYARVADIVEHQVAGSTLTANLTGP
AATVADLNLTGQRDRSRIEFAITILLLVILLIIYRNPITMVLPLITIGMS
VAVAQRLVAIAGLAGLGIANQSIIFMSGMMVGAGTDYAVFLISRYHDYLR
QGADSDQAVKKALTSIGKVIAASAATVAITFLAMVFTQLGILKTVGPMLG
ISVAVVFFAAVTLLPALMVLAGRRGWIAPRRDLTRRFWRSSGVHIVRRPK
THLLASALVLVILAGCAGLARYNYDDRKTLPASVESSIGYAALDKHFPSN
LIIPEYLFIQSSTDLRTPKALADLEQMAQRVSQVPGVAMVRGITRPAGRS
LEQARTSWQAGEVGSKLDEGSKQIAAHTGDIDKLAGGANLMASKLGDVRA
QVNRAISTVGGLIDALAYLQDLLGGNRVLGELEGAEKLIGSMRALGDTID
ADASFVANNTEWASPVLGALDSSPMCTADPACASARTELQRLVTARDDGT
LAKISELARQLQATRAVQTLAATVSGLRRALATVIRAMGSLGMSSPGGVR
SKINLVNKGVNDLADGSRQLAEGVQLLVDQVKKMGFGLGEASAFLLAMKD
TATTPAMAGFYIPPELLSYATGESVKAETMPSEYRDLLGGLNVDQLKKVA
AAFISPDGHSIRYLIQTDLNPFSTAAMDQIDAITAAARGAQPNTALADAK
VSVVGLPVVLKDTRDYSDHDLRLIIAMTVCIVVLILIVLLRAIVAPLYLI
GSVIVSYLAALGIGVIVFQFLLGQEMHWSIPGLTFVILVAVGADYNMLLI
SRLREEAVLGVRSGVIRTVASTGGVITAAGLIMAASMYGLVFASLGSVVQ
GAFVLGTGLLLDTFLVRTVTVPAIAVLVGQANWWLPSSWRPATWWPLGRR
RGRAQRTKRKPLLPKEEEEQSPPDDDDLIGLWLHDGLRL
433636921YP_007270548.1 Conserved membrane protein of unknown function [Mycobacterium canetMWSTVLVLALSVICEPVRIGLVVLMLNRRRPLLHLLTFLCGGYTMAGGVA
MVTLVVLGATPLAGHFSVAEVQIGTGLIALLIAFALTTNVIGKHVRRATH
ARVGDDGGRVLRESVPSSGAHKLAVRARCFLQGDSLYVAGVSGLGAALPS
ANYMGAMAAILASGATPATQALAVVTFNVVAFTVAEVPLVSYLAAPRKTR
AFMAALQSWLRSRSRRDAALLVAAGGCLMLALGLSNL
433636919YP_007270546.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MMQFYDDGVVQLDRAALTLRRYHFPSGTAKVIPLDQIRGYQAESLGFFMA
RFNIWGRPDLRRWLPLDVYRPLKSTLVTLDVPGMRPKPACTPTRPKEFIA
LLDELLALHRT
433636917YP_007270544.1 Putative phosphotransferase [Mycobacterium canettii CIPT 140070017]MSFPSSPPALPAIVARFAVGRPVRAVWVNELGGVTFRVDSGIGAGSEFIK
VARRGTADFANEARRLRWAAPYLAVPRVLGVGVDGDWAWLHTDALPGLSA
VHPRWRASPQVAVPALGAGLRTLHDSLPVPSCPFDWSTASRLAKLAPARR
AELGDSPPVDRLVVCHGDACSPNTILDDTGRCCGHVDFGDLGVADRWADL
AVATLSLQWNFPDYPGQLRDDEFFAAYGVAPDPARIDYYRRLWQAEDDSS
R
433636915YP_007270542.1 Putative acyltransferase [Mycobacterium canettii CIPT 140070017]MAEPTYRVLEILAQLLVLATGTRITYVGEENVPDQGGAVVAINHTSYVDW
LPAALAMHRRRRRMRFMIKAEMQRMRLVNFLIRHTRTIPVDRGAGASAYA
VAVQRLREGELVGVYPEATISRSFELKGFKTGAARMAAEADVPIVPVVVW
GAQRIWTKDHPRQIGRAKVPVTVQVGRPLRAAAGIEQTNAALRESMTALL
WQAQERYPHPAGAYWVPRRLGGGAPTLAEAARMEADEAAARAASRTPHES
R
433636913YP_007270540.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MKPTVPALIACDVDGTLLDDEEAVTKRTRDAVLAAVDAGTHFILATGRPP
RWVRPIVDALGFAPMAVCANGAVIYDPGTDRVMSVRTLPVDALATLAEVA
TRVIPGAGLAVERIGERAHDTATPQFVSSPGYEHAWLNPDNTEVSIDHLL
SAPAIKLLIRKAGAASADMAAELAKHVGFEGDITYSTNNGLVEIVPLGIS
KATGVDEIARPLGISDAEVVAFGDMPNDVPMLLRAGLGVAMGNAHPDALA
VADEVTAPNSQDGVARVLERWWS
433636911YP_007270538.1 Conserved exported protein of unknown function [Mycobacterium canetMAATVVIVAWVVNRPPASSHEPSPTPDTQLAEQPLIGLGGGVTVRELTQE
TPFSLVALTGDLAGTSARVRAKRPDGDWGPWYQTEYETEPRDPAGTDGSV
EPGGLNPGPRSTDPVFVGTTTTVQVAVTRPIDAPITQPPAGRPTNALPDN
GLGYRPATKEQPFGQNISAILISPPQAPPGTQWTPPTAVTMAGQPPAIIS
RAEWGADESLRCETPEYDRGVRAAVVHHTAGSNDYSPLESAGIVKAIYTY
HSKTLGWCDIAYNALVDKYGQVFEGSAGGLTKPVEGFHTGGFNRNTWGVA
MIGNFDDVAPTPIQIRTVGRLLGWRLGMDDVDPRSMVDLQSAGSSYTTFP
GGAIARLPAIFTHRDVGNTDCPGNAAYAVMDEIRDIAAHFNDPPEELIKA
LEGGAIYQRWQALGGMNSALGAPTSPEADAADGARYATFAKGAMYWSPVT
DAQPVTGAIYEAWASLSYERGPLGLPTSAEIQEPLQITQNFQHGTLNFER
LTGNVTEVVDGITTPLATRPPSGPTVPPEHFTLPTHPIT
433636909YP_007270536.1 UDP-galactopyranose mutase Glf (UDP-GalP mutase) (NAD+-flavin adeniMQPMTARFDLFVVGSGFFGLTIAERVATQLDKRVLVLERRPHIGGNAYSE
AEPQTGIEVHKYGAHLFHTSNKRVWDYVRQFTDFTDYRHRVFAMHNGQAY
QFPMGLGLVSQFFGKYFTPEQARQLIAEQAAEIDTADAQNLEEKAISLIG
RPLYEAFVKGYTAKQWQTDPKELPAANITRLPVRYTFDNRYFSDTYEGLP
TDGYTAWLQNMAADHRIEVRLNTDWFDVRDQLRPGSPAAPVVYTGPLDRY
FDYAEGRLGWRTLDFEVEVLPIGDFQGTAVMNYNDLDVPYTRIHEFRHFH
PERDYPTDKTVIMREYSRFAEDDDEPYYPINTEADRALLATYRARAKSET
ASSKVLFGGRLGTYQYLDMHMAIASALNMYDNLLAPHLRDGVPLLQDGA
433636907YP_007270534.1 Conserved membrane protein of unknown function [Mycobacterium canetMVAVQSALVDRPGMLATARGLSHFGEHCIGWLILALLGAIALPRRRREWL
VAGAGAFAAHAIAVLIKRLVRRQRPDHPAIAVNVDTPSQLSFPSAHATST
TAAALLMGRATGLPLPVVLVPPMALSRILLGVHYPSDVAVGVALGATVGA
IVDSVGGGRQRARKR
433636905YP_007270532.1 Conserved membrane protein of unknown function [Mycobacterium canetMVRVSLWLSVTAVAVLFGWGSWQRRWIADDGLIVLRTVRNLLAGNGPVFN
QGERVEANTSTAWTYLLYVGGWVGGPMRLEYVALALAMVLSLLGMVLLML
GTGRLYAPSLRGRRAIMLPAGALVYIAVPPARDFATSGLESGLVLAYLGL
LWWMMVCWSQPLRARPDSQMFLGALAFVAGCSVLVRPEFALIGGLALIMM
LIAARTWRRRVLIVLAGGFLPVAYQIFRMGYYGLLVPSTALAKDAAGDKW
SQGMIYVSNFNRPYALWVPLVLSVPLGLLLMTARRRPSFLRPVLAPDYGR
VARAVQSPPAVVAFIVGSGVLQALYWIRQGGDFMHGRVLLAPLFCLLAPV
GVIPILLPDGKDFSRETGRWLVGALSGLWLGIAGWSLWAANSPGMGDDAT
RVTYSGIVDERRFYAQATGHAHPLTAADYLDYPRMAAVLTALNNTPEGAL
LLPSGNYNQWDLVPMIRPSSGTAPGGKPAPKPQHAVFFTNMGMLGMNVGL
DVRVIDQIGLVNPLAAHTERLKHARIGHDKNLFPDWVIADGPWVKWYPGI
PGYIDQQWVTQAEAALQCPATRAVLNSVRAPITLHRFLSNVLHSYEFTRY
RIDRVPRYELVRCGLDVPDGPGPPPRE
433636903YP_007270530.1 Secreted MPT51/MPB51 antigen protein FbpD (MPT51/MPB51 antigen 85 cMKGRSALLRALCIAALSFGLGGVAVAAEPTAKAAPYENLMVPSPSMGRDI
PVAFLAGGPHAVYLLDAFNAGPDVSNWVTAGNAMNTLAGKGISVVAPAGG
AYSMYTNWEQDGSKQWDTFLSAELPDWLAANRGLAPGGHAAVGAAQGGYG
AMALAAFHPDRFGFAGSMSGFLYPSNTTTNGAIAAGMQQFGGVDTNGMWG
APQLGRWKWHDPWVHASLLAQNNTRVWVWSPTNPGASDPAAMIGQAAEAM
GNSRMFYNQYRSVGGHNGHFDFPASGDNGWGSWAPQLGAMSGDIVGAIR
433636901YP_007270528.1 Fatty-acid-coa ligase FadD32 (fatty-acid-coa synthetase) (fatty-aciMFVTGESGMAYHNPFIVNGKIRFPANTNLVRHVEKWAKVRGDKLAYRFLD
FSTERDGVARDILWSDFSARNRAVGARLQQVTQPGDRVAILCPQNLDYLI
SFFGALYSGRIAVPLFDPAEPGHVGRLHAVLDDCAPSTILTTTDSAEGVR
KFIRARSAKERPRVIAVDAVPTEVAATWQQPEANEETVAYLQYTSGSTRI
PSGVQITHLNLPTNVVQVLNALEGQEGDRGVSWLPFFHDMGLITVLLASV
LGHSFTFMTPAAFVRRPGRWIRELARKPGETGGTFSAAPNFAFEHAAVRG
VPRDDEPPLDLSNVKGILNGSEPVSPASMRKFFEAFAPYGLKQTAVKPSY
GLAEATLFVSTTPMDEVPTVIHVDRDELNNQRFVEVAADAPNAVAQVSAG
KVGVSEWAVIVDADTASELPDGQIGEIWLHGNNLGTGYWGKEEESAQTFK
NILKSRISESRAEGAPDDALWVRTGDYGTYFKDHLYIAGRIKDLVIIDGR
NHYPQDLECTAQESTKALRVGYVAAFSVPANQLPQTVFDDSHAGLKFDPE
DTSEQLVIVGERAAGTHKLDHQPIVDDIRAAIAVGHGVTVRDVLLVSAGT
IPRTSSGKIGRRACRAAYLDGSLRSGVGSPTVFATSD
433636899YP_007270526.1 Putative Propionyl-CoA carboxylase beta chain 4 AccD4 (Pccase) (ProMTVTEPVLHTTAEKLAELRERLELAKEPGGEKAAAKRDKKGIPSARARIY
ELVDPGSFMEIGALCRTPGDPNALYGDGVVTGHGLINGRPVGVFSHDQTV
FGGTVGEMFGRKVARLMEWCAMVGCPIVGINDSGGARIQDAVTSLAWYAE
LGRRHELLSGLVPQISIILGKCAGGAVYSPIQTDLVVAVRDQGYMFVTGP
DVIKDVTGEDVSLDELGGADHQASYGNIHQVVESEAAAYQYVRDFLSFLP
SNCFDKPPVVNPGLEPEITPHDLELDSIVPDSDNMAYDMHEILLRIFDDG
DFLDVAAQAGQAIITGYARVDGRTVGVVANQPMHMSGAIDNEASDKAARF
IRFSDAFDIPLVFVVDTPGFLPGVEQEKNGIIKRGGRFLYAVVEADVPKV
TITIRKSYGGAYAVMGSKQLTADLNFAWPTARIAVIGADGAAQLLMKRFP
DPNAPEAQAIRKSFVENYNLNMAIPWIAAERGFIDAVIDPHETRLLLRKS
MHLLRDKQLWWRVGRKHGLIPV
433636897YP_007270524.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MHQAGHVGTHERRAAATRRSALTAAGLAVVGAGVLGASACSPQKSPQPSP
PRLPDNALITLGVAAGPPPTPNRIGISSVLKIGRDLYVIDCGLGSLNAFT
NAGLQFDDLKAMFITHLHTDHIVDYYNFFLSGGFLAPPGRAPVLVYGPGP
AGGLPPSEVGNPNPATVNPANPTPGLAAATEALHRAFAYTSNIFIRDYGI
DNVADLVKVTEIALPPGSDYRHRAPKMSPFSVASDDNVSVTATLVSHYDV
YPAFGFRFDLKKSGVSVTFSGDTTKSDNLITLAQGTDILVHEAVFSLDTA
YFGNAFPPNYLVNSHTSAEQVGEVAAAAKPKQLILSHYAPDDLPDSQWLD
KIKKNYSGMTTIARDGQVFAL
433636895YP_007270522.1 Integral membrane indolylacetylinositol arabinosyltransferase EmbA MPHDGNERSHRIARLAAVVSGIAGLLLCGIVPLLPVNQTTATIFWPQGST
ADGNITQITAPLVSGAPRALDISIPCSAIATLPANGGLVLSTLPTGGVDT
GKAGLFVRANQDTVVVAFRDTVAAAAPRSAIAAGACGVLHIWANTGGVGA
QFVGIPGAGGTLPPEKKPQVGGIFTDLKVTPQPGLSARIDIDTRFITAPT
AVKTIAMVTAALAVVAAILALAALDRHHRGAPQRTRVRRRIGIATGLADA
GVIGTLLLWHVIGATSSDDGYNLTIARVAPAAGYIANYFRYFGTTEAPFD
WYPSVLAQLATVSTAGVWMRLPATLAGIACWLIVSRFVLRRLGPGPGGLA
SNRVAVFTAGAVFLSAWLPFNNGLRPEPLIALGVLVTWVLVERSIALGRL
APAAVAIVVATLTATLAPQGLIALAPLLTGARAIAQRIRRRRATDGLLAP
LGVLAAALSLITVVVFRDQTLATVAESARIKYKVGPTIAWYQDFLRYYFL
TVESNVEGSMSRRFAVLVLLFCLFGVLFVLLRRGRVAGLASGPAWRLIGT
TAVGLLLLTFTPTKWAVQFGAFAGLAGVLGAVTAFTFARIGLHSRRNLTL
YVTALLFVLAWATSGINGWFYVGNYGVPWYDIQPVIASHPVTSMFLTLSI
LTGLLAAWYHFRMDYAGHTEVKDNRRNRILASTPLLVVAVIMVAGEVGSM
AKAAVFRYPLYTTAKANLTALSTGLSSCAMADDVLAEPDPNAGMLQPVPG
QAFGPDGPLGGVSPVGFKPEGVGEDLKSDPVVSKPGLVNSDASPNKPNAA
ITDSAGTAGGKGPVGINGSHAALPFGLDPARTPVMGSYGENNLAATATSA
WYQLPPRSPDRPLVVVSAAGAIWSYKEDGDFIYGQSLKLQWGVTGPGGRI
QPLGQVFPIDIGPQPAWRNLRFPLAWAPPEADVARIVAYDPNLSPEQWFA
FTPPRVPVLESLQRLIGSATPVLMDIATAANFPCQRPFSEHLGIAELPQY
RILPDHKQTAASSNLWQSSSTGGPFLFTQALLRTSTIATYLRGDWYRDWG
SVERYHRLVPADQAPNAVVEEGVITVPGWGRPGPIRALP
433636893YP_007270520.1 Conserved membrane protein of unknown function [Mycobacterium canetMPSRRKSPQFGPELGAFASARAREVLVALGQLAAAVVVAVGVAVVSLLSI
ARVEWPAFPSSNQLHALTTVGQFACLAGLVGIGWLWRHRRFRRLARLGGL
VLVSAFTVVTLGMPLGATKLYLFGISVDQQFRTEYLTRLTDTAALRDMTY
IGLPPFYPPGWFWIGGRAAALTGTPAWEMFKPWAITSMAIAVAVALVLWW
RMIRFEYALLVTVATAAVMLAYSSPEPYAAMITVLLPPMLVLTWSGLGAR
DRQGWAAVVGAGVFLGFAATWYTLLVAYGAFTVVLMALLLAGSRLQSGIK
AAVDPLCRLAVVGAIAAAIGSTTWLPYLLRAARDPVSDTGSAQHYLPADG
AALTFPMLQFSLLGAICLLGTLWLVMRARSSAPAGALAIGVLAVYLWSLL
SMLATLARTTLLSFRLQPTLSVLLVAAGAFGFVEAVQALGKRGRGVIPMA
AAIGLAGAIAFSQDIPDVLRPDLTIAYTDTDGYGQRGDRRPPGSEKYYPA
IDAAIRRVTGKRRDRTVVLTADYSFLSYYPYWGFQGLTPHYANPLAQFDK
RATQIDSWSGLSTADEFIAALDKLPWQPPTVFLMRHGAHNSYTLRLAQDV
YPNQPNVRRYTVDLRTALFADPRFVVEDIGPFVLAIRKPQESA
433636891YP_007270518.1 Putative oxidoreductase [Mycobacterium canettii CIPT 140070017]MLSVGATTTATRLTGWGRTAPSVANVLRTPDAEMIVKAVARVAESGGGRG
AIARGLGRSYGDNAQNGGGLVIDMTPLNTIHSIDADTKLVDVDAGVNLDQ
LMKAALPFGLWVPVLPGTRQVTVGGAIACDIHGKNHHSAGSFGNHVRSMD
LLTADGEIRHLTPTGEDAELFWATVGGNGLTGIIMRATIEMTPTSTAYFI
ADGDVTASLDETIALHSDGSEARYTYSSAWFDAISAPPKLGRAAVSRGRL
ATVEQLPAKLRSEPLKFDAPQLLTLPDVFPNGLANKYTFGPIGELWYRKS
GTYRGKVQNLTQFYHPLDMFGEWNRAYGPAGFLQYQFVIPTEAVDEFKKI
IGVIQASGHYSFLNVFKLFGPGNQAPLSFPIPGWNICVDFPIKDGLGKFV
SELDRRVLEFGGRLYTAKDSRTTAETFHAMYPRVDEWISVRRKVDPLRVF
ASDMARRLELL
433636889YP_007270516.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MSEKVESKGLADAARDHLAAELARLRQRRDRLEVEVKNDRGMIGDHGDAA
EAIQRADELAILGDRINELDRRLRTGPTPWSGSETLPGGTEVTLRFPDGE
VVTMHVISVVEETPVGREAETLTARSPLGQALAGHQPGDTVTYSTPQGPN
QVQLLAVKLPS
433636887YP_007270514.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MRILAMTRAHNAGRTLAATLDSLAVFSDDIYVIDDRSTDDTAEILANHPA
VTNVVRARPDLPPTPWLIPESTGLELLYRMADFCRPDWVMMVDADWLVET
DIDLRAVLARTPDDIVALMCPMVSRWDDPEYPDLIPVMGTAEALRGPLWR
WYPGLRAGVKLMHNPHWPANITDHGRIGQLPGVRLVHSGWSTLAERILRV
EHYLRLDPDYRFNFGVAYDRSLLFGYALDEVDLLKADYRRRIRGDFDPLE
PGGRLPIDREPRAIGRGYGPHAGGFHPGVDFATDPGTPVYAVASGAVSAI
DEVDGLVSLTIARCELDVVYVFRPGDEGRLVLGDRIAAGAQLGTIGAQGE
SADGYLHFEVRTQDGHVNPVRYLANMGLRPWPPPGRLRAVSGSYPPATPC
TITAEDR
433636885YP_007270512.1 Putative dTDP-glucose 4-6-dehydratase rfbB [Mycobacterium canettii MEILVTGGAGFQGSHLTESLLANGHWVTVLDKSSRNAVRNMQGFRSHDRA
AFISGSVTDGQTIDRAVRDHHVVFHLAAHVNVDQSLGDPESFLETNVMGT
YRVLEAVRRYRNRLIYVSTCEVYGDGHNLKEGERLDEHAELKPNSPYGAS
KAAADRLCYSYFRSYGLDVTIVRPFNIFGVRQKAGRFGALIPRLVRQAIN
GEGLTIFGAGSATRDYLYVSDIVGAYNLVLRTPTLRGQAINFASGKDTRV
ADIVEYVADKFGARIEHRDARPGEVQRFPADISLAKSIGFQPQVEIWDGI
DRYINWAKDQPQYPYEQDGFSGSSVL
433636883YP_007270510.1 Galactofuranosyl transferase [Mycobacterium canettii CIPT 140070017MTESVFAVVVTHRRPDELAKSLDVLTTQTRLPDHLIVVDNDCSGDGRVRD
LVAGQPIATTYLGSRRNLGGAGGFALGMLHALAQGADWVWLADDDGHAQD
ARVLATLLACAQKHDLAEVSPMVCNIDDPTRLAFPLRRGLVWRRRASELR
TEAGQELLPGIASLFNGALFRASTLAAIGVPDLRLFIRGDEVEMHRRLVR
SGLPFGTCLDAVYLHPCGSDEFKPILCGRMHAQYPDDPGKRFFTYRNRGY
VLSQPGLRKLLAQEWLRFGWFFLVTRRDPKGLWEWIRLRRLGRREKFGKP
GGSA
433636881YP_007270508.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MRKRMVIGLSTGSDDDDVEVIGGVDPRLIAVQENDSDESSLTDLVEQPAK
VMRIGTMIKQLLEEVRAAPLDEASRNRLRDIHATSIRELEDGLAPELREE
LDRLTLPFNEDAVPSDAELRIAQAQLVGWLEGLFHGIQTALFAQQMAARA
QLQQMRQGALPPGVGKSGQHGHGTGQYL
433636879YP_007270506.1 Putative aminotransferase [Mycobacterium canettii CIPT 140070017]MAYDVARVRGLHPSLGDGWVHFDAPAGMLIPDSVATTVSTAFRRSGASTV
GAHPSARRSAAVLDAAREAVADLVNADPGGVVLGADRAVLLSLLAEASSS
RAGLGYEVIVSRLDDEANIAPWLRAAHRYGAKVKWAEVDIETGELPTWQW
ESLISKSTRLVAVNSASGTLGGVTDLRAMTKLVHDVGALVVVDHSAAAPY
RLLDIRETDADVVTVNAHAWGGPPIGAMVFRDPSVMNSFGSVSTNPYATG
PARLEIGVHQFGLLAGVVASIEYLAALDESARGSRRERLAVSMQSADAYL
NRVFDYLMVSLRSLPLVMLIGRPEAQIPVVSFAVHKVPADRVVQRLADNG
ILAIANTGSRVLDVLGVNDVGGAVTVGLAHYSTMAEVDQLVRALASLG
433636877YP_007270504.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MFEILLSDPAELRDADDAALLAAIEDCARAEAAAGARRLSAIAELTSRRT
GDDQRADWACDGWDCAAAEVAAALTVSHRKASGQMHLSLSLNRLPQVAAL
FLAGQLSARLVSIIAWRTYLVRDPEALSLLDAALAKHATAWGPLSAPKLE
KAIDSWIDRYDPAALRRTRISARSRDLCIGDPDEDAGTAALWGRLFATDA
AMLDRRLTQLAHGVCDDDPRTIAQRRADALGALAAGADRLTCGCGNPDCP
SSAGNHRQATGVVIHVVADAAALDAAPDPHLSGPEPALAPEAPATPAVKP
PAALISGGGVVPAPLLAELIRGGAALSRVRHPGDLRSEPHYRPSAKLAEF
VRIRDMTCRFPGCDQPAEFCDIDHTLPYPLGPTHPSNLKCLCRKHHLLKT
FWTGWRDVQLPDGTIIWTAPNGHTYTTHPGSRIFLPSWHTTTAELPPTPS
PPAIGPTHTLPMPRRHRTRAAELAHRIRRERAHVTQRNKPPPSGGDTAVA
EGFEPPDGFSRLSLSRRVH
433636875YP_007270502.1 Putative enoyl-CoA hydratase ECHA21 (enoyl hydrase) (unsaturated acMGETYESVTVETKDQVAQVTLIGPGKGNAMGPAFWSEMPEVFHALDADRE
VRAIVITGSGKNFSYGLDVPAMGGMFAPLIADGALARPRTDFHTEILRMQ
KAINAVADCRTPTIAAVQGWCIGGAVDLISAVDIRYASADAKFSVREVKL
AIVADMGSLARLPLILSDGHLRELALTGKNIDAARAEKIGLVNDVYDDAD
QTLAAAHATAAEIAANPPLAVYGIKDVLDQQRTSAVSENLRYVAAWNAAF
LPSKDLTEGISATFAKRPPQFTGE
433636873YP_007270500.1 Putative histidinol-phosphate aminotransferase HisC2 (imidazole aceMTARLRPELAGLPVYVPGKTVPGAIKLASNETVFGPLPSVRAAIDRATDT
VNRYPDNGCVQLKAALARHLGPDFAPEHVAVGCGSVSLCQQLVQVTASVG
DEVVFGWRSFELYPPQVRVAGAIPIQVPLTDHTFDLYAMLAAVTDRTRLI
FVCNPNNPTSTVVGPDALARFVEAVPAHILIAIDEAYVEYIRDGMRPDSL
GLVRAHNNVVVLRTFSKAYGLAGLRIGYAIGHPDVITALDKVYVPFTVSS
IGQAAAIASLDAADELLARTDTVVAERARVSAELRAAGFTLPPSQANFVW
LPLGSRTQDFVEQAADARIVVRPYGTDGVRVTVAAPEENDAFLRFARRWR
SDQ
433636871YP_007270498.1 Conserved protein of unknown function- leucine rich protein [MycobaMLGGIQQNTLMDNDPLAHGYYVADLLVALAVVALMLRARRTRPELARMLL
LGTLIGLVWELPVFGLSAWTNTPIIEWATPLPLPTVVFLLAHSVWDGALL
TMGWLLARALTGEPAGALGLTVQVLWGQLTALAVELSAILAGTWSYVDDL
WFNPVMFWFRGHPVTAAMQLTWLLAPLCFTALVRRLALTAR
433636869YP_007270496.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MGSTPPRTPQEVFAHHGQALAAGDLEEIVADYTDDSFVITPAGIARGKEG
IRQLFVKLLDDIPNALWDLKTQIFEGDVLLLEWTANSAVSRIDDGVDTFV
FRDGMIWAQTVRYTPHPKT
433636867YP_007270494.1 Putative two component transcriptional regulatory protein TcrX [MycMRRADGQPVTVLVVDDEPVLAEMVSMALRYEGWNITTAGDGSSAIAAARR
QRPDVVVLDVMLPDMSGLDVLHKLRSENPGLPVLLLTAKDAVEDRIAGLT
AGGDDYVTKPFSIEEVVLRLRALLRRTGVTTVDSGAQLVVGDLVLDEDSH
EVMRAGEPVSLTSTEFELLRFMMHNSKRVLSKAQILDRVWSYDFGGRSNI
VELYISYLRKKIDNGREPMIHTLRGAGYVLKPAR
433636865YP_007270492.1 19 kDa lipoprotein antigen precursor LpqH [Mycobacterium canettii CMKRGLTVAVAGAAILVAGLSGCSSNKSTTGSGETTTAAGTTASPGAASGP
KVVIDGKDQNVTGSVVCTTAAGNVNIAIGGAATGIAAMLTDGNPPEVKSV
GLGNVNGVTLRYTSGTGQGNASATKDGSHYKITGTATGVDMANPMSPVNK
SFEIEVTCS
433636863YP_007270490.1 Putative acyl-CoA dehydrogenase FadE36 [Mycobacterium canettii CIPTMTSVDRLDGLDLGALDRYLRSLGIGRDGELRGELISGGRSNLTFRVYDDA
TSWLVRRPPLHGLTPSAHDMAREYRVVAALGDTPVPVARTISLCQDDSVL
GAPFQVVEFVAGQVVRRRAELEALGSRSVIEGCVDALIRVLVDLHSIDPK
AVGLSDFGKPDGYLERQVRRWGSQWELVRLPDDHRDADISRLHLALQQAI
PQQSRTSIVHGDYRIDNTILDTDDPCHVRAVVDWELSTLGDPLSDAALMC
VYRDPALDLIVHAQAAWTSPLLPTADELADRYSLVSGQPLGHWEFYMALA
YFKLAIIAAGIDYRRRMSEQAEGKDTAAESVPDVVAPLIARGLAEIAKKS
G
433636861YP_007270488.1 Putative osmoprotectant (glycine betaine/carnitine/choline/l-prolinMRMLRRLRRATVAAAVWLATVCLVGSCANADPLGSATGSVKSIVVGSGDF
PESQVIAEIYAQALQANGFDVGRRLGIGSRETYIPALKDHSIDLVPEYIG
NLLLYFQPDATVTMLDAVELELYKRLPGDLSILTPSPASDTDTVTVTAAT
AARWNLKTIADLASHSADVKFAAPSAFQTRPSGLPGLRHKYALDIAPGNF
VTINDGGGAVTVRALVEGTATAANVFSTSAAIPQNHLVVLEDPEHNFLAG
NIVPLVNSQKKSDRLKDVLDAVSAKLTTAGLAELNAAVSGNAGVDPDEAA
RKWVRDNGFDHPVRQ
433636859YP_007270486.1 Putative osmoprotectant (glycine betaine/carnitine/choline/l-prolinMHYLMTHPGAAWALTVVHLRLSLLPVLIGLVSAVPLGLLVQRAPLLRRLT
TATASVMFTIPSLALFVVLPLIIGTRILDEANVIVALAVYTTALLVRAVL
EALDAVPAQVHDAATAIGYSRIAQMWKVELPLSIPVLVAGLRVIAVTNIA
MVSVGSVIGIGGLGTWFTAGYQTNKSDQIVAGVIAMFLLAIVVDVVINLA
GRLATPWERAPRAARRRRQVAAPITGGAR
433636857YP_007270484.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MNAVPSDLTPRVWPAMLTWRAQDISRMESVRVQLSGKRIRANGRIVAAAT
ANNPAFGAHYDLQTDETGATKRFGLTVTLAERERQLAIARDEENMWLVTD
HQGERRAAYNGALDIDLVFSPFFNALPIRRLGLHERAESIALPVVYVNVP
EMSVDAATVSYTSEGRLDGIKLRSPVADTTVTVDSDGFIVDYPGLAERM
433636855YP_007270482.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MGAQRASTQRPAADTPDGFGVAVVREEGRWRCSPMGPKALTSLRAAETEL
RELRSAGAVFGLLDVDDEFFVIVRPAPSGTRLLLSDATAALDYDIAAEVL
DNLDAEIDPEDLEDADPFEEGDLGLLSDIGLPEAVLGVILDETDLYADEQ
LGRIAREMGFADQLSAVIDRLGR
433636853YP_007270480.1 Putative integrase (fragment) [Mycobacterium canettii CIPT 14007001MKRAKVQQITPHDLRHTAASLAVSAGVNVLALQRILGHKSAKVTLDTYAD
IFDADLDAVAVTLGKDADQQT
433636851YP_007270478.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MLVPHPLVDALLRFADEGTYRPLWSEDILTETRRTMVDRLNISTERADYR
IRLMRENFIDAEVTGYNDLIAAMNNHEKDRHVLAAAVRERAEVIVTTNLK
HFPDDALKPYQIKALHPDDFLLDQLDLYEEATKAVILGMVDAYIDPPFTP
HSLLDALGKQVPQFAAKARRLFPSGSPFGLGVLLPFDQ
433636849YP_007270476.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MILTGAFLADAAAAVDNKLNVQGGVLSRFAVGPDRLARFVLVVLTQAEPD
SSDRDITVEMRPPTDDEPIRLNFEAPEAAVAEFPGFAFFEIQLRLPVNGR
WVLVVTGGTGAISLPVLVSDMPATIGF
433636847YP_007270474.1 Metal sensor transcriptional regulator (ArsR-SmtB FAMILY) [MycobactMGHGVEGRNRPSAPLDSQAAAQVASTLQALATPSRLMILTQLRNGPLPVT
DLAEAIGMEQSAVSHQLRVLRNLGLVVGDRAGRSIVYSLYDTHVAQLLDE
AIYHSEHLHLGLSDRHPSAG
433636845YP_007270472.1 Conserved protein of unknown function- possible triacylglycerol synMSPIDALFLSAESREHPLHVGALQLFEPPTGAERGFVRETYQAMLQCREI
APLFRKRPTSLHGALINLGWSTDADVDLGYHARRSALPAPGRVRELLELT
SRLHSNLLDRHRPLWETHVIEGLQDGRFAIYSKMHHALVDGVSGLTLMRQ
PMTTDPIDGKLRTAWSPATQHTAIKRRRGRLQQLGGMLGSVAGLAPSTLR
LARSALIEQQLTLPFGAPRTMLNVAVGGARRCAAQSWPLDRVKAVKDAAG
VSLNDVVLAMCAGALREYLDDNDALPDTPLVAMVPVSLRTDRDSVGGNMV
GAVLCNLATHLDDPADRLDAIHASMRGNKNVLSQLPRAQALAVSLLLLSP
AALNTLPGLAKATPPPFNVCISNVPGAREPLYFNGARMVGNYPMSLVLDG
QALNITLTSTADSLDFGVVGCRRSVPHVQRVLSHLETSLKELERAVGL
433636843YP_007270470.1 Conserved membrane protein of unknown function [Mycobacterium canetMDQDRSDNTALRRGLRIALRGRRDPLPVAGRRSRTSGGIGDLHTRKVLDL
TIRLAEVMLSSGSGTADVVATAQDVAQAYQLTDCVVDITVTTIIVSALAT
TDTPPVTIMRSVRTRSTDYSRLAELDRLVQRITSGGVAVDQAHEAMDELT
ERPHPYPRWLATAGAAGFALGVAMLLGGTWLTCVLAAVTSGVIDRLGRLL
NRIGTPLFFQRVFGAGIATLVAVAAYLITGQDPTALVATGIVVLLSGMTL
VGSMQDAVTGYMLTALARLGDALFLTAGIVVGILISLRGVTNAGIQIELH
VAATTTLATPGMPLPILVAVSGAALSGVCLTIASYAPPRSVATAGLSAGL
AELVLIGLGAAGFGRVVATWTAAIGVGFFATLISIRRQAPALVTATAGIM
PMLPGLAVFRAVLAFAVNDTPDGGLAQLLEAAATALALGSGVVLGEFLAS
PLRYGAGRIGDLFRIEGPPGLRRAVGRVVRLQPAKSQQPTGTGSQRWRSV
ALEPTTADDVDAGYRGDWPATCTGATEVR
433636841YP_007270468.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MSLAWDVVSVDKPDDVNVVIGQAHFIKAVEDLHEAMVGVSPSLRFGLAFC
EASGPRLVRHTGNDGDLVELATRTALAIAAGHSFVIFLREGFPINILNPV
QAVPEVCTIYCATANPVDVVVAVTPHGRGIVGVVDGQTPLGVETDRDIAQ
RRDLLRAIGYKL
433636839YP_007270466.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MPKLSAGVLLYRARAGVVDVLLAHPGGPFWAGKDDGAWSIPKGEYTGGED
PWLAARREFSEEIGLCVPDGPRIDFGSLKQSGGKVVTVFGVRADLDITDA
RSNTFELDWPKGSGKMRKFPEVDRVSWFPVARARTKLLKGQRGFLDRLMA
HPAVAGLSEGPESLPC
433636837YP_007270464.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MAAAAEELDVDGIAVRLTSPDRMYFPKLGSHGTKRRLVEYYFAVAGGPML
TALRDRPTHLQRFPDGVDGEQIYQKRIPRHRPDYLQTCRVTFPSGRMADA
LKVTHPAAIVWAAQMGTITLHPWQVRCPDTEHPDELRIDLDPQPGTGFVE
ARTVAVDVLRPVLDDLGLVGYPKTSGGRGIHVFLRIATDWDFVEVRRAGI
ALAREVERRAPDAVTTSWWKEERGARIFIDFNQNARDRTMASAYSVRPTP
IATVSMPLTWEELAGADPDDYTMTTVPELVKIRDDPWAGMDDVAQSIAPL
LDLAAADEERGLGDMPYPPNYPKMPGEPKRVQPSRDTDLKRGNTSK
433636835YP_007270462.1 Conserved two-domain membrane protein of unknown function [MycobactMHTVATNNAAPVIAAGPVGPSRRRRRVDAPLTRRRQPSSSAVLLVAAFGA
FLAFLDSTIVNVAFPDIQRHFHSDISDLSWMLNAYNIVFAAFLVAAGRLA
DLMGRKRVFILGVALFTVASGLCAIAESVGELVAFRVLQGIGAAVLVPAS
LGLVVEAFPAERRAHGVNLWGAAGAIAAGLGPPIGGALIEADGWRWVFLV
NLPLGVFAVLAARRALVENRAAGRRRVPDVRGAVLLAFALGLLTLGLIKG
PDWGWASLPTIGSLLAAAVAMVGFVMSSRHHPAPMVEPTLLRIRSFVAGT
GLTAVASAGFYAYLLTHVLFLNYVWGYTLLEAGMAVAPAALVAAVAAAVL
GRVADRHGYRFIVGIGALIWAASLLWYLKVVGSQPDFLGEWLPGQILQGI
GVGATFPLLGSAALARLAKGGSYATASAVTGTIRQVGAVIGVAVLVILVG
TPAPGAAEEALRHGWALAAICFVAVGIGALSLGRIRPVPAAAEPSPGPPV
APLGARRPPRPAPVASAAAAVAPTPKTSREVNLLEALRFARPDTQQIELQ
AGSYLFHAGDVSDALYVVRSGRLQVLAGDGAKDEVVAELGRGQVVGELGV
LLDAPRSASVRAVRDSSLMRVTKAEFAKIADAGVLGALAGVLAKRQHQTR
AASQRTTPEVVVAVVGVDANAPVAMVATELCRALSTRLRAVAPGRVDCDG
LERAEQTADRVVLHAAVGDARWREFCLRVADRVVLVASNPAVPSAPLPAR
ATGADLVLAGRPAGREHRRAWEQLITPRSMHVVRREFVADDLRVLATRIA
GRSVGLVLSGGAARACAHLGVLEELEAAGVTVDRFAGTSMGAIIAALAAS
GLDAAGVDAQIYEHFVRKSHGDYTLPSKGLIRGKRTQSTLRMIFGDHLVE
ELPKHFRCVSVDLLARRPVVHRQGPLADVVGCSMRLPFLYAPLPYGGTLH
VDGGVLDNVPVTTLVGKDGPLIAVNVASGGNPSPASGGHRRGKPRVPGLT
DTLLRTMTISSAMASEKVLAQADLVIKPNPIGVGLMEYHQIDRAREAGRI
AAREALPQIMELVHG
433636833YP_007270460.1 Putative dehydrogenase [Mycobacterium canettii CIPT 140070017]MKAVTCTNAKLEVVDRPSPAPAKGQLLLDVLRCGICGSDLHARLHCDELA
DVMAESGYHAFMRSNQQVVFGHEFCGEVVEYGPGTRRTPRRGTPVVAMPL
LRRGNKEVHGIGLSTMAPGAYAERLVVEQSLTFPVPNGLAPEIAALTEPM
AVGWHAVRRGEVGKGDVAIVIGCGPIGLAVICMLKSRGVRTVIASDFSPG
RRALATACGADSVVDPVQDSPYAVAAGLGQGNRHLQSILDAFDLAVGTVE
RLQRLRLPWWHLWRAAEAAGAATPKRPVIFECVGVPGIIDGIIASAPLFS
RVVVVGVCMGSDHIRPAMAINKEINLRFVLGYTPLEFRDTLHMLADGKVN
AAPLITGTVGLPGVAAAFDALGDPEAHAKIMIDPKSNAASPQPFRVE
433636831YP_007270458.1 Putative cutinase [Mycobacterium canettii CIPT 140070017]MDVIRWARRLAVVAGTAAAVTTPALLSAHVPMVWAEPCPDVEVVFARGTG
EPPGIGSVGGLFVDALRSQVGAKSLGVYAVNYPASNDFASSDFPKTVIDG
IRDAGSHIQSMAMSCPQTRQVLGGYSQGAAVAGYVTSAVVPPGVPVQAVP
APMAPEVANHVAAVTLFGAPSAQFLGQYGAPPIAIGPLYQPKTLQLCADG
DSICGDGNSPVAHGLYAVNGMVGQGANFAASRL
433636829YP_007270456.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MSFDSLSPQELAALHARHQQDYAALQGMKLALDLTRGKPSAEQLDLSNQL
LSLPGDDYRDPEGTDTRNYGGQHGLPGLRAIFAELLGIAVPNLIAGNNSS
LELMHDIVAFSMLYGGVDSPRPWIQEQDGIKFLCPVPGYDRHFAITETMG
IEMIPIPVLQDGPDVDLIEELVAVDPSIKGMWTVPVFGNPSGVTYSWETV
RRLVQMRTAAPDFRLFWDNAYAVHTLTLDFPRQVDVLGLAAKAGNPNRPY
VFASTSKITFAGGGVSFFGGSLGNIAWYLQYAGKKSIGPDKVNQLRHLRF
FGDADGVRLHMLRHQQILAPKFALVAEVLDQRLSESKIASWTEPKGGYFI
SLDVLPGTARRTVALAKDVGIAVTEAGASFPYRKDPDDKNIRIAPSFPSV
PDLRNAVDGLATCALLAATEALLDQGLASSTPNVR
433636827YP_007270454.1 Putative fatty acid synthase [Mycobacterium canettii CIPT 140070017MAEILEIFTATGQHPLKFTAYDGSTAGQVDATLGLDLRTPRGATYLATAP
GELGLARAYVSGDLQAHGVHPGDPYELLKTLTERVDFKRPSARVLANVVR
SIGVEHLLPIAPPPQEARPRWRRMANGLLHSKTRDAEAIHHHYDVSNSFY
EWVLGPSMTYTCAVFPNAEASLEQAQENKYRLIFEKLRLEPGNRLLDVGC
GWGGMVRYAARRGVRVIGATLSAEQAKWGQKAVEDEGLSDLAQVRHSDYR
DVAETGFDAVSSIGLTEHIGVKNYPFYFGFLKSKLRTGGLLLNHCITRHD
NRSTSFAGGFTDRYVFPDGELTGSGRITTEIQQVGLEVLHEENFRHHYAM
TLRDWCGNLVEHWDDAVAEVGLPTAKVWGLYMAASRVAFERNNLQLHHVL
ATKVDPRGDDRLPLRPWWQP
433636825YP_007270452.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MGQVSAASTILINAEPTATLDALADYETVRPKILSPHYSEYQVLEGGKGR
GTVAKWRLQATQSRVRDVQVNVDVAGHTVIEKDVNSSMVTNWTVAPAGPG
SSVTVKTTWTGAGGVKGFFEQTFAPLGLKKIQAEVLSNLKTELEGDA
433636823YP_007270450.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MQPGGDMSALLAQAQQMQQKLLEAQQQLANSEVHGQAGGGLVKVVVKGSG
EVIGVTIDPKVVDPDDIETLQDLIVGAMRDASQQVTKMAQERLGALAGAM
RPPAPPAAPPGAPGMPGMPGMPGAPGAPPVPGI
433636821YP_007270448.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MLISRMSVRSASMSVMGDVFIGSEAITAGRLTRHELQRWYQPIFRGVYVP
RCAVPTLRDRTVGAWLATSRHGVIAGNAASALHGAQWVDDDVAIELISPT
TRPQHGLVIRRETLCDDEITRVVGLPVTTPARTAYDLGRHLSRGEAVARL
DALMRATPFSRDDVLLLTKRHAGARGVRRLRDVLPLVDGGAASPKETWLR
LLLIDAGLPVPTTQIPVVHRWRNVGVFDMGWENYVVAAEYDGDQHRSDRD
RYVKDQRRLRKLAELGWIVIRVIAEDAPTTW
433636819YP_007270446.1 Putative ligase [Mycobacterium canettii CIPT 140070017]MVTTRARLALAAGAGARWASRVTGRGAGAMIGGLVAMTLDRSILRQLGMG
RRTVVVTGTNGKSTTTRMTAAALGTLGAVATNAEGANMDAGLVAALAAHR
DAALAVLEVDEMHVPHISDAVEPAVVVLLNLSRDQLDRVGEINVIERTLR
AGLARHPDAVVVANCDDVLMTSAAYDSPNVVWVAAGSAWSNDSVSCPRSG
EVIVRNPPSQEGHWYSTGADFKRPTPHWWFDDATLYGPDGLTLPMKLALP
GSVNRGNAAQAVAAAVALGADPAVAVAAVCQVDEVAGRYRTVRIGAHEAR
ILLAKNPAGWQEALAMVDKHAAGVVIAVNGQVPDGEDLSWLWDVRFEHFE
ETRVVAAGERGTDLAVRLGYAGVEHTLVHDTMAAIASCPPGRVEVVANYT
AFLQLQRALARRG
433636817YP_007270444.1 2-isopropylmalate synthase LeuA (Alpha-Isopropylmalate Synthase) (aMPVNRYRPFAEEVEPVRLRNRTWPDRVIDRAPLWCAVDLRDGNQALIDPM
SPARKRRMFDLLVRMGYKEIEVGFPSASQTDFDFVREIIEQGAIPDDVTI
QVLTQCRPELIERTFQACSGAPRAIVHFYNSTSILQRRVVFRADRAEVQA
IATDGARKCVEQAAKYPGTLWRFEYSPESYTGTELEYAKQVCDAVGEVIA
PTPEHPIIFNLPATVEMTTPNVYADSIEWMSRNLANRESVILSLHPHNDR
GTAVAAAELGFAAGADRIEGCLFGNGERTGNVCLVTLGLNLFSRGVDPQI
DFSNIDEIRRTVEYCNQLPVHERHPYGGDLVYTAFSGSHQDAINKGLDAM
KFDADAADCDVDDMLWQVPYLPIDPRDVGRTYEAVIRVNSQSGKGGVAYI
MKTDHGLSLPRRLQIEFSQVIQKIAEGTAGEGGEVSPKEMWDAFAEEYLA
PVRPLERIRQHVDAADDDGGTTSITATVKINGVETEISGSGNGPLAAFVH
ALADVGFDVAVLDYYEHAMSAGDDAQAAAYVEASVRIASPAQPGEAGRHA
SDPVTSKTVWGVGIAPSITTASLRAVVSAVNRAAR
433636815YP_007270442.1 Aspartate-semialdehyde dehydrogenase Asd (ASA dehydrogenase) (ASADHMGLSLGIVGATGQVGQVMRTLLDERDFPASAVRFFASARSQGRKLAFRGQ
EIEVEDAETADPSGLDIALFSAGSAMSKVQAPRFAAAGVTVIDNSSAWRK
DPDVPLVVAEVNFERDVARRARSLKKGIIANPNCTTMAAMPVLKVLHDEA
RLVRLVVSSYQAVSGSGLAGVAELAEQARAVVGGAEQLVYDGGALEFPPP
NTYVAPIAFNVVPLAGSLVDDDSGETDEDQKLRFESRKILGIPDLLVSGT
CVRVPVFTGHSLSINAEFAQPLSPERARELLDGAAGVKLVDVPTPLAAAG
VDESLVGRIRRDPGVPDGRGLALFVSGDNLRKGAALNTIQIAELLTADW
433636813YP_007270440.1 Conserved protein of unknown function- proline rich protein [MycobaMTETPQPAAPPPSVATTSPPPSPQQEKPPRLYRAAAWVVIVAGIVFTVAV
IFFSGALVLGQGKCPYHRHYHHGMFRPVGPVAPGPGMGWVFGFPGGPPPP
GMGPGFPGGPGGPAVGPTGPGPTTAPARP
433636811YP_007270438.1 Glutamate-cysteine ligase GshA [Mycobacterium canettii CIPT 1400700MTLAAMTAAASQLDNAAPDDVEITDSSAAAEYIADGCLVDGPLGRVGLEM
EAHCFDPADPFRRPSWEEITEVLEWLSPLPGGSVVSVEPGGAVELSGPPA
DGVLAAIGAMTRDQAVLRSALGNAGLGLVFLGADPLRSPVRVNPGARYRA
MEQFFSASHSGVPGAAMMTSTAAIQVNLDAGPQEGWAARVRLAHALGPTM
IAIAANSPMLGGRFSGWQSTRQRVWGQMDSARCGPILGASGDHPGIDWAK
YALKAPVMMVRSPDAQDTRAVTDYVPFTDWVDGRVLLDGRRATVADLVYH
LTTLFPPVRPRQWLEIRYLDSVPDEVWPAVVFTLVTLLDDPVAADLAVDA
VEPVATAWDTAARIGLADRRLYLAANRCLAIAARRVPTELIDAMQRLVDH
VDRGVCPADDFSDRVIAGGIASAITGMMHGAS
433636809YP_007270436.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MCRHLGWLGAQVAVSSLVLDPPQGLRVQSYAPRRQKHGLMNADGWGVGFF
DGAVPRRWRSPAPLWGDTSFHSVAPALRSHCILAAVRSATVGMPIEVSAT
PPFTDGHWLLAHNGVVDRAVLPAGPAAESVCDSAILAATIFAHGLDALGD
TIVQVGAADPNARLNILAANGSRLIATTWGDTLSILRRADGVVLASEPYD
DDSGWDDVPDGHLVEVTPKGVTLTALDRAKGPR
433636807YP_007270434.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MSRAGANSPAGDSLADRWRAARPPVAGLHLDSAACSRQSFAALDAAAQHA
RHEAEVGGYVAAEAAAAVLDAGRAAVAALSGLPDAEVVFTTGSLHALDLL
LGSWPGENRTLACLPGEYGPNLAVMAAHGFDVRPLPTLQDGRVALDDAAF
MLADDPPDLVHLTVVASHRGVAQPLAMVAQLCTELKLPLVVDAAQGLGHV
DCAVGADVTYASSRKWIAGPRGVGVLAVRPELMERLRARLPAPDWMPPLT
VAQQLGFGEANVAARVGFSVALGEHLACGPQAIRARLAELGDIARTVLAD
VSGWRVVEAVDEPSAITTLAPIDGADPAAVRAWLLSQRRIVTTYAGVERA
PLELPAPVLRISPHVDNTADDLDAFAEALVAATAATSGER
433636805YP_007270432.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MRTTSPFLRCRHETCCISNVGEEVTRTTYSREHQREYRRKVRLCLDVFET
MLAQTSFEADRPLTGMEIECNLVDADYQPAMSNRYVLDAIADPAYQTELG
AYNIEFNVPPRPLPGRTCLELEEEVRASLNDAETKASCSGAHIVMIGILP
TLMPEHLTDGWMSASARYAALNESIFKARGEDIPINIAGPEPLSCHAGSI
APESACTSVQLHLQLAPTDFAANWNAAQVLAGPQLALGANSPYFFGHQLW
SETRIELFTQSTDTRPEELKSRGVRPRVWFGERWITSVLDLFQENIRYFP
TLLPEVSDEDPLAELSAGRIPHLSELRLHNGTVYRWNRPVYDVVDGRPHL
RLENRVLPAGPTVVDMLANHAFYYGALRGLSEADPPLWTQMNFAAAQANF
LAAARYGMDAQLDWPGLGEVTTRELVLGTLLPMAHEGLRRWGVDAAVRDR
FLGVIGGRAQTGRNGAHWQVATVAALQDGGLTRPAALAEMLRRYCEHMHS
NEPVHTWDT
433636803YP_007270430.1 Conserved membrane protein of unknown function with PIN domain [MycMSETFDVDVLVHATHRASPFHDKAKTLVERFLAGPGLVYLLWPVALGYLR
VVTHPTLLGAPLAPDVAVENIEQFTSRPHVRQVGEANGFWPVYRRVADPV
KPRGNLVSDAHLVALMRHHGIATIWSHDRDFRKFEGIRIRDPFAG
433636801YP_007270428.1 Conserved membrane protein of unknown function [Mycobacterium canetMSEVVTGDAVVLDVQIAQLPVRAVSAVIDITIIFIGYILGLMLWATALTQ
LDEALTTAFLIIFTVLALVGYPLVWETATRGRSVGKIVMGLRVVSDDGSP
ERFRQALFRALASVVEIWMLLGSPAVICSMLSPKAKRVGDVFAGTVVVSE
RGPRLRPPPVMPPSLAWWASSLQLSGLTAGQAEVARQFLVRAPQLDPALR
EQMAYRIAGDVVARIAPPPPPGVPPQLVLAAVLAERHRRELLRLRPTLPA
AGQAPWAQMAPHRGWPPGLSGATPWPPQQPVIPWPEPDPPPQAAPWPQQA
PDGPGFSPPG
433636799YP_007270426.1 Conserved membrane protein of unknown function [Mycobacterium canetMILTGRTGLLALICVLPIALSPWPARAFVMLLVALAVAVTVDTLLAASTR
KLRFTRSPYTSARLGQPVDASLLICNGGRRRFRGQVRDAWPPSARAQPHT
HNVDVAAGQRQQVHTALRPVRRGDQRAAMVTARSIGPLGLAGRQSSQPVP
GLVRVLPPFLSRKHLPSRLAKLREIDGLLPTLIRGQGTEFDSLREYVVGD
DVRSIDWRASARRADVMVRTWRPERDRRVVIVLDTGRMAAGRVGVDPTAA
DPAGWPRLDWSMDAALLLAALASRAGDHVDFLAHDRISRAGVFGASRSEL
LAQLVDAMAPLQPTLVESDWHAMIATILRRTRRRSLVVLLTDLNATALDE
GLLPVLPQLSARHHVLVAAVADPRVDQLAAGRSDAAAVYDAAAAERARND
RRAIASQLRRGGVDVIDAPPAEIAPGLADRYLAMKATGRL
433636797YP_007270424.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MAPASTSSTGGHALATLLGNHGVEVVVADSIADVEAAARPDSLLLVAQTQ
YLVDNALLDRLAKAPGDLLLVAPTSRTRTALTPQLRIAAASPFNSQPNCT
LREANRAGSVQWGPSDTYQATGDLVLTSCYGGALVRFRAEGRTITVVGSS
NFMTNGGLLPAGNAALAMNLAGNRPRLVWYAPDHIEGEMSSPSSLSDLIP
ENVHWTIWQLWLVVLLVALWKGRRIGPLVAEELPVVIRASETVEGRGRLY
RSRRARDRAADALRTATLQRLRPRLGVGAGAPAPAVVTTIAQRSKADPPF
VAYHLFGPAPATDNDLLQLARALDDIERQVTHS
433636795YP_007270422.1 Conserved membrane protein of unknown function [Mycobacterium canetMHKRYAPQRPKPDTETYIEKCTDRGQDGGHDERRQLLRPVSTLPPGYPVE
PPPVAPGYAPAGYPPYPATPPGYGPPGYGAPPSYGPPPGYGPPLAPGAVK
PGIIPLRPLTLSDIFNGAVGYIRANPKATLGLTAMVVVTLQIISLVALFG
PMTAFGDIVTGEPDELTGAVVGGWSASFGASLLVSWLAGVLLSGMLTVIV
GRAVFGSPITVGEAWAKVRGRLLALFGLALLEAAGVVAVLGLAVVILSGV
AAAANEAAAALLGFPLLLVVGVSLAYLYVVLLFAPVLIVLERLPIVEAIT
RSFALVRHGFWRVLGIRLLTVLVVGVVGNAIAAPFMIVGEIVTAVTASDG
SVTMRLVGATLSAIGVTIGQIVTAPFSAGVVVLLYTDRRIRAEAFDLVLQ
TGLEAGPAGGPAPVESTDNLWLTRPF
433636793YP_007270420.1 Anti-anti-Sigma factor RsfB (Anti-sigma factor antagonist) (regulatMSAPDSITVTVADHNGVAVLSIGGEIDLITAAALEEAIGEVVADNPTALV
IDLSAVEFLGSVGLKILAATSEKIGQSVKFGVVARGSVTRRPIHLMGLDK
TFRLFSTLHDALTGVRGGRIDR
433636791YP_007270418.1 Putative cytochrome P450 137A2 Cyp137A2 [Mycobacterium canettii CIPMTDPKRCASVVGVAAFAVRRVHAADALGGPPGLPAPRGFRAAFAAAYAVA
YLAGGERRMLRLIRRYGPIMTMPILSLGDVAIVSDPALAKEVFTAPTDVL
LGGEGVGPAAAIYGSGSMFVQEEPEHLRRRKLLTPPLHGAALDSYVPIIE
NSTRAAMHTWPVDRPFAMLTVARSLMLDVIVKVIFGVDDPEEVRRLGRPF
ERLLNLGVSEQLTVRYALRRLGALRVWPARARANTEIDDVVMALIAQRRT
DPRLGERHDVLSLLVSARGESGEQLSDSEIRDDLITLVLAGHETTATTLA
WAFDLLLHHPDALRCVRAEAVGGGEAFTAAVINETLRVRPPAPLTARVAA
QPLTIGGYRVEVGTRIVVHIIAINRSAEVYEHPHEFRPERFLGTRPQTYA
WVPFGGGVKRCLGASFSMRELITVLHVLLREGEFAAVDDEPERIVRRSIM
LVPRRGTRVRFCPAR
433636789YP_007270416.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MAAVLPTLIRAGAVALGSAVAGIGYASLVERNAFVLREVTMPVLTPGSTP
LRVLHISDLHMLPNQHRKQAWLRELASWEPDLVVNTGDNLAHPKAVPAVV
QTLSDLLSRPGVFVFGSNDYFGPRLKNPMNYLTSPDHRVRGAALPWQDLR
AAFTERGWLDLTHTRREFEVAGLHIAAAGVDDPHIDRDRYDTIAGPASPA
ANLRLGLTHSPEPRVLDRFAADGYQLVLAGHTHGGQLCLPLYGALVTNCG
LDRSRAKGASQWGANMRLHVSAGIGTSPFAPVRFCCRPEATLLTLIATPM
GGRDSSSNLGRSQPTVSVR
433636787YP_007270414.1 Transcriptional regulatory protein WhiB-like WhiB4 [Mycobacterium cMSGTRPAARRTNLTAAQNVVRSVDAEERIAWVSKALCRTTDPDELFVRGA
AQRKAAVICRHCPVMQECAADALDNKVEFGVWGGMTERQRRALLKQHPEV
VSWSDYLEKRKRRTGTAG
433636785YP_007270412.1 Putative anion transporter ATPase [Mycobacterium canettii CIPT 1400MVATTSSGGSSVGWPSRLSGVRLHLVTGKGGTGKSTIAAALALTLAAGGR
KVLLVEVEGRQGIAQLFDVPPLPYQELKIATAERGGQVNALAIDIEAAFL
EYLDMFYNLGIAGRAMRRIGAVEFATTIAPGLRDVLLTGKIKETVVRLDK
NKLPVYDAIVVDAPPTGRIARFLDVTKAVSDLAKGGPVHAQSEGVVKLLH
SNQTAIHLVTLLEALPVQETLEAIEELAQMQLPIGSVIVNRNIPAHLEPQ
DLAEAAKGEVDAESVRAGLLMAGVKLPDADFAGLLTETIQHATRITARAE
IAQQLDALQVPRLELPTVSDGVDLGSLYELSESLAQQGVR
433636783YP_007270410.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MSAKARLGQLGITLPQVAAPLAAYVPAVRTGNLVYTAGQLPLEAGKLVRT
GKLGADVNPEEGKTLARICALNALAAVDSLVDLDAVTRVVKVVGFVASAP
GFHGQPSVINGASDLLAEVFGDSGAHARSAVGVSELPLDAPVEVELIVEV
G
433636781YP_007270408.1 Putative transcriptional regulatory protein (Probably Crp/Fnr-familMDEILARAGIFQGVEPSAIAALTKQLQPVDFPRGHTVFAEGEPGDRLYII
ISGKVKIGRRAPDGRENLLTIMGPSDMFGELSIFDPGPRTSSATTITEVR
AVSMDRDALRSWIADRPEISEQLLRVLARRLRRTNNNLADLIFTDVPGRV
AKQLLQLAQRFGTQEGGALRVTHDLTQEEIAQLVGASRETVNKALADFAH
RGWIRLEGKSVLISDSERLARRAR
433636779YP_007270406.1 Putative endonuclease III Nth (DNA-(apurinic or apyrimidinic site) MPRRWSAETRLALVRRARRMNRALAQAFPHVYCELDFTTPLELAVATILS
AQSTDKRVNLTTPALFARYRTARDYAQADRTELESLIRPTGFYRNKAASL
IGLGQALVERFGGEVPATMDKLVTLPGVGRKTANVILGNAFGIPGITVDT
HFGRLVRRWRWTTAEDPVKVEQAVGELIERKEWTLLSHRVIFHGRRVCHA
RRPACGVCVLAKDCPSFGLGPTEPLLAAPLVQGPETDHLLALAGL
433636777YP_007270404.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MSAGGTPLQAGATPTGSPGTVALRPDAGPSWLRPLVDNVGQIPDAYRRRL
PADVLAMVTAAGAVSAMTSSRRDHREAAVLVLFSGPKAGPGDGGVPDDAD
LLLTVRASTLRHHAGQAAFPGGVVDPADDGPVATALREANEETGIDPSRL
HPLATMERTFIAPSRFHVVPVLAYSPDPGPVAVVNEAETAIVARVPVRAF
INPANRLMVYRRPHTRRWAGPAFLLNQMLVWGFTGQVISAVLDVAGWAQP
WDTGDIRELDAAMVLVDDESDPR
433636775YP_007270402.1 Putative epoxide hydrolase EphE (Epoxide Hydratase) (Arene-Oxide HyMAAPDPSMTRIAGPWRHLDVHANGIRFHVVEAVPSPQPQGPDAATPPMQP
ALARPLVILLHGFGSFWWSWRHQLCGLTGARVVAVDLRGYGGSDKPPRGY
DGWTLAGDTAGLIRALGHPSATLVGHADGGLACWTTALLHSRLVRAIALI
SSPHPAALRRSTLTRRDQRHALLPTLLRYQLPIWPERLLTRNNAAEIERL
VRARGCAKWLASEDFSQAIDHLRQAIQIPAAAHCALEYQRWAVRSQLRSE
GRRFIRAMTQQLGMPLLHLRGDADPYVLADPVERTQRYAPHGRYISIAGA
GHFSHEEAPEEVNRHLMRFLEQVHQLS
433636773YP_007270400.1 Putative protease [Mycobacterium canettii CIPT 140070017]MQTAHRRFAAAFAAVLLAVVCLPANTAAADDKLPLGGGAGIVVNGDTMCT
LTTIGHDKNGDLIGFTSAHCGGPGAQIAAEGAENAGPVGIMVAGNDGLDY
AVIKFDPAKVTPVAVFNGFAINGIGPDPSFGQIACKQGRTTGNSCGVTWG
PGESPGTLVMQVCGGPGDSGAPVTVDNLLVGMIHGAFSDNLPSCITKYIP
LHTPAVVMSINADLADINAKNRPGAGFVPVPA
433636771YP_007270398.1 Putative periplasmic dipeptide-binding lipoprotein DppA [MycobacterMVRRMRAALAALATGLLVLAPVAGCGGGVLSPDVVLVNGGEPPNPLIPTG
TNDSNGGRIIDRLFAGLMSYDAAGKPSLEVAQSIESADNVNYRITVKPGW
KFTDGSPVTAHSFVDAWNYGALSTNAQLQQHFFSPIEGFDDVAGAPGDKS
RTTMSGLRVVNDLEFTVRLKAPTIDFTLRLGHSSFYPLPDSAFRDMAAFG
RNPIGNGPYKLADGPAGPAWEHNVRIDLVPNPDYHGNRKPRNKGLRFEFY
ANLDTAYADLLSGNLDVLDTIPPSALTVYQRDLGDHATSGPAAINQTLDT
PLRLPHFGGEEGRLRRLALSAAINRPQICQQIFAGTRSPARDFTARSLPG
FDPNLPGNEVLDYDPQRARRLWAQADAISPWSGRYAIAYNADAGHRDWVD
AVANSIKNVLGIDAVAAPQPTFAGFRTQITNRTIDSAFRAGWQGDYPSMI
EFLAPLFTAGAGSNDVGYINREFDAALAAAEAAPTLTESHELVNDAQRIL
FHDMPVVPLWDYISVVGWSSQVSNVTVTWNGLPDYEHIVKA
433636769YP_007270396.1 Putative Dipeptide-transport integral membrane protein ABC transporMIAAALILLILVVAAFPSLFTAADPTYADPSQSMLAPSAAHWFGTDLQGH
DIYSRTVYGARASVTVGLGATLAVFVVGGALGALAGFYGSWIDAVVSRVT
DVFLGLPLLLAAIVLMQVMHHRTVWTVIAILALFGWPQVARIARGAVLEV
RASDYVLAAKALGLNRFQILLRHALPNAVGPVIAVATVALGIFIVTEATL
SYLGVGLPTSVVSWGGDINVAQTRLRSGSPILFYPAGALAITVLAFMMMG
DALRDALDPASRAWRA
433636767YP_007270394.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MTVDPLAPLMELPGVAAASDRVRDALSRAHRHRANLRGWRVAAAEASLRA
ARASSVLDGGPARLHDAGAPTSGKAALSDPVFAGALRVGQALEGGAGPVV
GVWQRAPLQALARLHMLAAADQVDDDRLGRPRSDADVGPRLELLADVVTR
PTLASAPVVAAVAHGELLTLRPFGCADGVVARAVSRLVTIATGLDPHGLG
VPEVIWMRQPTEYRDAARRFAGGTPDGVAGWLLLCCGAMLDGAREALSIA
ESLSPG
433636765YP_007270392.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MLTDPGLRDELDRVAAAVGVRVVHLGGRHPVSRKTWSAAAAVVLDHAAAD
RCGRLALPRRTHVSVLTGTEAATATWAAAITVGAQHVLRMPEQEGELVRE
LAEAAESARDDGICGAVVAVIGGRGGAGASLFAVALAQAAADALLVDLDP
WAGGIDLLVGGETAPGLRWPDLALQGGRLNWSAVRAALPRPRGISVLSGT
RLGYELDAGPVDAVIDAGRRGGVTVVCDLPRRLTDATQAALDAADLVVLV
SPCDVRACAAAATMAPVLTAINPNLGLVVRGPSPGGLRAAEVADVAGVPL
LASMRAQPRLAEQLEHGGLRLRRRSVLASAARRVLGVLPRAGSGRHGRAA
433636763YP_007270390.1 Conserved membrane protein of unknown function [Mycobacterium canetMSGIASAALILSLALVVLPGSPRCRLTPDDTGRRVLLVGARRVAWCVGCV
AVGAAALLPLSTVVAVAVLGATLGLRYRRRRRYLRRSREGRALEAALELV
VGELRAGAHPVRAFSIAADETGGPVAVALRAVAARARLGADVTAGLLAAA
RSSALPAYWERLAVCWQLGSDHGLAIASLMRAAQRDVAERQRFSARVSAG
MAGARASAAILAILPLLGVLLGQLIGARPLSFLLTGRVGGWLLVVGLTLA
CAGLLWSDRITDRPVL
433636761YP_007270388.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MITMFRVLVARMTALAVDESGMSTVEYAIGTIAAAAFGAILYTVVTGDSI
VSALNRIIGRALSTKV
433636759YP_007270386.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MVARHRAQAAADLASLAAAARLPSGLAAACARATLVARAMRVEHAQCRVV
DLDVVVTVEVAVAFAGVATATARAGPAKVPTTPG
433636757YP_007270384.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MRRLSEREIVTTLLMPAPLDVDDEIGGVVRRALPIPYVGGSRIQPSSVQS
V
433636755YP_007270382.1 Conserved protein of unknown function- PE-PGRS family protein PE_PGMAGPAGAGGVGGLWGAGGAGGTGGSSDSSAGGAGGAGGSGGLLGGLVGTG
GGDGGAGGDGATIGGAGGNGGNAGLLGGTGGAGGDGGLNQNTGDGGAGGA
GGKAGLLFGAGGAGGAGGAGTDKGGPGGVGGDAGLLISSGGAGGAGGFGG
NDDGGAGGAGGNASLVGSGGIGGTGGFSGTAIGGAGGTGGRAGLLAGNGG
AGGAGGESLAVGGVGGNGGNAVLIGNGGNGGNGGNGGGTSGAGGTGGLIV
GENGVNGVP
433636753YP_007270380.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MTSDTSDHRAMPIEGPPGHRRTICWSAAYRYPGSMCVGFPKILAAFRPHA
GDLVFLGDRRRLEDVRNTMALRWRPGAHQAR
433636751YP_007270378.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MTHDWLLVETLGDEPAVVARGRELKKLVPITTFLRRSPYLAAVRTAIAET
LQTGQSLTSITPKHDRVIRTEPVIMTDGRMHGVQVWSGPTDAEPPDRPIP
GPLKWDLTRGVATDTPESLTNSGKNPEVEITYGRAFAEDLPARELNPNET
QVLAMAVKAKPGKTLCSIWDLTDWQGTPIRIGFVARSALEPGPNGRDHLV
ARAMNWRAETKAPAVPVDDLAQRILIGLAQAGVHRALVDLKTWTLLKWLD
QPCSFYDWRRSAADGPRLHPDDQHVIDAMTRDLANGSASHVLRLPGHDVD
WVPVHVTVNRIELEPDTFAGLVALRLPTDEELADAGLPKATDVTT
433636749YP_007270376.1 Putative helicase [Mycobacterium canettii CIPT 140070017]MASFGSHLLAAAVAGTPPGERPLRHVAELPPQAGRPRGWPEWAEPDVVDA
FADRGISSPWSHQAEAAELAYAGRHVVIGTGPASGKSLAYQLPVLNALAT
DSRARALYLSPTKALGHDQLRAAHALAAAVPRLADVAPTAYDGDSPDEVR
RFARERSRWLFSNPDMTHLSVLRNHARWAVLLRNLRFVIVDECHYYRGVF
GSNVAMVLRRLLRLCARYSAHPTVIFASATTASPGATAADLIGQPVVEVT
EDGSPRGARTVALWEPSLRSDVIGEHGAPVRRSAGAEAARVMADLIVEGA
QTLTFVRSRRAAELTALGARARLVDIAPELSDTVASYRAGYLAEDRSALH
QALAEGRLRGLATTNALELGVDIAGLDAVVLAGFPGTVASFWQQAGRSGR
RGQGALVVLIARDDPLDTYLVHHPAALLDKPVERVVIDPVNPHLLGPQLL
CAATELPLDSAEVRSWGAVEVAESLVDDGLLRRRNGKYFPAPGVKPHAAV
DVRGAIGGQIVIVEAGTGRLLGSVGVGQAPAAAHPGAVYLHQGETYVVDS
LDFQDGIAFVHAEDPGYATFAREVTDIAVTGTGERLVFGPVALGLVPVTV
TNHVVGYLRRQLSGEVLDFVELDMPEHTLPTTAVMYTITSDALVRSGIEA
TRIPGSLHAAEHAAIGLLPLVASCDRGDIGGMSTATGPEGLPSVFVYDGY
PGGAGFAERGFRRARTWLGATAEAIEACECPSGCPSCVQSPKCGNGNDPL
DKAGAVRVLRLVLAELSEESP
433636747YP_007270374.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MSQLSFFAAESVPPAVADLSGVLAGPGQIVLVGCGARLSVVVAESWRASA
LAEMIQEAGLVPEVARTDENTPLVRTAVDPLLCGIAAEWTRGAVKTVPPR
WLPGPRELRAWTLAAGSPEADRYLLGLDPHAPDTHSPLASALMRVGIAPT
LIGTRGTRPALRISGRRRLSRLVENVGEPPDGAEASAQWPRT
433636745YP_007270372.1 Conserved membrane protein of unknown function [Mycobacterium canetMDAEAFVGFRQVPAARYGGLMATTAALPRRIHAFVRWVVRTPWPLFSLSM
LQSDIIGALFVLGFLRYGLPPQDNIQLQDLPPVNLLIFVSTVIILFLAGA
VVNLKLLMPVFRWQRRDNLLTEPDPAATELARSRALRMPLYRTLISLAVW
ATGGGVFILASWSVAKHAAPVVAVATALGATATAIIGYLQSERVLRPVAV
AALRSGVPENVNAPGVILRLMLAWIPSTGVPLLAIVLAVAADKIALLHAT
PEALFNPILMMALAALGIGSVSTLLVAMSIADPLRQLRWALSEVQRGNYN
AHMQIYDASELGLLQAGFNDMVRELSERQRLRDLFGRYVGEDVARRALER
GTELGGQERDVAVLFVDLVGSTQLAATRPPAEVVQLLNEFFRVVVETVAR
HGGFVNKFQGDAALAIFGAPIEHPDGAGAALSAARELHDELIPVLGSAEF
GIGVSAGRAIAGHIGAQARFEYTVIGDPVNEAARLTELAKLEDGHVLASA
IAVSGALDAEALCWDVGEVVELRGRAAPTQLARPMNLAAPEEVSSEVRG
433636743YP_007270370.1 Conserved protein of unknown function- putative phiRV1 phage proteiMRCWRCAGLLVDAVQQLNAAAYVNGSGTGQPTGFVSALTGTAEVVVPGVG
SEAVVAADPYALQSALPPRFQANSAFAANLTSTNVLRQEETTNGALKFPS
LQDNPADALRQADLGSLQYGVGGRCGDRHRVPAGARRLEPLHLGVEATIE
LIPHVFGPNRRPTGQRGFFCWFRTGSDVLTNEAFRVLSVATSA
433636741YP_007270368.1 Putative phage integrase (fragment) [Mycobacterium canettii CIPT 14MREQRALVIPFDPVFPTRRGTHQSEADVHTHGRTIRGEDFKWVVRHSIRK
SVVTAVERSMGLEAAAQQAG
433636739YP_007270366.1 Conserved membrane protein of unknown function [Mycobacterium canetMPAPRMPRVALVAVLLITVQLVVRAVLAFGGYFYWDDLILLGRAGTGGLL
SPSYLFDDHDGHVMPGAFLVAGAIIRVAPLVWTGPAISLVVLQLLASLAL
LRALYVISSWRPVLLIPLTFALFTPLAVPGFAWWAAALNSLPMLAALAWV
CADAILLVRTGNHRYAVTGVLVYLGGLLFFEKAAVIPFVSFAVAALQCHV
RGDRSALATVWRAGVRLWTPSLALTVGWVALYLAVVDQRRWSSDLSMTWD
LLRRSVTHGIVPALAGGPWDWARWAPASPWATPPAGVMVLGWLVLIAVLA
LSLVRKQRIGPVWLTAAGYAVACQVPIFLMRSSPFTALELAQTLRYFPDL
VVVLALLAAVALQAPNRAGTRWLDASPARAVATVVAAVLFLTSSLYSTAT
FLASWRDNPTEGYLKNAQASLAAAASGAPLLDQEVDPLVLQRVAWPENLA
SHMFALLRVRPEFATTTTQLRMFTSTGRLVDAKVTWVRTIIAGPVPQCGY
FVQPDRPERLILDGPLLPGDWTVELNYLANSDGSMALALSDGPEQKVPVH
PGLNRVYARLPGAGDAITVRANTTALSLCIAAAPVGFLAPA
433636737YP_007270364.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MTQSSSVERLVGEIDEFGYTVVEDVLDADSVAAYLADTRRLERELPTVIA
NSTTVVKGLARPGHVPVDRVDHDWVRIDNLLLHGTRYEALPVHPKLLPVI
EGVLGRDCLLSWCMTSNQLPGAVAQRLHCDDEMYPLPRPHQPLLCNALIA
LCDFTADNGATQVVPGSHRWPERPSPPYPEGKPVEIKAGDALIWNGSLWH
TAAANRTDAPRPALTINFCVGFVRQQVNQQLSIPRELVRRFEPRLQELIG
YGLYAGKMGRIDWRPPADYLDADRHPFLDAVADRLQTSVRL
433636735YP_007270362.1 Putative transferase (Possibly glycosyltransferase) [Mycobacterium MASKMDTETHYSDVWVVIPAFNEAAVIGKVVTDVRSVFDHVVCVDDGSTD
GTGDIARRSGAHLVRHPINLGQGAAIQTGIEYARKQPGAQVFATFDGDGQ
HRVKDVAAMVDRLGAGDVDVVIGTRFGRPVGKASASRPPLMKRIVLQTGA
RLSRRGRRLGLTDTNNGLRVFNKTVADGLNITMSGMSHATEFIMLIAENH
WRVAEEPVEVLYTEYSKSKGQPLLNGVNIIFDGFLRGRMPR
433636733YP_007270360.1 Conserved membrane protein of unknown function [Mycobacterium canetMSTFRIFGFSLLMTVVALVTGYLHGGPTALFLLAVLALLEVSLSFDNAII
NAAILQRMSPFWQRMFLTIGILIAVFGMRLVFPLVIIWTTAGLDPVRAME
LALRPPAHGALEFADGSPSYEKLITAAHPQIAAFGGMFLLMLFLDFVVHD
RDIKWLKWIEVPFARIGRLGQVPVIVASVGLVLAGALLTHSSDQRGTVLV
AGLLGMVTYLVVNGISRAFRPAGLDEATPGAQARQAAGKAGCALFLYLEV
LDAAFSFDGVTGAFAITTDPIIIALGLGVVGAMFVRSITIYLVRQDTLDR
YVYLEHGAHWAIGALAIILLLSIDHRFAVPEWVTASVGVVFIGAAFTESV
RRNRLTVRSPTKFGS
433636731YP_007270358.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MGPTRWRKSTHVVVGAAVLAFVAVVVAAAALVTTGGHRAGVRAPVPPPRP
PTVKAGVVPVADTAATPSAAGVTAALEVVAADPDLGKLAGRITDALTGQE
LWQRLDDVPLVPASTNKILTAAAALLTLDRQARISTRVVAGGQNPQGPVV
LVGAGDPTLSAAPPGQDTWYHGAARIGDLVEQIRRSGVTPTAVQVDASAF
SGPTMAPGWDPADIDNGDIAPIEAAMIDAGRIQPTTVNSRRSRTPALDAG
RELAKALGLDPAAVTIASAPAGARQLAVVQSAPLIQRLSQMMNASDNVMA
ECIGREVAVAINRPQSFSGAVDAVTSRLNTAHIDTAGAALVDSSGLSLDN
RLTARTLDATMQAAAGPDQPALRPLLDLLPIAGGSGTLGERFLDAATDQG
PAGWLRAKTGSLTAINSLVGVLTDRSGRVLTFAFISNEAGPNGRNAMDAL
ATKLWFCGCTT
433636729YP_007270356.1 Putative cell cycle protein MesJ (putative/cytosine deaminase-relatMDRQGAVAQLRAAAEQFARVHLDACDRWSVGLSGGPDSLALTAVAARLWP
TTALIVDHGLQPGSATVAETARIQAISLGCVDARVLCVQVGAAGGREAAA
RSARYSALEEHRDGPVLLAHTLDDQAETVLLGLGRGSGARSIAGMRPYDP
PWCRPLLGVRRSVTHAACRELGLTAWQDPHNTDRRFTRTRLRTEVLPLLE
DVLGGGVAEALARTATALREDTDLIDTIAAQALPGAAVAGSRGQELSTSA
LTALPDAVRRRVIRGWLLAGGATGLTDRQIRGVDRLVTAWRGQGGVAVGS
TLRGQRLVAGRRDGVLVLRREPV
433636727YP_007270354.1 Conserved lipoprotein of unknown function- LpqG [Mycobacterium caneMIRLVRHSIALVAAGLAAALSGCDSHNSGSLGADPRQVTVFGSGQVQGVP
DTLIADVGIQVTAADVTSAMNQTNDRQQAVIDALVGAGLDRKDIRTTRVT
VAPQYSNPEPAGTATITGYRADNDIEVKIHPTDAASRLLALVVSTGGDAT
RISSVSYSIGDDSQLVKDARARAFQDAKNRADQYAQLSGLRLGKVISISE
ASGAAPTHEAPAPPRGLSAVPLEPGQQTVGFSVTVVWELT
433636725YP_007270352.1 Conserved protein of unknown function- PPE family protein [MycobactMLDFAQLPPEVNSALMYAGPGSGPMLAAAAAWEALAAELQTTASTYDALI
TGLADGPWQGSSAASMVAAATPQVAWLRSTAGQAEQAGSQAVAAASAYEA
AFFATVPPPEIAANRALLMALLATNFLGQNTAAIAATEAQYAEMWAQDAA
AMYGYAGASAAATQLSPFNPAAQTINPAGLASQAASVGQAVSGAANAQAL
TDIPKALFGLSGIFTNEPPWLTDLGKALGLTGHTWSSDGSGLIVGGALGD
LVHGVTGSAELDASVAMDTFGKWVSPARLMVTQFKDYFGLAHDLPKWASE
GAKAAGEAAKALPAAIPAIPSAGLGGVAGAVGQAASVGGLKVPAVWTATT
PAASPAVLAASNGLGAAAAAEGSTHAFGGMPLMGSGAGRAFNNFAAPRYG
FKPTVIAQPPAGG
433636723YP_007270350.1 Conserved protein of unknown function- ESAT-6 like protein EsxN (ESMTINYQFGDVDAHGAMIRAQAASLEAEHQAIVSDVLAAGDFWGGAGSVAC
QEFITQLGRNFQVIYEQANAHGQKVQAAGNNMAQTDSAVGSSWA
433636721YP_007270348.1 Putative Epoxide Hydrolase EphA (Epopxide Hydratase) (Arene-Oxide HMGAPTERLVDTNGVRLRVVEAGDPGAPVVILAHGFPELAYSWRHQIPALA
EAGYHVLAPDQRGYGGSSRPEAIEAYDIHQLTADLVGLLDDVGAERAVWV
GHDWGAVVVWNAPLLHADRVAAIVALSVPALPRAQVPPTQAFRSTFGENF
FYILYFQEPGVADAELNGDPARTMRRMIGGLRPPGDQGAAMRMLAPGPDG
FIDRLPEPAELPAWISQEELDHYIGEFTRTGFTGGLNWYRNFDRNWETTA
DLAGKTISVPSLFIAGTADPVLTFTRTDRAAEVISGPYREVLIDGAGHWL
QQERPGEVTAALLEFLAGLELR
433636719YP_007270346.1 ESX-1 secretion-associated protein EspC [Mycobacterium canettii CIPMTENLTVQPERLGVLASHHDNAAVDASSGVEAAAGLGESVTVTHGPYCSQ
FNDTLNVYLTAHNALGSSLHTAGVDLAKSLRIAAKIYSEADEAWRKAIDG
LFT
433636717YP_007270344.1 Membrane-bound protease FtsH (Cell division protein) [MycobacteriumMNRKNVTRTITAIAVVVLLGWSFFYFSDDTRGYKPVDTSVAIAQINGDNV
KSAQIDDREQQLRLILKKGNNETDGSEKVITKYPTGYAVDLFNALSAKNA
KVSTVVNQGSILGELLVYVLPLLLLVGLFVMFSRMQGGARMGFGFGKSRA
KQLSKDMPKTTFADVAGVDEAVEELYEIKDFLQNPSRYQALGAKIPKGVL
LYGPPGTGKTLLARAVAGEAGVPFFTISGSDFVEMFVGVGASRVRDLFEQ
AKQNSPCIIFVDEIDAVGRQRGAGLGGGHDEREQTLNQLLVEMDGFGDRA
GVILIAATNRPDILDPALLRPGRFDRQIPVSNPDLAGRRAVLRVHSKGKP
MAADADLDGLAKRTVGMTGADLANVINEAALLTARENGTVITGPALEEAV
DRVIGGPRRKGRIISEQEKKITAYHEGGHTLAAWAMPDIEPIYKVTILAR
GRTGGHAVAVPEEDKGLRTRSEMIAQLVFAMGGRAAEELVFREPTTGAVS
DIEQATKIARSMVTEFGMSSKLGAVKYGSEHGDPFLGRTMGTQPDYSHEV
AREIDEEVRKLIEAAHTEAWEILTEYRDVLDTLAGELLEKETLHRPELES
IFADVEKRPRLTMFDDFGGRIPSDKPPIKTPGELAIERGEPWPQPVPEPA
FKAAIAQATQAAEAARSDAGQTGHGANGSPAGTHRSGDRQYGSTQPDYGA
PAGWHAPGWPPRSSHRPSYSGEPAPTYPGQPYPTGQADPGSDESSAEQDD
EVSRTKPAHG
433636715YP_007270342.1 Dihydropteroate synthase 1 FolP (DhpS 1) (Dihydropteroate PyrophospMSPAPVQVMGVLNVTDDSFSDGGCYLDLDDAVKHGLAMAAAGAGIVDVGG
ESSRPGATRVDPAVETSRVIPVVKELAAQGITVSIDTMRADVARAALQNG
AQMVNDVSGGRADPAMGPLLAEADVPWVLMHWRAVSADTPHVPVRYGNVV
AEVRADLLASVADAVAAGVDPARLVLDPGLGFAKTAQHNWAILHALPELV
ATGIPVLVGASRKRFLGALLAGPDGVMRPTDGRDTATAVISALAALHGAW
GVRVHDVRASVDAIKVVEAWMGAERIERDG
433636713YP_007270340.1 2-amino-4-hydroxy-6-hydroxymethyldihydropteridinepyrophosphokinase MTRVVLSVGSNLGDRLARLRSVADGLGDALIAASPIYEADPWGGVEQGQF
LNAVLIADDPTCEPREWLRRTQEFERAAGRVRGQRWGPRNLDVDLIACYQ
TSATEALVEVTARENHLTLPHPLAHLRAFVLIPWIAVDPTAQLTVAGCPR
PVTRLLAELEPADRDSVRLFRPSFDLNSRHPLSRTPES
433636711YP_007270338.1 Conserved membrane protein of unknown function- rich in alanine- arMTVLSRGARVRRGGRRPGWVLLTALLVLAIGASSALVFTDRVELLKLAVL
LALWAAVAGAFVSVLYRRQSDVDQARVRDLKLVYDLQLDREISARREYEL
TLESQLRRELASELRAQAADEVAALRAELAALRTSLEILFDADLEHRPAL
GTVEKEARAARALDGESPPADWVSSDRVMAVRGGDGASRTDEASIIDVPE
VGVPPVSGGPRHYEAPPPPQPEPLFEPRHRPPPLPPQQEPPVWQPVTSHG
QWLPAGTPGSQWASVEPETTPAAPPPGRRRRARHASPADQAYNPPAYVEL
AAQYGESGRRSRHSAEHRDHDIGGSGAGTGERPPSPPMAPPPPAEPTPRH
RTADTPPDDSGGLHARDPLTGGQSVADLMARLQVESTGGGRRRRRGE
433636709YP_007270336.1 Pantoate-beta-alanine ligase PanC (Pantothenate synthetase) (PantoaMTIPAFHPGELNVYSAPGDVADVSRALRLTGRRVMLVPTMGALHEGHLAL
VRAAKRVPGSVVVVSIFVNPMQFGAGEDLDAYPRTPDDDLAQLRAEGVEI
AFTPTTAAMYPDGLRTTVQPGPLAAELEGGPRPTHFAGVLTVVLKLLQIV
RPDRVFFGEKDYQQLVLIRQLVADFNLDVAVVGVPTVREADGLAMSSRNR
YLDPAQRAAAVALSAALTAAAHAATAGAQAALDAARAVLDAAPGVAVDYL
ELRDIGLGPMPLNGSGRLLVAARLGTTRLLDNIAIEIGTFAGTDRPDGYR
AILESHWRN
433636707YP_007270334.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MLLAIDVRNTHTVVGLLSGMKEHAKVVQQWRIRTESEVTADELALTIDGL
IGEDSERLTGTAALSTVPSVLHEVRIMLDQYWPSVPHVLIEPGVRTGIPL
LVDNPKEVGADRIVNCLAAYDRFRKAAIVVDFGSSICVDVVSAKGEFLGG
AIAPGVQVSSDAAAARSAALRRVELARPRSVVGKNTVECMQAGAVFGFAG
LVDGLVGRIREDVSGFSVDHDVAIVATGHTAPLLLPELHTVDHYDQHLTL
QGLRLVFERNLEVQRGRLKTAR
433636705YP_007270332.1 Iron-regulated protein Lsr2 [Mycobacterium canettii CIPT 140070017]MAKKVTVTLVDDFDGSGAADETVEFGLDGVTYEIDLSTKNATKLRGDLKQ
WVAAGRRVGGRRRGRSGSGRGRGAIDREQSAAIREWARRNGHNVSTRGRI
PADVIDAYHAAT
433636703YP_007270330.1 Conserved protein of unknown function- PE-PGRS family protein [MycoMSFVIAVPEFLSAAATDLANLGSTISAANAAASIPTTGVLAAGADDVSAA
IAALFGAHAQAYQTISAQAATFHAQFVQALSAGAGAYANAEAANVQRSLL
NAINAPTQALLGRPLIGDGADGTAPGQNGGAGGLLYGNGGNGAAGVNAGI
AGGSGGAAGLIGNGGSGGAGGAGAAGGSGGQGGLLYGNGGAGGNGGAATI
PGGNGGAGGAGGNAWLFGNGGAGGLGAAGAAGAAGVNPLTVPAGQGSMGN
NGEPGGPGQPGTEFGQTGGTGGTGGAGLSVGGTGGTGGNGGPGAPGGTGG
TGGAGGSGGRGGLLVGDGGAGGIGGTGGEGGIGARGGTGGQGGMGGTGQP
GVGGDAGDGGNGGIGGDGGAGGDGGAGGAGGAGGLFGVSGSSGLGGAAGS
GGNGGGGGEPGVAGSPGVGPAGRGGDGDLGQFGPEGAPGQPGQPGQPG
433636701YP_007270328.1 Conserved lipoprotein of unknown function- LpqF [Mycobacterium caneMGPARLHNRRAGRRMLVLSAAAALIVVLASGCSSAPTPSANAANHGHRID
TRTPPGLRAQQTMDMLNSDWPIGEVGVGTLAAPGQVDTVKTTMEALWWDR
PFALAGVDIGASVAALHLISSYGAQQDIRIHTDDDGWVDRFDVETQAPSI
ASWRDVDAVLSKTGARYSFQVAKVDNGRCDPVAGTNTSESLPLASIFKLY
VLHALAGAVQHNTVSWDDLLTVTAKSKAVGSSGLELPVGARVSIRTAAEK
MIANSDNMATDLLIERLGTRAIEEALASAGHHDPASMTPFPTMYELFSVG
WGKPDLRDQWKHATQQVRAQILRQTNSTPYQPDPTRAHTPASNYGAEWYG
SAEDICRVHAALRADAVGPASPVRQIMSAVPGIQLDRSVWPYIGAKAGGL
PGDLTFSWYAVDKTGQPWVVSFQLNWPRDHGPTVTGWMLQVARQVFALIA
PQ
433636699YP_007270326.1 Putative hydrolase [Mycobacterium canettii CIPT 140070017]MPRMPANLLTHRGGRGEPLVLVHGLMGRGSTWDRQLPWLTLLGAVYTYDA
PWHRGRDVADPHPISTERFVADLGDAVSALGAPTRMVGHSMGALHSWCLA
AERPELVSALVVEDMAPDFRGRTTGPWEPWLRALPVEFDSAEQVFAEFGP
VAGRYFLDAFDRTATGWRLHGCTARWIEIAAEWGTRDYWAQWRAVRSPAL
LIEAGDGVTPPGQMSEMAERDYPTTYLRVAEAGHLVHDEAPEVYRQAVES
FFAAKTA
433636697YP_007270324.1 Carbonic anhydrase [Mycobacterium canettii CIPT 140070017]MPNTNPVAAWKALKEGNERFVAGRPQHPSQSVDHRAGLAAGQKPTAVIFG
CADSRVAAEIIFDQGLGDMFVVRTAGHVIDSAVLGSIEYAVTVLNVPLIV
VLGHDSCGAVNAALAAINDGTLPGGYVRDVVERVAPSVLLGRRDGLSRVD
EFEQRHVHETVAILMARSSAILERIARGSLAIVGVTYQLDDGRAVLRDHI
GNIGEEV
433636695YP_007270322.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MHAVTRPTLREAVARLAPGTGLRDGLERILRGRTGALIVLGHDENVEAIC
DGGFSLDVRYAATRLRELCKMDGAVVLSTDGSRIVRANVQLVPDPSIPTD
ESGTRHRSAERAAIQTGYPVISVSHSMNIVTVYVRGERHVLTDSATILSR
ANQAIATLERYKTRLDEVSRQLFRAEIEDFVTLRDVMTVVQRLELVRRIG
LVIDYDVVELGTDGRQLRLQLDELLGGNDTARELIVRDYHANPEPPSTGQ
INATLDELDALSDGDLLDFTALAKVFGYPTTTEAQDSALSPRGYRAMAGI
PRLQFAHADLLVRAFGTLQGLLAASAGDLQSVDGIGAMWARHVREGLSQL
AESTISDQ
433636693YP_007270320.1 Conserved lipoprotein of unknown function- lipoprotein LpqE [MycobaMNRCNIRLRLAGMTTWVASIALLAAALSGCGAGQISQTANQEPAVNGNRL
TINNVLLRDIRIQAVQTSDFIQPGKAVDLVLVAVNQSPDVSDRLVGITSD
IGSVTVAGDARLPASGMLFVGTPDGQIVAPGPLPSNQAAKATVNLTKPIA
NGLTYNFTFKFEKAGQGSVMVPISAGLATPHE
433636691YP_007270318.1 4-diphosphocytidyl-2C-methyl-D-erythritol synthase IspD (2-C-methylMVREAGEVVAIVPAAGSGERLAVGVPKAFYQLDGQTLIERAVDGLLDSGV
VDTVVVAVPADRTDEARQILGHRAMIVAGGSNRTDTVNLALTVLSGTAEP
EFVLVHDAARALTPPALVARVVEALRDGYAAVVPVLPLSDTIKAVDANGV
VLGTPERAGLRAVQTPQGFTTDLLLRSYQRGSQDLPAAEYTDDASLVEHI
GGQVQVVDGDPLAFKITTKLDLLLAQAIVRG
433636689YP_007270316.1 Cysteinyl-tRNA synthetase [Mycobacterium canettii CIPT 140070017]MTDRARLRLHDTAAGVVRDFVPLRPGHVSIYLCGATVQGLPHIGHVRSGV
AFDILRRWLLARGYDVAFIRNVTDIEDKILAKAAAAGRPWWEWAATHERA
FAAAYDALDVLPPSAEPRATGHITQMIEMIERLIQAGHAYTGGGDVYFDV
LSYPEYGQLSGHKIDDVHQGEGVAAGKRDQRDFTLWKGEKPGEPSWPTPW
GRGRPGWHLECSAMARSYLGSEFDIHCGGMDLVFPHHENEIAQSRAAGDG
FARYWLHNGWVTMGGEKMSKSLGNVLSMPAMLQRVRPAELRYYLGSAHYR
SMLEFSETAMQDAVKAYVGLEDFLHRVRTRVGAVCPGDPTPRFAEALDDD
LSVPIALAEIHHVRAEGNRALDAGDHDGALRSASAIRAMMGILGCDPLDQ
RWESRDETSAALAAVDVLVQAELQNREKAREQRNWALADEIRGRLKRAGI
EVTDTADGPQWSLLGGDTK
433636687YP_007270314.1 Putative arsenical pump integral membrane protein ArsB2 [MycobacterMTLAVALILLAVVLGFAVARPRGWPEAAAAVPAAVILLAIGAISPQQAMA
QVSGLARVVAFLGAVLLLAKLCDDEGLFEAAGAAMARASAGSHRLLRQVF
VVSAAITAALCLDATVVLLTPVVLATVRRLRTPVRPYAYATAHLANAASL
LLPVSNLTNLLAYHGAGISFTKFTLLMALPWLSAVAAVYVVFRWFFARDL
RVVPSRQQLEPGPRMPVFVLVVVALTLGGFALAESVGLAPTWAALAGAAV
LAVRSLRRGHTSALQIVRAINVSFLVFVLALGVVVHAVMLNGMATRMSAV
LPTGSGLPTLLGIAALAAVLANVVNNLPATLVLVPLVAAGGPAAVLAVLL
GVNIGPNLTYVGSLSNLLWRGVLRRHDIEANVGEYTRLGLCTVPAALAMA
VLALWASAQVLGI
433636685YP_007270312.1 Conserved lipoprotein of unknown function- LppH [Mycobacterium caneMGKQLAALVALVGACMLAAGCTNVVDGTAVAADKSGPLHQDPIPVSVLEG
LLLDLSQINAALGATSMKVWFNAKAMWDWSKSVADKNCLAIDGPAQEKVY
AGTGWTAMRGQRLDDSIDDSKKRDHYAIQAVVGFPTAHDAEEFYSSSVQS
WSSCSNRRFVEVTPGQDDAAWTVADVVNDNGTLSSSQVQEGGDGWTCQRA
LTARNNVTIDIVTCAYSQPDLVAIGIANQIAAKVAKQ
433636683YP_007270310.1 Transcriptional regulatory protein (probably TetR-family) [MycobactMAVLAESELGSEAQRERRKRILDATMAIASKGGYEAVQMRAVADRADVAV
GTLYRYFPSKVHLLVSALGREFSRIDAKTDRSAVAGATPFQRLNFMVGKL
NRAMQRNPLLTEAMTRAYVFADASAASEVDQVEKLIDSMFARAMADGEPT
EDQYHIARVISDVWLSNLLAWLTRRASATDVSKRLDLAVRLLIGDQDSA
433636681YP_007270308.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MTRLIPGCTLVGLMLTLLPAPTSAAGSNTATTLFPVDEVTQLETHTFLEC
HPNGSCDFVAGANLRTPDGPAGFPPGLWARQTTEIRSTNRLAYLDAHATS
QFERVMKAGGSDVITTVYFGEGPPDKYQTTGVIDSTNWSTGQPMTDLNVI
VCTHMQVVYPGVNLTSPSTCAQANFS
433636679YP_007270306.1 Putative oxidoreductase. putative 3-hydroxy-9- 10-seconandrost-1-3-MTSIQQRDAQSVLAAIDDLLPEIRDRAQATEDLRRLPDETVKALDDVGFF
TLLQPQQWGGLQCDPALFFEATRRLASVCGSTGWVSSIVGVHNWHLALFD
QRAQEEVWGEDPSTRISSSYAPMGAGVVVDGGYLVNGSWNWSSGCDHASW
TFVGGPVIKDGRPVDFGSFLIPRSEYEIKDVWYVVGLRGTGSNTLVVKDI
FVPRHRFLSYKAMNDHTAGGLATNSAPVYKMPWGTMHPTTISAPIVGMAY
GAYAAHVEHQGKRVRAAFAGEKAKDDPFAKVRIAEAASDIDAAWRQLIGN
VSDEYALLAAGKEIPFELRARARRDQVRATGRSIASIDRLFEASGATALS
NEAPIQRFWRDAHAGRVHAANDPERAYVIFGNHEFGLPPGDTMV
433636677YP_007270304.1 3-4-DHSA dioxygenase [Mycobacterium canettii CIPT 140070017]MSIRSLGYLRIEATDMAAWREYGLKVLGMVEGKGAPEGALYLRMDDFPAR
LVVVPGEHDRLLEAGWECANAEGLQEIRNRLDLEGTPYKEATAAELADRR
VDEMIRFADPSGNCLEVFHGTALEHRRVVSPYGHRFVTGEQGMGHVVLST
RDDAEALHFYRDVLGFRLRDSMRLPPQMVGRPADGPPAWLRFFGCNPRHH
SLAFLPMPTSSGIVHLMVEVEQADDVGLCLDRALRRKVPMSATLGRHVND
LMLSFYMKTPGGFDIEFGCEGRQVDDRDWIARESTAVSLWGHDFTVGARG
433636675YP_007270302.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MLLLDVNVCIFAIREDSCPNHATYRTWLTGILTGDEPVGISELVLSGVIR
LLTNHRVFRQPSTTQQALDSCRALRSAPAAVALRPGPRHWGIFESLCADV
GARANAVPDAYHAALAIENGATWITTDRSFARFPGLRWRLPLS
433636673YP_007270300.1 Conserved protein of unknown function- YrbE family [Mycobacterium cMSSVVDSDARRRAVGDGPRVAGIRRYGRRLAAAVGTPWRSVLRQGDESLR
TLGRFFELAGQSVGYLITDLVRWRHPWRETLNQASFIVGVTAIPALLISV
PFGVIVAVQVGSLIQQVGATSISGAAGGLGVIRQAAPIVAALLLGGAAGA
AIATDLGARSIRDEVDALRVMGIDPVQRLVTPRLAAIILVSPPLCVFIVF
MGLAAGYVINVGFQSGTPGSYMASFGSFASIADVVVALLKTWLFGVIVTL
IACQRGLETKGGPRGVADAVNAAVVLGVVTVFVLNLVITEFVTLFMPAKV
G
433636671YP_007270298.1 Conserved protein of unknown function- putative Mce family protein MRTPSSAALRIRGLIVAAVLAVVVTTLVQAARGTYDDTFRLTVVAATVGE
GLAPGAEVKFRGLAIGSVKTLESTGYNQQTMTVLLDARQAKALTVDTIAR
FTSSNVFGSAAVELVSEGKGPPLPPNQTLVLGTDVRAASVTRLLRRGQRL
SRILNTPEFEHVIETLRRHADLVEPAARAGVDLARIMADSQTIPVSRSLS
VLASFLNGVAGALPALGRVPDLLDALDPLAAPGGVDRTNLVMRQTGQLLR
DAGQISVRHNPWLRQLVGAIMNVEIPAMFAVGSLAPAYDRLPGLIDRTGA
AFPVVDGDVRMRTEVIMDGGP
433636669YP_007270296.1 Conserved protein of unknown function- putative Mce family protein MILRGYHRVLDERAAAARSRRHGIIGILAIVVVLATAGVAYLNPTGQASY
TAHAGTSGGLRAGDEVRVAGVPVGRVTGVRLHGTLVEIKFDVKKSVVVGT
LSTLEIKLLTPVGGHYVSLDPQGNAPLGSNVIPLQRVKSPYEASDMLQEV
TPFLKEVDGQVIHDTFTELADAATKHPNALRDILRSAHELTGLLRKMTGD
LRRGLDFANDATGALVAGRKQLAALVEQFALVGQRYTSKSVDIVEFFTLL
AELTRIVDRVMVFYDREVAQSVNDIDDIVDALVRHPDRVGRAVEGLGQIL
NTVGPMLSGNGIVLDESRRLVPGQDLCLPNIMRRC
433636667YP_007270294.1 Conserved protein of unknown function- putative Mce family protein MTRRWTVALLGALAVSLAAAGLGSSSLDPTRLPVPGSYVPGDKYTIKIEF
ASVLNLPARAKVDLGGVRVGVLDRVRLVGTTAVAYVDIARGVKLPQNTRA
ELRQTTVLGDIYIALMPPESPAPASLRDGDTIPLRNTVPADNVEDILGGL
SNLVSGGTLNTLQEAVVNFNKAFPKDPAEQDRIRRKLATVLRDLAANQDA
LDEILCSAENVSEGLISNAGVFDRMITEGPDKLQAMASVLPDIIQLLVDV
QDLGRSGGELVVPNTPDFIQILSYITPLVDTVATADTTVPVVADKLIGLI
RDKLIPFFANGGPKFSVSEVHPPRGDAGVDPADKADQAISAMRTMGMLP
433636665YP_007270292.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MSIDTIDETEVATTEVERDDEGTKDRPRRTWLRVPRLRPSRPWRWVSVLA
LAAVIGGGVFGFVKYSSVVDELAALRQAESDRDAAVRLAKEYALKSLTYS
FEDPNAFFRSVEDGVSQTLKDKYVNATDLLTGIMLQAQVSSSGEVLATDA
VAQPGQVYQVVVSAAQTTRNLQNPKPRVSLILLQVTVNKVGDGWQVSDIG
PKTAGHAGNVDQFAPPEPAPAPAPRR
433636663YP_007270290.1 Conserved protein of unknown function- possible PIN family toxin-anMIYLLDTSALVRLLSNEKLQQAWYDAIDADAIGSCFPQRAEFLFSARDRV
EYDEIAEMYSDLYPDVAVPKRADRWVEATQYRMSRAGEHRSASAIDLIIA
ATAAHYGLTVLHDDNDFATVARHAPELGQHNIYDIT
433636661YP_007270288.1 Putative aspartate aminotransferase AspB (Transaminase A) (ASPAT) (MTDRVALRAGVPPFYVMDVWLAAAERQRTHGDLVNLSAGQPSAGAPEPVR
AAAAAALHLNQLGYSVALGIPELRDAIAANYQRRYGVSVEPDAVVITTGS
SGGFLLAFLACFDAGDRVAMASPGYPCYRNILSALGCEVVEIPCGPQTRF
QPTAQMLAEIDPPLHGVVVASPANPTGTVIPPEELAAIASWCDASDVRLI
SDEVYHGLVYEGAPPTSCAWQTSRNAVVVNSFSKYYAMTGWRLGWLLVPP
ELRRAVDCLTGNFTICPPVLSQIAAVSAFTPEATAEADGNLASYAINRSL
LLDGLRRIGIDRLAPTDGAFYVYADVSDFTSDSLAFCSKLLADTGVAIAP
GIDFDTARGGSFVRMSFAGPSGDIEEALRRIGCWLPSQ
433636659YP_007270286.1 Putative acyl-CoA dehydrogenase FadE32 [Mycobacterium canettii CIPTMTMEFALNEQQRDFAASIDAALGAADLPGVVRAWAAGDVAPGRKVWQQLA
NLGVTALGVAEKFDGLGASPVDLVVALERLGRWCVPGPVAESIAVAPVLL
AGADHAERCAGLASGELIATVAMPPQVPRAVDVDIAGLVLLATDQGVTEA
EAGEGHNSVDPSRRLWDVTASGQAWRAPKDVVERAYEFGALATAAQLVGA
GQALLDTAVDYAKQRTQFGRVIGSYQAIKHKLADVHIAIELARPLVYGAA
LSLEPRDVSAAKAAASEAGLLAARSALQTHGAIGFTQEHDLSLWLLRVQA
LHSAWGTPQEHRRRVLEAL
433636657YP_007270284.1 Putative fatty-acid-CoA ligase FadD3 (fatty-acid-CoA synthetase) (fMPAALDRLARLFPDHDALIAEDRRFTSTELRDAVYRAAAALIALGVEPGD
RVAIWSPNTWHWVVACLAIHHAGAAVVPLNTRYTATEATDILARAGAPVL
FAAGLFLGVDRAAGLDRAALPALRHVVRVPVEADDGTWDEFIATGAGALD
AVPARAAAVTPHDVSDILFTSGTTGRSKGVLCAHRQSLSASASWAAIGKI
TSDDRYLCINPFFHNFGYKAGILACLQTGATLIPHVTFDPLRALQAIERH
RITVLPGPPTIYQSLLDHPARNNYDLSSLRFAVTGAATVPVVLVERMQSE
LDIDIVLTAYGLTEANGMGTMCRPEDDAVTVATTCGRPFADFELRIADSG
EVLLRGPNVMVGYLDDPEATAAAIDADGWLHTGDIGAVDQAGNLRITDRL
KDMYICGGFNVYPAEVEQVLARMDGVADAAVIGVPDQRLGEVGRAFVVAR
PGAGLDEASVIAYTREHLANFKTPRSVRFVDVLPRNAAGKVSKPQLRELA
433636655YP_007270282.1 Putative oxidoreductase [Mycobacterium canettii CIPT 140070017]MNLSVAPNEIAGHGLLDGKVVVVTAAAGTGIGSATARRALAEGADVVISD
HHERRLGETAAELSALGLGRVEHVVCDVTSTAQVDALIDSTTARMGRLDV
LVNNAGLGGQTPVADMTDDEWDRVLDVSLTSVFRATRAALRYFRDAPHGG
VIVNNASVLGWRAQHSQSHYAAAKAGVMALTRCSAIEAAEYGVRINAVSP
SIARHKFLDKTTSAELLDRLAAGEAFGRAAEPWEVAATIAFLASDYSSYL
TGEVISVSSQHP
433636653YP_007270280.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MTSRAEITSKYAKAYVKASKKDRGRILDQVVEVTGWSRDNARRRLTAAAK
SPPGAGRSIVKRPRKPRSPKYSYDALKVLQRVWAASGGQCGKYLAASMVL
QLDGLERHGELEFGRDRYGSKVREELLAMSAASIDRYLKTAKAKDQISGV
STTKPSPLLRNSIKVRKAGDEVEAEPGFFEGDTVAHCGPTLKGEFARTLN
LTDVHIGWVFTRTVRNNAHTHILAGLEASVIEIPYGITGLDFDNGTEFLN
KPVIGWAGDNGIYFTRSRPYKKNDQATIESKNNHLVRKYAFYYRYDTAEE
RAVLNRMWKLVNDRLNYLTPTIKPIGYASSADGRRRRLYDAPQTPLDRLL
AAGVLSPAQQADLIAYRDSLNPAQIGRQIADLQNRLLILAQEKTEQLYLA
NIPTALPDIRKGIRIKAG
433636651YP_007270278.1 Conserved protein of unknown function- PPE family protein PPE62 [MyMAHFSVLPPEINSLRMYLGAGSAPMLQAAAAWDGLAAELGTAASSFSSVT
TGLAGQAWQGPASAAMAAAAAPYAGFLTTASAQAQVAAGQAKAVASVFEA
AKAAIVPPAAVAANREAFVALIRSNWLGLNAPWIAAVESLYEEYWAADVA
AMTGYHAGASQAAAQLPLPAGLQQFLNTLPNLGIGNQGNANLGSGNTGSG
NVGDGNTGSSNLGGGNIGDRNIGSGNIGSDNFGSGNFGAGNIGFGNNGNL
LALGHNVGMGNAGSNNMGFGNTGDFNTGGGNTGNGNIGGGNTGNNNFGFG
NTGNGNIGIGLTGNNQMGINLAGLLNSGNGNIGIGNSGTNNIGLFNSGSG
NIGIFNTGTNNPVLGDINNFGFGNSGAANHGFGNSGLLNTGFGNTGQVNT
GFGNSGVENTGYGNAGDFNTGFDNSGKTNTGDGNSGNTNTGSWNSGNVNT
GFGIITDSGLTNSGFNNTGTGVSGFFNTPSGPGAMNVSGFFNTASGGAAI
NGQVSGIGNTGVPGILGPTISGVDSGLFNMGSGISGLFNLRQLLG
433636649YP_007270276.1 Putative Acetyl-CoA Acetyltransferase FadA6 (Acetoacetyl-CoA ThiolaMTEAYVIDAVRTAVGKRGGALAGIHPVDLGALAWRGLLDRTDIDPAAVDD
VIAGCVDAIGGQAGNIARLSWLAAGYPEEVPGVTVDRQCGSSQQAISFGA
QAIMSGTADVIVAGGVQNMSQIPISSAMTVGEQFGFTSPTNESRQWLHRY
GDQEISQFRGSELIAEKWNLSREEMERYSLTSHERAFAAIRAGHFENEIL
TVETESGPFRVDEGPRESSLEKMAGLQPLVEGGRLTAAMASQISDGASAV
LLASERAVKDHGLRPRARIHHVSARAADPVFMLTGPIPATRYALDKTGLA
IDDIDTVEINEAFAPVVMAWLKEIKADPAKVNPNGGAIALGHPLGATGAK
LFTTMLGELERVGGRYGLQTMCEGGGTANVTIIERL
433636647YP_007270274.1 Putative electron transfer protein FdxB [Mycobacterium canettii CIPMTDACQAEYAIAAMSTVEMDQAAPESAAHHPLPDPGESVPRLALPTIGIF
LATLTAFVGSTTAYISGWIPFWVTIPVNAAVTFVMFTVVHDASHYSISSI
RWVNGLFGRLAWLFVGPVVAFPAFGYIHIQHHRHSNDDEQDPDTFASRGS
LWVLPLRWSMVEYFYIKYYLPRGRSRPVTEVAETLVMMTLFLTGLIVAIV
TGNFWTLAIVFLIPQRIGLTVLAWWFDWLPHHGLEDTQRSNRYRATRNRV
GAEWLFTPVLLSQNYHLVHHLHPSVPFYRYLRTWRRNEEAYLERNAAIST
VFGQQLNPDEYRQWKELNGRLAKLLPVRMPARSSSPHAVLHRIPVASVDP
ITADATLVTFAVPEALRDAFRFEPGQHVTVRTDLGGQGIRRNYSICAPAT
RAQLRIAVKHIPGGAFSTFVANELKAGDVLELMTPTGRFGTPLNPLHRKH
YVGLVAGSGITPVLSILATTLEIETESRFTLIYGNRTKESTMFRAELDRL
ESRYADRLEILHVLSSEPLHTPELRGRIDRDKLTRWLTSSLRPAGVDEWF
ICGPLAMTTTVRETLIEHGVDSERIHLELFYGFDTPPATRPSYAGATVTF
TLSGQRATFDLVPGDSILEGALGLRSDAPYACMGGACGTCRAKLIEGNVE
MDHNFALDRAELDAGYILTCQSHPTTPFVAVDYDA
433636645YP_007270272.1 Putative CoA-transferase subunit beta [Mycobacterium canettii CIPT MSTRAEVCAVACAELFRDAGEIMISPMTNMASVGARLARLTFAPDILLTD
GEAQLLADTPALGKTGAPNRIEGWMPFGRVFETLAWGRRHVVMGANQLDR
YGNQNISAFGPLQHPTRQMFGVRGSPGNTINHATSYWVGNHCKRVFVEAV
DVVSGIGYDKVDPDNPAFRFVNVYRVVSNLGVFDFGGPDHSMRAVSLHPG
VTPGDVRDATSFEVHDLDAAEQTRLPTDDELRLIREVIDPKALRDRELRA
433636643YP_007270270.1 Putative Enoyl-CoA Hydratase EchA20 (Enoyl Hydrase) (Unsaturated AcMPITSTTPEPGIVAVTVDYPPVNAIPSKAWFDLADAVTAAGADLDTRAVI
LRAKGRGFNAGVDIKEMQRTEGFTALIDANRGCFAAFRAVYECAVPVIAA
VNGFCVGGGIGLVGNSDVIVASEDATFGLPEVERGALGAATHLSRLVPQH
LMRRLFFTAATVDAATLQHFGSVHEVVPRDQLDEAALRVARDIAAKDTRV
IRAAKEALNLIDVQRVNASYRMEQGFTFELNLAGVADEHRDAFVKKS
433636641YP_007270268.1 Putative short-chain type Dehydrogenase/Reductase [Mycobacterium caMGLVDGRVVIVTGAGGGIGRAHALAFAAEGARVVVNDIGVGLDGSPASGG
SAAQGVVDEILAAGGQAVADGSDISDWDQAADLIQVAVETFGGVDVLVNN
AGIVRDRMIANTSEEEFDAVIAVHLKGHFATMRHAASYWRGLSKAGKAPK
DIDARIINTSSGAGLQGSVGQGNYSAAKAGIAALTLVGAAEMGRYGVTVN
AIAPAARTRMTETVFAEMMAKPQEGFDAMAPENVSPLVVWLGSAESRDVT
GKVFEVEGGIIRVAEGWAHGPQVDKGAKWDPAELGPVVSDLLAKSRPPVP
VYGA
433636639YP_007270266.1 Putative acetyl-CoA acetyltransferase FadA5 (acetoacetyl-CoA thiolaMGNPVIVEATRSPIGKRNGWLSGLHATELLGAVQKAVVDKAGIQSGLHAG
DVEQVIGGCVTQFGEQSNNISRVAWLTAGLPEHVGATTVDCQCGSGQQAN
HLVAGLIAIGAIDVGIACGIEAMSRVGLGANAGPDRSLIRAQSWDIDLPN
QFEAAERIAKRRGITREDVDVFGLESQRRAQRAWAEGRFDREISPIQAPV
LDEQKQPTGERHLVSRDQGLRETTMAGLSELKPVLEGGIHTAGTSSQISD
GAAAVLWMDENKARALGLTPRARIVAQALVGAEPYYHLDGPVQSTAKVLE
KAGMKIGDIDIVEINEAFASVVLSWARVHEPDMDRVNVNGGAIALGHPVG
CTGSRLITTALHELERTDQSLALITMCAGGALSTGTIIERI
433636637YP_007270264.1 Putative FadE28-like Acyl-CoA dehydrogenase [Mycobacterium canettiiMDFDPTAEQQAVADVVTSVLERDISWEALVCGGVTALPVPERLGGDGVGL
FEVGALLTEVGRHGAVTPALATLGLGMVPLLELASGEQQDRYLARVAEGG
VLTAALNEPGAALPDRPATRFVGGRLSGTKVGVGYAEQADRMLVTADNAV
VVVSPTADGVRLVRTPASNGSDEYTVTLDDVVVPDSDVLAGATVRRVNQL
VLAMIGAYADGLVAGALRLTADYVGSRKQFGKPLSTFQTVAAQLAEVYIA
SRTIDLAAKSVIWRLAEDLDAGDDLGVLGYWVTSQAPPAMQICHHLHGGM
GMDVSYPMHRYYSTIKDLTRLLGGPSHRLELLGARCSST
433636635YP_007270262.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MTGVSDIQEAVAQIKAAGPSKPRLARDPVNQPMINNWVEAIGDRNPIYVD
DAAARAAGHPGIVAPPAMIQVWTMMGLGGVRPKDDPLGPIIKLFDDAGYI
GVVATNCEQTYHRYLLPGEHVSISAELGDVVGPKQTALGEGWFINQHIVW
QVGDEDVAEMNWRILKFKPAGSASSVPEDLDPDAMMRPASSRDTAFFWDG
VKAHELRIQRLADGSLRHPPVPAVWQDKSAPIEYVVSSGRGTVFSFVVHH
APKVPGRSLPFVVALVELEEGVRMLGELRGADQARVAIGMPVRATYIDFP
DWSLYAWEPDE
433636633YP_007270260.1 Putative Lipid transfer protein or keto acyl-CoA thiolase ltp22 [MyMLSGQAAIVGIGATDFSKNSGRSELRLAAEAVLDALADAGLSPTDVDGLT
TFTMDTNTEIAVARAAGIGELTFFSKIHYGGGAACATVQHAAMAVATGVA
DVVVAYRAFNERSGMRFGQVQARLAGHADAQADSTSVDNSFSYPHGLSTP
AAQVAMIARRYMHLSGATSRDFGAVSVADRKHAANNPKAYFYGKPITIED
HQNSRWIAEPLRLLDCCQETDGAVAIVVTSAARARDLKQRPVVIEAAAQG
CSPDQYTMVSYYRPELDGLPEMGLVGRQLWAQSGLTPADVQTAVLYDHFT
PFTLIQLEELGFCGKGEAKDFIADGAIEVGGRLPINTHGGQLGEAYIHGM
NGIAEGVRQLRGTSVNPVAGVEHVLVTAGTGVPTSGLILG
433636631YP_007270258.1 Putative dehydrogenase. Putative 2-enoyl acyl-CoA hydratase [MycobaMPIDLDVALGAQLPPVEFSWTSTDVQLYQLGLGAGSDPMNPRELSYLADD
TPQVLPTFGNVAATFHLTTPPTVQFPGIDIELSKVLHASERVEVPAPLPP
SGSARAVTRFTDIWDKGKAAVICSETTATTPDGLLLWTQKRSIYARGEGG
FGGKRGPSGSDVAPERAPDLQVAMPILPQQALLYRLCGDRNPLHSDPEFA
AAAGFPRPILHGLCTYGMTCKAIVDALLDSDATAVAGYGARFAGVAYPGE
TLTVNVWKDGRRLVASVVAPTRDNAVVLSGVELVPA
433636629YP_007270256.1 2-keto-4-pentenoate hydratase [Mycobacterium canettii CIPT 14007001MLRDATRDELAADLAQAERSRDPIGQLTAAHPEIDVVDAYEIQLINIRQR
VAEGARVVGHKVGLSSPIMQQMMGVDEPDYGHLLDDMQVFEDTPVQASRY
LSPRVEVEVGFILAADLPGAGCTEDDVLAATEALVPAIELIDTRIKDWQI
KICDTIADNASAAGFVLGAARVPPADLDVRAIDAKLTRNGEVVAEGRSDA
VLGNPATAVAWLAGKVESFGVRLRKGDIVLPGSCTFAVEARAGDEFVADF
TGLGLVRLSFE
433636627YP_007270254.1 Putative 4-hydroxy-2-oxovalerate aldolase (HOA) [Mycobacterium caneMTDMWDVRITDTSLRDGSHHKRHQFTKDEVAAIVAALDAAGVPVIEVTHG
DGLGGSSFNYGFSKTPEQELIKLAAQTANEARIAFLMLPGVGTKDDIKEA
QDNGGSICRIATHCTEADVSIQHFGLARELGLETVGFLMMAHTIAPEKLA
AQARIMADAGCQCVYVVDSAGALVLDGVADRVSALVAELGEDAQVGFHGH
ENLGLGVANSVAAVRAGAKQIDGSCRRFGAGAGNAPVEALIGVFDKIGVK
TGIDFFDIADAAEDVVRPAMPAECLLDRNALIMGYSGVYSSFLKHAVRQA
ERYGVPASALLHRAGQRKLIGGQEDQLIDIALEIKRELDSGAAVTH
433636625YP_007270252.1 Conserved protein of unknown function- PPE family [Mycobacterium caMFMDFAMLPPEVNSTRMYSGPGAGSLWAAAAAWDQVSAELQSAAETYRSV
IASLTGWQWLGPSSVRMGAAVTPYVEWLTTTAAQARQTATQITAAATGFE
QAFAMTVPPPAIMANRAQVLSLIATNFFGQNTAAIAALETQYAEMWEQDA
TAMYDYAATSAAARTLTPFTSPQQDTNSAGLPAQSAEVSRATANAGAADG
NWLGNLLEEIGILLLPIAPELTPFFLEAGEIVNAIPFPSIVGDEFCLLDG
LLAWYATIGSINNINSMGTGIIGAEKNLGILPELGSAAAAAAPPPADIAP
AFLAPLTSMAKSLSDGALRGPGEVSAAMRGAGTIGQMSVPPAWKAPAVTT
VRAFDATPMTTLPGGDAPAAGVPGLPGMPASGAGRAGVVPRYGVRLTVMT
RPLSGG
433636623YP_007270250.1 Putative oxidoreductase [Mycobacterium canettii CIPT 140070017]MTGMLKRKVIVVSGVGPGLGTTLAHRCARDGADLVLAARNAERLDDVAKQ
IIDTGRRAVAVRTDITDDDDVSNLVQATLAAYGKADVLINNAFRVPSMKP
LAGTTFEHIRDAIELSALGTLRLIQAFTPTLAQSHGAIVNVNSMVIRHSQ
PKYGAYKMAKSVLLAMSHSLATELGEQGIRVNSVAPGYIWGDTLKGYFEH
QAGKYGTTVDQIYQATAANSDLKRLPTEDEVASAILFLASDLASGITGQT
LDVNCGEYHT
433636621YP_007270248.1 Protein of unknown function- possible transposase [Mycobacterium caMTTSTNHKPADPVGADLLRLLKTVKLGALADTLPERAALARQHQLSHIGF
LETLLADEVSRRESRSAALRAAKAGLDPTMSFRHVECVGRPAL
433636619YP_007270246.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MPDDQPAVPDVDRLARSMLLLHGDHHDHNDSPEQHRTCGSWSKSRNFADD
PQRAAAVREASRAERDRYLTSGLQPVDCRFCHVTVTVKRLGPGHTAVQWN
TEASRRCAYFTELRARGGDSARTRACPRLTDSIEHAVAEGYLEHHDPNR
433636617YP_007270244.1 Putative siderophore-binding protein [Mycobacterium canettii CIPT 1MPLFSFEGRSPRIDPTAFVAPTATLIGDVTIEAGASVWFNAVLRGDYAPV
VVREGANVQDGAVLHAPPGIPVDIGPGATVAHLCVIHGVHVGSEALIANH
ATVLDGAVIGARCMIAAGALVVAGTQIPAGMLVTGAPAKVKGPIEGTGAE
MWVNVNPQAYRDLAARHLAGLEPM
433636615YP_007270242.1 Putative lipid carrier protein or Keto acyl-CoA thiolase Ltp3 [MycoMAGKLAAVLGTGQTKYVAKRQDVSMNGLVREAIDRALADSGSTFDDIDAV
VVGKAPDFFEGVMMPELFMADAMGATGKPLIRVHTAGSVGGSTGVVAASL
VQSGKYRRVLALAWEKQSESNAMWALSIPVPFTKPVGAGAGGYFAPHVRA
YIRRSGAPAHIGAMVAVKDRLNGSRNPLAHLQQPDITLEKVMASQMLWDP
IRFDETCPSSDGACAVVVGDEEIADARLAQGHPVAWIHGTALRTEPLAFA
GRDQVNPQAGRDAAAALWNAAGITSPIDEIDAAEIYVPFSWFEPMWLENL
GFAREGEGWKLTEAGETAIGGRLPVNPSGGVLSANPIGASGLIRFAEAAI
QVMGKAEAHQVPGARKALGHAYGGGSQYFSMWVVSCEKPKQTAA
433636613YP_007270240.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MGPTLSRFFTALRARRIVGVRGSDGRVHVPPVEYDPVTYKPLSEMVPVSS
VGTVASWTWQPEPLAGQPLDRPFAWALIKLDGADTLLMHAVDVRTAGPSA
IHTGARVHAHWADQPVGAITDIACFALGETAEPVAAHKTEDARDPVTMIV
TPIQLEIQHTASHEESAYLRAIAQGKLVGARTGKTGKVYFPPHGADPATG
KPTTEFVELPDKGTVTTFAIVNIPFLGQRIKPPYVAAYVLLDGADIPFLH
LVSDVDAHQVRMGMRVEAVWKPRERWGLGIDNIEYFRPTGEPDADYDTYK
HHL
433636611YP_007270238.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MSVSQHTIAGTVLTMPVHIRTANLHSAMFSVPADPAQRLIDYSGLRVCEY
LPGKAIVMQMLVRYVDGDLGRYHEYGTAIMVNPPGTQRRGPRALTRAAAF
IHHLPVDQVFTLEAGRTIWGFPKIMADFNVTDGRRFGFDVSADGRLIAGI
EFSTGLPVPTLGWQMLKTYSHHDGVTREIPWEMKVSGLRARLGGARLRLG
DHPYAKELASLGLPKRALLSQSAANVEMTFGDGHPI
433636609YP_007270236.1 Putative Enoyl-CoA hydratase EchA19 (Enoyl Hydrase) (Unsaturated acMESGPDALVERRGHTLIVTMNRPAARNALSTEMMRIMVQAWDRVDNDPDI
RCCILTGAGGYFCAGMDLKAATQKPPGDSFKDGSYDPSRIDALLKGRRLT
KPLIAAVEGPAIAGGTEILQGTDIRVAGESAKFGISEAKWSLYPMGGSAV
RLVRQIPYTLACDLLLTGRHITAAEAKEMGLIGHVVPDGQALTKALEIAD
AISANGPLAVQAILRSIRETEGMPENEAFKIDTQIGIKVFLSDDAKEGPR
AFAEKRAPNFQNR
433636607YP_007270234.1 Conserved protein of unknown function- PE-PGRS family protein (PE-PMPAGTAARRARTGTGGDGGLTGTGGTGGSGGTGGDGGNGGNGADNTANMT
AQESGDGGNGGDGGFGGGAGAGGGGLTAGANGTGGQGGAGGDGGNGGIGG
HGPLTDDPGGNGGTGGNGGTGGTGGAGIGSLGGGTGGDGGNGGNGGTGGE
GGEMGGAGGTGGAAGNGGDGGNGGTGGGDGGAGGTGGTGGTGGLGDPRLG
GSGGDGGTGGSGGAAGNGGNGGNAGAGGNGNGGTGGAGGIGGNGGNGGDA
EPGVPPGAGGAGGAGTTGGKGGTGGNGSGTGSGGTGGDGGTGGGGGNGGT
GWNGGKGDTGSGGGAGDDGKAPAGGTGGAGGDGGAGGKGGSGGV
433636605YP_007270232.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MTIDVWMQHPTQRFLHGDMFASLRRWTGGSIPETDIPIEATVSSMDAGGV
TLGLLSAWRGPNGQDLISNDAVAEWVRLYPNRFAGLAAVDLDRPMAAVRE
LRRRVGEGFVGLRVVPWLWGAPPTDRRYYPLFAECVQSAVPFCTQVGHTG
PLRPSETGRPIPYIDQVALDFPELVIVCGHVGYPWTEEMVAVARKHENVY
IDTSAYTIKRLPGKLVRFMKTDTGQRKVLFGTNYPMIAHTHALTGLDELG
LSDEARRDFLYGNAVRVFKLDPRGKVQT
433636603YP_007270230.1 Conserved protein of unknown function PE-PGRS family protein PE_PGRMAPAGPAGKAGSSGAGGTNGSGGAGGTGGQGGMGGAGGAGADNPTGIGGT
GGTGGTGGAAGAGGAGGAIGTGGTGGAVGSVGNAGIGGTGGTGGVGGAGA
AGADAAAGSSATGGAGFAGGAGGEGGAGGNSGVGGTNGSGGTGGAGGKGG
TGGAGGSGADNPTGAGFAGGAGGTGGAAGAGGAGGATGAGGTGGVLGATG
SAGIGGDGGRGGDGGDGASGLGLGLSGFDGGPGGQGGAGGSAGAGGINGA
GGAGGDGRYGGDGATGAAGLGDNGGVGGDGGAGGAAGNGGNAGVGLTAKA
GDGGAAGNGGNGGAGGAGGAGDNNFNGGQGGAGGQGGQGGLGGASTTSIN
ANGGVGGNGGTGGDGGAGGAGTLGVGGSGGTGGDGGDAGAGGGGGFGGAA
GKAGIGGDGGRGGDGGDGASGLGLGLSGFDGGQGGQGGAGGSAGAGGING
AGGAGGDGGDGGDGATGAAGLGDNGGVGGDGGAGGAAGNGGNAGVGLTAK
AGDGGAAGNGGNGGAGGAGGAGDNNFNGGQGGAGGQGGQGGLGGASTTSI
NANGGVGGNGGTGGDGGAGGAGTLGVGGSGGTGGDGGDAGAGGGGGFGGA
AGKAGGGGNGGVGGNGGEGASGLGLGLSGFDGGQGGQGGAGGNAGAGGIN
GAGGAGGTGGDGGDGAPATLIGGPDGGDGGQGGIGGAGGNAGFGAGDPGD
GGVGGTGGAGGNGGAGADGDPSIDGGQGGAGGHGGQGGQGGLNSTGLTSA
ASGDGGAGGIGGAGGHGGDGDGFIGGSGGTGGVGGDAGVGGLANTGGTAG
NAGIGGAGGAGGDGGAGDSGALSQDGNGFAGGQGGQGGAGGNAGAGGING
AGGAGGTGGDGGDGAPATLIGGPDGGDGGQGGIGGAGGNAGFGAGDPGDG
GVGGTGGAGGNGGAGADGDPSIDGGQGGAGGHGGQGGQGGLNSTGLTSAA
SGDGGAGGIGGAGGHGGDGDGFIGGSGGTGGVGGDAGVGGLANTGGTAGN
AGIGGAGGAGGDGGAGDSGALSQDGNGFAGGQGGQGGAGGNAGTGGINGA
GGAGGTGGDGGDGAPATLIGGPDGGDGGQGGIGGAGGNAGFGAGDPGDGG
VGGTGGAGGNGGAGADGDPSIDGGQGGAGGHGGQGGQGGLNSTGLTSAAS
GDGGNGGIGGAGGHGGDGDGFIGGSGGTGGVGGDAGVGGLANTGGTAGNA
GIGGAGGAGGDGGAGDSGALSQDGNGFAGGQGGQGGAGGNAGTGGINGAG
GAGGTGGDGGDGAPATLIGGPDGGDGGQGGIGGAGGNAGFGAGDPGDGGV
GGTGGAGGNGGAGADGDPSIDGGQGGAGGHGGQGGQGGLNSTGLTSAASG
DGGNGGIGGAGGHGGDGDGFIGGSGGTGGVGGDAGVGGLANTGGTAGNAG
IGGAGGAGGDGGAGDSGALSQDGNGFAGGQGGQGGAGGNAGTGGINGAGG
AGGTGGDGGDGAPATLIGGPDGGDGGQGGIGGAGGNAGFGAGDPGDGGVG
GTGGAGGNGGAGADGDPSIDGGQGGAGGHGGQGGQGGLNSTGLTSAASGD
GGAGGIGGAGGHGGDGDGFIGGSGGTGGVGGDAGVGGLANTGGTAGNAGI
GGAGGAGGDGGAGDSGALSQDGNGFAGGQGGQGGAGGNAGAGGINGAGGA
GGTGGDGGDGQNGTTGVASEGGAGGQGGDGGDGGAGGSAGFGSGVAGAGG
AGGTGGEGGDGGTGGTGGTNFAGGQGGAGGRGGAGGNGANGVGDNAAGGD
GGNGGAGGLGGGGGTGGTNGNGGLGGGGGNGGTGGAGGTPTGSGAEGTGG
DGGDAGAGGNGGSATGVGNGGNGGDGGNGGDGGNGAPGGFGGGAGAGGLG
GSGAGGGTDGDDGNGGSPGTDGS
433636601YP_007270228.1 Conserved protein of unknown function PE-PGRS family protein PE_PGRMSFVLIAPEFVTAAAGDLANLGSSISAANAAAASATTQVLAAGADEVSAR
IAALFGGFGLEYQAISAQVAAYHQQFVQALSTGAGAYASAEAAAAEQIVL
GVINAPTQALLGRPLIGDGANATTPGGAGGAGGLLFGNGGAGAAGAPGQA
GGAGGPAGLWGNGGPGGAGGSGGGTGGAGGAGGWLFGVGGAGGVGGAGGG
TGGAGGPGGLIWGGGGAGGVGGAGGGTGGAGGRAELLFGAGGVGGAGGAG
TDGGPGGSGGTGGHGGVGGDGGWLAPGGAGGAGGQGGAGGAGSDGGALGG
TGGTGGTGGAGGAGGRGALLLGAGGQGGLGGAGGTGGMGGAGGDGVLGGV
GGAGGDGGVGGVAGLGGAGGAAGQLFSAGGAAGAVGVGGTGGQGGAGGAG
AAGADAPASTGQTGGTGFAGGAGGTGGAGGNAIAGGINGSGGAGGTGGQG
GAGGMGGSGADNANGIGGTGGDGGTGGAAGAGGAGGAAGTGGTGGVVGAA
GKAGVGG
433636599YP_007270226.1 Putative fatty-acid-CoA synthetase FadD17 (fatty-acid-CoA synthase)MNPTVTELLLPLSEIDDRGVYFEGSFTSWRDHIRHGAAIAAALRERLDPA
RPPHVGVLLQNTPFFSATLVAAGLSGIVPVGLNPVRRGAALAHDIANADC
QLVLIGSGSAEAPADIEHINVDSPEWTDEVAAHRDTEVRFRSADPADLFM
LIFTSGTSGDPKAVKCSHRKVAIAGVTITQRFSLGRHDVCYVSMPLFHSN
AVLVGWAVAAACQGSMALRRKFSASQFLADVRRYGATYANYVGKPLSYVL
ATPELPDDADNPLQAVYGNEGVPGDIDRFGRRFGCVVIDGFGSTEGGVAI
SRTLDTPAGALGPLPGGIQIVDPDTGEPCPAGVVGELVNTAGPGSFEGYY
NDAAAEAERMAGGVYHSGDLAYRDDAGYAYFAGRLGDWMRVDGENLGTAP
IERVLMRYPGATEVAVYPVPDPVVGDQVMAALVLARGTKFDADKFRAFLT
EQPDLGHKQWPSYVRVSAGLPRTMTFKVIKRQLSAEGVACADPVWPIRR
433636597YP_007270224.1 Putative acyl-CoA dehydrogenase FadE26 [Mycobacterium canettii CIPTMRISYTPQQEELRRELRSYFATLMTPERREALSSVQGEYGVGNVYRETVA
QMGRDGWLALGWPKEYGGQGRSAMDQLIFTDEAAIAGAPVPFLTINSVAP
TIMAYGTDEQKRFFLPRIAAGDLHFSIGYSEPGAGTDLANLRTTAVRDGD
DYVVNGQKMWTSLIQYADYVWLAVRTNPESSGAKKHRGISVLIVPTTAEG
FSWTPVHTMAGPDTSATYYSDVRVPVANRVGEENAGWKLVTNQLNHERVA
LVSPAPIFGCLREVREWAQNTKDAGGTRLIDSEWVQLNLARVHAKAEVLK
LINWELASSQSGPKDAGPSPADASAAKVFGTELATEAYRLLMEVLGTAAT
LRQNSPGALLRGRVERMHRACLILTFGGGTNEVQRDIIGMVALGLPRANR
433636595YP_007270222.1 Putative short-chain type dehydrogenase/reductase. Putative 17-betaMTESNRSPRTTNTTDLSGKVAVVTGAAAGLGRAEALGLARLGATVVVNDV
ASALDASDVVDEIGAAAADAGAKAVAVAGDISQRATADELLASAVGLGGL
DIVVNNAGITRDRMLFNMSDEEWDAVIAVHLRGHFLLTRNAAAYWRDKAK
EAEGGSVFGRLVNTSSEAGLVGPVGQANYAAAKAGITALTLSAARALGRH
GVCANVICPRARTAMTADVFGAAPDVEAGQIDPLSPQHVVSLVQFLASPA
AAEVNGQVFIVYGPQVTLVSPPRMERRFSADGTHWDPTELTATLRDYFAG
RDPEQSFSATDLMRQ
433636593YP_007270220.1 Putative ABC transporter integral membrane subunit- YrbE4b [MycobacMSYDVTIRFRRFFSRLQRPVDNFGEQALFYGETMRYVPNAITRYRKETVR
LVAEMTLGAGALVMIGGTVGVAAFLTLASGGVIAVQGYSSLGDIGIEALT
GFLSAFLNVRVVAPVIAGIALAATIGAGATAQLGAMRVSEEIDAVECMAV
HSVSYLVSTRLIAGLVAIIPLYSLSVLAAFFAARFTTVFVNGQSAGLYDH
YFNTFLIPSDLLWSFMQAIAMSIAVMLVHTYYGYNASGGSVGVGVAVGQA
VRTSLIVVVVITLFISLAVYGASGNFNLSG
433636591YP_007270218.1 Conserved protein of unknown function- MCE-family protein Mce4B- thMAGSGVPSHRSMVIKVSVFAVVMLLVAAGLVVVFGDFRFGPTTVYHATFT
DASRLKAGQKVRIAGVPVGSVKAVKLNPDHSIDVAFAIDRSYTLYSSTRA
VIRYENLVGDRFLEITSGPGELRKLPPGGTINVAHTQPALDLDALLGGLR
PVLKGFDADKINTITSAVIELLQGQGGPLANVLADTGAFSAALGARDQLI
GEVITNLNAVLATVDAKSAQFSASVDQLQQLVSGLAKNRDPIAGAISPLA
STTTDLTELLRNSRRPLQGILENARPLATELDNRKAEVNNDIEQLGEDYL
RLSALGSYGAFFNIYFCSVTIKINGPAGSDILLPIGGQPDPSKGRCAFAK
433636589YP_007270216.1 Conserved protein of unknown function- MCE-family protein Mce4D- thMLTGSRGLRYATVIALVAALVGGVYVLSSTGNTRTIVGYFTSAVGLYPGD
QVRVLGVPVGEIDTIEPRSSDVKITMSVSKDVKVPVDVQAVIMSPNLVAA
RFIQLTPAYTGGAVLPDNGRIDLDRTAVPVEWDEVKEGLTRLAADLSPAA
GELQGPLGAAINQAADTLDGNGDSLHNALRELSQVAGRLGDSRGDIFGTV
KNLQVLVDALSESNEQIVQFAGHVASVSQVLADSSANLDQTLGTLNQALS
DIRGFLRENNSTLIETVNQLNDFAQTLSDQSENIEQVLHVAGPGITNFYN
IYDPAQGTLNGLLSIPNFANPVQFICGGSFDTAAGPSAPDYYRRAEICRE
RLGPVLRRLTVNYPPIMFHPLNTITAYKGQIIYDTPATEAKSETPVPELT
WIPVGGGAPVGNPADLQSLLVPPAPGPAPAPPAPGAGPGEQGGGG
433636587YP_007270214.1 Conserved protein of unknown function- MCE-family protein Mce4F [MyMIDRLAKIQLSIFAVITVITLSVMAIFYLRLPATFGIGTYGVSADFVAGG
GLYKNANVTYRGVAVGRVESVGLNPNGVTAHMRLNSGTAIPSNVTATVRS
VSAIGEQYIDLVPPENPSSTKLRNGFRIQRQNTRIGQDVADLLRQAETLL
GSLGDTRLRELLHEAFIATNGAGPELARLIESARLLVDEANANYPQVSQL
IDQAGPFLQAQIRAGGDIKSLADGLARFTWQLRAADPRLRDTLADAPDAI
DEANTAFSGIRPSFPALAASLANLGRVGVIYHKSIEQLLVVFPALFAAII
TSAGGVPQDEGAKLDFKIDLHDPPPCMTGFLPPPLVRSPADESLREIPRD
MYCKTAQNDPSTVRGARNYPCQEFPGKRAPTVQLCRDPRGYVPVGTNPWR
GPPIPYGTEVTDGRNILPPNKFPYIPPGADPDPGVPIVGPPPPGQVAGPG
PAPHQPAQPAPPPNDNGPPPPFTSWMPPGYPPEPPQVPYPATIPPPPPPE
GTGPPPGPAPGPQPQASGPAYTIYDQLSGAFADPAGGTGIFAPGMKGASS
AENWVDLMRDPRQL
433636585YP_007270212.1 Conserved exported protein of unknown function- possible Mce associMRRLISVAYALMVATTVGLSAAGGWFYWDRVQTGGEASARALLPKLAMQE
IPQVFGYDYQTVERSLTAVYPLLTPDYRQEFQKSANAQIIPEAKKREVVV
QANVVGVGVMDAKRDCASVMVYLNRTVTDKTRQPLYDGSRLRVDFQRIDG
KWLIAYITPI
433636583YP_007270210.1 Putative alpha- alpha-trehalose-phosphate synthase [UDP-forming] OtMAPSGGQEAQICDSETFGDSDFVVVANRLPVDLERLPDGSTTWKRSPGGL
VTALEPVLRRRRGAWVGWPGVNDDGAEPDLHVLDGPIIQDELELHPVRLS
TTDIAQYYEGFSNATLWPLYHDVIVKPLYHREWWDRYVDVNQRFAEAASR
AAAHGATVWVQDYQLQLVPKMLRMLRPDLTIGFFLHIPFPPVELFMQMPW
RTEIIQGLLGADLVGFHLPGGAQNFLILSRRLVGTDTSRGTVGVRSRFGA
AVLGSRTIRVGAFPISVDSGALDHAARDRNIRRRAREIRTELGNPRKILL
GVDRLDYTKGIDVRLKAFSELLAEGRVKRDDTVLVQLATPSRERVESYQT
LRNDIERQVGHINGEYGEVGHPVVHYLHRPAPRDELIAFFVASDVMLVTP
LRDGMNLVAKEYVACRSDLGGALVLSEFTGAAAELRHAYLVNPHDLEGVK
DGIEEALNQTEEAGRRRMRSLRRQVLAHDVDRWAQSFLDALAGAHPRGQG
433636581YP_007270208.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MREFQRAAVRLHILHHAADNEVHGAWLTQELSRHGYRVSPGTLYPTLHRL
EADGLLVSEQRVVDGRARRVYRATPAGRAALTEDRRALEELAREVLGSQS
HTAGNGT
433636579YP_007270206.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MHAEGPPSVICIRLLVGLVFLSEGIQKFLYPDQLGPGRFERIGIPAATFF
ADLDGVVEIVCGTLVLLGLLTRVAAVPLLIDMVGAIVLTKLRALQPGGFL
GVEGFWGMAHAARTDLSMLLGLIFLLWSGPGRWSLDARLSKRATACGAR
433636577YP_007270204.1 Conserved membrane protein of unknown function CpsA [Mycobacterium MARSEGNRPRHRAVPQPSRIRKRLSRGVMTLVSVVALLMTGAGYWVAHGA
LGGITISQALTPEDPRSSGNNMNILLIGLDSRKDQEGNDLPWSVLKQLHA
GDSDDGGYNTNTLILVHVGADGKVVAFSIPRDDWVPFTGVPGYNHIKIKE
AYGLTKQYVAEQLANQGVSDRKELETRGREAARAATLRAVRSLTGVPIDY
FAEINLAGFYDLAQTLGGVDVCLNHAVYDSYSGADFPAGRQRLNAAQALA
FVRQRHGLDNGDLDRTHRQQAFLSSVMRELQDSGTFTNLDRLDNLMAVAR
KDVVLSAGWDEDLFRRMGDLAGGNVEFRTLPVVRYDNIDGQDVNIIDPTA
IRAEVAAAFGSAPPTSQTAAAAKPNPSTVVDVVNAGSISGLASQVSGALL
KRGYTAGQVRDRESGDPFTTAIEYGAGAETDAQNVADLLGIDAPNHPDPA
VAPGHIRVTVDTNFSLPAPDEATAAATSTETSTYPLYGGGTTTDPTPDQG
APIDGGGVPCVN
433636575YP_007270202.1 Conserved membrane protein of unknown function [Mycobacterium canetMEHDVATSPPAGWYTDPDGSAGQRYWDGDRWTRHRRPNPSAPRSPLALRV
DRLRSRWLGMPAGLRLTVPVAAVLTMVGVAVYAWIRPLPDDWSQLPKRLS
CQLRPGPTPPATITVAFVDVSHPRGAVLQLVVRFAEPLPPSPSGSFASGF
AGYLLTYTIANNGKEFAELGPQQDTDELAIRKPGESRGTEPNMRPDRNTN
ARRTAPDTVEINLETKRLGLDQAPVDPQLTFAAQFRTPSTVTVDFGSQFC
QGERLAGQRR
433636573YP_007270200.1 Conserved protein of unknown function- possible diacylglycerol O-acMSQTARRLGPQDMFFLYSESSTTMMHVGALMPFTPPSGAPPDLLRQLVDE
SKASEVVEPWSLRLSHPELLYHPTQSWVVDDNFDLDYHVRRSALASPGDE
RELGILVSRLHSHALDLRRPPWEVHFIEGLEGGRVAIYIKMHHSLIDGYT
GQKMLARSLSTDPHDTTHPLFFNIPTPGRSPADTQDSVGGGLIAGAGNVL
AGLGDVVRGLGGLVSGVGSVLGSVAGAGRSTFELTKALVNAQLRSDHEYR
NLVGSVQAPHCILNTRISRNRRFATQQYPLDRLKAIGAQYDATINDVALA
IIGGGLRRFLDELGELPNKSLIVVLPVNVRPKDDEGGGNAVATILATLGT
DVADPVQRLAAVTASTRAAKAQLRSMDKDAILAYSAALMAPYGVQLASTL
SGVKPPWPYTFNLCVSNVPGPEDVLYLRGSRMEASYPVSLVAHSQALNVT
LQSYAGTLNFGFIGCRDTLPHLQRLAVYTGEALDQLAAADGAAGLGS
433636571YP_007270198.1 Conserved protein of unknown function- PE family protein [MycobacteMVDFGALPPEINSARMYAGPGSASLVAAAKMWDSVASDLFSAASAFQSVV
WGLTTGSWIGSSAGLMAAAASPYVAWMSVTAGQAQLTAAQVRVAAAAYET
AYRLTVPPPVIAENRTELMTLTATNLLGQNTPAIEANQAAYSQMWGQDAE
AMYGYAATAATATEALLPFEDAPLITNPGGLLEQAVAVEEAIDTAAANQL
MNNVPQALQQLAQPAQGVVPSSKLGGLWTAVSPHLSPLSNVSSIANNHMS
MMGTGVSMTNTLHSMLKGLAPAAAQAVETAAENGVWAMSSLGSQLGSSLG
SSGLGAGVAANLGRAASVGSLSVPPAWAAANQAVTPAARALPLTSLTSAA
QTAPGHMLGGLPLGHSVNAGSGINNALRVPARAYAIPRTPAAG
433636569YP_007270196.1 Putative dicarboxylic acid transport integral membrane protein KgtPMTVSIAPPSRPSQAETRRAIWNTIRGSSGNLVEWYDVYVYTVFATYFEDQ
FFDRADRNSTVYVYAIFAVTFVTRPVGSWFFGRFADRRGRRAALTFSVSL
MAACSLIVALVPSRSSIGVAAPILLILCRLVQGFATGGEYGTSATYMSEA
ATRERRGYFSSFQYVTLVGGHVLAQFTLLVILAVFTREQVHEFGWRIGFA
VGGGAAIVVFWLRRTMDESLSQERLTAIKAGRDHDSGSLRELATHYWKPL
LLCFLVTLGGTVAFYTYSVNAPAIVKSVYGSQAMTATWINLVGLILLMML
QPIGGMISDKIGRKPLLLWFGVGGLIYTYVLVTYLPETRSPTMSFLLVAV
GYVILTGYCSINALVKSELFPAHVRALGVGVGYALANSVFGGTAPLIYQA
LKERDQVPMFIAYVTVCIAVSLIVYVFFIKNKADTYLDREQGFAFYGHA
433636567YP_007270194.1 Integrase- catalytic region (fragment) [Mycobacterium canettii CIPTMAATIGYLFAKHKRTYGSPRITADLRDMGWRVSVNTVAALMREQGLVARR
KRRRHGTTKPDKSARKAPDLLGRDFSPRDHPNLAWVGDLTEIPTDEGKLQ
PRLSN
433636565YP_007270192.1 Putative peroxidase BpoA (non-haem peroxidase) [Mycobacterium canetMVFLHGGGQTRRSWGRAAAAVAERGWQAVTIDLRGHGESDWSSEGDYRLV
SFAGDIQEVLRNLPGQPALVGASLGGFATMLLAGELSPGIASAVVLVDIV
PNMDLAGASRIHAFMAERVESGFGSLDEVADVIANYNPHRPRPSDPDGLV
ANLRRRGDRWYWHWDPQFIGGIAAFPPVEVTDVDRMNAAVATILRDEVPV
LLVRGQVSDIVRQESADQFLSRFPQVEFTDVRGAGHMVAGDRNDAFAGAV
LDFLARHVGVR
433636563YP_007270190.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MFVSNAREAEPFVAPDLSEIRVLVDRASMGVASVSLAHATVAAGAETVWH
RLQATDEIYFVLSGRGLVSVGDESGEVGPGDAVWIPAGVPQKIRALGSVP
LTFLCACGPAYLPERDQRMDEVAVIGVWP
433636561YP_007270188.1 4-hydroxy-2-oxovalerate aldolase MhpE (HOA) [Mycobacterium canettiiMLMTATHREPIVLDTTVRDGSYAVNFQYTDDDVRRIVGDLDAAGIPYIEI
GHGVTIGAAAAQGPAAHTDEEYFRAARSVVRNAKLGAVIVPALARIETVD
LAGDYLDFLRICVIATEFELVMPFVERAQSKGLEVSIQLVKSHLFEPDVL
AAAGKRARDVGVRIVYVVDTTGTFLPEDARRYVEALRGASDVSVGFHGHN
NLAMAVANTLEAFDAGADFLDGTLMGFGRGAGNCQIECLVAALQRRGHLA
GVDLDRIFDAARSDMLGRSPQSYGIDPWEISFGFHGLDSLQVEHLRAAAQ
QAGLSVSHVIRQTAKSHAGQWLSPQDIDRVVVGMRA
433636559YP_007270186.1 Conserved protein of unknown function possible rep13e12 repeat protMGSDSRERIVEVFDALDADLDRLCEVSFEVLTTPERLAMLERLERLVRRL
PAVGHALINQLDAQASEEELGATLCCALANRLRITKPDAARRIADAADLG
PRRALTGEPLAPQLTATATAQRQGLIGEAHIKVIRSFFAHLPAEVDVSTR
EAADADLAGKAAQYRPDELARYARRVMDWLHPDGDFTDTERARKRGITLS
NQQYDGMSRLSGYLTPQARATFEAVLAKLAAPGMCNPDDHTPVIDTTPDA
AAIDRDTRSQAQRNHDGLLAGLRALIASGKLGQHNGLPVSIVVTTTLTDL
ENAAGKGFTGGGSLLPMADVIRMASHAHHYLAIFDHGTPLALYHTKRLAS
PAQRIMLFARDRGCTKPGCDAPAYHSQAHHVTGWTSTGRTDITDLTLACG
PDNRLAEKGWTTRKNTHGDTEWLPPPHLDHGQPRTNTFHHPERFLHNQDD
DDKPD
433636557YP_007270184.1 Transposase (fragment) [Mycobacterium canettii CIPT 140070017]MVDRIAPRFPRYEPLRHASELMLGMVSGLDRKNCWTIAEHRGDATPDGLQ
HLLARAKWDADGVRDDLRNYVIDASGGILVVDETGDVKKGVHLVGVQRQY
TGTAGRVENTQVAVFLTYAAPRGHALIDRALYLPRSWAEDPQRCTDAGIP
TTQRCFATKPTLATALIARAVAAKVPAAWVAGDEVYGADPKLRAAIRGHG
LGYVLAVSANRRVPPRPAASASIVYPPCCPSGPGRSTPPARAATDTATTP
GPGSRWKPRTTPTRVTIIC
433636555YP_007270182.1 dTDP-glucose 4-6-dehydratase RmlB [Mycobacterium canettii CIPT 1400MRLLVTGGAGFIGTNFVHSAVREHPDDAVTVLDALTYAGRRESLADVEDA
IRLVQGDITDAELVSQLVAESDAVVHFAAESHVDNALDNPEPFLHTNVIG
TFTILEAVRRHGVRLHHISTDEVYGDLELDDRARFTESTPYNPSSPYSAT
KAGADMLVRAWVRSYGVRATISNCSNNYGPYQHVEKFIPRQITNVLTGRR
PKLYGAGANVRDWIHVDDHNSAVRRILDKGRIGRTYLISSEGERDNLTVL
RTLLRLMDRDPDDFDHVTDRVGHDLRYAIDPSTLYDELCWAPKHTDFEEG
LRTTIDWYRDNESWWRPLKDATEARYQERGQ
433636553YP_007270180.1 Putative translation initiation factor IF-1 [Mycobacterium canettiiMAKKDGAIEVEGRVVEPLPNAMFRIELENGHKVLAHISGKMRQHYIRILP
EDRVVVELSPYDLSRGRIVYRYK
433636551YP_007270178.1 Putative 30S ribosomal protein S13 RpsM [Mycobacterium canettii CIPMARLVGVDLPRDKRMEVALTYIFGIGRTRSNEILAATGIDRDLRTRDLTE
EQLIHLRDYIEANLKVEGDLRREVQADIRRKIEIGCYQGLRHRRGMPVRG
QRTKTNARTRKGPKRTIAGKKKAR
433636549YP_007270176.1 Putative 30S ribosomal protein S4 RpsD [Mycobacterium canettii CIPTMARYTGPVTRKSRRLRTDLVGGDQAFEKRPYPPGQHGRARIKESEYLLQL
QEKQKARFTYGVMEKQFRRYYEEAVRQPGKTGEELLKILESRLDNVIYRA
GLARTRRMARQLVSHGHFNVNGVHVNVPSYRVSQYDIVDVRDKSLNTVPF
QIARETAGERPIPSWLQVVGERQRVLIHQLPERAQIDVPLTEQLIVEYYS
K
433636547YP_007270174.1 50S ribosomal protein L17 [Mycobacterium canettii CIPT 140070017]MPKPTKGPRLGGSSSHQKAILANLATSLFEHGRITTTEPKARALRPYAEK
LITHAKKGALHNRREVLKKLRDKDVVHTLFAEIGPFFADRDGGYTRIIKI
EARKGDNAPMAVIELVREKTVTSEANRARRVAAAQAKAKKAAAMPTEESE
AKPAEEGDVVGASEPDAKAPEEPPAEAPEN
433636545YP_007270172.1 Conserved membrane protein of unknown function [Mycobacterium canetMAQGLKLGLHIPLWAGYACSTLIIFPLVVYGMKVLSQLQLWTTPLWLILM
AAPFGYLVVSHPDSIGQFFSYAGKDGRGGLSFGSVLLAAGVCLSLIAQIA
EQIDYLRFMPPRTPENANRWWTWTLLAGPGWVAFGATKQIIGLFLAVYLM
ANIPGSSAIANQPVHQFMQIYRTFVPGWLALTLAVILVVLSQIKINVTNA
YSGSLAWTNSFTRLTKHYPGRVVFLGVNLAIALILMEANMFDFLNTILGC
YANCGMAWVVAVASDIGFNKYLLGLSPKTPEFRRGMLYAINPVGFGSLLL
AAGLSIVTFFGGLGAALQPYSPLVAIVTALVMPPILAAATKGKYYLRRTH
DGIDLPMYDEHGNPSAAVLTCHVCQQDFERPDMLACQTHGAHVCSLCLSA
DKQAEHVLPGLARAHIPGDQVP
433636543YP_007270170.1 Putative cutinase precursor Cut3 [Mycobacterium canettii CIPT 14007MNNRPIRLLTSGRAGLGAGALITAVVLLIALGAVRTPVAFADGCPDAEVT
FARGTAEPPGIGRVGQAFVDSLRQQTGMEIGVYPVNYAASRLQLHGGDGA
NDAISHIKSMASSCPNTKLVLGGYSQGATVIDIVAGVPLGGISFGSPLPA
AYADNVAAVAVFGNPSNRAGGSLSSLSPLFGSKAIDLCNPTDPICHAGPG
NEFSGHIDGYIPTYTTQAASFVVNRLRAGSVPHLPGSVPQLPGSVLQIPG
TAAPAPESLHGR
433636541YP_007270168.1 Putative membrane-anchored mycosin MycP4 (serine protease) (subtiliMTTSRTLRLLVVSALATLSGLGTPVAHAVSPPPIDERWLPESALPAPPRP
TVQREVCTEVTAESGRAFGRAEPPAQLADLDQVWRLTRGAGQRVAVIDTG
VARHRRLPKVVAGGDYVFTGDGTADCDAHGTLVAGIIAAAPDAQSDNFSG
VAPDVTLISIRQSSSKFAPVGDPSSTGVGDVDTMAKAVRTAADLGASVIN
ISSIACVPAAAAPDDRALGAALAYAVDVKNAVIVAAAGNTGGAAQCPPQA
PGVTRDSVTVAVSPAWYDDYVLTVGSVNAQGEPSAFTLAGPWVDVAATGE
AVTSLGPFGDGTVNRLGGQHGSTPISGTSYAAPVVSGLAALIRARFPTWT
ARQVMQRIESTAHHPPAGWDPLVGNGTVDALAAVSSDSIPQAGSATSDPA
PVAVPVPRRSTPGPSDRRALHTAFAGAAICLLALMATLATASRRLRPGRN
GIAGD
433636539YP_007270166.1 ESX conserved componant EccC4 [Mycobacterium canettii CIPT 14007001MNSGPACATADILVAPPPELRRSEPSSLLIRLLPVVMSVATVGVMVTVFL
PGSPATRHPTFLAFPMMMLVSLVVTAVTGRGRRHVSGIHDDRVDYLGYLS
VLRTSVTQTAAAQHVSLNWTHPDPATLWTLIGGPRMWERRPGAADFCRIR
VGVGSAPLATRLVVGQLPPAQRADPVTRAALRCFLAAHATIADAPIAIPL
RVAGPIAIDGDPIKVRGLLRAMVCQLAVWHSPEELLIAGVVSDRNRAHWD
WLKWLPHNQHPNACDAVGPAPMVYSTLAEMQNALAATVLAHVVAIIDTAE
RGNGATTGAITIEVGARRDGAPPVVRCAGEVTALACPDQLEPQDALVCAR
RLAAHRVGHSGRTFSRGSGWPELAGIGDVAAFDPSTLWRNVNHHDRLRVP
IGVTPDGTAVQLDIKEAAEQGMGPHGLCVGATGSGKSELLRTIALGMMAR
NSPEVLNLLLVDFKGGATFLDLAGAPHVAAVITNLAEEAPLVARMQDALA
GEMSRRQQLLRTAGHLVSVTAYQRARQTGAQLPCLPILFIVVDEFSELLS
QHPEFADVFLAIGRVGRSLGMHLLLASQRLDEGRLRGLETHLSYRMCLKA
LSASESRNVLGTQDAYQLPNTPGAGLLQTGTGELIRFQTAFVSGPLRRAS
PSAVHPVTAPSVRPFTTHAAAPVTPGSVGGTAEVPTPTVLHAVLDRLAGH
GPAAHQVWLPPLDEPPMLGALLRDAEPAQAELAVPIGIVDRPFEQSRVPL
TIDLSGAAGNVAVVGAPQTGKSTALRTLIMALAATHDAGRVQFYCLDFGG
GALAQVGELPHVGAVAGRAQPQLASRMLAELESAVRFREAFFRDHGIDSI
ARYRQLRAKSAAESFADIFLVIDGWASLRQEFAALEESIVALAAQGLSFG
VHVALSAARWAEIRPSLRDQIGSRIELRLADPADSELDRRQAQRVPVDRP
GRGLSRDGMHMVIALPDLDGVALRRRSGDPVAPPIPLLPARADYDSVVAR
AGDELAAHILLGLEERRGQPVAVDFGRHPHLLVLGDNECGKTAALRTLCR
EIVRTHTAARAQLLIVDFRRTLLDVIESEHMGGYVSSPAALGAKLSSLVD
LLQARMPAPDVSQAQLRARSWWSGPDIYVVVDDYDLVAVSSGNPLMVLLE
YLPYARDLGLHLVVARRSGGAARALFEPVLASLRDLGCQALLMSGRPDEG
ALFGSSRPMPLPPGRGILVTGAGDEQLVQVAWSPPP
433636537YP_007270164.1 ESAT-6 like protein EsxU [Mycobacterium canettii CIPT 140070017]MKTSSGRCVRKPYGPSTPLVEPGRIGGNQTRLAAVLLDVSTPNTLNADFD
LMRSVAGITDARNEEIRAMLQAFIGRMSGVPPSVWGGLAAARFQDVVDRW
NAESTRLYHVLHAIADTIRHNEAALREAGQIHARHIAAAGGDL
433636535YP_007270162.1 50S ribosomal subunit protein L13 [Mycobacterium canettii CIPT 1400MPTYAPKAGDTTRSWYVIDATDVVLGRLAVAAANLLRGKHKPTFAPNVDG
GDFVIVINADKVAISGDKLQHKMVYRHSGYPGGLHKRTIGELMQRHPDRV
VEKAILGMLPKNRLSRQIQRKLRVYAGPEHPHSAQQPVPYELKQVAQ
433636533YP_007270160.1 Conserved membrane protein of unknown function [Mycobacterium canetMGRLFGTDGVRGVANRELTAELALALGAAAARRLSRSGAPGRRVAVLGRD
PRASGEMLEAAVIAGLTSEGVDALRVGVLPTPAVAYLTGAYDADFGVMIS
ASHNPMPDNGIKIFGPGGHKLDDDTEDQIEDLVLGVSRGPGLRPAGAGIG
RVIDAEDATERYLRHVAKAATARLDDLAVVVDCAHGAASSAAPRAYRAAG
ARVIAINAEPNGRNINDGCGSTHLDPLRAAVLAHRADLGLAHDGDADRCL
AVDANGDLVDGDAIMVVLALAMKEAGELACNTLVATVMSNLGLHLAMRSA
GVTVRTTAVGDRYVLEELRAGDYSLGGEQSGHIVMPALGSTGDGIVTGLR
LMTRMVQTGSSLSDLASAMRTLPQVLINVEVVDKATAAAAPSVRTAVEQA
AAELGDTGRILLRPSGTEPMIRVMVEAADEGVAQRLAATVADAVSTAR
433636531YP_007270158.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MADRLNVAERLAEGRPAAEHTQSYVRACHLVGYQHPDLTAYPAQIHDWYG
SEDGLDLHALDADCAQLRAAASVLMEALRMERSQVAVLAAAWTGSGADAA
VHFVQRHCETGNSVVTEVRAAAQRCESLRDNLWQLVDSKVATAIAIDERA
LAQRPAWLAAAEALTTEGADRPTAVEVVRQQIQPYVDDDVRNDWLTTMRS
TTAGVAASYDAVTDQLASAPRAHFEIPDDLGPGRQPSPASVPAQPSATAA
ITPAAALPPPDPVPAVTSRPVTPSDFGSAPGDGSATPAGVGSAGGFGDAG
GTGGLGGFAGLAGLANRIVDAMDSLLGSVAEQLGDPLAADNPPGAVDPFA
EDAADNADDGDDAHPEEADEAAEPKEATEPDEADEVDDADESVPADRARD
VAEEATLPPVAEPPPPAAPPVAEPPPPVAAPAPPGAPEPANGPPPEALSE
GATPCEIAADELPQAGP
433636529YP_007270156.1 Conserved membrane protein of unknown function [Mycobacterium canetMVGRAVPSPNRRHRRVWPPRTKGQLLSNPYAQHQLKLIRHTGALILWQQR
TYVVSGTREQCEAAYKSAQTYNLLVGWWSLVSLLAMNWIALISNFNAIRR
VRAAADGASVPHGPHAIAHPAVPRGPIPAGWYPDPSGAGLRYWDGATWTH
WTHSPRHR
433636527YP_007270154.1 Conserved membrane protein of unknown function [Mycobacterium canetMGRILRVVVGLVLVIAAYVTVIALYHSTGLGRPHEVAHGRSTADGTTVTL
HVEQLQTIKGVLVANLAVSPGTELLDSQTQGLKDDLTVTVTSVVTPTKRT
WSSGSLPGVFPVPLTISGDPANWPFDHYRSGPITVQLYRGAAHAPERVSV
TFVDRLPGWNVDISGVGDANVPAPYRVGLHRSPSTVAFGTVIVGVLIALA
GVGLFVAVQTARGRRKFQPPMTTWYAAMLFAVIPLRNALPDAPPIGFWID
VTVVLWVVVALVTSMVLYILCWWWHLKPDVDETM
433636525YP_007270152.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MRHYYSVDTIRAAEAPLLASLPDGALMRRAAFGLATEIGRELTARTGGVV
GRRVCAVVGSGDNGGDALWAATFLRRRGAAADAVLLNPDRTHRKALAAFT
KSGGRLVESVSAATDLVIDGVVGISGSGPLRPAAAQVFAAVQAAAIPVVA
VDIPSGIDVATGAITGPAVHAALTVTFGGLNPVHALADCGRVVLVDIGLD
LAHTDVLGFEATDVAARWPVPGPRDDKYTQGVTGVLAGSSTYPGAAVLCT
GAAVAATSGMVRYAGSAYAEVLAHWPEVIASPTPAAAGRVQAWVVGPGLG
TDEAGAAALWFALDTDLPVLVDADGLTMLADHPDLVAGRNAPTVLTPHAG
EFARLAGAPPGDDRVGACRQLADALGATVLLKGNVTVIADPGGPVYLNPA
GQSWAATAGSGDVLSGMIGALLASGLPSGEAAAAAAFVHARAAAAAAADP
GPADAPTSASRISGHIRAALAAL
433636523YP_007270150.1 Transposase (fragment) [Mycobacterium canettii CIPT 140070017]MRKCLSCKEELSAQVTAALADTYRGPWVYAPGEVFADLAVAVADGADRRG
GEQLDNRWSLVDRLGRDHVPHLAGVGTAAASSHRPRSA
433636521YP_007270148.1 Transposase [Mycobacterium canettii CIPT 140070017]MVGQLCGDREHVLGAKASTTTMWRLVDERIDAGHLPRVRAARAAARAAAW
AAGAAPVAGQWLHIDIDATLVIDHSDNKEKAGATWKKSFEHHPLLAFLDR
PEIAGGEALAGLLRPGGAGSNTAADHVSVLAQALAGLPARWRPDPDHPED
PDKPAVLVRCDTAGATHDFADACRAAGVGFSFGYPVDWRVQDAVDTLNIG
QCWYPAIDTDGGIRDGAWVAEATNLVNLSAWPAGTRLILRKERPHPGAQL
RFTDADGMRVTAFITDTPPGVVAGQVAGLELRHRQHARIEDRIRELKATG
LRNLPCHAFDANAAWLEIVLAAADLVTWCRLIGFTGHPGLTRAEINTFRY
RVLHVAARITRGARRTRLRIDATWRWAAAIATAWQRVRTAFG
433636519YP_007270146.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MHDATGGAGFVRPDLTAFCRLDELGVEVTGQYLDSDRAVLACRITDEDRW
CRRCGEQGQVRDTVTRRLAHEPFGWRPTTLVLTVRRYRCAGCAHVWRQDS
SAAAEPRAKLSRHGLRWALEAVVCQHLTMARVAEGLGVSWNTANDAVLAE
GKRVLIDDAGRFDEVTVIGVDEHVWRHTRRGDKYVTVIIDLTGIREGTGP
ARLLDMVEGRSKQAFKTWLAEREESWRQAVEVVAMDGFTGFKTATSEELP
DAVAVMDPFHVVRLGGEALDKCRRRVQLDTCGHRGRKTDPLYAARRTLQT
GADLLTDKQKDRLTKLFAVDTHIEVETTWGIYQRMISAYRHPDRRRGREL
MSTLIESISDAVPAALTQVITLGRTLKKRAADVLAYFDRPGTSNGPTEAI
NGRLEHLRGSALGFRNLTHYIARSLLEAGGFKPRLHPRS
433636517YP_007270144.1 Conserved protein of unknown function- PPE family protein [MycobactMHPLTPPTPPEIISNQMYTGPGAGSLRAAAKQLRRLADSAEAKVESLSDT
LDELSENWKGSSPEWMADAVGRYLDWLSKHSCQIWQTAHVIEDLVELYEL
TRQTVVPPADIAHNREEVRRLIASNVAGVNAPEIAQLDARYQQYGARNVL
AMHFYLRSTRDALSQLRPWQEPPQIHSSG
433636515YP_007270142.1 Protein of unknown function [Mycobacterium canettii CIPT 140070017]MNECLDGPIGLVFDPVATGQGGKPRCSDGPRSTGVCGDRSPGPTGRAWTS
ASSTRCATAEKAVAGEVFVKRNRFIALTGDTKTINRVPGRKQLQCVLSAL
DCHSSGGS
433636513YP_007270140.1 Conserved protein of unknown function- PPE family protein PPE57 [MyMPFTLTPAHQISYQMYAGPGADSMRATAQQLRELAFSADTTADSLNDTLF
DLDDTWIGGSSAFMTDAALRYLKWLSKHSKRLWQTANTIHHLANTYEDIR
QRVVPPAAIEDNREEVRRLIASDITGENAPAIAELDEQYRSYGDTNVQAM
NLYAERAQTLLSQLPRWQEPPQIHQRGRGG
433636511YP_007270138.1 Transposase (fragment2) [Mycobacterium canettii CIPT 140070017]MSICDPALRNALRTLKLSGMLDTLDARLAQTRNGDLGHLEFLQALCEDEI
ARRESAALTRRLRRAKFEAQATFEDFDFTANPKLPGAMLRDLAALRWLDA
GESVILYGPVGVGKTHVAQALGHAVARRGGDVRFARTSRMLSDLAGGQAD
RSWGQRIREYTKPLVLILDDFAMREHTAMHADDLYELISDRAITGKPLIL
TSNRAPNNWYGLFPNPVVAESLLDRLINTSHQILMDGPSYRPRKRPGRTT
S
433636509YP_007270136.1 Alanine racemase Alr [Mycobacterium canettii CIPT 140070017]MAMTPISQTPGLLAEAMVDLGAIEHNVRVLREHAGHAQLMAVVKADGYGH
GATRVAQTALGAGAAELGVATVDEALALRGDGITAPVLAWLHPPGIDFGP
ALLADVQIAVSSLRQLDELLDAVRRTGRTATVTVKVDTGLNRNGVGPAQF
PAMLTALRQAMAEDAVRLRGLMSHMVYADKPDDSINDVQAQRFTAFLTQA
REQGVRFEVAHLSNSSATMARPDLTFDLVRPGIAVYGLSPVPALGDMGLV
PAMTVKCAVALVKSIRAGEGVSYGHTWIAPRDTNLALLPIGYADGVFRSL
GGRLEVLINGRRCPGVGRICMDQFMVDLGPGPLDVAEGDEAILFGPGIRG
EPTAQDWADLVGTIHYEVVTSPRGRIARTYREAENR
433636507YP_007270134.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MSRVQISTVLAIDTATPAVTAGIVRRHDLVVLGERVTVDARAHAERLTPN
VLAALADAALIMADLDAVVVGCGPGPFTGLRAGMASAAAYGHALGIPVYG
VCSLDAIGGQTIGDTLVVTDARRREVYWARYCDGIRTVGPAVNAAADVDP
GPALAVAGSPEHAALFALPCVEPSRPSPAGLVAAVNWADKPAPLVPLYLR
RPDAKPLAVCT
433636505YP_007270132.1 Putative O-sialoglycoprotein endopeptidase Gcp (glycoprotease) [MycMTTVLGIETSCDETGVGIARLDPDGTVTLLADEVASSVDEHVRFGGVVPE
IASRAHLEALGPAMRRALTAAGLERPDIVAATIGPGLAGALLVGVAAAKA
YSAAWGVPFYAVNHLGGHLAADVYEHGPLPECVALLVSGGHTQLLHVRSL
GEPIIELGSTVDDAAGEAYDKVARLLGLGYPGGKALDDLARTGDRDAIVF
PRGMSGPADDRYAFSFSGLKTAVARYLESHAADPGFRTADIAAGFQEAVA
DVLTMKAVRAATALGVSTLLIAGGVAANSRLRELATQRCGEAGRTLRIPS
PRLCTDNGAMIAAFAAQLVAAGAPPSPLDVPSDPGLPVMQGQVR
433636503YP_007270130.1 Cpn60 chaperonin GroEL- large subunit of GroESL [Mycobacterium caneMSKLIEYDETARRAMEVGMDKLADTVRVTLGPRGRHVVLAKAFGGPTVTN
DGVTVAREIELEDPFEDLGAQLVKSVATKTNDVAGDGTTTATILAQALIK
GGLRLVAAGVNPIALGVGIGKAADAVSEALLASATPVSGKTGIAQVATVS
SRDEQIGDLVGEAMSKVGHDGVVSVEESSTLGTELEFTEGIGFDKGFLSA
YFVTDFDNQQAVLEDALILLHQDKISSLPDLLPLLEKVAGTGKPLLIVAE
DVEGEALATLVVNAIRKTLKAVAVKGPYFGDRRKAFLEDLAVVTGGQVVN
PDAGMVLREVGLEVLGSARRVVVSKDDTVIVDGGGTAEAVANRAKHLRAE
IDKSDSDWDREKLGERLAKLAGGVAVIKVGAATETALKERKESVEDAVAA
AKAAVEEGTVPGGGASLIHQARKALTELRASLTGDEVLGVDVFSEALAAP
LFWIAANAGLDGSVVVNKVSELPAGHGLNVNTLSYGDLAADGVIDPVKVT
RSAVLNASSVARMVLTTETVVVDKPAKAEDHDHHHGHVH
433636501YP_007270128.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MNETPHAPVVEQVLVAAAFGNQPGRWPLPTAITPHQLWLRAVAAGGQGRY
AHAYGDLSVLRRLVPAGPLASLAHSTQGSLLRQLGWHTLARGWDGRALAL
AGADREAGADALIGLAADALGVGRFAAAGALLGRADPLVVSPLVADRLAV
RRRWVAAELAMATGDGATAVRHAEEAVELTQAMAVASARHRVKSDVVLAA
ALCSAGAVARARAVGEAALDATARFGLLPLRWALACLLIDIGTVTFSAQQ
LRELTKIRNICAGQVRRAGGCWRTA
433636499YP_007270126.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MRDHLPPGLPPDPFADDPCDPSAALEAVEPGQPLDQQERMAVEADLADLA
VYEALLAHKGIRGLVVCCDECQQDHYHDWDMLRSNLLQLLIDGTVRPHEP
AYDPEPDSYVTWDYCRGYADASLNEAAPDADRFRRR
433636497YP_007270124.1 Probable inosine-5'-monophosphate dehydrogenase GuaB3 (IMP dehydrogMVEIGMGRTARRTYELSEISIVPSRRTRSSKDVSTAWQLDAYRFEIPVVA
HPTDALVSPEFAIELGRLGGLGVLNGEGLIGRHLDVEAKIAQLLEAAAAD
PEPSTAIRLLQELHAAPLNPDLLGAAVARIREAGVTTAVRVSPQNAQWLT
PVLVAAGIDLLVIQGTIVSAERVASDGEPLNLKTFISELDIPVVAGGVLD
HRTALHLMRTGAAGVIVGYGSTQGVTTTDEVLGISVPMATAIADAAAARR
DYLDETGGRYVHVLADGDIHTSGELAKAIACGADAVVLGTPLAESAEALG
EGWFWPAAAAHPSLPRGALLQIAVGERPPLARVLGGPSDDPFGGLNLVGG
LRRSMAKAGYCDLKEFQKVGLTVGG
433636495YP_007270122.1 Conserved protein of unknown function with PIN domain [MycobacteriuMIYMDTSALTKLLISEPETTELRTWLTAQSGQGEDAATSTLGRVELMRVV
ARYGQPGQTERARYLLDGLDILPLTEPVIGLAETIGPATLRSLDAIHLAA
AAQIKRELTAFVTYDHRLLSGCREVGFVTASPGAVR
433636493YP_007270120.1 Putative dioxygenase [Mycobacterium canettii CIPT 140070017]MTDLITVKKLGSRIGAQIDGVRLGGDLDPAAVNEIRAALLAHKVVFFRGQ
HQLDDAEQLAFAGLLGTPIGHPAAIALADDAPIITPINSEFGKANRWHTD
VTFAANYPAASVLRAVSLPSYGGSTLWANTAAAYAELPEPLKCLTENLWA
VHTNRYDYVTTKPLTEAQQAFRQVFEKPDFQTEHPVVRVHPETGERALLA
GDFVRSFVGLDNHESSVLFELLQRRITMPENTIRWNWAPGDVAVWDNRAT
QHRAIDDYDDQHRLMHRVTLMGDVPVDVYGQASRVISGAPMEIAG
433636491YP_007270118.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MTILILTDNVHAHALAVDLQARHGDMDVYQSPIGQLPGVPRCDVAERVAE
IVERYDLVLSFHCKQRFPAALIDGVRCVNVHPGFNPYNRGWFPQVFSIID
GQKVGVTIHEIDDQLDHGPIIAQRECAIESWDSSGSVYARLMDIERELVL
EHFDAIRDGSYTAKSPATEGNLNLKKDFEQLRRLDLNERGTFGHFLNRLR
ALTHDDFRNAWFVDASGRKVFVRVVLEPEKPVEA
433636489YP_007270116.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MKIRTLSGSVLEPPSAVRATPGTSMLKPEPGGSTIPKIPLIRPSFPGPAE
LAEDFVQIAQANWYTNFGPNERRFARALRDYLGPHLHVATLANGTLALLA
ALHVSFGAGTRDRYLLMPSFTFVGVAQAALWTGYRPWFIDIDANTWQPCV
HSARAVIERFRDRIAGILLANVFGVGNPQISVWEELAAEWELPIVLDSAA
GFGSTYADGERLGGRGACEIFSFHATKPFAVGEGGALVSRDPRLVEHAYK
FQNFGLVQTRESIQLGMNGKLSEISAAIGLRQLVGLDRRLASRRKVLECY
RTGMADAGVRFQDNAHVASLCFASACCTSADHKAAVLGSLRRHAIEARDY
YNPPQHRHPYFVTNAELVESTDLAVTADICSRIVSLPVHDHMAPDDVARV
VAAVQEAEVRGE
433636487YP_007270114.1 Putative hydrolase [Mycobacterium canettii CIPT 140070017]MADWYRPNYPEVRSRVLGLPEKVRACLFDLDGVLTDTASLHTKAWKAMFD
AYLAERAERTGEKFVPFDPAADYHTYVDGKKREDGVRSFLSSRAIEIPDG
SPDDPGAAETVYGLGNRKNDMFHKLLRDDGAQVFDGSRRYLEAVTAAGLG
VAVVSSSANTRDVLATTGLDRFVQQRVDGVTLREEHIAGKPAPDSFLRAA
ELLGVTPDAAAVFEDALSGVAAGRAGNFAVVVGINRTGRAAQAAQLRRHG
ADVVVTDLAELL
433636485YP_007270112.1 Putative multifunctional dimethylallyltransferase/farnesyl diphosphMRGTDEKYGLPPQPDSDRMTRRMLPVLGLAHELITPTLRQMADRLDPHMR
PVVSYHLGWSDERGRPVNNNCGKAIRPALVFVAAEAAGADPHSAIPGAVS
VELVHNFSLVHDDLMDRDEHRRHRPTVWALWGDAMALLAGDAMLSLAHEV
LLDCDSPHVGAALRAISEATRELIRGQAADTAFESQTDVALDECLKMAEG
KTAALMAASAEVGALLAGAPRSVREALVAYGRHIGLAFQLVDDLLGIWGR
PEITGKPVYSDLRSRKKTLPVTWTVAHGGSAGRRLAAWLVDETGSQTASD
DELAAVAELIECGGGAGGQARRPADT
433636483YP_007270110.1 GMP synthetase (glutamine aminotransferase) [Mycobacterium canettiiMVQPADIDVPETPARPVLVVDFGAQYAQLIARRVREARVFSEVIPHTASI
EEIRARQPVALVLSGGPASVYADGAPKLDPALLDLGVPVLGICYGFQAMA
QALGGTVAHTGTREYGRTELKVLGGKLHSDLPEVQPVWMSHGDAVTAAPD
GFDVVASSAGAPVAAFEACDRRLAGVQYHPEVMHTPHGQQVLSRFLHDFA
GLGAQWTPANIANALIEQVRTQIGDGHAICGLSGGVDSAVAAALVQRAIG
DRLTCVFVDHGLLRAGERAQVQRDFVAATGANLVTVDAAETFLEALSGVS
APEGKRKIIGRQFIRAFEGAVRDVLDGKTAEFLVQGTLYPDVVESGGGSG
TANIKSHHNVGGLPDDLKFTLVEPLRLLFKDEVRAVGRELGLPEEIVARQ
PFPGPGLGIRIVGEVTAKRLDTLRHADSIVREELTAAGLDNQIWQCPVVL
LADVRSVGVQGDGRTYGHPIVLRPVSSEDAMTADWTRVPYEVLERISTRI
TNEVAEVNRVVLDITSKPPATIEWE
433636481YP_007270108.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MTVAFASDQRLENGAEQLESLRRQMALLSEKVSGGPSRSGDLVPAGPVSL
PPGTVGVLSGARSLLLSMVASVTAAGGNAAIVGQPDIGLLAAVEMGADLS
RLAVIPDPGTDPVGVAAVLIDGMDLVVLGLGGRRVTRTRARAVVARARQK
GCTLLVTDGDWQGASTRLAARVCGYEITPALRGVPTPGLGRISGVRLQIN
GRGR
433636479YP_007270106.1 Putative nucleoside hydrolase IunH (purine nucleosidase) [MycobacteMSVVFADVDTGIDDALAVIYLLASPDANLVGVASTGGNIAVGQVCANNLS
LLELCGAADIPVSKGADEPLSGRWPDHPKFHGPKGIGYAELPASNRRLTE
YDATTAWIAAAHSHAGDLIGLVTGPLTNLALALRAEPALPRLLRRLVIMG
GVFGGQPITEWNIRVDPEAASEVFTAWTGQRQLPIVCGLDLTRRVAMTPD
ILARLASVCGPSPVMRVIEDALRFYFESHEARGHGYLAYMHDPLAAAVAV
DPELLTTRTATVDVDPTGATVTDWSGKRNPNARIGMSVDPAVFFDRFVER
IGRFARRT
433636477YP_007270104.1 Putative multi-functional enzyme with acyl-CoA-reductase activity AMRYVVTGGTGFIGRHVVSRLLDGRPEARLWVLVRRQSLSRFERFAGQWGD
RVRPLVGDLTELELSERTIAELGDIDHVLHCAAVHDTTWADATRAVIELA
ARLDATFHHVSSIAVAGDFAGHYTEADFDVGQRLPTPYHRMTFEAEQLVR
STPGLRYRIYRPAVVVGDSRTGEMDTIDGPYYLFGVLAKLAVLPSFTPML
LPDIGRTNIVPVDYVADALVALMHADGRDGQTFHLTAPTAIGLRGIYRGI
AGAAGLPPLLGTLPGFVAAPVLNARGRAKVLRNMAATQLGIPAEIFDVVG
CAPTFTSDTTREALRGTGIHVPEFATYAPGLWRYWAEHLDPDRARRNDPL
LGRHVIITGASSGIGRASAIAVAKRGATVFALARNGNALDELVTEIRAHG
GQAHAFTCDVTDSASVEHTVKDILGRFDHVDYLVNNAGRSIRRSVVNSTN
RLHDYERVMAVNYFGAVRMVLALLPHWRERRFGHVVNVSSAGVQARNPKY
SSYLPTKAALDAFADVVASETLSDHITFTNIHMPLVATPMIVPSRRLNPV
RAISAERAAAMVIRGLVEKPARIDTPLGTLAEAGNYVAPRLSRRILHQLY
LGYPDSAAAQGISRPDADRPPAPRRPRRSARAGVPRPLRRLGRLVPGVHW
433636475YP_007270102.1 Double hotdog hydratase [Mycobacterium canettii CIPT 140070017]MAIDPNSIGAVTEPVLFEWTDRDTLLYAIGVGAGTGDLAFTTENSHGIDQ
QVLPTYAVICCPAFGAAAKVGTFNPATLLHGSQGIRLHAPLPAAGKLWVV
TEVADIQDKGEGKNAIVALRGRGSDPESGSLVAETLTTLVLRGQGGFGGA
RGERPAAPEFPDRHPDARIDMPTREDQALIYRLSGDRNPLHSDPWFATQL
AGFPKPILHGLCTYGVAGRALVAELGGGVAANITSIAARFTKPVFPGETL
STVIWRTEPGRAVFRTEVAGSDGAEARVVLDDGAVEYVAG
433636473YP_007270100.1 Conserved protein of unknown function with PIN domain- possible toxMTAAMYLDSSAIVKLAVREPESDALRRYLRTRRPRVSSALARAEVMRALL
RQGESARKAGRRVLASLDLLRVDTRVLDLAGALLPFELRTLDAIHLATAQ
RLGADLGRLCTYDDRMRDAADTLGMAVIAPS
433636471YP_007270098.1 Integrase- catalytic region [Mycobacterium canettii CIPT 140070017]MSCRALGVSQAWFYKWCHGDGSPRRARRKALAATIGYLFAKHKRTYGSPR
ITADLRDMGWRVSVNTVAALMREQGLVARRKRRRHGTTKPDKSARKAPDL
LGRDFSPRDHPNLAWVGDLTEIPTDEGKLHLASVIDLHSRRVPGFAMGVH
HDAALARAALCMAIAVRGGSVAGVIFHTDQGGEYTGELFASACRSARVTQ
SMGRTGSALDNAAAESFNSTLEWELLRNNHFHTREEARHAVAAWIDEYNV
ERRHSTNGMLSPVDYERACGQQRSEQPAGEQHAQKRAA
433636469YP_007270096.1 Putative LytB-related protein LytB1 [Mycobacterium canettii CIPT 14MAEVFVGPVAQGCASGEVTVLLASPRSFCAGVERAIETVKRVLDVAEGPV
YVRKQIVHNTVVVAELRDRGAVFVEDLDEIPDPPPPGAVVVFSAHGVSPA
VRAGADERGLQVVDATCPLVAKVHAEAARFAARGDTVVFIGHAGHEETEG
TLGVAPRSTLLVQTPADVAALNLPEGTQLSYLTQTTLALDETADVIDALR
ARFPTLGQPPSEDICYATTNRQRALQSMVGECDVVLVIGSCNSSNSRRLV
ELAQRSGTPAYLIDGPDDIEPEWLSSVSTIGVTAGASAPPRLVGQVIDAL
RGYASITVVERSIATETVRFGLPKQVRAQ
433636467YP_007270094.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MNLVSEKEFLDLPLVSVAEIVRCRGPKVSVFPFDGTRRWFHLECNPQYDD
YQQAALRQSIRILKMLFDHGIETVISPIFSDDLLDRGDRYIVQALEGMAL
LANDEEILSFYKEHEVHVLFYGDYKKRLPSTAQGAAVVKSFDDLTISTSS
NTEHRLWFGVFGNDAAESVAQFSISWNETHGKPPTRREIIEGYYGEYVDK
ADMFIGFGRFSTFDFPLLSSGKTSLYFTVAPSYYMTETTLRRILYDHIYL
RHFRPKPDYSAMSADQLNVLRNRYRAQPDRVFGVGCVHDGIWFAEG
433636465YP_007270092.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MSISAVVFDRDGVLTSFDWTRAEEDVRRITGLPLEELERRWGGWLNGLTI
DDAFVETQPISEFLSSLARELELGSKARNELVRLDYMAFAQGYPDARPAL
EEARRRGLKVGVLTNNSLLVSARSLLQCAALHDLVDVVLSSQMIGAAKPD
PRAYRAIAEALGVSTTSCLFFDDIADWVEGARCAGMRAYLVDRSGQTRDG
VVRDLSSLGAILDGRDHDRT
433636463YP_007270090.1 Enoyl-CoA hydratase EchA18 [Mycobacterium canettii CIPT 140070017]MRRCAMTKMDEASNPCGGDIEAEMCQLMREQPPAEGVVDRVALQRHRNVA
LITLSHPQAQNALNLASWRRLKRLLDDLAGESGLRAVVLRGAGDKAFAAG
ADIKEFPNTRMSAADAAEYNESLAVCLRALTTMPIPVIAAVRGLAVGGGC
ELATACDVCIATDDARFGIPLGKLGVTTGFTEADTVARLIGPAALKYLLF
SGELIGIEEAARWGLVQKVVAPQDLAAATATLVGQICRQSAVTMRAAKVV
ANMHGRALTGADTDALIRFGVEAYEGADLREGVAAFSQGRPPKFDD
433636461YP_007270088.1 Conserved protein of unknown function- possible triacylglycerol synMAQLTALDAGFLKSRDPERHPGLAIGAIAVVNGAAPSYDQLKTVLTERIK
SIPRCTQVLATEWIDYPGFDLTQHVRRVALPRPGDEAELFRAIALALERP
LDPDRPLWECWIIEGLNGNRWAILIKIHHCMAGAMSAAHLLARLCDDADG
SAFANHVDIKQIPPHGDARSWAETLWRMSVSIAGAVCTSAARAVSWPAVT
SPAGSVTTRRRYQAVRVPRDAVDAVCHKFGVTANDVALAAITEGFRTVLL
HRGQQPRADSLPTLEKTDGSSAMLPYLPVEYDDPVRRLRTVHNRSQQSGR
RQPDSLSNYTPLMLCAKVIHALARLPQQGVVTLATSAPGPRHQLRLMGQK
MDQVLPIPPTALQLSTGVAVLSYGDELVFGITADYDAASEMQQLVNGIEL
GVARLVALSHDSVLLFTKDRHKRSSRALPSAARRGRPSVPTARARH
433636459YP_007270086.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MSVELTQEVSARLTSDHYGWLTTVARSGQPVPRLVWFYFDGTDLAVYSMP
KAAKVAHITAHPQVSLNLDSDGNGAGIIVVGGTAAVDATDVDCRDDAPYW
AKYREDAAKFGLTEAIAAYSTRLKITPTRVWTTPTG
433636457YP_007270084.1 Putative rRNA methylase [Mycobacterium canettii CIPT 140070017]MFRLLFVSPRIAPNTGNAIRTCAATGCELHLVEPLGFDLSEPKLRRAGLD
YHDLACVIVHPSLTHAWRALSPERVFAFTAQATTLFTNVGYRAGDVLMFG
PEPTGLDEATLADTHITGQVRIPMLAGRRSLNLSNAAAVAVYEAWRQHGY
PGAI
433636455YP_007270082.1 Conserved protein of unknown function- PPE family [Mycobacterium caMLMYAGAGPGPLLAAAAAWDGLAAELGAAAASFESVTSGLVGGSWRGVAA
AAMAAAAAPYAGWLGSVAAAAAEVAGQARVVVGVFEAALAATVDPAVVAA
NRMQMVQLAVSNLFGQNTPAIAAAEAVYELMWAQDVAAMAGYHAGASAAA
SALPGFGPPLPGWVGGVGAFLNSVFADSSRALQLNAGSANIGNYNVGMGN
VGEFNRGFANVGVQNLGFGNVGRGNFGYANAGSGNIGFGNSGLGMLPGVG
NMGYGNAGGGNYGLANMGVGNIGFANTGNNNIGIGLTGDNLTGIGSWNSG
VGNIGLFNSGTGNVGFFNSGTGNFGLFNSGSHNTGIGNSGTGSTGFFNAG
NFNSGLGNTGHYNTGSFNAGDTNTGDFNPGGINTGWFNTGNINTGWANSG
NVNTGAFNSGNYSNGMFLVGDYQGLNGFAGGSTIPAIPIGLGLNGGVGPI
TLQPIPIIPDVPLNIQHTVEIPPLAIPDIVVPAFFIPNSVIPAFSDGLPI
SINVGPVTVSPLKLFAAQNWSTSLTIPAGNLGTNIGQTGIIRIPAMITQA
ADGTTNSTGPIDINTNFPALTLTLNWNTPAITAFPGGLSVPNAPLDVLAT
LSVGTPGFTIPGFSIPGEPIPLTINIVGQIDGFTTPAITIDRIPLDIGAG
INVGPISIHGLDIPANPGYGNTTTAPSSGFFNTGAGGTSGFGNFGSGTSG
WWNQASSALAGAGSGFGNVGALHSGLLNVGSGLSGFYNTSALDMVTPAVV
SGVGNVGQQLSGLMWAGSDLNRTLIANIGLADVGNHNLGLGNVGDFNLGL
GNLGGHNMGLGNVGDGNVGFGNLGHGNVGFGNSGLAAGAAGLGNIGFGNA
GGGNYGLANVGLGNIGFANTGNNNIGIGLTGNNLTGFGFLNTGSANVGLF
NSGTGNTGFFNTGNGNFGLFNSGNFNTGIGNSGTGSTGLFNSGGFNTGVA
NAGHYNTGNFNAGNTNTGGFNPGSVNTGWFNTGHASTGFANSGSVSTGAF
MTADHSNGALWRGSHEGLASAYFGPFVSEFPITAHVAGQAGPAHIAPVQV
PALHFAITDASVALGPVHVDPITVPAIPLQALGSVDLGANEIGPLRALNA
LTASVSGSLNSFTLGNPLVTVHNVTLGTNSVGPIAIPSPTFTGATAGSPI
PFSLSLNVPQVTLLPDGLNILAQRVVQATVTGGNDAVTFFPGGFTIPQAS
AGVTNLVGGIDGFTLLPNGLSVTVPASVDGTVTFGAIHFPVVNVPPVPGF
GNTTTAPSSGFFNTGAGGGSGFGNFGAGMSGWGNVASNALAGAGSGFANA
GSLGSGLFNFGSGVSGIYNTSVLGPATPAAISGLGNVGQQLSGWFLAGTA
VNSTGANLGLADVGHGNVGFGNVGDVNLGLGNLGGHNLGLGNIGDGNVGF
GNLGFGNVGFGNSGLAAGMPGLGNVGSGNAGSGNLGFGNVGLGNIGLANT
GTGNIGIGLTGDNQFGIGGLNSGAGNIGLFNSGAGNVGFFNTGTGNVGLF
NSGSHNTGIGNSGLSSGGLFNAGNVNTGLANTGHYNTGSFNAGSINTGGF
NSGSLNTGWFNTGHANTGLANAGDVGTGAFLTGGQSNGFLWRGDQQGLFG
FSWGITIPEFPIHVTTTGGVGPFVIPDIDLLPPLRFGLTGEVNYGFAVPD
IPIPAIHIGFDGGAVVRFFVPNTTLLDVFDITGDVEYGPVVLRNINIPPF
PFQAVLLGSNLSGDIGPIALDPFTALAAVSQPLEIAIPEIPLEAIFIDEF
IPIAIPSIDIPASTIQGISMSGTMPIDVSADIPAVSIPGMTIPAVPLNFD
ILAIVPPTNISIIDIKPVTGFGNSTTVPSSGFFNTGGGGGSGLLNFGAGI
SGLFNVTTLDPTTPAMMSGFSNLGNHTSGLSVDGLVAMLTFPAPPSIFDP
FFDELQFLNFSNLLDLGNVGANIGFGNAGEGNSGAGNVGGSNLGFGNVGL
SNLGFGNIGDGNVGFGNIGDGNLGFGNSGVGTGLPGLGNVGFGNAGHGNY
GFANFGVGNVGFANMGNNNIGIGLVGDNLTGIGGLNSGTGNIGLFNSGTG
NVGFFNTGTGNFGLFNSGSYNTGIGNSGMVSTGLFNAGNFNTGMANAGHY
NTGSFNVGDTNTGDFNSGNVNTGWFNTGDTNTGMFNTGNVNTGAFNSGNL
NNGALWTGDRHWLAGLAFTIEIPASTIIDINETLNLGPINIPQIDIPGMS
LFDVHELINLGPFTIPQIDVPAFGLDIHETMVLDPIVFLPATGMPAQNIV
IPLSSPAGTQSSTQTFPLISMRFLNEDWIVGSVAAIPDFGDPFPAPTKGI
KITTGPGPATMGQLTISLPQINIPQIATSAIPLTIDISGGLPAFTLFPGG
LNVPQNAIPLTIDAAGVLDPLTFFPGGYTIDLPLNLALNITMPHSSVPVT
LIGANGGFGNTTPTPSSGFFNTGDGGASGFGNVGAGVSGWWNQASSALAG
AGSGYLNVGSLHSGLLNVGSGVSGFYNTSALPLETPALLSGIGNIGQQLS
GLSTAGTALNQTPIVTLGMADVGDLNVGFGNVGNLNLGLGNLGLQNLGLG
NLGDGNVGFGNVGHGNVGFGNSGLGALAGSNIGFANTGSGNLGLANMGLG
NIGFANTGTGNIGIGLVGDNLTGIGGLNAGTGNIGLFNSGTGNVGFFNSG
AGNFGMFNSGSYNTGIGNSGTASTGLFNAGNFNTGMANVGHYNTGNFNTG
NTNTGDFNPGDTNTGWFNTGHTNTGFANSGNVGTGAFMSANYSNGLFWRG
EYQGLFSYAYHLDVPTITIMDAHLDAAFGPVVLPPIPVPAAHVALGGNVA
MGAFTIPEITIAVPNADITGSVNVGPFTLPSVTVPSLSATIRQVMAASTG
AELRIDPIEIWTQGNNGLGVTFYTFGSRVNILESPYAQDPIVLGPGMSGG
SDMTINLATQAFGTPVISIGQIPVGFHAPASIDAITLFPGGLTFPSASLL
NLNVDAFTEAITIPAISWPVMSANADGALYVVASQVPAINIPPSPGIGNT
TTAPSSGFFNTGGGGVSGFGNFGAGTSGWWNQAHSALAGTASGFANAGSL
GSGVLNLGSGVSGFHNTATLPLGTPAMVSGLGTLGQQLSGLLSNGAVNVG
LADLGDFNVGLGNVGDLNVGAANIGGHNLGLGNIGDGNVGFGNIGHGNLG
FGNAALGALAGGNVGWGNAGSGNLGLANLGAANIGFANTGTNNIGIGLVG
DNLTGIGGLNSGAGNVGLFNSGTGNVGFFNTGTGNFGLFNSGSYNTGIGN
SGIASTGFFNAGNFNTGLANTGHYNTGSFNAGSTNTGDFNPGNTNTGWFN
TGHANTGLGNAGNVNTGAFIAGTNSNGMLWRGNLQGLIGYELGYTLPQFP
AVAADVDGGVGPLTVLPHIIIPSIPWGITATGDVGPIVIPSFDIPSIHLG
LNPAIDVGSITVAPITLTTPGLTIGPITTADIQNTSGSMSEVWVKPSFLP
GGVRLVEATAGGAISIAEGFTINAVSWNPATVNFPGFTIPLEPIHIEVPL
SVTIPGFTIPGGEIPLLPLGLGLSNGTPVIDIPSLGVIDRIPLELHAATI
LGPVNVPIFGIGGTPGFGNATTAPSSGFFNLGGGGGSGFWNTGTAMSGWF
NAISDPLLGGASGFDNFGTQLSGLRNRGAGLSGMFNTGALGLVVQAFNSG
FANVGQQLSGWLYTGTGPS
433636453YP_007270080.1 Conserved protein of unknown function- PE-PGRS family protein (fragMGGNGANGINGGLQQDGTDAKAGGEGGQGGQGGQGGQGGARGGANPLNGG
TFGTAGDGGNGGTGGTGGTGGTGGTGGNGGGVNLVSVDEVAGQGGRGGDG
GTGGKAGTGGAGGAAGGPGGSTGATGAGGIQGNGGHGGNGGAGGSAVTGS
DFTTNPEAGQGGNGGNGGTGANGGNGGTGGRGGDAGTGIHRDGERGGTGG
LGGTGLNGAGGRGGDGGDSGNGATAGVLIPPGNGGIGGNGAGGGAGNGGP
GGDGGNGGTGGKGGTALAGGTGGTGGGGGAGGKGGTGIIDGITYPGSSGG
TAGSGSGPNGQSGGAGGAGAPGGKGGGP
433636451YP_007270078.1 Conserved protein of unknown function- putative toxin [MycobacteriuMRSVNFDPNAWEDFLFWLAADRKTARRITRLIGEIQRDPFSGIGKPEPLQ
GELSGYWSRRIDDEHRLVYRAGDDDVTMLKARYHY
433636449YP_007270076.1 Putative bifunctional protein FolD: methylenetetrahydrofolate dehydMGAIMLDGKATRDEIFVDLKERVAALDAAGRTPGLGTILVGADPGSQAYV
RGKHADCAKVGITSIRRDLPADISQATLDETIDELNANPDCTGYIVQLPL
PKHLDENAALERVDPAKDADGLHPTNLGRLVLGTPAPLPCTPRGIVHLLR
RYDVAIAGAHVVVIGRGVTVGRPLGLLLTRRSENATVTLCHTATRDLPAL
TRQADIIVAAVGVPHLLTADMVRPGAAVVDVGISRADDGLVGDVHPDVWE
LAGHVSPNPGGVGPLTRAFLLTNVVELAERG
433636447YP_007270074.1 Putative methyltransferase (methylase) [Mycobacterium canettii CIPTMTCSRRNMSLSFGSAVGAYERGRPSYPPEAIDWLLPAAACRVLDLGAGTG
KLTTRLVERGLDVVAVDPIPEMLDVLRAALPQTVALLGTAEEIPLDDNSV
DAVLVAQAWHWVDPARAIPEVARVLRPGGRLGLVWNTRDERLGWVRELGE
IIGRDGDPVRDRVTLPEPFTTVQRHQVEWTNYLTPQALIDLVASRSYCIT
SPAQVRTKTLDRVRQLLATHPALANSNGLALPYVTVCVRASLT
433636445YP_007270072.1 O-acetylhomoserine (thiol)-lyase [Mycobacterium canettii CIPT 14007MSADSNSTDADPTAHWSFETKQIHAGQHPDPTTNARALPIYATTSYTFDD
TEHAAALFGLEIPGNIYTRIGNPTTDVVEQRIAALEGGVAALFLSSGQAA
ETFAILNLAGTGDHIVSSPRLYGGTYNLFHYSLAKLGIEVSFVDDPDDLD
TWQAAVQPNTKAFFAETISNPQIDILDTPAVSEVAHRNGVPLIVDNTIAT
PYLIQPLAQGADIVVHSATKYLGGHGAAIAGVIVDGGTFDWTQGRFPGFT
TPDPSYHGVVFAELGPPAFALKARVQLLRDYGSAASPFNAFLVAQGLETL
SLRIERHVANAQRVAEFLAAHQDVLSVNYAGLPSSPWYERGKKLAPKGTG
AVLSFELAGGIEAGKAFVNALKLHSHVANIGDVRSLVIHPASTTHAQLSP
AERLATGVSPGLVRLAVGIEGIDDILADLELGFAAARTFSADPQSVAAF
433636443YP_007270070.1 Putative transposase [Mycobacterium canettii CIPT 140070017]MRNVRLFRALLGVDKRTVIEDIEFEEDDAGDGARVIARVRPRSAVLRRCG
RCGRKASWYDRGAGLRQWRSLDWGTVEVFLEAEAPRVNCPTHGPTVVAVP
WARHHAGHTYAFDDTVAWLAVACSKTAVCELMRIAWRTVGAIVARVWADT
EKRIDRFANLRRIGIDEISYKRHHRYLTVVVDHDSGRLVWAAPGHDKATL
GLFFDALGAERAAQITHVSADAADWIADVVTERCPDAIQCADPFHVVAWA
TEALDVERRRAWNDARAIARTEPKWGRGRPGKNAAPRPGRERARRLKGAR
YALWKNPEDLTERQSAKLAWIAKTDPRLYRAYLLKEGLRHVFSVKGEEGK
QALDRWISWAQRCRIPVFVELAARIKRHRVAIDAALDHGLSQGLIESTNT
KIRLLTRIAFGFRSPQALIALAMLALAGHRPTLPGRHNHPQISQ
433636441YP_007270068.1 Putative tryptophanyl-tRNA synthetase TrpS (tryptophan--tRNA ligaseMSTPTGSRRIFSGVQPTSDSLHLGNALGAVAQWVGLQDDHDAFFCVVDLH
AITIPQDPEALRRRTLITAAQYLALGIDPGRATIFVQSQVPAHTQLAWVL
GCFTGFGQASRMTQFKDKSARQGSEATTVGLFTYPVLQAADVLAYDTELV
PVGEDQRQHLELARDVAQRFNSRFPGTLVVPDVLIPKMTAKIYDLQDPTS
KMSKSAGTDAGLINLLDDPALSAKKIRSAVTDSEREIRYDPDVKPGVSNL
LNIQSAVTGTDIDVLVDGYVGHGYGDLKKDTAEAVVEFVNPIQARVDELT
ADPAELEAVLAAGAQRAHDVASKTVHRVYDRLGFLP
433636439YP_007270066.1 Putative transcriptional regulatory protein (probably MerR-family) MKISEVAALTNTSTKTLRFYEDSGLLAPPARTASGYRNYGPEIVDRLRFI
HRGQAAGLTLQEVRQILAIHDRGEAPCAHVRQLLSTRIDEVRAQIAELIA
LEGHLQTLLDHASYGPPTEHDHSTVCWILESDLDEPTAIEVSDIHA
433636437YP_007270064.1 Putative N-acetylglucosamine-6-phosphate deacetylase NagA (GlcNac 6MTVLGADAVVIDGRICRPGWVHTAGGRILAGGAGVPPVPADAEFPDAIVV
PGFVDMHVHGGGGTSFADGNAADIAHAAEFHLRHGTTTTLASLVTAGPAE
LLSAVGALAEATRDGVVAGIHLEGPWLSPARCGAHDHTRMRAPDPAEIES
VLAAADGAVRMVTLAPELPGSDAAIRRFRDAGVVVAVGHTDATYTQTRHA
IDLGATVGTHLFNAMPPLDHRAPGPVLALLCDPRVTVEIIADGVHVHPAV
VHAVIEAVGPDRLAVVTDAIAAAGCGDGEFRLGTMPIEVESGVARVAGAS
TLAGSTATMDQLFRTVAGLGSKSDSAGDVALAAAVQVTSATPARALGLTG
VGRLAAGYAANLVVLDCDLRVTAVMVNGDWRVG
433636435YP_007270062.1 Putative penicillin-binding protein DacB1 (d-alanyl-d-alanine carboMAFLRSVSCLAAAVFAVGTGIGLPTAAGEPNAAPAACPYKITTPPAVDSS
EVPAAGEPPLPLVVPPTPVGGNALGGCGIITAPGSAPAPGDVSAEAWLVA
DLDSGAVIAARDPHGRHRPASVIKVLVAMASINTLTLNKSVAGTADDAAV
EGTKVGVNTGGTYTVNQLLHGLLMHSGNDAAYALARQLGGMPAALEKINL
LAAKLGGRDTRVATPSGLDGPGMSTSAYDIGLFYRYAWQNPVFADIVATR
TFDFPGHGDHPGYELENDNQLLYNYPGALGGKTGYTDDAGQTFVGAANRD
GRRLMAVLLHGTRQPIPPWEQAAHLLDYGFSTPAGTQIGTLIEPDPSLMS
TDSNPADRQGVDPRAAARISAADALPVRVGVAIIGTLIVFGLIMVARAMN
RRPQH
433636433YP_007270060.1 Putative alternative RNA polymerase sigma factor SigJ [MycobacteriuMEVSEFEALRQHLMSVAYRLTGTVADAEDIVQEAWLRWDSRDTVIADPRA
WLTTVVSRLGLDKLRSAAHRRETYIGTWLPEPVVTGLDATDPLAAVVAHE
DARFAAMVVLERLRPDQRVAFVLHDGFAVPFAEVAEVLGTSEAAARQLAS
RARKAVAAAPAPAPDPAHNEVVGRLMAAMAAGDLDTVVSLLHPDVTFTGD
SNGKAPTAVRAVRGSDKVVRFILGLVQRYGPGLFGANQLALVNGELGAYT
AGLPGVDGYRAMAPRITAITVRDGKVCALWDIANPDKFTGSPLKERQAQP
TGRGRHHRN
433636431YP_007270058.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MSYSYFVELPRLEDIEPGAHTDVLIANSRVDQGRIRAAVEAVFDAHPALG
TVFEPRVDTLTSRPGGGGWGWGVEPPGAAVAEVIARHSASFDMYTGRLFA
VSLLPGSPDRLVLTASRLCVDDASWQTVVEDLVRQYDESVLVPAR
433636429YP_007270056.1 Molybdopterin cofactor biosynthesis protein A [Mycobacterium canettMGDLRLSVIDQCNLRCRYCMPEAEYAWLPRADLLSVDEISLIVDAFIAVG
VDKIRLTGGEPLIRSDLAAIIEVISAKVGDGSGLQDLAITTNGVLLADQA
RKLKSAGMRRITISLDTLRPDRFKAISQRGTHYKVIEGIEAVAAAGFTDT
KLDSVVIRGFNDDELSDLIEFARNVNAEVRFIEYMDVGGATQWSMDKVFT
KAQMLSTLGKKYGPIAALPKYDSAPANRYRLPDGTTFGIIASTTEPFCAT
CDRSRLTADGIWLHCLYALSGINLRESVRAGASANDVVQILQRGWRDRAN
RGAEQRLAQRTRQVFLPVSRLKRDPHLEMHTRGG
433636427YP_007270054.1 Molybdenum cofactor biosynthesis protein C3 MoaC3 [Mycobacterium caMQPAGGTVNDHDGVLTHLDEQGAARMVDVSAKAVTLRRARASGAVLMKPS
TLDMICHGTAAKGDVIATARIAGIMAAKRTGELIPLCHPLGIEAVTVTLE
PQGADRLSIAAAVTTVARTGVEMEALTAVAVTALTVYDMCKAVDRAMTIT
DIRLDEKSGGRSGHYRRHDADVKPSDGGSTEDGC
433636425YP_007270052.1 Putative methyltransferase [Mycobacterium canettii CIPT 140070017]MSVQTDPALREHPNRVDWNARYERAGSAHAPFAPVPWLADVLRAGVADGP
VLELASGRSGTALALAAHGRQVTAIDVSDVALLQLESEAVRRGVADRLNL
VQADLGCWEPGETRFALVLSRLFWDAAIFHRACEAVMPGGVLAWESLALS
GAEAGTASAKRRVKPGEPACLLPADFTVVHEGQGSCDSAPSRIMIARRSP
LPGA
433636423YP_007270050.1 Conserved protein of unknown function with PIN domain [MycobacteriuMRALLDVNVLLALLDRDHVDHERARAWITGQIERGWASCAITQNGFVRVI
SQPRYPSPISVAHAIDLLARATHTRYHEFWSCTVSILDSKVIDRSRLHSP
KQVTDAYLLALAVAHDGRFVTFDQSIALTAVPGATKQHLATL
433636421YP_007270048.1 Succinate dehydrogenase- flavoprotein subunit [Mycobacterium canettMICQHRYDVVIVGAGGAGMRAAVEAGPRVRTAVLTKLYPTRSHTGAAQGG
MCAALANVEDDNWEWHTFDTVKGGDYLADQDAVEIMCKEAIDAVLDLEKM
GMPFNRTPEGRIDQRRFGGHTRDHGKAPVRRACYAADRTGHMILQTLYQN
CVKHDVEFFNEFYALDLALTQTPSGPVATGVIAYELATGDIHVFHAKAVV
IATGGSGRMYKTTSNAHTLTGDGIGIVFRKGLPLEDMEFHQFHPTGLAGL
GILISEAVRGEGGRLLNGEGERFMERYAPTIVDLAPRDIVARSMVLEVLE
GRGAGPLKDYVYIDVRHLGEEVLEAKLPDITEFARTYLGVDPVTELVPVY
PTCHYLMGGIPTTVTGQVLRDNTSVVPGLYAAGECACVSVHGANRLGTNS
LLDINVFGRRAGIAAASYAQGHDFVDMPPNPEAMVVGWVSDILSEHGNER
VADIRGALQQSMDNNAAVFRTEETLKQALTDIHALKERYSRITVHDKGKR
FNTDLLEAIELGFLLELAEVTVVGALNRKESRGGHAREDYPNRDDVNYMR
HTMAYKEIGADKEGPELRSDVRLDFKPVVQTRYEPKERKY
433636419YP_007270046.1 Putative succinate dehydrogenase (cytochrome B-556 subunit) SdhC (SMWSWVCHRISGATIFFFLFVHVLDAAMLRVSPQTYNAVLATYKTPIVGLM
EYGLVAAVLFHALNGIRVILIDFWSEGPRYQRLMLWIISSVFLLLMVPAG
VVVGIHMWEHFR
433636417YP_007270044.1 Putative thymidine phosphorylase DeoA (TDRPase) (pyrimidine phosphoMTDFAFDAPTVIRTKRDGGRLSDAAIDWVVKAYTDGRVADEQMSALLMAI
VWRGMDRGEIARWTAAMLASGARLDFTDLPLATVDKHSTGGVGDKITLPL
VPVVAACGGAVPQASGRGLGHTGGTLDKLESITGFTANLSNQRVREQLCD
VGAAIFAAGQLAPADAKLYALRDITGTVESLPLIASSIMSKKLAEGAGAL
VLDVKVGSGAFMRSPVQARELAHTMVELGAAHGVPTRALLTEMNCPLGRT
VGNALEVAEALEVLAGGGPPDVVELTLRLAGEMLELAGIHGRDPAQTLRD
GTAMDRFRRLVAAQGGDLSKPLPIGSHSETVTAGASGTMGDIDAMAVGLA
AWRLGAGRSRPGARVQHGAGVRIHRRPGEPVVVGEPLFTLYTNAPERFGA
ARAELAGGWSIRDSPPQVRPLIVDRIV
433636415YP_007270042.1 Conserved protein of unknown function- secreted protein antigen [MyMYRFACRTLMLAACILATGVAGLGVGAQSAAQTAPVPDYYWCPGQPFDPA
WGPNWDPYTCHDDFHRDSDGPDHSRDYPGPILEGPVLEDPGAAPPPPAAG
GGA
433636413YP_007270040.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MLPDRRALAYLEWGDSTGYPAFYFHGTPSSRLEGAFADGAARRTGFRLIA
IDRPGYGRSTFQAGRNFRDWPADVCALADAFELEEFGVVGHSGAGPHLFA
CGAVIPRTRLAFVGALGPWGPLATPDIMRSLNAADRCYARLARSGPRLFG
ALFAPLGWCAKYTPGLFSTLLAAAVPAADKHLLSDERFGRHLRAIQLEAF
RQGSRGAAYESFLQFRPWGFDLAEVAVPTHIWLGDRDSFVPRAMGEYLQR
AIPHVDLHWAHGKGHFNIEDWDAILAACALDIGKRRGG
433636411YP_007270038.1 Acid phosphatase (acid phosphomonoesterase) (phosphomonoesterase) (MLRGIQALSRRLTRVYRALAVIGVLAASLLASWVGAVPQVGLAASALPTF
AHVVIVVEENRSQAAIIGNKSAPFINSLAANGAMMAQAFAETHPSEPNYL
ALFAGNTFGLTKNTCPVNGGALPNLGSELLSAGYTFMGFAEDLPAVGSTV
CSAGKYARKHVPWVNFSNVPATLSVPFSAFPKPQNYPGLPTVSFVIPNAD
NDMHDGSIAQGDAWLNRHLSAYANWAKTNNSLLVVTWDEDDGSSRNQIPT
VFYGAHVRPGTYNETISHYNVLSTLEQIYGLPKTGYATNAPPITDIWGD
433636409YP_007270036.1 Putative phosphomannomutase PmmB (phosphomannose mutase) [MycobacteMTPENWIAHDPDPQTAAELAACGPDELKARFSRPLAFGTAGLRGHLRGGP
DAMNLAVVLRATWAVARVLTDRGLAGSPVIVGRDARHGSPAFAAAAAEVL
AAAGFSVLLLPDPAPTPVVAFAVRHTGAAAGIQITASHNPATDNGYKVYV
DGGLQLLAPTDRQIEAAMATAPPADQIARKTVNPSDNRASDLIDRYIQRA
AGVRRCAGSVRVALTPLHGVGGAMAVETLRRAGFTEVHTVATQFAPNPDF
PTVTLPNPEEPGATDALLTLATDVDADVAIALDPDADRCAVGIPTVSGWR
MLSGDETGWLLGDYILSQTDDQASPPETRVVASTVVSSRMLAAIAAHHAA
VHVETLTGFKWLARADANLPGTLVYAYEEAIGHCVDPTAVRDKDGISAAV
LVCDLVAALKGQGRSVTDALDELARCYGVHEVAALSRPVGGAVETTDLMR
RLREDPPRRLAGFPATVTDIGDTLILTGGDDNMLVRVAVRPSGTEPKLKC
YLEIRCAVTGDLPAARQLVRARIDELSASVRRWW
433636407YP_007270034.1 Putative amidohydrolase AmiB1 (aminohydrolase) [Mycobacterium canetMPAASASDRVEELVRRRGGELVELSHAIHAEPELAFAEHRSCAKAQALVA
ERGFEITTAAGGLDTAFRADYGSGPLVVGVCAEYDALPGIGHACGHNIIA
ASAVGTALALAEVADDLGLTVALLGTPAEESGGGKALMLQAGTFDDVAVA
VMVHPGPTDIAGARSLALSEVTVRYRGKESHAAVAPHLGVNAADAVTVAQ
VAIGVLRQQLAPGQMVHGIVTDGGQAVNVIPGQARLQYAMRAVESDSLRE
LQTRMFACFAAGALAAGCEYEIDEAAPAYAELKPDPWLADVCREEMQRLG
REPLLPALEAELPLGSTDMGNVTQVLPGIHPVIGLDAGAATVHQRAFTVA
SAGASADRAVVDGAIMLARTVVRLAQTPDERDRVLAAQQRRAAR
433636405YP_007270032.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MPLYAAYGSNMHPEQMLERAPHSPMAGTGWLPGWRLTFGGEDIGWEGALA
TVVEDPDSKVFVVLYDMTPADEKNLDRWEGSEFGIHQKIRCRVERISSDT
TTDPVLAWLYVLDAWEGGLPSARYLGVMADAAEIAGAPSDYVHDLRTRPA
RNIGPGTIA
433636403YP_007270030.1 Glycerol-3-phosphate dehydrogenase 2 [Mycobacterium canettii CIPT 1MSNPIQAPDGGQGWPAASLGPAQRAVAWKRLGTEQFDVVVIGGGVVGSGC
ALDAATRGLKVALVEARDLASGTSSRSSKMFHGGLRYLEQLEFGLVREAL
YERELSLTTLAPHLVKPLPFLFPLTKRWWERPYIAAGIFLYDRLGGAKSV
PAQRHFTRAGALRLSPGLKRSSLIGGIRYYDTVVDDARHTMTVARTAAHY
GAVVRCSTQVVALLREGDRVIGVGVRDSENGAVAEVRGHVVVNATGVWTD
EIQALSKQRGRFQVRASKGVHVVVPRDRIVSDVAMILRTEKSVMFVIPWG
SHWIIGTTDTDWNLDLAHPAATKADIDYILGTVNAVLATPLTHADIDGVY
AGLRPLLAGESDDTSKLSREHAVAVPAAGLVAIAGGKYTTYRVMAADAID
AAVQFIPARVAPSITEKVSLLGADGYFALVNQAEHVGALQGLHPYRVRHL
LDRYGSLISDVLAMAASDPSLLSPITEAPGYLKVEAAYAAAAEGALHLED
ILARRMRISIEYPHRGVDCAREVAEVVAPVLGWTAADIDREVANYMARVE
AEVLSQAQPDDVSADMLRASAPEARAEILEPVPLD
433636401YP_007270028.1 Pseudouridine synthase [Mycobacterium canettii CIPT 140070017]MALRPEDRLLSVHDVLGPVRVRLLGGSVLAELTARFGVTARAKVLAGEVV
DDDGAVVDSGTVLPPGSVVHLYRDLPDEVPVPFDVPVLHQDADIVVVDKP
HFLATMPRGRHVAQTALVRLRRELGLPELSPAHRLDRLTAGVLLFTTRRE
VRGSYQTMFARGLVRKTYLARAPVAPGLALPRLVRSRIVKRRGHLQAVCE
PGVPNAETLVERIARDGLYRLTPTTGRTHQLRVHMAALGIPIMGDPLYPN
VISVAAHDFSTPLQLLAQRIEFDDPLTGSHRAFASTRTLTGATLPTWSAA
ADSRP
433636399YP_007270026.1 Putative esterase lipoprotein LpqC [Mycobacterium canettii CIPT 140MPWARMLSLIVLMVCLAGCGGDQLLARHASSVATFQFGGLTRSYRLHVPP
AEPSGLVISLHGGGGTGAGQEALTDFDAVADAADLLVVYPDGYDKSWADG
RGASPADRRHLDDVGFLVALAAKLVHDFDIAPGHVFATGMSNGGFMSNRL
ACDRADIFAAVAPVAGTLGVGVTCNPSRPVSVLEVHGTADPLVPFNGGAV
RGRGGLSHSISVASLVDRWRAVDGCQGDPSAAELPDVGDGTVVHLFDSSS
CAAGTEVISYQIDNGGHTWPGGRQYLPKAVIGATTRAFDGSQVIAQFFAT
HGRD
433636397YP_007270024.1 Putative ATP-dependent helicase Lhr (large helicase-related proteinMRFAQPSALSRFSALTRDWFTSTFAAPTAAQASAWAAIADGDNTLVIAPT
GSGKTLAAFLWALDSLASSAPVSERPAATRVLYVSPLKALAVDVERNLRT
PLAGLTRLAERQGLPAPQIRVGVRSGDTPPALRRQLVSQPPDVLITTPES
LFLMLTSAARQTLTGVQTVIIDEIHAIAATKRGAHLALSLERLDDLSSGR
RAQRIGLSATVRPPEELARFLSGQSPTTIVAPPAAKTVELSVQVPVPDMA
NLTDNTIWPDVEARLVDLIESHNSTIVFANSRRLAERLTARLNEIHAARC
GIELAPDTNQQVPGGAPAHVMGSGQTFGAPPVLARAHHGSISKEQRAVVE
EDLKRGQLKAVVATSSLELGIDMGAVDLVIQVQAPPSVASGLQRIGRAGH
QVGEISRGVLFPKHRTDLLGCAVSVQRMLAGEIETMRVPANPLDILAQHT
VAAAALEPLDADAWFDTVRRAAPFATLPRSLFEATLDLLSGKYPSTEFAE
LRPRLVYDRDTGTLTARPGAQRLAVTSGGAIPDRGLFAVYLATERPSRVG
ELDEEMVYESRPGDVISLGATSWRITEITHDRVLVIPAPGQPARLPFWRG
DDAGRPAELGAALGALTGELAALDRTAFGTRCAGLGFDDYATDNLWRLLD
DQRTATAVVPTDSTLLVERFRDELGDWRVILHSPYGLRVHGPLALAVGRR
LRDRYGIDEKPTASDNGIVVRLPDTVSAGEDSPPGAELFVFDADEIDPIV
TTEVAGSALFASRFRESAARALLLPRRHPGRRSPLWQQRQRAARLLEVAR
KYPDFPIVLETVRECLQDVYDVPILVELMARIAQRRVRVAEAETAKPSPF
AASLLFGYVGAFMYEGDTPLAERRAAALALDSTLLAELLGRVELRELLDP
DVIAATSRQLQHLAADRVARDAEGIADLLRLLGPLTEDEIAARAGAPEVS
GWLDGLRAAKRALAVSFAGRSWWVAVEDMGRLRDGVGAAVPVGLPASFTE
AVADPLGELLGRYARTHTPFTTAAAAARFGLGLRVTADVLGRLASDGRLV
RGEFVATAEGSAGGEQWCDAEVLRILRRRSLAALRAQAEPVSTAAYGRFL
PAWQHVSAGNSGIDGLAAVIDQLAGVRIPASAIEPLVLAPRIRDYSPAML
DELLASGDVTWSGAGSISSSDGWIALHPADSAPMTLAEPAEIDFTDAHRA
ILASLGSGGAYFFRQLTHDGLTEAELKAALWELIWAGRVTGDTFAPVRAV
LGGAGTRKRAAPAHRGHRPPRLSRYRLTHAQARNADPTVAGRWSALPLPE
PDSTLRAHYQAELLLNRHGVLTKGAVATEGVAGGFATLYKVLSAFEDAGR
CQRGYFIESLGGAQFAVASTVDRLRSYLDGVDPERPDYHAVVLAAADPAN
PYGAALPWPASSADGTARPGRKAGALVVLVDGELAWFLERGGRSLLTFTD
DPEANHAAAIGLADLVTAGRVASILVERADGMPVLQPGGRASAALTALLA
AGFVRTPRGLRRR
433636395YP_007270022.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MNPPSRIARNLLPRVAEALIDTRIVVVQGARQVGKSTLAAEITGRLGGRL
VTLDDDLTRTTAAADPYSFVRQFPDGLLTIDEVQRVPELVLALKATVDAN
HRPGRYLLTGSANLLQLPATEDSLAGRVESLELFGFSQGELEGVTETFID
RLFAGDLFLGHKSDLARHDYLARACSGGYPEAVSRKSTRRRNAWLDNYVD
RVVKRDAADVSNLQRIADLPRLIRLLAARSASELNLSSLATNAEIPVRTL
PPYLDLLETLYLIDRIPAWSTNLSKRVVDRPKVLLLDSGLAARLVNVSPT
GAGPHANPNAAGAIIETFVIAELRRQLGWSQQAPRLFHYRDRDGAEVDLI
LETADGLIAAIEIKSAATLRGRDTRSISRLRDKLGARFAGGVILHTGPQA
QPFGDRLAAVPIDILWSPSG
433636393YP_007270020.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MSRPKRLQTGQLRARFAAGLSAMYAAEVPAYGTLVEVCAQVNSDYLTRHR
RAERLGSLQRVTAERHGAIRVGNPAELAAVADLFAAFGMLPVGYYDLRTA
ESPIPVVSTAFRPIDANELAHNPFRVFTSMLAIEDRRYFDADLHTRVQTF
LARRQLFDPALLAQARAIAADGGCDADDAPAFVAAAVAAFALSREPVEKS
WYDELSRVSAVAADIAGVGSTHINHLTPRVLDIDDLYRRMTERGITMIDT
IQGPPRTDGPDVLLRQTSFRALAEPRMFRDEDGTVTPGILRVRFGEVEAR
GVALTPRGRERYEAAMAAADPAAVWATHFPSTDAEMAAQGLAYYRGGDPS
APIVYEDFLPASAAGIFRSNLDRDSQTGDGPDDAGYNVDWLAGAIGRHIH
DPYALYDALAQEERR
433636391YP_007270018.1 Putative L-lysine-epsilon aminotransferase Lat (L-lysine aminotransMAAVVKSVALAGRPTTPDRVHEVLGRSMLVDGLDIVLDLTRSGGSYLVDA
VTGRRYLDMFTFVASSALGMNPPALVDDREFHAELMQAALNKPSNSDVYS
VAMARFVETFARVLGDPALPHLFFVEGGALAVENALKAAFDWKSRHNQAH
GIDPALGTQVLHLRGAFHGRSGYTLSLTNTKPTITARFPKFDWPRIDAPY
MRPGLDEPAMAALEAEALRQARAAFETRPHDIACFVAEPIQGEGGDRHFR
PEFFAAMRELCDEFDALLIFDEVQTGCGLTGTAWAYQQLDVAPDIVAFGK
KTQVCGVMAGRRVDEVADNVFAVPSRLNSTWGGNLTDMVRARRILEVIEA
EGLFERAVQHGKYLRARLDELAADFPAVVLDPRGRGLMCAFSLPTTADRD
ELIRQLWQHAVIVLPAGADTVRFRPPLTVSTAEIDAAIAAVRSALPAVT
433636389YP_007270016.1 Conserved protein of unknown function- UsfY [Mycobacterium canettiiMGPIPPQPVRRVLPLMVVPGNGQKWRNRTETEEAMGDTYRDPVDHLRTTR
PLAGESLIDVVHWPGYLLIAAGVVGGVGALAAFGTGHHAEGMTFGVVAIV
VTVVGLAWLAFEHRRIRKIADRWYTEHPEVRRQRLAG
433636387YP_007270014.1 RNA polymerase Sigma-F factor [Mycobacterium canettii CIPT 14007001MTARAAGGSASRANEYADVPEMFRELVGLPAGSPEFQRHRDKIVQRCLPL
ADHIARRFEGRGEPRDDLIQVARVGLVNAAVRFDVKTGSDFVSFAVPTIM
GEVRRHFRDNSWSVKVPRRLKELHLRLGTATADLSQRLGRAPSASELAAE
LGMDRAEVIEGLLAGSSYHTLSIDSGGGSDDDARAITDTLGDVDAGLDQI
ENREVLRPLLEALPERERTVLVLRFFDSLTQTQIAERVGISQMHVSRLLA
KSLARLRDQLE
433636385YP_007270012.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MTAPASLPAPLAEVVSDFAEVQGQDKLRLLLEFANELPALPSHLAESAME
PVPECQSPLFLHVDASDPNRVRLHFSAPAEAPTTRGFASILAAGLDEQPA
ADILAVPEDFYTELGLAALISPLRLRGMSAMLARIKRRLREAD
433636383YP_007270010.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MTRLVLGSASPGRLNVLRDAGIEPLVIASHVDEDVVIAALGPDAVPSDVV
CVLAAAKAAQVATTVTGTQRVVAADCVVVACDSMLYIEGRLLGKPTSIDE
AREQWRSMAGRAGQLYTGHCVIRLQDNKTVYRAAETAITTVYFGTPSASD
LEAYLASGESLRVAGGFTLDGLGGWFIDGVQGNPSNVIGLSLPLLRSLVQ
RCGLSVAALWTGNAGGQA
433636381YP_007270008.1 Putative propionyl-CoA carboxylase beta chain 5 AccD5 (PCCase) (proMTSVTDRSAHSAERSTEHTIDIHTTAGKLAELHKRREESLHPVGEDAVEK
VHAKGKLTARERIYALLDEDSFVELDALAKHRSTNFNLGEKRPLGDGVVT
GYGTIDGRDVCIFSQDATVFGGSLGEVYGEKIVKVQELAIKTGRPLIGIN
DGAGARIQEGVVSLGLYSRIFRNNILASGVIPQISLIMGAAAGGHVYSPA
LTDFVIMVDQTSQMFITGPDVIKTVTGEEVTMEELGGAHTHMAKSGTAHY
AASGEQDAFDYVRELLSYLPPNNSTDAPRYQAAAPTGPIEENLTDEDLEL
DTLIPDSPNQPYDMHEVITRLLDDDEFLEIQAGYAQNIVVGFGRIDGRPV
GIVANQPTHFAGCLDINASEKAARFVRTCDCFNIPIVMLVDVPGFLPGTD
QEYNGIIRRGAKLLYAYGEATVPKITVITRKAYGGAYCVMGSKDMGCDVN
LAWPTAQIAVMGASGAVGFVYRQQLAEAAANGEDIDELRLRLQQEYEDTL
VNPYVAAERGYVDAVIPPSHTRGYIGTALRLLERKIAQLPPKKHGNVPL
433636379YP_007270006.1 Conserved membrane protein of unknown function [Mycobacterium canetMSYLENVLAAGEQVVLHRHPHWNRLIWPVVVLVLVTGLAAFGSGFVNSTP
WQQIAKNVIHAVIWGIWLVIVGWLTLWPFLSWLTTHFVVTNRRVMFRRGV
LTRSGIDIPLARINSVEFRDRIFERIFRTGTLIIESASQDPLEFYNIPRL
REVHALLYHEVFDTLGSDESPS
433636377YP_007270004.1 N5-carboxyaminoimidazole ribonucleotide synthase [Mycobacterium canMMAVASSRTPAVTSFVAPLVAMVGGGQLARMTHQAAIALGQNLRVLVTAA
DDPAAQVTPNVVIGSHTDLAALRRVAAGADVLTFDHEHVPNELLEKLVAD
GVNVAPPPQALVHAQDKLVMRQRLAAAGVSMPRYAGIKDPAEIDVFAARV
DAPIVVKAVRGGYDGRGVRMARDLADARDFARECLADGVAVLVEERVELR
RELSALVARSPFGQGAAWPVVQTVQRDGTCVLVIAPAPALPDDLATAAQR
LALRLAAELDVVGVLAVELFETTDGALLVNELAMRPHNSGHWTIDGARTS
QFEQHLRAVLDYPLGDTDAVAPVTVMANVLGAAQPPVISVDERLHHLFAR
MPDARVHLYGKAERPGRKVGHINFLGSDVVQLCERAELAAHWLSHGQWTD
GWDPHRAGDDAQRSDEEERRQ
433636375YP_007270002.1 Putative acyl-CoA dehydrogenase FadE25 [Mycobacterium canettii CIPTMAGWAGNPSFDLFKLPEEHDEMRSAIRALAEKEIAPHAAEVDEKARFPEE
ALVALNSSGFNAVHIPEEYGGQGADSVATCIVIEEVARVDASASLIPAVN
KLGTMGLILRGSEELKKQVLPALATEGAMASYALSEREAGSDAASMRTRA
KADGDHWILNGAKCWITNGGKSTWYTVMAVTDPDRGANGISAFMVHKDDE
GFTVGPKERKLGIKGSPTTELYFENCRIPGDRIIGEPGTGFKTALATLDH
TRPTIGAQAVGIAQGALDAAIAYTKDRKQFGESISTFQAVQFMLADMAMK
VEAARLMVYSAAARAERGEPDLGFISAASKCFASDVAMEVTTDAVQLFGG
AGYTTDFPVERFMRDAKITQIYEGTNQIQRVVMSRALLR
433636373YP_007270000.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MPTSNPAKPLDGFRVLDFTQNVAGPLAGQVLVDLGAEVIKVEAPGGEAAR
QITSVLPGRPPLATYFLPNNRGKKSVTVDLTTEQAKQQTLRLADTADVVL
EAFRPGTMEKLGLGPDDLRSRNPKLIYARLTAYGGNGPHGSRPGIDLVVA
AEAGMTTGMPTPEGKPQIIPFQLVDNASGHVLAQAVLAALLHRERHGVAD
VVQVAMYDVAVGLQANQLMMHLNRTASDQPKPEPAPKAKRRKGVGFATQP
SDAFRTANGYIVISAYVPKHWQKLCYLIGRPDLVEDQRFAEQRSRSINYA
ELTAELESALASKTATEWVQLLQANGLMACLAHTWKQVVDTPLFAENDLT
LEVGRGADTITVIRTPARYTSFRAVVTDPPPTAGEHNAAFLARP
433636371YP_007269998.1 Transposase (part1) [Mycobacterium canettii CIPT 140070017]MRVEPDRRHLMLPVIGTVRTHENTRRIERLIAKGRARVLAISVRRNGTRL
DARVRVLVQRPSRPNVWLPDSRVGVDVGVRRLATVADADGVVIEQVDNPQ
PLAAALRELRHVSRARSRCTNGSRQYRERTTEMSRLHRRVNDVRTHHLHV
LTTRLAQTHGRIVVEGLDAAGMLR
433636369YP_007269996.1 Putative transposase fusion protein [Mycobacterium canettii CIPT 14MTAITDTGGLLGNAEFRTNPTGYWAATCWARSFGEVVAVGAEGTSSYGAG
LTQTLQANNIHVVEVNRPDRSARRRQGKSDPLDAYSAARAVLAGHSCPCP
KTRTPGPSKRC
433636367YP_007269994.1 Putative metal cation-transporting P-type ATPase C CtpC [MycobacterMTLEVVSDAAGRMRVKVDWVRCDSRRAVAVEEAVAKQNGVRVVHAYPRTG
SVVVWYSPRRADRAAVLAAIKGAAHVAAELIPARAPHSAEIRNTDVLRMV
IGGVALALLGVRRYVFARPPLLGTTGRTVATGVTIFTGYPFLRGALRSLR
SGKAGTDALVSAATVASLILRENVVALTVLWLLNIGEYLQDLTLRRTRRA
ISELLRGNQDTAWVRLTDPSAGSDAATEIQVPIDTVRIGDEVVVHEHVAI
PVDGEVVDGEAIVNQSAITGENLPVSVVVGTRVHAGSVVVRGRVVVRAHA
VGNQTTIGRIISRVEEAQLDRAPIQTVGENFSRRFVPTSFIVSAIALLIT
GDVRRAMTMLLIACPCAVGLSTPTAISAAIGNGARRGILIKGGSHLEQAG
RVDAIVFDKTGTLTVGRPVVTNIVAMHKDWEPEQVLAYAASSEIHSRHPL
AEAVIRSTEERRISIPPHEECEVLVGLGMRTWADGRTLLLGSPSLLRAEK
VRVSKKASEWVDKLRRQAETPLLLAVDGTLVGLISLRDEVRPEAAQVLTK
LRANGIRRIVMLTGDHPEIAQVVADELGIDEWRAEVMPEDKLAAVRELQD
GGYVVGMVGDGINDAPALAAADIGIAMGLAGTDVAVETADVALANDDLHR
LLDVGDLGERAVDVIRQNYGMSIAVNAAGLLIGAGGALSPVLAAILHNAS
SVAVVANSSRLIRYRLDQTPLRAR
433636365YP_007269992.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MLRADPVGPRITYYDDATGERIELSAVTLANWAAKTGNLLRDELAAGPAS
RVAILLPAHWQTAAVLFGVWWIGAQAILDDSPADVALCTADRLAEADAVV
NSAAVAGEVAVLSLDPFGRPATDLPVGVTDYATAVRVHGDQIVPEHNPGP
VLAGRSVEQILRDCAASAAARGLTAADRVLSTASWAGPDELVDGLLAILA
AGASLVQVANPDPAMLQRRIATEKVTRVL
433636363YP_007269990.1 dTDP-6-deoxy-L-lyxo-4-hexulose reductase RmlD (dTDP-rhamnose modifiMAGRSERLVITGAGGQLGSHLTAQAAREGRDMLALTSSQWDITDPAAAER
IIRHGDVVINCAAYTDVDGAESNEAVAYAVNATGPQHLARACARVGARLI
HVSTDYVFDGDFAGAEPRPYEPTDETAPQGVYARSKLAGEQAVLAAFPEA
AVVRTAWVYTGGTGKDFVAVMRRLAAGHGRVDVVDDQTGSPTYVADLAEA
LLALADAGVRGRVLHAANEGVVSRFGQACAVFEECGADPQRVRPVSSAQF
PRPAPRPSYSALSSRQWALAGLTPLRHWRSALAAALAAPANSTSIDRRLP
STRD
433636361YP_007269988.1 d-alpha-D-mannose-1-phosphate guanylyltransferase ManB [MycobacteriMATHQVDAVVLVGGKGTRLRPLTLSAPKPMLPTAGLPFLTHLLSRIAAAG
IEHVILGTSYKPAVFEAEFGDGSALGLQIEYVTEEHPLGTGGGIANVAGK
LRNDTAMVFNGDVLSGADLAQLLDFHQSNRADVTLQLVRVGDPRAFGCVP
TDEEDRVVAFLEKTEDPPTDQINAGCYVFERNVIDRIPQGREVSVEREVF
PALLADGDCKIYGYVDASYWRDMGTPEDFVRGSADLVRGIAPSPALRGHR
GEQLVHDGAAVSPGALLIGGTVVGRGAEIGPGTRLDGAVIFDGVRVEAGC
VIERSIIGFGARIGPRALIRDGVIGDGADIGARCELLSGARVWPGVFLPD
GGIRYSSDV
433636359YP_007269986.1 Transposase [Mycobacterium canettii CIPT 140070017]MYITRVPNRGSPPAVLLRESFRENGKVKTRTLANLSRWPEHKLDRLDRAL
KGLPPADWDLSEAFEIARSLPHGHVAAVLGTAEKLGIAELIDPTPSRPRN
LVLAMLIGQIIEPGSKLAIARGLRTETATSSLGAVLGVAGADEDDLYDAM
DWALARKDGIETALAARHLADGTLVLYDVSSAAFEGHTCPLGAIGHARDG
VKGRLQIVYGLLCSPAGVPVAIEVFKGNTADPKTLKAQIDKLKTRFGLTN
IALVGDRGMLTSARIRDELRPAHLDWISALRAPQIKTLVEDGALQLTLFD
EQNLFEITHPDYLGERLVCCHNPALAEQRARKRAELLAATENQLQAIAEA
TRRQRRPLRGQDKIGLRVGKVRNKFKMTKHFDIEITDETFSFTRNQQAIA
AEAALDGIYVLRTSLPERALGRDEVVLRYKDLGDVERFFRTLNSELDVRP
IRHRLADRVRAHMFLRMLSYYISWHMKQALAPILFTDNDKPVAAAKRTNP
LAPAQRSNEALNKAARKRTEDDYPVHSFTSLLTDLATICANYIQPTDDLP
PFTKTTTPTPLQRRAFDLLAVSHRHGLP
433636357YP_007269984.1 Putative F420 biosynthesis protein FbiB [Mycobacterium canettii CIPMTGPEHGSASTIEILPVIGLPEFRPGDDLSAAVAAAAPWLRDGDVVVVTS
KVVSKCEGRLVPAPEDPEQRDRLRRKLIEDEAVRVLARKDRTLITENRLG
LVQAAAGVDGSNVGRSELALLPVDPDASAATLRAGLRERLGVTVAVVITD
TMGRAWRNGQTDAAVGAAGLAVLRNYAGVLDPYGNELVVTEVAVADEIAA
AADLVKGKLTATPVAVVRGFGVSDDGSTARQLLRPGANDLFWLGTAEALE
LGRQQAQLLRRSVRRFSTDPVPGDLVEAAVAEALTAPAPHHTRPTRFVWL
QTPALRARLLDRMKDKWRSDLTSDGLPADAIERRVARGQILYDAPEVVIP
MLVPDGAHSYPDAARTDAEHTMFTVAVGAAVQALLVALAVRGLGSCWIGS
TIFAADLVRDELDLPVDWEPLGAIAIGYADEPSGLRDPVPAADLLILK
433636355YP_007269982.1 Putative transcriptional regulatory protein WhiB-like WhiB2 [MycobaMVPEAPAPFEEPLPPEATDQWQDRALCAQTDPEAFFPEKGGSTREAKKIC
MGCEVRHECLEYALAHDERFGIWGGLSERERRRLKRGII
433636353YP_007269980.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MRVSGAWAALVHDSLSVVNVPRRCCRPGCPHYAVATLTFVYSDSTAVIGP
LATAREPHSWDLCVGHAGRITAPRGWELVRHAGPLPSHPDEDDLVALADA
VREGGPSAGRRHHPGGNGAPLHGFDDFPAAATGAPTGGGVLAPPEPGAGR
RRGHLRVLPDPAD
433636351YP_007269978.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MNVARAIDLEDTEGLIAADRGALLRAASMAGAQVRAIAAAADEGELDLLR
GSDRPRSVIWVTGRGTAETAGTILASTLGAAAAEPIVLASAAPPWVGPLD
VLIVAGDDPGDPALVGAAAIGVRRGARVVVVAPYEGPLRDSTAGRVAALE
PRLRVPDEFGLSRYLAAGLAALQTVDPKLRIDLASLADELDAEALRNSAG
REVFTNPAKALAARVSGCQLALAGDNAATLALARHGSSVMLRIANQVVAA
TRLSDAVVALRAGTPPDALFHDEEIDGPAPQRLRVLALALAGERTVVAAR
VAGLDDAYLVAAEDVPELLDAPVGSGGAVLAVRLEMAAVYLRLVRG
433636349YP_007269976.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MVIGASIAGLCAARVLSDFYSTVTVFERDELPEAPANRATVPQDRHLHML
MARGAQEFDSLFPGLLHDMVAAGVPMLENRPDCIYLGAAGHVLGTGHTLR
KEFTAYVPSRPHLEWQLRRRVLQLSNVQIVRRLVTEPQFERPQQRVVGVL
LDSPGSGQDREREEFIAADLVVDAAGRGTRLPVWLTQWGYRRPAEDTVDI
GISYASHQFRIPDGLIAEKVVVAGASHDQSLGLGMLCYEDGTWVLTTFGV
ADAKPPPTFDEMRALADKLLPARFTAALAQAQPIGCPAFHAFPASRWRRY
DKLERFPRGIVPFGDAVASFNPTFGQGMTMTSLQAGHLRRALKARNSAVK
GDLAAELNRATAKTTYPVWMMNAIGDISFHHATAEPLPRWWRPAGSLFDQ
FLGAAETDPVLAEWFLRRFSLLDSLYMVPSVPIIGRTIAHNLRLWLKEQR
ERRQPVTTRRSP
433636347YP_007269974.1 Putative transmembrane alkane 1-monooxygenase AlkB (alkane 1-hydroxMTTQIGSGGPEAPRPPEVEEWRDKKRYLWLMGLIAPTALVVMLPLIWGMN
QLGWHAAAQVPLWIGPILLYVLLPLLDLRFGPDGQNPPDEVTDRLENDKY
YRYCTYIYIPFQYLSVVLGAYLFTAANLSWLGFDGALSWAGKLGVALSVG
VLGGVGINTAHEMGHKKDSLERWLSKITLAQTCYGHFYIEHNRGHHVRVS
TPEDPASARFGETLWEFLPRSVIGGLRSAVHLEAQRLRRLGVSPWNPMTY
LRNDVLNAWLMSVVLWGGLIAVFGPALIPFVIIQAVFGFSLLEAVNYLEH
YGLLRQKSANGRYERCAPVHSWNSDHIVTNLFLYHLQRHSDHHANPTRRY
QTLRSMAGAPNLPSGYASMISLTYFPPLWRKVMDHRVLEHYGGDITRVNL
HPRVREKALARYGASA
433636345YP_007269972.1 Putative rubredoxin RubB [Mycobacterium canettii CIPT 140070017]MNDYKLFRCIQCGFEYDEALGWPEDGIAAGTRWDDIPDDWSCPDCGAAKS
DFEMVEVARS
433636343YP_007269970.1 Putative adenosylhomocysteinase SahH (S-adenosyl-l-homocysteine hydMTGNLVTKNSLTPDVRNGIDFKIADLSLADFGRKELRIAEHEMPGLMSLR
REYAEVQPLKGARISGSLHMTVQTAVLIETLTALGAEVRWASCNIFSTQD
HAAAAVVVGPHGTPDEPKGVPVFAWKGETLEEYWWAAEQMLTWPDPDKPA
NMILDDGGDATMLVLRGMQYEKAGVVPPAEEDDPAEWKVFLNLLRTRFET
DKDKWTKIAESVKGVTEETTTGVLRLYQFAAAGDLAFPAINVNDSVTKSK
FDNKYGTRHSLIDGINRGTDALIGGKKVLICGYGDVGKGCAEAMKGQGAR
VSVTEIDPINALQAMMEGFDVVTVEEAIGDADIVVTATGNKDIIMLEHIK
AMKDHAILGNIGHFDNEIDMAGLERSGATRVNVKPQVDLWTFGDTGRSII
VLSEGRLLNLGNATGHPSFVMSNSFANQTIAQIELWTKNDEYDNEVYRLP
KHLDEKVARIHVEALGGHLTKLTKEQAEYLGVDVEGPYKPDHYRY
433636341YP_007269968.1 Two component sensory transduction transcriptional regulatory proteMDTMRQRILVVDDDASLAEMLTIVLRGEGFDTAVIGDGTQALTAVRELRP
DLVLLDLMLPGMNGIDVCRVLRADSGVPIVMLTAKTDTVDVVLGLESGAD
DYIMKPFKPKELVARVRARLRRNDDEPAEMLSIADVEIDVPAHKVTRNGE
QISLTPLEFDLLVALARKPRQVFTRDVLLEQVWGYRHPADTRLVNVHVQR
LRAKVEKDPENPTVVLTVRGVGYKAGPP
433636339YP_007269966.1 Conserved lipoprotein of unknown function LpqB [Mycobacterium canetMRLAILLFLGAVLAGCASVPSTSAPQAIGTVERPVPSNLPKPSPGMDPDV
LLREFLKATADPANRHLAARQFLTESASNAWDDAGSALLIDHVVFVETRS
AEKVSVTMRADILGSLSDVGVFETAEGQLPDPGPIELVKTSGGWRIDRLP
NGVFLDWQQFQETYKRNTLYFADPTGKTVVPDPRYVAVSDRDQLATELVS
KLLAGPRPEMARTVRNLLAPPLRLRGPVTRADGGKSGIGRGYGGARVDME
KLSTTDPHSRQLLAAQIIWTLARADIRGPYVINADGAPLEDRFAEGWTTS
DVAATDPGVADGAAAGLHALVNGSLVAMDAQRVTPVPGAFGRMPEQTAAA
VSRSGRQVASVVTLGRGAPDEAASLWVGDLGGEAVQSADGHSLSRPSWSL
DDAVWVVVDTNVVLRAIQDPASGQPARIPVDSTAVASRFPGAINDLQLSR
DGTRAAMVIGGQVILAGVEQTQAGQFALTYPRRLGFGLGSSVVSLSWRTG
DDIVVTRTDAAHPVSYVNLDGVNSDAPSRGLQTPLTAIAANPSTVYVAGP
PGVLMYSASVESRPGWAEVPGLMVPGAAPVLPG
433636337YP_007269964.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MLDLVLPLECGGCGAPATRWCAACAVELSVAAGEPHVVSPRVDPQVPVFA
LGRYAGVRRQAILAMKEHGRRDLVAPLACALIVGVDHLLSWGMLENPLTM
VPAPTRRWAARRRGGDPVTRMARIAGATLGRHHDVTVVPALRMRALARDS
VGLGASARERNITGRVLLRGQRPRHEVVLVDDIITTGATARESVRVLRAA
GVRVGAVLAVAAA
433636335YP_007269962.1 Putative preprotein translocase SecA1 1 subunit [Mycobacterium caneMLSKLLRLGEGRMVKRLKKVADYVGTLSDDVEKLTDAELRAKTDEFKRRL
ADQKNPETLDDLLPEAFAVAREAAWRVLDQRPFDVQVMGAAALHLGNVAE
MKTGEGKTLTCVLPAYLNALAGNGVHIVTVNDYLAKRDSEWMGRVHRFLG
LQVGVILATMTPDERRVAYNADITYGTNNEFGFDYLRDNMAHSLDDLVQR
GHHYAIVDEVDSILIDEARTPLIISGPADGASNWYTEFARLAPLMEKDVH
YEVDLRKRTVGVHEKGVEFVEDQLGIDNLYEAANSPLVSYLNNALKAKEL
FSRDKDYIVRDGEVLIVDEFTGRVLIGRRYNEGMHQAIEAKEHVEIKAEN
QTLATITLQNYFRLYDKLAGMTGTAQTEAAELHEIYKLGVVSIPTNMPMI
REDQSDLIYKTEEAKYIAVVDDVAERYAKGQPVLIGTTSVERSEYLSRQF
TKRRVPHNVLNAKYHEQEATIIAVAGRRGGVTVATNMAGRGTDIVLGGNV
DFLTDQRLRERDLDPVETPEEYEAAWHSELPIVKEEASKEAKEVIEAGGL
YVLGTERHESRRIDNQLRGRSGRQGDPGESRFYLSLGDELMRRFNGAALE
TLLTRLNLPDDVPIEAKMVTRAIKSAQTQVEQQNFEVRKNVLKYDEVMNQ
QRKVIYAERRRILEGENLKDQALDMVRDVITAYVDGATGEGYAEDWDLDA
LWTALKTLYPVGITADSLTRKDHEFERDDLTREELLDALLKDAERAYAAR
EAELEEIAGEGAMRQLERNVLLNVIDRKWREHLYEMDYLKEGIGLRAMAQ
RDPLVEYQREGYDMFMAMLDGMKEESVGFLFNVTVEAVPAPPVAPAAEPE
ELAEFAAAAAAAAQQRSAVDGGARERAPSALRAKGIASESPALTYSGPAE
DGSAQVQRNGGAAHKTPAGVPAGASRRERREAARRQGRGAKPPKSVKKR
433636333YP_007269960.1 Conserved membrane protein of unknown function [Mycobacterium canetMKRYLTIIYGAASYLVFLVAFGYAIGFVGDVVVPRTVDHAIAAPIGQAVV
VNLVLLGVFAVQHSVMARQGFKRWWTRFVPPSIERSTYVLLASVALLLLY
WQWRTMPAVIWDVRQPAGRVALWALFWLGWATVLTSTFMINHFELFGLRQ
VYLAWRGKPYTEIGFQAHLLYRWVRHPIMLGFVVAFWATPMMTAGHLLFA
IGATGYILVALQFEERDLLAALGDQYRDYRREVSMLLPWPHRHT
433636331YP_007269958.1 Conserved integral membrane protein of unknown function [MycobacterMEVSRALLFELGVLLAVLAVLGAVARRFALSPIPVYLLAGLSLGNGGILG
VAAAGEFIATGAPIGVVLLLLALGLEFSATEFASSLRHHLPSAGVDIVLN
ATPGAVAGWLLGLDGVAILGLAGVTYISSSGVIARLLEDLRRLGNRETPA
VLSVLVLEDFAMAAYLPLFAVLATDGSWLEAVVGMTVAIAALLGAFAASY
RWGHHVGRLVTHPDSEQLLLRVLGITLIVAAVAESLHASAAVGAFLVGLT
LTGETADRARMVLTPLRDLFATIFFLGIGLSVDPGKLVSMLPVALALAAV
TAATKVATGMFAARREGVARRGQLRAGTALVARGEFSLIIIGLAGASIPG
VAALATAYVFVMAIVGPILARYTGGGLPAAAVASN
433636329YP_007269956.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MVTRLSASDASFYQLENTATPMYVGLLLILRRPRAGLSYEALLETVEQRL
PQIPRYRQKVQEVKLGLARPVWIDDRDFDITYHVRRSALPSPGSDEQLHE
LIARLAARPLDKSRPLWEMYLVEGLEKNRIALYTKSHQALINGVTALAIG
HVIADRTRRPPAFPEDIWVPERDPGTTRLLLRAVGDWLVRPGAQLQAVGS
AVAGLVTNSGQLVETGRKVLDIARTVARGTAPSSPLNATVSRNRRFTVAR
ASLDDYRTVRARYDCDVHDVVLTVIAGALGNWLMSRGEAVAPTATVRAMA
PLSVYADDQLDSTGPGQAISQVTPFLVDLPVGEGNAVVRLSQIAHATESN
PTAASLVDARTIVTLSGLAPATLHAMGVRVATSFSARLFNLLITNAPGTQ
SQMYIAGTKLLETYSVPPLLHNQALAISVTSYNGMLYFGINADRDAMSDV
DLLPGLLSQALDELLEASR
433636327YP_007269954.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MTQVYIPATLAMLQRLVADGALWPVNGTAFAVTPTLRESYAEGDDEELAE
VALREAALASLRLLAADIGATADALPPRRAVLAAEVDDATYRPDLDDAVV
RLAGPITIDQVVAAYVDNAGAEPAVMAAIAVIDAADLGDEDAELVVGDAQ
DHDLAWYANQELPFLLDLL
433636325YP_007269952.1 Putative linoleoyl-CoA desaturase (delta(6)-desaturase) [MycobacterMAITDVDVFAHLTDADIENLAAELDAIRRDVEESRGERDARYIRRAIAAQ
RALEVSGRLLLAGSSRRLAWWTGALTLGVAKIIENMEIGHNVMHGQWDWM
NDPEIHSSTWEWDMSGSSKHWRYTHNFVHHKYTNILGMDDDVGYGMLRVT
RDQRWKRYNIFNVVWNTILAIGFEWGVALQHLEIGKIFKGRADREAAKTR
LREFSAKAGRQVFKDYVAFPALTSLSPGATYRSTLTANVVANVIRNVWSN
AVIFCGHFPDGAEKFTKTDMIGEPKGQWYLRQMLGSANFNAGPALRFMSG
NLCYQIEHHLYPDLPSNRLHEISVRVREVCDKYDLPYTTGSFLVQYGKTW
RTLAKLSLPDKYLRDNADDAPETRSERMFAGLGPGFAGADPVTGRRRGLK
TAIAAVRGRRRSKRMAKSVTEPDDLAA
433636323YP_007269950.1 3-phosphoshikimate 1-carboxyvinyltransferase AroA (5-enolpyruvylshiMKTWPAPTAPTPVRATVTVPGSKSQTNRALVLAALAAAQGRGASTISGAL
RSRDTELMLDALQTLGLRVDGVGSELTVSGRIEPGPGARVDCGLAGTVLR
FVPPLAALGSVPVTFDGDQQARGRPIAPLLDALRELGVAVDGTGLPFRVR
GNGSLAGGTVAIDASASSQFVSGLLLSAASFTDGLTVQHTGSSLPSAPHI
AMTAAMLRQAGVDIDDSTPNRWQVRPGPVAARHWDIEPDLTNAVAFLSAA
VVSGGTVRITGWPRVSVQPADHILAILRQLNTVVIHADSSLEVRGPTGYD
GFDVDLRAVGELTPSVAALAALASPGSVSRLSGIAHLRGHETDRLAALST
EINRLGGNCRETPDGLVITATPLRPGIWRAYADHRMAMAGAIIGLRVAGV
EVDDIAATTKTLPEFPRLWAEMVGPGEGWGYPQPRSGQRARWATGQGSGG
433636321YP_007269948.1 Gcn5-related N-acetyltransferase- phosphorylase [Mycobacterium caneMRWLSGMPSTRASVEAYIRHCREQWVTGGPLRSFGIRTVAETIVGTVDLR
FDGEGLASGQVNVAYGLYPGWRGRGLATRAVDLVCQYAAEHGATEAVIKV
EPENSASARVALRAGFAFVRRICEQDGTVFDRYERVLRAKMHADEVDIDE
DLVRRLLRAQFPQWADLPIAPVRSAGTDNAMYRLGEDLAVRIPRIGWAIE
SLRTEQQWLPRIAAHLGVASPVPVGLGSPAEGFGWPWSVCRWVAGENPSA
AEFVEPNRAVEDLADFITALRATDPMGGPPAKRGAPLGEQDAEVRAALAA
LDGIIDVHAATAAWESALRVPPYAGPPMWFHGDLSRFNILTAQGRLTGVI
DFGLMGVGDPSVDLIIAWNLLSAPARAKFRVAVGAADDDWMRGRGRALAI
ALIALPYYQDTNPPLAASARYAIGEVLADFRYGARPGC
433636319YP_007269946.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MRRSASTCGWKTPTRRGTSRPSDSKTLILELPDERAVAIVPVPSTLSLKA
AGGPRGAQSGHG
433636317YP_007269944.1 Alternative RNA polymerase Sigma-E factor (Sigma-24) SigH (RpoE) [MMADIDGVTGSAGLQPGPSEETDEELTARFERDAIPLLDQLYGGALRMTRN
PADAEDLLQETMVKAYAGFRSFRHGTNLKAWLYRILTNTYINSYRKKQRQ
PAEYPTEQITDWQLASNAEHSSTGLRSAEVEALEALPDTEIKEALQALPE
EFRMAVYYADVEGFPYKEIAEIMDTPIGTVMSRLHRGRRQLRGLLADVAR
DRGFARGEQAHEGVSS
433636315YP_007269942.1 Putative anti-sigma factor [Mycobacterium canettii CIPT 140070017]MSENCGPTDAHADHDDSHGGMGCAEVIAEVWTLLDGECTPETRERLRRHL
EACPGCLRHYGLEERIKALIGTKCRGDRAPEGLRERLRLEIRRTTIIRGG
P
433636313YP_007269940.1 Conserved protein of unknown function- biotinylated protein TB7.3 [MAEDVRAEIVASVLEVVVNEGDQIDKGDVVVLLESMKMEIPVLAEAAGTV
SKVAVSVGDVIQAGDLIAVIS
433636311YP_007269938.1 Putative transcriptional regulatory protein Whib-like WhiB1 [MycobaMDWRHKAVCRDEDPELFFPVGNSGPALAQIADAKLVCNRCPVTTECLSWA
LNTGQDSGVWGGMSEDERRALKRRNARTKARTGV
433636309YP_007269936.1 Conserved integral membrane protein of unknown function [MycobacterMPVRAPAAVRGAGLIVAVQGGAALVVAAALLVRGLAGADQHIVNGLGTAG
WFVLVGGAVLAAGCRLAVGKLWGRGLAVFAQLLLLPVAWYLIVGSHQPAI
GIPVGIIALGVLVLLFSPPSIRWAAGRDQRGAASAANRGPDSR
433636307YP_007269934.1 Putative isochorismate synthase EntC [Mycobacterium canettii CIPT 1MSAHVATLHPEPPFALCGPRGTLIARGVRTRYCDVRAAQAALRSGTAPIL
LGALPFDVSRPAALMVPDGVLRARKLPDWPTGPLPKVRVAAALPPPADYL
TRIGRARDLLAAFDGPLHKVVLARAVQLTADAPLDARVLLRRLVVADPTA
YGYLVDLTSAGNDDTGAALVGASPELLVARSGNRVMCKPFAGSAPRAADP
KLDAANAAALASSAKNRHEHQLVVDTMRVALEPLCEDLTIPAQPQLNRTA
AVWHLCTAITGRLRNISTTAIDLALALHPTPAVGGVPTKAATELIAELEG
DRGFYAGAVGWCDGRGDGHWVVSIRCAQLSADRRAALAHAGGGIVAESDP
DDELEETTTKFATILTALGVQQ
433636305YP_007269932.1 Putative Soj/ParA-related protein [Mycobacterium canettii CIPT 1400MTDTRVLAVANQKGGVAKTTTVASLGAAMVEKGRRVLLVDLDPQGCLTFS
LGQDPDKLPVSVHEVLLGEVEPNAVLVTTMEGMTLLPANIDLAGAEAMLL
MRAGREYALKRALAKFSDRFDVVIIDCPPSLGVLTLNGLTAADEAIVPLQ
CEMLAHRGVGQFLRTVADVQQITNPNLRLLGALPTLYDSRTTHTRDVLLD
VADRYDLQVLAPPIPRTVRFAEASASGSSVMAGRKNKGAVAYRELAQALL
KHWKTGRPLPTFTVDL
433636303YP_007269930.1 Putative ATP-dependent RNA helicase RhlE [Mycobacterium canettii CIMTAVKHTTESTFAKLGVRDEIVRALGEEGIKRPFAIQELTMPLALDGEDV
IGQARTGMGKTFAFGVPLLQRITSGDGTRPLTGAPRALVVVPTRELCLQV
TDDLATAGKYLTAGPDTDDAAAVRRRLSVVSIYGGRPYEPQIEALRAGAD
VVVGTPGRLLDLCQQGHLQLGGLSVLVLDEADEMLDLGFLPDIERILRQI
PADRQSMLFSATMPDPIITLARTFMVRPTHIRAEAPHSSAVHDATEQFVY
RAHALDKVELVSRVLQARDRGATMIFTRTKRTAQKVADELTERGFAVGAV
HGDLGQLAREKALKAFRTGGIDVLVATDVAARGIDIDDVTHVINYQCPED
EKMYVHRIGRTGRAGRTGVAVTLVDWDELPRWSMIDQALGLGSPDPAETY
SNSPHLYAELAIPATAGGTVGPARKSQGRRRDTDCDGQKTAQHARNTPRR
RRTRGGKPVTGHPGTNPISSPIVGGDATSEPGSGTASDSGSDVVSGSRSG
NGEAARRRRRRRRRPTHAQDGFAARAN
433636301YP_007269928.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MALGAVATAVIINSGDSTSTKAIVGAPAPRTVISTSPRPTAPTSTSPHPS
PSTLRPQLPPETVTTVAPPGTGPTTVPTRTPTAAPPQTAVPPPAPLNPRT
VVYRVTGTKQLFDLVNVVYTDARGFPVTDFNVSLPWTKMVVLNPGVQTES
VVATSLYSRLNCSIVNTGAQTVVASTNNAIIATCTR
433636299YP_007269926.1 TetR family transcriptional regulator [Mycobacterium canettii CIPT MSDLAKTAQRRALRSSGSARPDEDVPAPNRRGNRLPRDERRGQLLVVASD
VFVDRGYHAAGMDEIADRAGVSKPVLYQHFSSKLELYLAVLHRHVENLVS
GVHQALSTTTDNRQRLHVAVQAFFDFIEHDSQGYRLIFENDFVTEPEVAA
QVRVATESCIDAVFALISADSGLDPHRARMIAVGLVGMSVDCARYWLDAD
KPISKSDAVEGTVQFAWGGLSHVPLTRS
433636297YP_007269924.1 Transposase (fragment) [Mycobacterium canettii CIPT 140070017]MWRHTRRGDKYVTVIIDLTGIREGTGPARLLDMVEGRSKQAFKTWLAERE
ESWRQAVEVVAMDGFTGFKTATSEELPDAVAVMDPFHVVRLGGEALDKCR
RRVQLDTCGHRGRKTDPLYAARRTLQTGADLLTDKQKDRPTKLFAVDTHI
EVEATWGIYQRMISAYRNPDRRRGRELMSALIESISDAVPAALTEVITLG
RTLKKRAADVLAYFDRPGTSNGPTEAINGRLEHLRGSALGFRNLTHYITR
SLLETGGFKPRLHPRS
433636295YP_007269922.1 Putative molybdopterin biosynthesis-like protein MoeZ [MycobacteriuMSTSLPPLVEPASALSREEVARYSRHLIIPDLGVDGQKRLKNARVLVIGA
GGLGAPTLLYLAAAGVGTIGIVDFDVVDESNLQRQVIHGVADVGRSKAQS
ARDSIVAINPLIRVRLHELRLAPSNAVDLFKQYDLILDGTDNFATRYLVN
DAAVLAGKPYVWGSIYRFEGQASVFWEDAPDGLGVNYRDLYPEPPPPGMV
PSCAEGGVLGIICASVASVMGTEAIKLITGIGETLLGRLLVYDALEMSYR
TITIRKDPSTPKITELIDYEQFCGVVADDAAQAAKGSTITPRELRDWLDS
GRKLALIDVRDPVEWDIVHIDGAQLIPKSLINSGEGLAKLPQDRTAVLYC
KTGVRSAEALAAVKKAGFSDAVHLQGGIVAWAKQMQPDMVMY
433636293YP_007269920.1 Putative DNA-methyltransferase (modification methylase) [MycobacterMAPVTDEQVELVRSLVAAIPLGRVSTYGDIAALAGLSSPRIVGWIMRTDS
SDLPWHRVIRASGRPAQHLATRQLELLRAEGVLSVDGRVALSEIRYEFPS
G
433636291YP_007269918.1 Putative ATP-dependent DNA helicase [Mycobacterium canettii CIPT 14MSHIWGVEAGVALAPGLRGPVLVLGGPGTGKSTLLVEAAVAHIGAGTDPE
SVLLLTGSGRMGMRARSALTTALLRSRTNGPCRAAIREPVVRTVHSYAYA
VLRKAAQRAGDALPRLLTSAEQDAIIRELLAGDAEDGPAATTTWPAHLRP
ALTTAGFATELRNLLARCAERGLDPLELQQLGRRRGRPEWIAAGQFAQRY
EQVMLLRGAVGLAAPQATAPALSAAELVGAALEAFAVDPELLAAERARVR
TLLVDDAQQLDPQAARLVRMLAAGTELALIAGDPNQAVFGFRGGEPTGLL
ADDPPPAGGAPIPSVTLTVSHRCAPAVARAVTGIARRLPGRSVGRRIEGT
GTEVGSVTVRLAGSAHAEAAMIADALRRAHLIDGVPWSQMAVIVRSVPRA
VRLPRALAAAGVPVAPPAVGGPLSAEPAVRALLTVLEATADGLDGDQALL
LLTGPIGGVDPVSLRQLRRTLQRARPGQASRKFGDLLVEVLGGDAPLSGP
GSRALRRVRAVLTAAARCHRSGSLGGQDPRHTLWAAWQRSGLQRRWLAAS
EHGGAAAVQATRDLETVTALFDITDHYVSRTSGASLRGLVEHVTALQLPV
VRPEPAAPTEQVMVLSAHAALGHEWDLVVIAGLQDGLWPNTVPRGGVLGT
QRLLDELDGVTEDASMRAPLLAEERRLLVTAMGRARRRLLVTAVDSDAGG
GGHEAVLPSAFFFEIAQWADGDGEPVAMQPVSAPRVLSAAAVVGRLRAVV
CAPACAVDDVDRDCAATQLARLAKAGVPGADPSEWHGLAPVSTSDPLCDS
DDVVTLTPSTLQALNDCPLRWLAERHGGTNTRELPSAVGSVLHALFAESG
RSESQLLAELDRVWDHLPFGAQWYSANELARHRAMIQAFVQWRAQSRSEL
TEVGVEVDIDGALEGGSGQGRKIRLRGRADRLERDPAGRLVIVDIKTGKR
PVSKDDAQQHAQLAMYQLAVAEGLVRAGDEPGGARLVYVGKSGAAGVAER
TQDPLTPAARDGWRNLVRQLAAATAGPQFIARRNDGCTHCPLRPGCPAHV
QGSAP
433636289YP_007269916.1 Putative transmembrane cation transporter [Mycobacterium canettii CMAGSWRRLRGLDEKLTAQPGYALVGVLRIPQRRASPARVISRRVVVAVVA
LLLTAGIVYVDRDGYLDAQGDRLTFLDCLYYAAVTLSTTGYGDITPISEF
ARAINIFVITPLRIAFLILLVGTTLEVLTETSRQAYKIQRWRSRVRNHTV
VIGYGTKGKTAVAAMVSDELVPGEIVVVDTDSGVLERAAAAGLVTVHGDA
TKSDVLRLAGTQHASSIIVATSRDDTAVLVTLTAREIAPKAKIVASIREA
ENQHLLRQSGADTVVVSSETAGRLLGIATTTPSVVEMIEDLLTPEAGLAV
AEREVEQAEVGGSPRHLRDIVLGVVRDGQLLRIGAPEVDAIEASDRLLYI
RQVGR
433636287YP_007269914.1 Putative glutaredoxin protein [Mycobacterium canettii CIPT 14007001MTTAALTIYTTSWCGYCLRLKTALTANRIAYDEVDIEHNRAAAEFVGSVN
GGNRTVPTVKFADGSTLTNPSADEVKAKLVKIAG
433636285YP_007269912.1 Transcriptional regulatory protein WHIB-like WhiB7 [Mycobacterium cMSVLTVPRQTPRQRLPVLPCHVGDPDLWFADTPAGLEVAKTLCVSCPIRR
QCLAAALQRAEPWGVWGGEIFDQGSIVSHKRPRGRPRKDAVA
433636283YP_007269910.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MQEGGPQETMSARSTQHDAADALFRAIIETLDKHRNERTLTEDVLDTLAR
AYASISTNVPEQGRLG
433636281YP_007269908.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MSTVEVMGDLPFGFSSGDDPPEDPSGRDKRGKDGADSGSGANPLGAFGIG
GEFNMADLGQIFTRLGEMFGGVGTAMAAGKTSGPVNYDLARQVASSSIGF
IAPIPAATNSAIADAVHLADTWLDGATSLPAGATKAVGWSPTDWVDNTLA
TWKRLCDPMAQQISTVWASSLPEEAKSMAGPLLSIMSQMGGIAFGSQLGQ
ALGRLSREVLTSTDIGLPLGPKGVAAILPGAVESFAAGLEQPRSEILTFL
ATREAAHHRLFSHVPWLASQLLGAVEAYAMGMKIDMTGIEELARDINPTS
LADPAAMEQLLSQGVFEPKATPAQTQALERLETLLALIEGWVQTVVTAAL
GERIPGEAALSETLRRRRASGGPAEQTFATLVGLELRPRKLREAGALWER
LTRAVGMDARDAVWQHPDLLPATDDLDDPAAFIDRVIGGDTSGIDEAIAE
LERDQQARGADDSGHDGGPVDN
433636279YP_007269906.1 Conserved membrane protein of unknown function [Mycobacterium canetMGMRSAARMPKLTRRSRILIMIALGVIVLLLAGPRLIDAYVDWLWFGELG
YRSVFTTMLATRIVVCLVAGVVVGGIVFGGLALAYRTRPVFVPDADNDPV
ARYRAVVLARLRLVGIGIPAAIGLLAGIVAQSYWARIQLFLHGGDFGVRD
PQFGRDLGFYAFELPFYRLMLSYMLVSVFLAFVANLVAHYIFGGIRLSGR
TGALSRSARVQLVSLVGVLVLLKAVAYWLDRYELLSHTRGGKPFTGAGYT
DINAVLPAKLILMAIALICAAAVFSAIALRDLRIPAIGLVLLLLSSLIVG
AGWPLIVEQISVKPNAAQKESEYISRSITATRQAYGLTSDVVTYRNYSGD
SPATAQQVAADRATTSNIRLLDPTIVSPAFTQFQQGKNFYYFPDQLSIDR
YLDRNGNLRDYVVAARELNPDRLIDNQRDWINRHTVYTHGNGFIASPANT
VRGIANDPNQNGGYPEFLVNVVGANGTVVSDGPAQLDQPRIYFGPVISNT
SADYAIVGRNGDDREYDYETNIDTKRYTYTGSGGVPLGGWLARSVFAAKF
AERNFLFSNVIGSNSKILFNRDPAQRVEAVAPWLTTDSAVYPAIVNKRLV
WIVDGYTTLDNYPYSELTSLSSATADSNEVAFNRLVPDKKVSYIRNSVKA
TVDAYDGTVTLYQQDEKDPVLKAWMQVFPGTVKPKSDIAPELAEHLRYPE
DLFKVQRMLLAKYHVNDPVTFFSTSDFWDVPLDPNPTASSYQPPYYIVAK
NIAKDDNSASYQLISAMNRFKRDYLAAYISASSDPATYGNLTVLTIPGQV
NGPKLANNAITTDPAVSQDLGVIGRDNQNRIRWGNLLTLPVAQGGLLYVE
PVYASPGASDAASSYPRLIRVAMMYNDKVGYGPTVRDALTGLFGPGAGAT
ATGIAPTEAAVPPSPAANPPPPASGPQPPPVTAAPPVPVGAVTLSPAKVA
ALQEIQAAIGAARDAQKKGDFAAYGSALQRLDEAITKFNDAG
433636277YP_007269904.1 Protein of unknown function [Mycobacterium canettii CIPT 140070017]MKRAMFIALVGERAKQAKDFLAWGLRPNLIHPDSRFARDNAAVTLDDAPN
LVSSTALYPTMNANEHLVAAAEVIALALTQGQMRTSALAALCRIAMESSA
KAIWLIRETDTDERLRRCYGFIKGERGRQEQFEGLEAEALEPRIDPLADA
QRVKFEKHRERPAARHEQIQALPAEALTGLPGPLELVEGAEDWMDEQPTA
RARSRTGQGDSSAKRKEFLFPQFGFCARVHVAGGIPIRLVW
433636275YP_007269902.1 Protein of unknown function (possibly secreted) [Mycobacterium caneMGAPGLQEGAAAVEQLVDIRRRKGTEHVAFVAGQVGNNELLNIIQADDER
GEMLWSSTQTSMSSADLRKRIYLAQVVAEAMTSTEPIDEALLFVSALREL
DRPHIQALVRIREADAANQKDPGLNGDILQDALRAIPYPVLAALARTGVV
RQGSEQRGSGLFAITYADTLGISGISEFGLRLLADLESVKPER
433636273YP_007269900.1 Protein of unknown function [Mycobacterium canettii CIPT 140070017]MATEALPKMEAVVSDDDSGVVNPDDENPIADESVVVSLRPSPPAADPDDP
RLWTVLAHCDAADLAELTAIRRFGLRMVDDDGPAQVLSEFVGPLRLGGAV
TRLEIVHGVRNVNHTDAPRRFSS
433636271YP_007269898.1 Transposase [Mycobacterium canettii CIPT 140070017]MTMTLADTAAVAVADDGYVGSGKGPRGERPKRRTFTAEYKLGILEQYESL
TEPGARGALLRKEGLYSSHITEWKRLRDAGALDALAAKPSGPKPAQTEAD
KRAAKLEAENARLAAELAKAKQANEVLGKLSELLSLLSNSSDGETRQNL
433636269YP_007269896.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MKLADAIATAPRRTLKGTYWHQGPTRHPVTSCADPARGPGRYHRTGEPGV
WYASNKEQGAWAELFRHFVDDGVDPFEVRRRVGRVAVTLQVLDLTDERTR
SHLGVDETDLLSDDYTTTQAIAAAARDANFDAVLAPAAALPGCQTLAVFV
HALPNIEPERSEVRQPPPRLANLLPLIRPHEHMPDSVRRLLATLTRAGAE
AIRRRRR
433636267YP_007269894.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MHDATGGAGFVRPDLTAFCRLDELGVEVTGQYLDSDRAVLACRITDEDRW
CRRCGEQGQVRDTVTRRLAHEPFGWRPTTLVLTVRRYRCAGCAHVWRQDS
SAAAEPRAKLSRHGLRWALEAVVCQHLTMARVAEGLGVSWNTANDAVLAE
GKRVLIDDAGRFDEVTVIGVDEHVWRHTRRGDKYVTVIIDLTGIREGTGP
ARLLDMVEGRSKQAFKTWLAEREESWRQAVEVVAMDGFTGFKTATSEELP
DAVAVMDPFHVVRLGGEALDKCRRRVQLDTCGHRGRKTDPLYAARRTLQT
GADLLTDKQKDRLTKLFAVDTHIEVETTWGIYQRMISAYRHPDRRRGREL
MSTLIESISDAVPAALTQVITLGRTLKKRAADVLAYFDRPGTSNGPTEAI
NGRLEHLRGSALGFRNLTHYIARSLLEAGGFKPRLHPRS
433636265YP_007269892.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MILLPQVERWFFALNRDAMASVTGAIDLLEMEGPTLGRPVVDKVNDSTFH
NMKELRPAGTSIRILFAFDPARQAILLLGGDKAGNWKRWYDNNIPIADQR
FENWLASEHGGG
433636263YP_007269890.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MPLVYFDASAFVKLLTTETGSSLASALWDGCDAALSSRLAYPEVRAALAA
AARNHDLTESELADAERDWEDFWAATRPVELTATVEQHAGHLARAHALRG
ADAVHLASALAVGDPGLVVAVWDRRLHTGAHAAGCRVAPAQLDP
433636261YP_007269888.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MTAAEDKEERLRLSGTRIELEELLQLPVDVAYEGLLTDDVSESVRKKLIT
LRAGPSRTACSNLRNPAGVGADDGARRDVVHQRDIADGTGVEPATHR
433636259YP_007269886.1 Transposase [Mycobacterium canettii CIPT 140070017]MLPKRAWQKYSSGAGSHGHRYYSWAWIALEAEDDADTGHHHLLIRRNDRT
GELAYLRCYSPRRTTLHALVKVAGQRWRIEESFQAAKGLTGIDQHQVRRW
TSWHRWTTLAMLAHAFLAVATATERDTQPTPAGLIMLTVNEFHRLFDALL
LITKHTVTSLLAWSRWRRQHQHRARLSHYRRREPQ
433636257YP_007269884.1 Putative peroxidase (non-haem peroxidase) [Mycobacterium canettii CMTHRQAGGIGATYQDAPTKSINVGGTRFVYRRLGADAGVPVIFLHHLGAV
LDNWDPRVVDGIAAKHPVVTFDNRGVGASEGQTPDTVTAMADDAIAFVRA
LGFDQVDLLGFSLGGFVAQVIAQQEPQLVRKIILAGTGPAGGVGIGKVTF
GTIRESIKATLTFRDPKELRFFTRTDSGKSAARQFVKRLKERKDNRDKSI
TVRAFRSQLKAIHAWGTQKPSDLTSIGHPVLIANGDDDTMVPTSNSFDLA
DRLPNATLRIYPDAGHGGIFQHHAQFVDDALQFLES
433636255YP_007269882.1 Putative amidase [Mycobacterium canettii CIPT 140070017]MAMSAKASDDIAWLPATAQLAVLAAKKVSSAELVELYLSRIDTYNASLNA
SLNAIVTVDPDAARRVAKRSDAARARGDELGPLHGLPITVKDSYETAGMR
TTCGRRDLADYVPTQDAEAVARLRRAGAIIMGKTNMPTGNQDVQASNPVF
GRTNNPWDAARTSGGSAGGGAAATAAGLTSFDYGSEIGGSTRIPAHYCGL
YGHKSTWRSVPLVGHIPSAPGNPGRWGQADMACAGVQVRGARDIIPALEA
TVGPMRADGGFSYALAPPRAGALKDFRVAVWAEDPHCPIDADARRAMDDA
VAALRAAGAHVVEQPATIPVDMAVSHNIFQSLVFGAFAVDRSTLNPASAA
ALGLRAVRHPRGEAANALRATLQSHRAWLFADAARHEMRDRWAGFFNEFD
VLLLPVTPTPAPLHHNKDHDRLGRTIDVDGVSRSYWDQLKWNALANIAGT
PATTMPITTTATGLPIGIQAMGPAGGDRTTVEFAALLTEVLGGFRVPPL
433636253YP_007269880.1 Putative transcriptional regulatory protein (probably TetR/AcrR-famMPPVTRTTEPPRRGGRGARQRILKAAAELFYCEGINATGVELIANKASVS
KRTLYQHFPSKSALVEEYLRGLRQAAGEADKMPKASNATPRERLLALFDR
PNRGDGRMRGCPFHNAAVEAAGEMPGVERIVHSHKRDYIKGLARLAREAG
AAHPRSLGNQLAVLFEGAAALSTSLDDAGPWAHARAAAEVLIDQATARPV
433636251YP_007269878.1 Putative non-Heme haloperoxidase Hpx [Mycobacterium canettii CIPT 1MTVRAADGTPLHTQVFGPPDGYPIVLTHGFVCAIRAWAYQIADLAGDYRV
IAFDHRGHGRSGVPRRGAYSLNHLAADLDSVLDATLAPRERAVVAGHSMG
GITIAAWSDRYRHKVRRRTDAVALINTTTGDLVRKVKLLSVPRELSPVRV
LAGRSLVNTFGGFPLPGAARALSRHVISTLAVAADADPSATRLVYELFTQ
TSAAGRGGCAKMLVEEVGSAHLNLDGLTVPTLVIGGVRDRLTPISQSRRI
ARTAPNVVGLVELPGGHCSMLERHQEVNSHLRALAESVTRHVRDRRISS
433636249YP_007269876.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MPQMLGPLDEYPLHQLPQPIAWPGSSDRNFYDRSYFNAHDRTGNIFLITG
IGYYPNLGVKDAFMLIRRADTQTAVHLSDAIDQNRLHQHVNGYRVEVVEP
LRKLRIVLDETEGMAADLTWEGLFDVVREQPHVLRSGNRVTLDAQRFAQL
GTWSGRIVVDGEQIAVDPATWLGSRDRSWGIRPVGEPEPAGRPADPPFEG
MWWLYVPLAFDDFAVVLIIQEEPDGFRSLNDCTRIWRDGRVEQLGWPRVR
IHYRSGTRIPTGATIEASTPDGAPVHFDVESKLAVPTHVGGGYGGDSDWS
HGMWKGEKFVERRTYDMTDPTIIARAGFGVIDHVGRALCRDGDGNPVQGW
GLFEHGALGRHDPSGFADWSTVAP
433636247YP_007269874.1 Putative transcriptional regulatory protein (probably TetR-family) MKADLSSLGKAPGAGRPRDPRIDSAILSATAELLVQIGYSNLSLAAVAER
AGTTKSALYRRWSSKAELVHEAAFPAAPTALQAPAGDIAADIRMMIAATR
DVFTTPVVRAALPGLVADMTADAELNARVLARFADLFTAVRMRLCEAVDR
GEAHPDVDPARLIELIGGATMLRMLLYPDEILDDAWVDRTTAILVHGVYC
AAAGGMGR
433636245YP_007269872.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MKRLIALGIFLIVGIELLALILHDRRFVLAGSGLALALVLLNVRRMLGNR
DELTAAPDSDDLGEGLRRWLSNTETTIRWSESTRADWDRHLRPMLARRFE
IATGHRQAKDSVAFAATGRMLFGPELWEWVNPNNVTHTGDRQPGPGRAAL
EEILQKLEQV
433636243YP_007269870.1 Conserved exported protein of unknown function [Mycobacterium canetMIQTCEVELRWRASQLTLAIATCAGVALAAAVIAGRWQLIAFAAPLLGVL
CSISWQRPVPVIQVHGDPDSQRCFENEHVRVTVWVTTESVDAAVELTVSA
LAGMQFEALESVSSRTTTVSAVAQRWGRYPIRARVAVVARGGLLMGTGTV
DAAEIIVFPLTPPQSTPLPQTELLDRLGAHLTRHVGPGVEYADIRPYVPG
DQLRAVNWAVSARRGRLHVTRRLTDRAADVVVLIDMYRQPAGPATEATER
VVRGAAQVVQTALRNGDRAGIVALGGNRPRWLGADIGQRQFYRVLDTVLG
AGEGFENTTGTLAPRAAVPAGAVVIAFSTLLDTEFALALIDLRKRGHVVV
AVDVLDSCPLQDQLDPLVVRMWALQRSAMYRDMATIGVDVLSWPADHSLQ
QSMGALPNRRRRGRGRASRARLP
433636241YP_007269868.1 Putative dioxygenase [Mycobacterium canettii CIPT 140070017]MLSTDNRAELGDILTDIGDYLDDNPPALSLPPAAYTSSELWQLERERIFN
RSWMLVAHVDQLAKTGDYVTVSVAGEPVMVVRDVDGQLHALSPICRHRLM
LMVEPGAGRIDTLTCQYHLWRYGLDGRLRGAPHMAANLDFNRRECRLPQF
AVATWNGLVWINLDADAEPIAVHLDLTDDEFAGYRLGEMVQVESWSHEWR
ANWKVAAENGHENYHVLGLHRQTLEPFVPGGGDLDVRQYSRWALRLRVPF
TVPVEAKSLQLNEVQKSNLVVLWTFPNSALAIAGERVVWFGFIPQSIDRV
QVLGGVLTTPELAADAAATAQTSQFVMAMINDEDRLGLEAVQLGTGSRFA
ERGHLSPKEWPGMLAFYRNLAMALVGDHPGAS
433636239YP_007269866.1 Conserved protein of unknown function- PPE family protein [MycobactMNYSVLPPEINSLRMFTGAGSAPMLAASVAWDGLAAELAVAASSFGSVTS
GLAGQSWQGAAAAAMAAAAAPYAGWLAAAAARAAGASAQAKAVASAFEAA
RAATVHPMLVAANRNAFVQLVLSNLFGQNAPAIAAAEAMYEQMWAADVAA
MVGYHGGASAAAAQLSSWSTGLQQALPAAPSALAAAIGLGNIGVGNLGGG
NTGDYNLGSGNSGNANVGSGNSGNANVGSGNDGATNLGSGNIGNTNLGSG
NVGNVNLGSGNRGFGNLGNGNFGSGNLGSGNTGSTNFGGGNLGSFNLGSG
NIGSSNIGFGNNGDNNLGLGNNGNNNIGFGLTGDNLVGIGALNSGIGNLG
FGNSGNNNIGFFNSGNNNVGFFNSGNNNFGFGNAGDINTGFGNAGDTNTG
FGNAGFFNMGIGNAGNEDMGVGNGGSFNVGVGNAGNQSVGFGNAGTLNVG
FANAGSINTGFANSGSINTGGFDSGDRNTGFGSSVDQSVSSSGFGNTGMN
SSGFFNTGNVSAGYGNNGDVQSGINNTNSGGFNVGFYNSGAGTVGIANSG
LQTTGIANSGTLNTGVANTGDHSSGGFNQGSDQSGFFGQP
433636237YP_007269864.1 Putative NADH dehydrogenase i (chain M) NuoK (NADH-ubiquinone oxidoMNNVPWLSVLWLVPLAGAVLIILLPPGRRRLAKWAGMVVSVLTLAVSIVV
AAEFKPSAEPYQFVEKHSWIPAFGAGYTLGVDGIAVVLVLLTTVLIPLLL
VAGWNDATDADDLSPASGRYPQRPAPPRLRSSGDERTRGVHAYVALTLAI
ESMVLMSVIALDVLLFYVFFEAMLIPMYFLIGGFGQGAGRSRAAVKFLLY
NLFGGLIMLAAVIGLYVVTAQYDSGTFDFREIVAGVAAGRYGADPAVFKA
LFLGFMFAFAIKAPLWPFHRWLPDAAVESTPATAVLMMAVMDKVGTFGML
RYCLQLFPDPSTYFRPLIVTLAIIGVIYGAIVAIGQTDMMRLIAYTSISH
FGFIIAGIFVMTTQGQSGSTLYMLNHGLSTAAVFLIAGFLIARRGSRSIA
DYGGVQKVAPILAGTFMVSAMATVSLPGLAPFISEFLVLLGTFSRYWLAA
AFGVTALVLSAVYMLWLYQRVMTGPVAEGNERIGDLVGREMIVVAPLIAL
LLVLGVYPKPVLDIINPAVENTMTTIGQHDPAPSVAHPVPGVGASRTAEG
PHP
433636235YP_007269862.1 Putative NADH dehydrogenase i (chain K) NuoK (NADH-ubiquinone oxidoMNPANYLYLSVLLFTIGASGVLLRRNAIVMFMCVELMLNAVNLAFVTFAR
MHGHLDAQMIAFFTMVVAACEVVVGLAIIMTIFRTRKSASVDDANLLKG
433636233YP_007269860.1 NADH-quinone oxidoreductase subunit I [Mycobacterium canettii CIPT MANTDRPALPHKRAVPPSRADSGPRRRRTKLLDAVAGFGVTLGSMFKKTV
TEEYPERPGPVAPRYHGRHQLNRYPDGLEKCIGCELCAWACPADAIYVEG
ADNTEEERFSPGERYGRVYQINYLRCIGCGLCIEACPTRALTMTNDYELA
DDNRADLIYEKDRLLAPLLPEMAAPPHPRAPGATDKDYYLGNVTAEGLRG
VRESQTTGDSR
433636231YP_007269858.1 NADH-quinone oxidoreductase subunit G [Mycobacterium canettii CIPT MTQAADTDTRVAQPEMVTLTIDDVEISVPKGTLVIRAAELMGIQIPRFCD
HPLLEPVGACRQCLVEVEGQRKPLASCTTVATDDMVVRTQLTSEIADKAQ
HGVMELLLINHPLDCPMCDKGGECPLQNQAMSNGRTDSRFTEDKRTFAKP
INISAQVLLDRERCILCARCTRFSDQIAGDPFIDMQERGALQQVGIYADE
PFESYFSGNTVQICPVGALTGTAYRFRARPFDLVSSPSVCEHCASGCAQR
TDHRRGKVLRRLAGDDPEVNEEWNCDKGRWSFTYATQPDVITTPLIRDGG
DPKGALVPTSWSHAMAVAARGLAAARGRTGVLVGGRVTWEDAYAYAKFAR
ITLGTNDIDFRARPHSAEEADFLAARIAGRHMAVSYADLESAPVVLLVGF
EPEDESPIVFLRLRKAARRHRVPVYAIAPFATGGLHKMSGRLIKTVPGAE
PAALDDLATGAVGDLLATPGAVIMVGERLATVPGGLSAAARLADTTGARL
AWVPRRAGERGALEAGALPTLLPGGRPLADEVARAQVCAAWHVAELPAAA
GRDADGILAAAGDETLAALLVGGIEPADFADPDAVLAALDATGFVVSLEL
RHSAVTERADVVFPVAPTTQKAGAFVNWEGRYRTFEPALRGSMSQAGQSD
HRVLDALADDMGVHLGVPTVEAAREELAALGIWDGKHAAGPHIAATGPTQ
PEAGEAILTGWRMLLDEGRLQDGEPYLAGTARTPVVRLSPETAAEIGAAD
GEAVTVSTSRGSITLPCSVTDMPDRVVWLPLNSAGSTVHRQLRVTIGSIV
KIGAGS
433636229YP_007269856.1 Putative NADH dehydrogenase I (chain E) NuoE (NADH-ubiquinone oxidoMTQPPGQPVFIRLGPPPDEPNQFVVEGAPRSYPPDVLARLEVDAKEIIGR
YPDRRSALLPLLHLVQGEDSYLTPAGLRFCADQLGLTGAEVSAVASFYTM
YRRRPTGEYLVGVCTNTLCAVMGGDAIFDRLKEHLGVGHDETTSDGVVTL
QHIECNAACDYAPVVMVNWEFFDNQTPESARELVDSLRSGTPKAPTRGAP
LCAFRETSRILAGLPDQRPDEGQGGAGAPTLAGLQVARENDMQAPPTPGA
DE
433636227YP_007269854.1 Putative NADH dehydrogenase I (chain C) NuoC (NADH-ubiquinone oxidoMSPPNQDAQQGRPDSPTTEVVDVRRGMFGVSGTGDTSGYGRLVRQVVLPG
SSPRPYGGYFDDIVDRLAEALRHERVEFEDAVEKVVVYRDELTLHVRRDL
LPRVAQRLRDEPELRFELCLGVSGVHYPHETGRELHAVYPLQSITHNRRL
RLEVSAPDSDPHIPSLFAIYPTNDWHERETYDFFGIIFDGHPALTRIEMP
DDWQGHPQRKDYPLGGIPVEYKGAQIPPPDERRGYN
433636225YP_007269852.1 Putative NADH dehydrogenase i (chain A) NuoA (NADH-ubiquinone oxidoMNVYIPILVLAALAAAFAVVSVVIASLVGPSRFNRSKQAAYECGIEPAST
GARTSMGPGAATGQRFPIKYYLTAMLFIVFDIEIVFLYPWAVSYDSLGTF
ALVEMAIFMLTVFVAYAYVWRRGGLTWD
433636223YP_007269850.1 Putative two-component system response regulator [Mycobacterium canMPDSSTALRILVYSDNVQTRERVMRALGKRLHPDLPDLTYVEVATGPMVI
RQMDRGGIDLAILDGEATPTGGMGIAKQLKDELASCPPILVLTGRPDDTW
LASWSRAEAAVPHPVDPIVLGRTVLSLLRAPAH
433636221YP_007269848.1 Putative NADPH quinone oxidoreductase FadB4 (NADPH:quinone reductasMRAVRVTRLEGPDAVEVAEVEEPTSAGVVIEVHAAGVAFPDALLTRGRYQ
YRPEPPFVLGAEIAGVVRSAPDNSQVRPGDRVVGLTMLTGGMAEVAVLSP
ERVFKLPDNMTFEAGAGVLFNDLTVYFALAVRGRLQAGETVLVHGAAGGI
GTSTLRLAPALGASRTVAVVSTQEKAELATVAGATDVVLAEGFKDAVKEL
TNGRGVDIVVDPVGGDRFTDSLRSLAAGGRLLVIGFTGGEIPTVKVNRLL
LNNIDVVGVGWGAWSLTHPDALAQQWSQLERLLRSGKLPPPEPVVYPLDQ
AAAAIASLENRTAKGKVVLRVRD
433636219YP_007269846.1 Putative acyl-CoA dehydrogenase FadE24 [Mycobacterium canettii CIPTMTNTTSAANAAKPSGARTDRRGRTTGVGLAPHKRTGIDVALALLTPIVGQ
EFLDKYHLRDPLNRSLRYGVKTMFATAGAATRQFQRVQGRRGGPTRLKSS
GRDYFDLTPDDDQKLIIETVDEFAEEVLRPAAHDADDAAAYPSDLTAKAA
ELGITAINIPEDFDGIAEHRSSVTNVLVAEALAYGDMGLALPILAPGGVA
SALTHWGSADQQATYLKEFAGENVPQACVAITEPQPLFDPTRLKTTAVRT
PSGYRLDGVKSLIPAAADAELFIVGAQLGGKPALFIVESAASGLTVKADP
SMGIRGAALGQVELCGVSVPLNARLGEDEASDNDYSEALALARLGWAALA
VGTSHAVLDYVVPYVKQRQAFGEPIAHRQAVAFMCANIAIELDGLRLITW
RGASRAEQGLPFAREAALAKRLGSDKGMQIGLDGVQLLGGHGYTKEHPVE
RWYRDLRAIGVAEGVVVI
433636217YP_007269844.1 Putative monophosphatase [Mycobacterium canettii CIPT 140070017]MSHDDLMLALALADRADELTRVRFGALDLRIDTKPDLTPVTDADRAVESD
VRQTLGRDRPGDSVLGEEFGGSTTFTGRQWIVDPIDGTKNFVRGVPVWAS
LIALLEDGVPSVGVVSAPALQRRWWAARGRGAFASVDGARPHRLSVSSVA
ELHSASLSFSSLSGWARLGLRERFIGLTDAVWRVRAYGDFLSYCLVAEGA
VDIAAEPQVSVWDLAALDIVVREAGGRLTSLDGVAGPHAGSAVATNGLLH
DEVLTRLNAG
433636215YP_007269842.1 Conserved protein of unknown function- PPE family protein [MycobactMDFAQLPPEVNSARMYTGPGAGPLLAAAGGWNSLAAELATTAEAYGSVLS
GLAALHWRGPAAESMAATAAPYIGWLYTTAEKTQQTAIQARAAALAFEQA
YAMTVPPPLVAANRIQLLALIAANFFGQNTAAIAATEAQYAEMWAQDAAA
MYGYATASAAAALLTPFSPPRQTTNPAGLTAQAAAVSQATDPLSLLIETV
TQALQALTIPSFIPEDFTFLDAIFAGYATVGVTQDVESFVAGTIGAESNL
GLLDVGDENPAEVTPGDFGIGELVSATSPGGGVSGSGAGSAASVGNTVLA
SVGRANSIGQLSVPPSWAAPSTRTVSALSPAGLTTLPGTDVAERGMPGVP
GVPVAAGRASGVLPRYGVRLTVMAHPPAAG
433636213YP_007269840.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MSDPRPARAVVVGIDGSRAATHAALWAVDEAVNRDIPLRLVYVIDLSQPS
AAGEGGGGQSAARAALHDASREVEATGQPVKIETEVLCGRPLTKLMQESR
SAAMLCVGSVGLDHVRGRRGSVAATLAGSALCPVAVIHPSPAEPATTSQV
SAVVAEVDNGVVLRHAFEEARLRGVPLRAVAVHAAETPDDVEQGSRLAQV
HLSRRLAHWTRLYPEVRVDRAIAGGSACRHLAANAKPGQLFVADSHSAHE
LCGAYQPGCAVLTVRSANL
433636211YP_007269838.1 Two component sensor histidine kinase DevS [Mycobacterium canettii MTTGGLVDENDGAAMRPLRHTLSQLRLHELLVEVQDRVEQIVEGRDRLDG
LVEAMLVVTAGLDLEATLRAIVHSATSLVDARYGAMEVHDRQHRVLHFVY
EGIDEQTVRRIGHLPKGLGVIGLLIEDPKPLRLDDVSAHPASIGFPPYHP
PMRTFLGVPVRVRDESFGTLYLTDKTNGQPFSDDDEVLVQALAAAAGIAV
ANARLYQQAKARQSWIEATRDIATELLSGTEPATVFRLVAAEALKLTAAD
AALVAVPVDEDMPAADVGELLVIETVGSAVASTVGRTIPVAGAVLREVFV
NGIPRRVDRVDLEGLDELADAGPALLLPLRARGTVAGVVVVLSQGGPGAF
TDEQLEMMAAFADQAALAWQLATSQRRMRELDVLTDRDRIARDLHDHVIQ
RLFAIGLALQGAVPRERNPEVQQRLSDVVDDLQDVIQEIRTTIYDLHGAS
QGITRLRQRIDAAVAQFADSGLRTSVQFVGPLSVVDSALADQAEAVVREA
VSNAVRHAQASTLTVRVKVDDDLCIEVTDNGRGLPDEFTGSGLTNLRQRA
EQAGGEFTLASVPGASGTVLRWSAPLSQ
433636209YP_007269836.1 Putative diacylglycerol O-acyltransferase [Mycobacterium canettii CMNHLTTLDAGFLKAEDVDRHVSLAIGALAVIEGPAPDQEAFLLSLAQRLR
PCTRFGQRLRLRPFDLGAPKWVDDPDFNLGRHVWRIALPRPGNEDQLFEL
IADLMARRLDRDRPLWEVWVIEGLADSKWAILTKLHHCMADGIAATHLLA
GLSDESMSDSFASNIHTTMQSQSASVRRGGFRVNPSEALTASTAVMAGIV
RAAKGAGEIAAGVLSPAASSLNGPISDLRRYSAAKVPLADVEQVCRKFDV
TINDVALAAITESYRNVLIQRGERPRFDSLRTLVPVSTRSNSALGKTDNR
VSLMLPNLPVDQENPLQRLRIVHSRLTRAKAGGQRQFGNTLMAIANRLPF
PMTAWAVGLLMRLPQRGVVTVATNVPGPRRPLQIMGRRVLDLYPVSPIAM
QLRTSVAMLSYADDLYFGILADYDVVADVGQLARGIEDAVARLVAISKRR
KVTRRRGALSLVV
433636207YP_007269834.1 Conserved protein of unknown function (part 2) [Mycobacterium canetMYAFYYRYDTAEERAVLNRMWKLVNDRLNYLTPTIKPIGYASSADGRRRR
LYDAPQTPLDRPLAARVLSAAQQADLITYRDSLNPAQIGRQIADLQNRLL
ILAKEKTEQLYLANIPTSLPDIHKGIRIKAG
433636205YP_007269832.1 Transposase [Mycobacterium canettii CIPT 140070017]MRPATPLICAFIDEHKERFGVVPICRALAIQGAAIAPRTYWAHRASAPSK
RALWDTTITEILAGYYQPDADGKRPPESLYGSLKMWAHLQRQGIPVARRT
VERIMRHNGWRGVMRARRPPRTTERDPAATRAPDLVGRRWRVGAPNLLEV
ADFTYVALDTGGFGYTAFVVDAYAGLIPGWECSMVKDTGFVERALRHAAA
FRARQGHPFDDTVHHSDAGSQYTAIHYGETLMLEGLIPSIGTVGDALDNA
LCETTIGLYKTECVRPGSPFRTGPIRTVADLENMTSAWVSWYNTSRLMHR
LGRIPPAEAEDEYYARLQAGKHTGHT
433636203YP_007269830.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MVIRFDQIGSLVLSMKSLASLSFQRCLRENSSLVAALDRLDAAVDELSAL
SFDALTTPERDRARRDRDHHPWSRSCSQLSPRMAHGAVHQCQWPKAVWAV
IDNP
433636201YP_007269828.1 Putative transcriptional regulatory protein [Mycobacterium canettiiMQFNVLGPLELNLRGTKLPLGTPKQRAVLAMLLLSRNQVVAADALVQAIW
EKSPPARARRTVHTYICNLRRTLSDAGVDSRNILVSEPPGYRLLIGDRQQ
CDLDRFVAAKESGLRASAKGYFSEAIRYLDSALQNWRGPVLGDLRSFMFV
QMFSRALTEDELLVHTKLAEAAIACGRADVVIPKLERLVAMHPYRESLWK
QLMLGYYVNEYQSAAIDAYHRLKSTLAEELGVEPAPTIRALYHKILRQLP
MDDLVGRVTRGRVDLRGGNGAKVEELTESDKDLLPIGLA
433636199YP_007269826.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MGEDSLQDLEQRRARLYDQLAATGDFRRGSISENYRRCGKPNCVCAQEGH
PGHGPRYLWTRTVAGRGTKGRQLSVEEVDKVRAELANYHRFAQVSEQIVA
VNEAICEARPPNPAATAPPAGMTGDKKGGSATRSRRSSPPR
433636197YP_007269824.1 Putative cytochrome P450 141 cyp141 [Mycobacterium canettii CIPT 14MTSTSIPTFPFDRPVPTEPSPMLSELRNSCPVAPIELPSGHTAWLVTRFD
DVKGVLSDKRFSCRAAAHPSSPQFVPFVQLCPSLLSIDGPQHTAARRLLA
QGLNPGFIARMRPVVQQIVDNALDDLAAAEPPVDFQEIVSVPIGEQLMAK
LLGVEPETVHELAAHVDAAMSVCEIGDEEVSRRWSALCTMVIDILHRKLA
EPGDDLLSTIAQANRQQSSMTDEQVVGMLLTVVIGGVDTPIAVITNGLAS
LLHHRDQYERLVEDPGRVARAVEEIVRFNPATEIEHLRVVTEDVVIAGTA
LSAGSPAFTSITSANRDSDQFLDPDEFDVERNPNEHIAFGYGPHACPASA
YSRMCLTTFFTSLTQRFPQLQLARPFEDLERRGKGLHSVGIKELLVTWPT
433636195YP_007269822.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MSPSPSALLADHPDRIRWNAKYECADPTEAVFAPISWLGDVLQFGVPEGP
VLELACGRSGTALGLAAAGRCVTAIDVSDTALVQLELEATRRELADRLTL
VHADLCSWQSGDGRFALVLCRLFWHPPTFRQACEAVAPGGVVAWEAWRRP
IDVARDTRRAEWCLKPGQPESELPAGFTVIRVVDTDGSEPSRRIIAQRSL
433636193YP_007269820.1 Conserved protein of unknown function SseC1 [Mycobacterium canettiiMCSGPKQGLTLPASVDLEKETVITGRVVDGDGQAVGGAFVRLLDSSDEFT
AEVVASATGDFRFFAAPGSWTLRALSAAGNGDAVVQPSGAGIHEVDVKIA
433636191YP_007269818.1 Putative molybdenum cofactor biosynthesis protein MoeB [MycobacteriMTEALIPAPSQISLTRDEVRRYSRHLIIPDIGINGQQRLKDARVLCIGAG
GLGSPALLYLAAAGVGTIGIIDGDHVDESNLQRQIIHGTSDVGRPKVESA
AEAVAEINPHVRVTQYREMLTHDNALEIFGDHDLIVDGTDNFTTRYLIND
AAVLAGRPYVWGSIYRFNGQTSVFWPGRGPCYRCLHPAPPPPGLVPSCAE
GGVLGAICATIASIQVTEVLKLLTGVGTPLVGRLLMYEALDATYHQIRIA
KNPDCAICGDAPTITELVDDSVSCASTQSVDPELVISCDELRTKQQSDQN
FLLVDVREPAEFDIAHIPGSILIPKGEIGSAAGLAQLPLDKEIVLYCKSG
IRSAQALTTLKAAGLHNVKHLDGGIAEWTRTIDSSLLVY
433636189YP_007269816.1 Putative phosphatase [Mycobacterium canettii CIPT 140070017]MTSRDGFTIVWDWNGTLCDDRTILLDAVGQTLVNEGFEPLSQQQLIQRFA
RPLRTFFENACGRDLLTSEWERVQSTFRRIYRSREAEVTLVEDAYDVLAQ
GNRSAAGQFLLSLAPHDELMHFVQKYGIAKWFNEIRGRTRPDQEKPMMLA
ELIMQRSLNPTRVVHIGDSLEDAAAASAVGAISVLVTGASLQPPDRVMLE
QLQPFVASSLKQALQYAGGDGD
433636187YP_007269814.1 Putative pterin-4-alpha-carbinolamine dehydratase MoaB1 (PHS) (4-alMTVSTPEQHEQRASHDASEGKHDVCQGRLAALADAAVSEKLGALPGWQLL
DMRLSRAFQCTNFDQSIDFMNRVASIANDINHHPDIAVLDKRSVRVTAWT
RKLGYLTDIDFDLAASVEAMYATEFADRPAR
433636185YP_007269812.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MPGKEIDRVRATSALAVIRQHPVMVFFALSPVLAALGVMWWLAGAGWAIV
AALVLVVVGGAMIVLKR
433636183YP_007269810.1 NADPH-ferredoxin reductase FprA [Mycobacterium canettii CIPT 140070MRPYYIAIVGSGPSAFFAAASLLKAADTTEDLDMAVDMLEMLPTPWGLVR
SGVAPDHPKIKSISKQFEKTAEDPRFRFFGNVVVGEHVQPGELAERYDAV
IYAVGAQSDRMLNIPGEDLPGSIAAVNFVGWYNAHPHFEQVSPDLSGARA
VVIGNGNVALDVARILLTDPDVLARTDIADHALESLRPRGIQEVVIVGRR
GPLQAAFTTLELRELADLDGVDVVIDPAELDGITEEDAAAVGKVCKQNIK
VLRGYADREPRPGHRRMVFRFLTSPIEIKGERKVERIVLGRNKLVSDGSG
RVAAKDTGEREELPAQLVVRSVGYRGVPTRGLPFDDQSGTIPNVGGRING
SPNEYVVGWIKRGPTGVIGTNKKDAQDTVDTLIKDLGNAKEGAECKSFPE
DHADQLAAWLAARQPKLVTSAHWQVIDAFERAAGEPHGRPRVKLASLAEL
LRIGLG
433636181YP_007269808.1 Conserved membrane protein of unknown function [Mycobacterium canetMTTSGTVLAASIAQHWHNFWRGEIGDWIFDRGLRIVMLLIAAVLAARFVT
WLANRVTRRLDLGFTESDALVRSEATKHRQAVALVISWVSIVLIYVVVVY
EIIDVLPVPVGALVGPAAVLGAALGFGAQRLVQDLLAGFFIIVEKQYGFG
DLVELSMVGSPENAAGTVEDVTLRVTKLRSSGGEVFTVPNGNIVKSVNLS
KDWARAVVDIPVPTSADLGRVNEVLHQECEHARHDSLLGELLLDEPTVMG
VERIEVDTVTLRLVARTLPGKQFEAGRQLRVLVIRALTRAGIVTAADARA
AVAESPEQ
433636179YP_007269806.1 Transporter subunit: ATP-binding component of ABC superfamily [MycoMITLDHVTKQYKSSARPALDDINVKIDKGEFVFLIGPSGSGKSTFMRLLL
AAETPTSGDVRVSKFHVNKLRGRHVPKLRQVIGCVFQDFRLLQQKTVYDN
VAFALEVIGKRTDAINRVVPEVLETVGLSGKANRLPDELSGGEQQRVAIA
RAFVNRPLVLLADEPTGNLDPETSRDIMDLLERINRTGTTVLMATHDHHI
VDSMRQRVVELSLGRLVRDEQRGVYGMDR
433636177YP_007269804.1 Putative SsrA-binding protein SmpB [Mycobacterium canettii CIPT 140MSKSSRGGRQIVASNRKARHNYSIIEVFEAGVALQGTEVKSLREGQASLA
DSFATIDDGEVWLRNAHIPEYRHGSWTNHEPRRNRKLLLHRRQIDTLVGK
IREGNFALVPLSLYFAEGKVKVELALARGKQARDKRQDMARRDAQREVLR
ELGRRAKGMT
433636175YP_007269802.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MIRGAVYRVDFGDAKRGHEQRGRRYAVVISPGSMPWSVVTVVPTSTSAQP
AVFRPELEVMGTKARFLVDQIRTIDIGYVHGDPVDYLDRDEMAKVEHAVA
RYLGL
433636173YP_007269800.1 Protein of unknown function [Mycobacterium canettii CIPT 140070017]MRGNQRLLDDQAKIVFSESFLLYLDDLTPAERESVLAEVVALCDNPIGKH
PLGSRSATDRLAGLNTVQALGKKHRVVFAARAEQGVGLIEVVCAGPRTGN
AVYDVANALVRSGRLTEEEATQLWDALALLEVVAEGVGIDGWDYRPRPAE
AHLVRALVQLGLLPEDLARVVSRAEAEAAMRDGYDETGQPDTYAALTAVM
RAARARSDYGDATDILRRRSEERCGAEMPRARAKCIRRVGHPGPHRATG
433636171YP_007269798.1 Putative helicase- C-terminal fragment [Mycobacterium canettii CIPTMNRSSRNHHRQTTRLVTGAGHHQDGVDAQLVWGIKNFVRTTRRCRILKIK
ADNQSNWGRGLPARFTLSAGLDRPPRPRPQRQSAGIVNDPNERCDEHDDP
TYIVDPIKKVITVSVETMTIIDEIGA
433636169YP_007269796.1 Putative membrane-anchored nucleotide-binding enzyme (modular proteMGFYIRKSVKAGPFRFNLSKSGVGVSAGVPGFRIGTGPRGNYVHMGRNGV
YYRASANGPISRSSTRLGQSVRQQQPAFRPSDVVMEDVTGATALSLEPTG
SDDLVDQLNAAAARAAWWWPVAIVVVLLGLMTMPWGLLVWTLGGVGCAWL
YLNDQARRTVVVFYDVHDDAHSWFDSLVAQWSWLTESQQVRRIIESGDVL
GTYNFKVNSGASALVRTISAAASTSGKISQLSTNIVVPSITAGNSALYLL
PDRLVVREGKRYSDIDYRTLRTFPQRQRFIESSTPPRDALQVDSTWQYVN
VKGGQTVVSRITEYCR
433636167YP_007269794.1 PE-PGRS family protein- triacylglycerol lipase (esterase/lipase) (tMSYVLALPEVMSAAATDVASIGGAVTAANRGVAGATTTVLAAAEDEVSAA
IAALFSAHGQGYQAFSARMAVFHERFVQALAGAAQAYAAAEVANVPLLET
ELAITVETGFAAAQQGLQQIPTTLATGFSQLSNVLLSEIFGAPAAPAFPA
TQDGTFTGTSSLLNRFELAGLLWPVKPFVELSGFAEPGNPLLSLIASDIP
PLSWFIGNSPPPLLNLLLGQTVQYTTYDGMSVVQITPAYPTGEYVVAVHG
GAFILPPSIFHWINYSVMAQQTGATVQVPIYPLLQQGGTAGTVVPALAGL
ISAQIGQHGASNVSVIGDSAGGNLALAAVQHIVIQGHPVPESMVLLSPWL
DVGMTNPNIAFVADPLLSIGPAQQIGRAWAGNLPVNDYRVSPLYGSLSGL
PPTYVYAGNLDILAPDVFVLQQAAVTAGAPVNFVLANGQVHDWVLLTPDG
LRYLPQINLQLGIVA
433636165YP_007269792.1 Putative transcriptional regulatory protein [Mycobacterium canettiiMAVSDLSHRFEGESVGRALELVGERWTLLILREAFFGVRRFGQLARNLGI
PRPTLSSRLRMLVEVGLFDRVPYSSDPERHEYRLTEAGRDLFAAIVVLMQ
WGDEYLPRPEGPPIKLRHHTCGEHADPRLICTHCGEEITARNVTPEPGPG
F
433636163YP_007269790.1 Putative oxidoreductase [Mycobacterium canettii CIPT 140070017]MTDIEVALPFWLDRPDHEATDVALAAADTGFAALWIGEMATYDAFALATS
IGLRAPNMTLKVGPLAVGVRGPVGLALGVSSVASLTGCRVDLALGASSPA
IVAGWHGRPWAHHVPVMRETIECLRSIFTVRGSNTAAVTSTAADSGCAVR
HPIRELRWGRLDLA
433636161YP_007269788.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MPIPFADGMLSRLGRRGAALDLIEEFEDESGEPPASLSPADLLAAEPALL
LQKMENRLVRHHLANPDVLSGEQLRKLRYILNFARLADFEPGAAGPGGSR
GRGDISVGGQVAPWRSRVVDALYGPLREEPDPVTALGGARDVLATLVDDQ
DDQRRVLIERHGNDFSAAELDAEVGYKKLVTVLGGGGGAGFVYIGGMQRL
LAAGQVPDYMIGSSFGSIIGSLVARELPVPIDEYADWAKTVSYRAILGPE
RRRSRHGLAGMFALRFDQFAHTLLSRGDGERMRMSDLAIPFDVVVAGVRR
QPYAALPSRFRHRERSALTLRSLPFLPIGIGPWVAARMWQVAAFIDLRVV
KPIVISSDDATRDVNVVDAASFSSAIPGVLHHETSDPRMLPILDELCADQ
DVAAMVDGGAASNVPVELAWERVRDGRLGTRNACYLAFDCFHPHWDPRHL
WLVPITQAIQLQMVRNLPYADHLVRFEPTLSPVNLAPSAAAIDRACRWGR
DSVEPAIPVTSALLEPAWWEGDRPPAAEPKERAKSAASSMSAVMAAIQAP
TGRFRRWRSRHLT
433636159YP_007269786.1 Putative chain-fatty-acid-CoA ligase FadD13 (fatty-acyl-CoA synthetMKNIGWMLRQRATVSPRLQAYVEPSTDVRMTYAQMNALANRCADVLTALG
IAKGDRVALLMPNSVEFCCLFYGAAKIGAVAVPINTRLAAPEVSFILADS
GSKVVIYGAASAPVIDAIRTQADPPGTVTDWIGADSLADRLRSVAADEPA
VECGGDDNLFIMYTSGTTGHPKGVVHTHDSVHSAASSWASTIDVRYRDRL
LLPLPMFHVAALTTVIFSAMRGVTLISMPQFDATKVWSLIVEERVCIGGA
VPAILNFMRQVPEFAELDAPDFRYFITGGAPMPEALIKIYAAKNIEVVQG
YALTESCGGGTLLLSEDALRKAGSAGRATMFTDVAVRGDDGVIRERGEGE
VVIKSDILLKEYWNRPEATRDAFDNGWFRTGDIGEIDDEGYLYIKDRLKD
MIISGGENVYPAEIENVIIGVPGVSEVAVIGLPDEKWGEIAAAIVVADQN
EVSEQQIVEYCGTRLARYKLPKKVIFAEAIPRNPTGKILKTVLREQYSAT
VPK
433636157YP_007269784.1 Conserved protein of unknown function- possible triacylglycerol synMRRLNGVDALMLYLDGGSAYNHTLKISVLDPSTDPDGWSWPKARQMFEER
AHLLPVFRLRYLPTPLGLHHPIWVEDPDFDLDAHVRRVVCPAPGGMAEFC
ALVEQIYAHPLDRDRPLWQTWVVEGLDGGRVALVTLLHHAYSDGVGVLDM
LAAFYNDTPDEAPVVAPPWQPPPLPSTRQRLGWALRDLPSRLSKIVPTVR
AVRDRVRIEREFAKDGDRRVPPTFDRSAPPGPFQRGLSRSRRFSCESFPL
AEVREVSKTLGVTINDVFLACVAGAVRRYLERCGSPPTDAMVATMPLAVT
PAAERAHPGNYSSVDYVWLRADIADPLERLHATHLAAEATKQHFAQTKDA
DVGAVVELLPERLISGLARANARTKGRFDTFKNVVVSNVPGPREPRYLGR
WRVDQWFSTGQISHGATLNMTVWSYCDQFNLCVLADAVAVRNTWELVGGF
RASHEELLAAARAQAMSKEVAT
433636155YP_007269782.1 Putative short-chain type dehydrogenase/reductase [Mycobacterium caMSSFEGKVAVITGAGSGIGRALALNLAEKRAKLALSDVDTDGLAETARLA
QALGAQVKSDRLDVAEREAVLSYADTVVAHFGTVHQVYNNAGIAYNGNVD
KSEFKDIERIIDVDFWGVVNGTKAFLPHVIASGDGHIVNISSLFGLIAVP
GQSAYNAAKFAVRGFTEALRQEMLVARHPVKVTCVHPGGIKTAVARNATV
ADGEDQQTFAEFFDRRLALHSPEMAAKTIVNGVAKGRARVVVGLEAKAVD
VLARIMGSSYQRLVAAGVAKFFPWAK
433636153YP_007269780.1 Putative monooxygenase (hydroxylase) [Mycobacterium canettii CIPT 1MNQHFDVLIIGAGLSGIGTACHVTAEFPDKTIALLERRERLGGTWDLFRY
PGVRSDSDMFTFGYKFRPWRDVKVLADGASIRQYIADTATEFGVDEKIHY
GLKVNTAEWSSRQCRWTVAGVHEATGETRTYTCDYLISCTGYYNYDAGYL
PDFPGVDRFGGRCVHPQHWPEDLDYSGKKVVVIGSGATAVTLVPAMAGSN
PGSAAHVTMLQRSPSYIFSLPAVDKISQVLGRFLPDRWVYEFGRKRNIAI
QRKLYQACRRWPKLMRRLLLWEVGRRLGRSVDMSNFTPNYLPWDERLCAV
PNGDLFKTLASGAASVVTDQIETFTETGILCKSGREIEADIIVTATGLNI
QMLGGMRLIVDGAEYQLPEKMTYKGVLLENAPNLAWIIGYTNASWTLKSD
IAGAYLCRLLRHMADNGYTVATPRDAQDCALDVGMFDQLNSGYVKRGQDI
MPRQGSQHPWRVLMHYEKDAKVLLEDPIDDGVLHFAAAAQDHAAA
433636151YP_007269778.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MTPHYRRAAASRLDTHRTQKLRSQSNGGKDRHQLTYEQFARMLTLMGPSD
LWTVERAARHWGVSASRARAILSSRHIHRVSGYPAQAIKAVTLRQGARTD
LKTANHLVPAAQAFTMAETGAAIGETEDERARLRIFFEFLRGADETGTSA
LDLIVDEPGLIGEHRFDALLAAAAEYISARWGRPGPLWSVSIERFLDTAW
WVSDLPSARAFAAVWTPAPFRRRGIYLDRHDLTSDGVCVMPEPVFNRTEL
QRAFTALAAKLERRGVVGQVHVVGGAAMLLAYNSRVTTRDIDALFSPDGP
MLEAIREVADEMGWPRTWLNNQASGYVSRTPGEGAPVFDHPFLHVVATPA
QHLLAMKVVAARGVRDGEDIRLLLDRLRITSAAGVWEIVARYFPAETITD
RSRLLVEDLLNQ
433636149YP_007269776.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MRFGVLTFVTDEGIGPAELGAALEQRGFESLFLAEHTHIPVNTQSPYPGG
GPIPERYYRTLDPFVALAAAAATTQSLVLGTGIALVPERDPILTAKEVAS
LDLASQGRFRFGVGVGWLREEVANHGVDPAVRGRVIDERLRAMIQIWTQE
QAEFHGKYVDFDPIYCWPKPVTKPYPPLYVGGGPANFPRIARLNAGWIAI
SPSPEQLSRPLDRLRAMAGGDVPVTVCQWGEATAKDLEGYRHLGVERVLL
ELPTEPRDPTLRYLDTLQAELARLA
433636147YP_007269774.1 Putative hydrolase [Mycobacterium canettii CIPT 140070017]MANRPDIIIVMTDEERAVPPYESAEVLAWRQRSLTGRRWFDEHGVSFTCH
YTGSLACVPSRPTIFTGQYPDLHGVTQTDGIGKRFDDSRLRWLRAGEVPT
LGNWFRAAGYDTHYDGKWHISHADLEDPATGAPLATNDNEGVVDSAAVRR
YLDADPLGPYGFSGWVGPEPHGAGLANSGFRRDPLVADRVVAWLTERYAR
RRAGDTAAMRPFLLVASFVNPHDIVLFPAWVWRSPLKPSPLDPPHVPAAP
TADEDLSTKPAAQIAYREAYYSGYGLTRMVSRNYARNAQRYRDLYYRLHA
EVDGPIDRVRRAVTEGGSEDAVLVRTADHGDLLGAHGGLHQKWFNLYDEA
TRVPFIIARIGEKATQPRTVSAPTSHVDLVPTLLGAAGVDVDVVAATLAE
SFSEVHPLPGRDLMPVVDGASADEGRAIYLMTRDNVLEGDTGASLLSRQL
GRIVNPPAPLRIKVPAHVAANFEGLVVRVDDTDAAGGGGHLWKLVRTFDD
PATWTEPGVRHLATNGMGGEAYRTDPLDDQWELYDLTADPIEAYNRWSDP
ELHELRQHLRMQLKGQRASSVPERNRPWPYAERQPPSGKSPNVVRRVLGR
LGP
433636145YP_007269772.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MTSMYEQVDTNTADPVAGSRIDPVLARSWLLVNGAHGDRFESAAHSRADI
VVLDIEDAVAPKDKHAARDNAVRWFGDGNADWVRINGFGTPWWADDLAML
ADSPVGGVMLAMVESVDHVTETAKRLPNVPIVALVETARGLERINEIAAA
KGTFRLAFGIGDFRRDTGFGEDPATLAYARSRFTIAARAAGLPSAIDGPT
IGSNALKLIEATAVSAEFGMTGKICLSPDQCSVVNEGLSPSQDEICWAKE
FFAEFARDGGEIRNGSDLPRIARATKILDLARAYGIEVSDFEDEPVHMPA
PTDTYHY
433636143YP_007269770.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MVRETRVRVARVYDDIDPEDGQRVLVDRIWPRGIRKDDQRVGMWCKDVAP
SKELREWYHRQPERFDEFASRYQEELHDSAALAELRKLTERSVVTLVTAT
RHVARSHAAVLAQLLNGC
433636141YP_007269768.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MNEQCLKLTAYFGERQRAVGGAGRFLADAMLDLFGSHNVATSVMLRGTTS
FGPKHEFRCDQSLSLSEDPPVTVAAVDIESKIRSLVDDVTAMTDRGLVTL
ERARLVTRHSRAEEFGDIDSRNGDAAKLTIYAGRQVRVAGAPAYYTICEL
LHRHGFAGATVLLGVDGTAHGRRRRARFFGRNVNVPLMIIAVGTPAQVAV
AAMELTAALPNPLLTIERVRLCKRDGELFARPQQLPQTDDQGRTLWQKLL
VHTAEATHHEGLPIHRALVHRLMQSETARGATALRGIWGFYGDHKPHGDK
LFQLVRRVPVTTIIVDTPQAIARSFDIVDELTNWHGLVTSEMVPAAVSLT
GSRDGTQKTGETPLARYDY
433636139YP_007269766.1 Conserved membrane protein of unknown function [Mycobacterium canetMPNHDYRELAAVFAGGALGALARAALSALAIPDPARWPWPTFTVNVVGAF
LVGYFTTRLLERLPLSSYRRPLLGTGLCGGLTTFSTMQVETIRMIEHGHW
GLAAAYSVVSITLGLLAVHLATVLVRRVRIRR
433636137YP_007269764.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MLTVGVGIGAAILLGWFTLAHRHPDQPGAAATPPPAGLTTQSAPTAAPPS
TPQSPDLDSVFLGNLHDRGISFTNPDAAVYNGKMVCTNLGGGMTVQQVVE
ALQSSSPALGDRTTAYVAVSIRTYCPKYDALLPPGS
433636135YP_007269762.1 Multidrugs-transport integral membrane protein Mmr [Mycobacterium cMIYLYLLCAIFAEVVATSLLKNTEGFTRLWPTVGCLVGYGIAFALLALSI
SHGMQTDVAYALWSAIGTAAIVLVAVLFLGSPISVMKVVGVGLIVVGVVT
LNLAGAH
433636133YP_007269760.1 Putative carbon starvation protein A homolog CstA [Mycobacterium caMAAPTPSNRIEERSGHASYVRTDADLPPVAILDRSPITLRHKIFFVAVAV
IGALAWTVVAFFRNEPVNAVWIVVAAGCTYIIGFRFYARLIEMKVVRPRD
DHATPAEILDDGTDYVPTDRRVVFGHHFAAIAGAGPLVGPVLATQMGYLP
SSIWIVVGAVLAGCVQDYLVLWISVRRRGRSLGQMVRDELGATAGVAALV
GIPVIITIVIAVLALVVVRALAKSPWGVFSIAMTIPIAIFMGCYLRFLRP
GRVSEVSLIGIGLLLLAVVSGDWVAHTSWGAAWFSLSPVTLCWLLISYGF
AASVLPVWLLLAPRDYLSTFMKVGTIALLAIGVCAAHPVIEAPAVSKFAG
SGNGPVFAGSLFPFLFITIACGALSGFHALICSGTTPKMLEKEGQMRVIG
YGGMMTESFVAVIALLTAAILDQHLYFTLNAPSLHTHDSAATAAEYVNGL
GLTGSPVTPDQISQAAASVGEQTIVSRTGGAPTLAFGMAEMLHRVVGGAG
LKAFWYHFAIMFEALFILTTVDAGTRAARFMVSDALGNFGGVLRKLQNPS
WRPGAWACSLVVVAAWGSILLLGVTDPLGGINTLFPLFGIANQLLAGIAL
TVITVVVIKKGRLKWAWIPGIPLLWDLAVTLTASWQKIFSADPSVGYWTQ
HAHYAAAQHAGETAFGSATNADEINDVVRNTFVQGTLSIVFVVVVVLVVV
AGVIVALKTIRGRGIPLAEDDPAPSTLFAPAGLIPTAAERKLQRRLGAPA
SASVAAPD
433636131YP_007269758.1 Putative acyl-CoA dehydrogenase FadE22 [Mycobacterium canettii CIPTMGIALTDDHRELSGVARAFLTSQKVRWAARASLDAAGDARPPFWQNLAEL
GWLGLHIDERHGGSGYGLSELVVVIEELGRAVAPGLFVPTVIASAVVAKE
GTDDQRARLLPALIDGTLTAGVGLESQVQVTDGVADGEAGIVLGAGLAEL
LLVAAGDDVLVLERGRKGVSVDVPENFDPTRRSGRVHLDNVRVTTHDILL
GAHESALAHARTLLAAEAVGGAADCVDSAVAYAKVRQQFGRTIATFQAVK
HHCANMLVAAESAIAAVWDAARAAAEDEEQFRLAAAVAAALAFPAYARNA
ELNIQVHGGIGFTWEHDAHLHLRRALVTVGLFGGDAPARDVFERTAAGVT
RAISLDLPAQAEELRARIRSDAAEIAALEKDAQRDKLIETGYVMPHWPRP
WGRAAGAVEQLVIEEEFSAAGIERPDYSITGWVILTLIQHGTPWQIERFV
EKALRQQEIWCQLFSEPDAGSDAASVKTRATRVEGGWKINGQKVWTSGAQ
YCARGLATVRTDPDAPKHAGITTVIIDMLAPGVEVRPLRQITGDSEFNEV
FFNDVFVPDEDVVGAPNSGWTVARATLGNERVSIGGSGSYYEAMAAKLVQ
LAQRRSDAFAGAPIRVGVFLAEDQALRLLNLRRAARSVEGAGPGPEGNIT
KLKVAEHMIEGAAIAAALWGPEIALLDGPGRVIGRTVMGARGMAIAGGTS
EVTRNQIAERILGMPRDPLIS
433636129YP_007269756.1 Putative cytochrome P450 136 Cyp136 [Mycobacterium canettii CIPT 14MATIHPPAYLLDQAKRRFTPSFNNFPGMSLVEHMLLNTKFPEKKLAEPPP
GSGLKPVVGDAGLPILGHMIEMLRGGPDYLMFLYKTKGPVVFGDSAVLPG
VAALGPDAAQVIYSNRNKDYSQQGWVPVIGPFFHRGLMLLDFEEHMFHRR
IMQEAFVRSRLAGYLEQMDRVVSRVVADDWVVNDARFLVYPAMKALTLDI
ASMVFMGHEPGTDHELVTKVNKAFTITTRAGNAVIRTSVPPFTWWRGLRA
RELLENYFTARVKERREASGNDLLTVLCQTEDDDGNRFSDADIVNHMIFL
MMAAHDTSTSTATTMAYQLAAHPEWQQRCRNESDRHGDGPLDIESLEQLE
SLDLVMNESIRLVTPVQWAMRQTVRDTELLGYYLPKGTNVIAYPGMNHRL
PEIWTDPLTFDPERFTEPRNEHKRHRYAFTPFGGGAHKCIGMVFGQLEIK
TILHRLLRRYRLELSRPDYQPRWDYSAMPIPMDGMPIVLRPM
433636127YP_007269754.1 Putative short chain alcohol dehydrogenase/reductase [MycobacteriumMLQRGAGQYFAGKRCFVTGAASGIGRATALRLAAQGAELYLTDRDRDGLA
QTVCDARALGAQVPEYRVLDVSDYEDVAAFAADIHARHPSMDVVLNIAGV
SAWGTVDQLTHDQWSRMVAINLMGPIHVIETLVPPMVAAGRGGHLVNVSS
AAGLVGLPWHAAYSASKYGLRGLSEVLRFDLARHGIGVSVVVPGAVKTPL
VNTVEIAGVDRDDPRVNRWVERFSGHAVTPEKAADKILAGVARNRYLVYT
SADIRALYAFKRYAWWPYTLVMRRVNVFFTRALRPGP
433636125YP_007269752.1 Putative transcriptional regulatory protein (probably TetR-family) MSGAERLGDLPVFARQEPVPERGDAARNRALLLEAARRLIARSGADAITM
DDVAAAAGVGKGTLFRRFGSRAGLMMVLLDEDERASQQAFLFGPPPLGPD
APPLDRLIAFGRERMRFVHAHHQLLSEANRDPQTRHSAALSVLRTHLRVL
LASAPTTGDLDAQTDALLALLDVDYVEHQLNAGGHTLQTLGDAWESLARK
LCGR
433636123YP_007269750.1 Glutaredoxin electron transport protein NrdH [Mycobacterium canettiMTVTVYTKPACVQCSATSKALDKQGIAYQKVDISLDSEARDYVMALGYLQ
APVVVAGNDHWSGFRPDRIKALAGAALTA
433636121YP_007269748.1 Ribonucleoside-diphosphate reductase 2- alpha subunit [MycobacteriuMLNLYDADGKIQFDKDREAAHQYFLQHVNQNTVFFHNQDEKLDYLIRENY
YEREVLDQYSRNFVKTLLDRAYAKKFRFPTFLGAFKYYTSYTLKTFDGKR
YLERFEDRVVMVALTLAAGDTALAELLVDEIIDGRFQPATPTFLNSGKKQ
RGEPVSCFLLRVEDNMESIGRSINSALQLSKRGGGVALLLTNIREHGAPI
KNIENQSSGVIPIMKLLEDAFSYANQLGARQGAGAVYLHAHHPDIYRFLD
TKRENADEKIRIKTLSLGVVIPDITFELAKRNDDMYLFSPYDVERVYGVP
FADISVTEKYYEMVDDARIRKTKIKAREFFQTLAELQFESGYPYIMFEDT
VNRANPIEGKITHSNLCSEILQVSTPSLFNEDLSYAKVGKDISCNLGSLN
IAKTMDSPDFAQTIEVAIRALTAVSDQTHIKSVPSIEQGNNDSHAIGLGQ
MNLHGYLARERIFYGSEEGIDFTNIYFYIVLYHALRASNRIAIERGTHFK
GFERSKYASGEFFDKYTDQIWEPKTQKVRQLFADAGIRIPTQDDWRRLKE
SVQAHGIYNQNLQAVPPTGSISYINHSTSSIHPIVSKVEIRKEGKIGRVY
YPAPYMTNDNLEYYEDAYEIGYEKIIDTYAAATQHVDQGLSLTLFFKDTA
TTRDVNKAQIYAWRKGIKTLYYIRLRQMALEGTEVEGCVSCML
433636119YP_007269746.1 Putative monooxygenase [Mycobacterium canettii CIPT 140070017]MSIADTAAKPSTPSPANQPPVRTRAVIIGTGFSGLGMAIALQKQGVDFVI
LEKAADVGGTWRDNTYPGCACDIPSHLYSFSFEPKADWKHLFSYWDEILG
YLKGVTDKYGLRRYIEFNSLVDRGYWDDDECRWHVFTADGREYVAQFLIS
GAGALHIPSFPDIDGRDEFAGPAFHSAQWDHSIDLTGKRVAIVGTGASAI
QIVPEIVGLVAELQLYQRTPPWVVPRTNEELPVSLRRALRNVPGLRALLR
LGIYWAQEALAYGMTKRPNTLKIIEAYAKYNIRRSVKDRELRRKLTPRYR
IGCKRILNSSTYYPAVADPKTELITDRIDRITRDGIVTADGTGREVFREA
DVIVYATGFHVTDSYTYVQIKGRHGEDLVDRWNREGIGAHRGITVADMPN
LFFLLGPNTGLGHNSVVFMIESQIHYVADAIAKCDRMGVQALAPTREAQD
RFNEELQRKLAGSVWNSGGCSSWYLDEHGKNTVLWCGYTWQYWLTTRSVN
PAEYRFFGIGNGLSSDRATVATAN
433636117YP_007269744.1 Protein of unknown function [Mycobacterium canettii CIPT 140070017]MNRLDVLAARASELAVALPRHLNPAVAQDPLNQLPDVFVVFSHWFVTITA
ADLGDTSNYSICG
433636115YP_007269742.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MTKTFSHPHFFRSVLRWLQVGYPEGVPGPDRVALLSLLRSTPLTEEQIGE
VVRHFTENGSPAVTDRVIDRDEIAEFISEVTHHDAGPENIQRVAGILAAA
GWPLAGVDVGESESGGDRAPASQG
433636113YP_007269740.1 Putative FeIII-dicitrate-binding periplasmic lipoprotein FecB [MycoMLFGGMRSTVAVAVAAAVIAACSGCGSDQPPHQASQSMITPTTQIAGAGV
LGNDRKPDESCARAAAAADPGPPTRPAHNAAGVSPEMVAVPAEAQRIVVL
SGDQLDALCALGLQSRIVAAALPNGSSSQPSYLGTTVHDLPGVGTRSAPD
LGAIAAAHPDLILGSQGLTPQLYPQLAAIAPTVFTAAPGADWENNLRGVG
AATARIAAVDALITGFAEHATQVGTKHDATHFQASIVQLTANTMRVYGAN
NFPASVLSAVGVDRPPSQRFTDKAYIEIGTTTADLAKSPDFSAADADIVY
LSCASEAAAERAAVILDSDPWRKLSANRDNRVFVVNDQVWQTGEGMVAAR
GIVDDLRWVDAPIN
433636111YP_007269738.1 Putative phosphoserine phosphatase SerB2 (PSP) (O-phosphoserine phoMPAKVSVLITVTGMDQPGVTSALFEVLAQHGVELLNVEQVVIRGRLTLGV
LVSCPLDVADGTALRDDVAAAIHGVGLDVTIERSDDLPIIRQPSTHTIFV
LGRPITAGAFSAVAREVAALGVNIDFIRGISDYPVTGLELRVSVPPGGVG
PLQIALTKVAAEEHVDVAVEDYGLAWRTKRLIVFDVDSTLVQGEVIEMLA
ARAGAQGQVAAITEAAMRGELDFAESLQRRVATLAGLPATVIDDVAEQLE
LMPGARTTIRTLRRLGFRCGVVSGGFRRIIEPLARELMLDFVASNELEIV
DGILTGRVVGPIVDRPGKAKALRDFASQYGVPMEQTVAVGDGANDIDMLG
AAGLGIAFNAKPALREVADASLSHPYLDTVLFLLGVTRGEIEAADAGDCG
VRRVEIPAD
433636109YP_007269736.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MNSAGEPLVPPLTPRPAATVMLVRDTEAGSASGLAVFLMRRHAAMDFAAG
VMVFPGGGVDDRDRNADLGRLGAWAGPPPHWWAQRFGIEPELAEALVCAA
ARETFEESGVLFAGPADQDHSAPNSIVSDASVYGDARRALADRTLSFADF
LRREKLVLRSDLLRPWANWVTPEAELTRRYDTYFFVGALPEGQRADGENT
ESDRAGWMLPADAIADFAAGRNFLLPPTWTQLDSLAGHTVADVLAVERQI
VPVQPQLARNGDNWEIEFFDSDRYNQARRSSGSTGWPL
433636107YP_007269734.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MTRSTNIPADATPNPHATAEQVAAARHDSKLAQVLYHDWEAENYDEKWSI
SYDQRCVDYARGRFDAIVPDEVVAGLPYDRALELGCGTGFFLLNLIQAGV
ARRGSVTDLSPGMVKVATRNGQALGLDIDGRVADAEGIPYDDDVFDLVVG
HAVLHHIPDVELSLREVVRVLKPGGRFVFAGEPTTVGDGYARTLSTLTWR
VVTNATKLPGLRGWRRPQGELDESSRAAALEALVDLHTFTPQDLQRIAHN
AGAVEVATATEEFTAAMLGWPLRTFECTVPPGRLGWGWARFAFTSWKTLG
WVDANVWRHVVPKGWFYNVMITGVKPS
433636105YP_007269732.1 Conserved exported protein of unknown function- TB22.2 [MycobacteriMRYLIATAVLVAVVLVGWPAAGAPPSCAGLGGTLQAGQICHVHASGPKYM
LDMTFPVDYPDQQALTDYITQNRDGFVNVAQGSPRRDQPYQMDATSEQHS
SGQPPHATRSVVLKFFQDLGGAHPSTWYKAFNYNLATSQPITFDTLFVPG
TTPLDSIYPIVQRELARQTGFGAAILPSTGLDPAHYQNFAITDDSLIFYF
AQGELLPSFVGACQAQVPRSAIPPLAI
433636103YP_007269730.1 Putative transferase [Mycobacterium canettii CIPT 140070017]MTTMWGAPLHRRWRGSRLRDPRQAKFLTLASLKWVLANRAYTPWYLVRYW
RLLKFKLANPHIITRGMVFLGKGVEIHATPELAQLEIGRWVHIGDKNTIR
AHEGSLRFGDKVVLGRDNVINTYLDIEIGDSVLMADWCYICDFDHRMDDI
TLPIKDQGIIKSPVRIGPDTWIGVKVSVLRGTTIGRGCVLGSHAVVRGVI
PDYSIAVGAPAKVVKNRQLSWEASAAQRAELAAALADIERKKAAR
433636101YP_007269728.1 Alpha (1->4) glucosyltransferase [Mycobacterium canettii CIPT 14007MRILMVSWEYPPVVIGGLGRHVHHLSTALAAAGHDVVVLSRCPSGTDPST
HPSSDEVTEGVRVIAAAQDPHEFTFGNDMMAWTLAMGHAMIRAGLRLKKL
GTDRSWRPDVVHAHDWLVAHPAIALAQFYDVPMVSTIHATEAGRHSGWVS
GALSRQVHAVESWLVRESDSLITCSASMNDEITELFGPGLAGITVIRNGI
DAARWPFAARRPRTGPAELLYVGRLEYEKGVHDAIAALPRLRRTHPGTTL
TIAGEGTQQDWLIDQARKHRVLRATRFVGHLDHTELLALLHRADAAVLPS
HYEPFGLVALEAAAAGTPLVTSNIGGLGEAVINGQTGVSCAPRDVAGLAA
AVRSVLDDPAAAQRRARAARQRLTSDFDWQTVATATAQVYLAAKRGERQP
QPRLPIVEHALPDR
433636099YP_007269726.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MCAFVPHVPRHSRGDNPPSASTASPAVLTLTGERTIPDLDIENYWFRRHQ
VVYQRLAPRCTARDVLEAGCGEGYGADLIAGVARQVIAVDYDETAVAHVR
SRYPRVEVMQANLAELPLPDASVDVVVNFQVIEHLWDQAQFVRECARVLR
TSGLLMVSTPNRITFSPGRDTPINPFHTRELNADELTSLLIDAGFVDVAI
CGLFHGPRLRDMDARHGGSIIDAQIKRAVAGAPWPPELAADVAAVTTADF
EMVPAGQDRDIDDSLDLIAIAVRP
433636097YP_007269724.1 Putative electron transfer flavoprotein (alpha-subunit) FixB (alphaMAEVLVLVEHAEGALKKVSAELITAARALGEPAAVVVGVPGTAAPLVDGL
KAAGAAKIYVAESDVVDKYLITPAVDVLAGLAESSAPAGVLIAATADGKE
IAGRLAARIGSGLLVDVVDVREGGVGVHSIFGGAFTVEAQANGDTPVITV
RAGAVEAEPAAGAGEQVSVEVPAAAENAARITAREPAVAGDRPELTEATI
VVAGGRGVGSAENFSVVEALADSLGAAVGASRAAVDSGYYPGQFQVGQTG
KTVSPQLYIALGISGAIQHRAGMQTSKTIVAVNKDEEAPIFEIADYGVVG
DLFKVAPQLTEAIKARKG
433636095YP_007269722.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MSAPAVTEHSWLPRATCDVSCVSVGDAAQVRRPLVVLRVALRVMLALLLV
PGVPLVVMPLPGRTRVQRIYCRLVLRLFGVRITVSGSPIRNLRGVLVVSG
HVSWLDVFCIGSVLPGSFVARADMFTGRTIGIVARILKIIPIERASLRRL
PGVVDTIARRLRAGQTVVAFPEGTTWCGRPGDDAGRPAARAGAGCPHRGC
GAFYPAMFQAAIDAGRPVQPLRLTYHHVDGTVSTAPAFVGDDTLVRSVCR
LLTVRRTVAWLRVESLQLPGTDRRNLARRCQSAVLVGALGQSGQRPGRRH
VPAT
433636093YP_007269720.1 Putative tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferaMKVLAAMSGGVDSSVAAARMVDAGHEVVGVHMALSTAPGTLRTGSRGCCS
KEDAADARRVADVLGIPFYVWDFAEKFKEDVINDFVSSYARGETPNPCVR
CNQQIKFAALSARAVALGFDTVATGHYARLSGGRLRRAVDRDKDQSYVLA
VLTAQQLRHAAFPIGDTPKRQIRAEAARRGLAVANKPDSHDICFIPSGNT
KAFLGERIGVRHGAVVDADGAVLATHDGVHGFTIGQRKGLGIAGPGPNGR
PRYVTAIDADTATVHVGDVTDLDVQTLTGRAPVFTAGAAPSGPVDCVVQV
RAHGETVSAVAELIGDALFVQLHAPLRGVARGQTLVLYRPDPAGDEVLGS
ATIAGTSGLSTGGNPGA
433636091YP_007269718.1 Conserved protein of unknown function- ESAT-6 like protein EsxS [MyMSLLDAHIPQLIASHTAFAAKAGLMRHTIGQAEQQAMSAQAFHQGESAAA
FQGAHARFVAAAAKVNTLLDIAQANLGEAAGTYVAADAAAASSYTGF
433636089YP_007269716.1 Conserved protein of unknown function- PE family [Mycobacterium canMTLRVVPEGLAAASAAVEALTARLAAAHAGAAPAITAVVAPAADPVSLQS
AVGFSALGSEHAAIAAEGVEELVRSGVAVGESGVGYAAGDAVAAATYLVS
GGSL
433636087YP_007269714.1 Conserved protein of unknown function- ESAT-6 like protein EsxS [MyMSLLDAHIPQLIASHTAFAAKAGLMRHTIGQAEQQAMSAQAFHQGESAAA
FQGAHARFVAAAAKVNTLLDIAQANLGEAAGTYVAADAAAASSYTGF
433636085YP_007269712.1 Conserved protein of unknown function- PE family protein (fragment)MTLRVVPEGLAAASAAVEALTARLAAAH
433636083YP_007269710.1 Conserved protein of unknown function- ESAT-6 like protein EsxQ (TBMYNYPAMTANVGDMAGYAGTTQSLGADIASARTAPSRACQGDLGMSHQDL
QAQWNQAMEDLARAYRRCRRALRQIGVLERPIGDSSDCGTIRRVGSFPGR
WLDPRHVGPATAADARD
433636081YP_007269708.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MSVFATATGIGSWPGTAAREAAQVVVGELAGALAYLTELPARGVGADMLG
RAGGLLVDVAIDTVPRGYRIAARPGAVARRAASLLDEDMDALEEAWETAG
LRGGGRAVKVQAPGPVTLVAGLELANGHRAITDPGAVRDLAASLAEGVAA
HRAALARRLDTPVVVQFDEPSLPAALDGRLTGVTALSPVAPLDETVAEAL
LDTCIAAVDADVALHSCSPDLPWDLLQRSRISAVSVDASTLQAADLDAVA
AFVESGRAVVLGLVPVTAPERAPSMEEVAAAAVAVTDRLGVPRSALRDRL
GVSPACGLANATGQWARTAVGLARDVAQAFARDPEAI
433636079YP_007269706.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MRSYLLRIELADRPGSLGSLAVALGSVGADILSLDVVERGNGYAIDDLVV
ELPPAAMPDTLITAAESLNGVRVDSLRPHTGLLEAHRELELLDHVAAAGD
NQSKLGILVAEAPRVLRVSWCTVLRSSGGELHRLAGSQGAPETRANSAPW
LPIERAAALDGGADWVPQAWRDMDTTMVAAPLGDPHTAVVLGRPGPEFRP
SEVARLGYLAGIVATMLR
433636077YP_007269704.1 Putative glutamyl-tRNA(Gln) amidotransferase (subunit A) GatA (Glu-MTDIIRSDAATLAAKIADREVSSAEITQAYLDQIEATDETYHAFLHVAAD
QALAAAAAVDQAVAVGEPLPSALAGVPLALKDVFTTSDMPTTCGSKILEG
WRSPYDATLTARLRAAGIPILGKTNMDEFAMGSSTENSAYGPTRNPWNLD
RVPGGSGGGSAAALAAFQAPLAIGSDTGGSIRQPAALTATVGVKPTYGTV
SRYGLVACASSLDQGGPCARTVLDTALLHRVISGHDPRDSTSVDAEVPDV
VGAARAGAVGDLRGVRVGVVRQLHGGEGYQPGVLASFEAAVEQLTALGAQ
VSEVDCPHFDHALAAYYLILPSEVSSNLARFDAMRYGLRVGDDGTRSAEE
VMAMTRAAGFGPEVKRRIMIGTYALSAGYYDAYYNQAQKVRTLIARDLDA
AYRSVDVLVSPTTPTTAFRLGEKVDDPLAMYLFDLCTLPLNLAGHCGMSV
PSGLSPDDGLPVGLQIMAPALADDRLYRVGAAYEAARGPLPSAI
433636075YP_007269702.1 Putative glutamyl-tRNA(Gln) amidotransferase (subunit B) GatB (Glu-MTVAAGAAKAAGAELLDYDEVVARFQPVLGLEVHVELSTATKMFCGCATT
FGAEPNTQVCPVCLGLPGSLPVLNRAAVESAIRIGLALNCEIVPWCRFAR
KNYFYPDMPKNYQISQYDEPIAVNGYLDAPLEDGTTWRVEIERAHMEEDT
GKLTHVGSETGRIHGATTSLIDYNRAGVPLIEIVTKPIEGAGARAPQIAR
SYVTALRDLLRALDVSDVRMDQGSMRCDANVSLKPVGTAEFGTRTETKNV
NSLKSVEVAVRYEMQRQGAILASGGRITQETRHFHEAGYTSAGRTKETAE
DYRYFPEPDLEPVAPSRELVERLRQTIPELPWLSRRRIQQEWGVSDEVMR
DLVNAGAVELVAATVEHGASSETARAWWGNFLAQKANEAGIGLDELAITP
AQVAAVVALVDEGKLSNSLARQVVEGVLAGEGEPEQVMTARGLALVRDDS
LTRAAVDEALAANPDVAEKIRGGKVAAAGAIVGAVMKATRGQADAARVRE
LVLEACGQG
433636073YP_007269700.1 Putative oxidoreductase [Mycobacterium canettii CIPT 140070017]MSEDVARIHDGDVIDESFDELMGMLDHPVFVVTTQADGRPAGCLVSFATQ
TSVQPPSFMVGLPRSTGTSEVASRSEHLAVHVLSQRQHVLAELFGSQTEE
EVNKFARCSWRAGPCGMPILDDAAAWFIGRTASRSDVGDYVAYLLEPVSV
WAPECSEDLLYLSDLDFDVDDIDPGKEASPRFYERERGDETRRYGVVRFT
LDVP
433636071YP_007269698.1 Conserved membrane protein of unknown function [Mycobacterium canetMTSSNDSHWQRPDDSPGPVPGRPVSASLVDPEDDLTPARYAGDFGSGTTT
VIPPYDAASSGVGNSGYSLIEAAEPLPYVQPQPGRQVPAGSAGIDMDDDE
RVRAAGRRGTQNLGLLILRVGLGAVLIAHGLQKLFGWWDGQGLAGFQNSL
SDIGYQHAEILAYVSAGGEIVAGVLLVLGLFTPLAAAGALAFLINGLLAG
ISAQHSRPVAYFLQDGHAYQITLVVMAVAVILSGPGRYGLDAARGWAHRP
FIGSFVALLGGIAAGIAVWVLLNGVNPLA
433636069YP_007269696.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MTSRAEITSKYAKAYVKASKKDRGRILDQVVEVTGWSRDNARRRLTAAAK
SPPGAGRSIVKRPRKPRSPKYSYDALKVLQRVWAASGGQCGKYLAASMVL
QLDGLERHGELEFGRDRYGSKVREELLAMSAASIDRYLKTAKAKDQISGV
STTKPSPLLRNSIKVRKAGDEVEAEPGFFEGDTVAHCGPTLKGEFARTLN
LTDVHIGWVFTRTVRNNAHTHILAGLEASVIEIPYGITGLDFDNGTEFLN
KPVIGWAGDNGIYFTRSRPYKKNDQATIESKNNHLVRKYAFYYRYDTAEE
RAVLNRMWKLVNDRLNYLTPTIKPIGYASSADGRRRRLYDAPQTPLDRLL
AAGVLSPAQQADLIAYRDSLNPAQIGRQIADLQNRLLILAQEKTEQLYLA
NIPTALPDIRKGIRIKAG
433636067YP_007269694.1 Acetolactate synthase III- thiamin-dependent- small subunit [MycobaMSPKTHTLSVLVEDKPGVLARVAALFSRRGFNIESLAVGATECKDRSRMT
IVVSAEDTPLEQITKQLNKLINVIKIVEQDDEHSVSRELALIKVQADAGS
RSQVIEAVNLFRANVIDVSPESLTVEATGNRGKLEALLRVLEPFGIREIA
QSGMVSLSRGPRGIGTAK
433636065YP_007269692.1 Conserved lipoprotein of unknown function [Mycobacterium canettii CMAGAKHAIGRIVAIATAAAVILAACSSGSKGGAGSGHAGKARSAVTTTDA
DWKPVADALGRSGKLGDNNTAYRINLPRNDLHITSYGVDIKPGLSLGGYA
AFARYDNNETLLMGDLVITEEELPKVTDALQAHGIAQTALHKHLLQQDPP
VWWTHIHGMGDAAQLAQGLKAALNATTIGPPTPPPARQPPVDIDVAGVDQ
ALGRKGTQDGGLLKYSIPRKDTIIEDGHVLPAASLNLTTVINFQPVGHGR
AAINGDFILIAPEVQEVIRAMRAGNITIVELHNHGLTEEPRLFYMHYWAV
DDAVTLARALRAAMDATNLQSP
433636063YP_007269690.1 Conserved protein of unknown function (part2) [Mycobacterium canettMFDSEPRFDDAGRLDDAAVVDALAVAARAENAAAAHRLAWMGELYARRAP
ADDVERSNWAIDGHANVVAEISAALRISRGRAAGQLRYAIALRERLPKVA
EVFRSGAIDFRMVAALVARSDIVDDEAIAKLDAALAKHAPQWMRMSGPKL
VERIDMWVEKFDPHGVREPRAPGEDRYVQIGPAGAGMAGIWGQLALTEGA
ALDGRLDELAGTVCGEDPRTSAQRRADALVALAAGQSRLTCECGAPQCPA
AGERPRLAQVVIHVLAEQATLDGTSTAPGYLPGMGAVPAPLLRELAANAT
CKPLRIPAPVAEAGYRPSAALAEFIRWRDLTCRWPGCDEPAAVCQIDHTI
PYPVGPTHPSNLKLYCPVHHLVKTFYTGAGGWSDRQLPDGTVIFTAPTGH
TYTTTPAGASFFPVLGTPTGQLVIPKPTGAPTANRGLMMPRRGRTRAQDR
AARIADERHRNAARIARKHYLLAERLTRDHEPPPF
433636061YP_007269688.1 Putative D-3-phosphoglycerate dehydrogenase SerA1 (PGDH) [MycobacteMSLPVVLIADKLAPSTVAALGNQVEVRWVDGPDRDKLLAAVPEADALLVR
SATTVDAEVLAAAPKLKIVARAGVGLDNVDVDAATARGVLVVNAPTSNIH
SAAEHALALLLAASRQIPAADASLREHTWKRSSFSGTEIFGKTVGVVGLG
RIGQLVAQRIAAFGAHVVAYDPYVSPARAAQLGIDLLSLDDLLARADFIS
VHLPKTPETAGLIDKEALAKTKPGVIIVNAARGGLVDEAALADAITGGHV
RAAGLDVFATEPCTDSPLFELAQVVVTPHLGASTAEAQDRAGTDVAESVR
LALAGEFVPDAVNVGGGVVNEEVAPWLDLVRKLGVLAGVLSDELPVSLSV
QVRGELAAEEVEVLRLSALRGLFSAVIEDAVTFVNAPALAAERGVTAEIS
KASESPNHRSVVDVRAVGADGSVVTVSGTLYGPQLSQKIVQINGRHFDLR
AQGINLIIHYVDRPGALGKIGTLLGTAGVNIQAAQLSEDAEGPGATILLR
LDQDVPDDVRTAIAAAVDAYKLEVVDLS
433636059YP_007269686.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MELAIRTAMTRLGGSLLQQLLAADTGHRGPRIDCGAGHCAEFVGYRDKQI
DTVLGRITVRRAYYHCTECEHGIAPRDHDLGVTGASLSPGLRKMVARAAA
AEPFAADLLAELAGIELSAKRIERSAETDGAAIAARITAEAPAIARCTVT
VLPGPADRERPPDKLYLAIDGTGVPMVGAALRGRAGKKPDGRARTREVKL
AALFTQTRLDEAGRPVRDPDSTSYLASFAPAEAFATLVHAEARRRGADAI
RQLVVLGNGAHWIWNLATAILPEATPIVDIYHARQHLHDLADHLTGVLGQ
AHPEWLASRLADLDAGDIETLVTETERLHPRLPDDTARNIAKALGYFKNN
AQRMRYAYFRAHGLFIGSGVVEAGCKSVIAQRLKLSRAGRLPTCPRPARW
AGLPARVGGFSQPVPATNTVR
433636057YP_007269684.1 Conserved membrane protein of unknown function [Mycobacterium canetMSRDPTGVGARWAIMIVSLGVTASSFLFINGVAFLIPRLENARGTPLSQA
GLLASMPSWGLVVTMFAWGYLLDHVGERTVMAVGSALTAAAAYAAASVHS
LLWIGVFLFVGGMAAGGCNSAGGRLVSGWFPPQQRGLAMGIRQTAQPLGI
ASGALVIPELAERGVHAGLMFPAVVCTLAAVASVLGIVDPPRKSRTKASE
QELASPYRGSSILWRIHAASALLMMPQTVTVTFMLVWLINHHGWSVAQAG
VLVTMSQLLGALGRVAVGRWSDHVGSRMRPVRLIAAAAAATLFLLAAVDN
EGSRYDVLLMIAISVIAVLDNGLQATAITEYAGPYWSGRALGIQNTTQRL
MAAAGPPLFGSLITTAAYPTAWALCGVFPLAAVPLVPVRLLPPGLETKS
433636055YP_007269682.1 Putative glutamyl-tRNA Synthetase GltS (glutamate--tRNA ligase) (glMTATETVRVRFCPSPTGTPHVGLVRTALFNWAYARHTGGTFVFRIEDTDA
QRDSEESYLALLDALRWLGLDWDEGPEVGGPYGPYRQSQRTEIYRDVLAR
LLAAGEAYHAFSTPEEVEARHVAAGRNPKLGYDNFDRHLTDAQRAAYLAE
GRQPVVRLRMPDDDLAWNDLVRGPVTFATGSVPDFALTRASGDPLYTLVN
PCDDALMKITHVLRGEDLLPSTPRQLALHQALIRIGVAERIPKFAHLPTV
LGEGTKKLSKRDPQSNLFAHRDRGFIPEGLLNYLALLGWSIADDHDLFGL
DEMVAAFDVADVNSSPARFDQKKADALNAEHIRMLDVGDFTVRLRDHLDT
HGHHIALDEAAFAAAAELVQTRIVVLGDAWELLKFFNDDQYVIDPKAAAK
ELGPDGAAVLDAALAALTGVTDWTAPLIEAALKDALIEGLALKPRKAFGP
IRVAATGTTVSPPLFESLELLGRDRSMQRLRAARQLVGHA
433636053YP_007269680.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MCVTWAEMPEIAALIRHIEDLHARHGRSYLLRAGLPSLFRYIEGVHGERP
WGSVLDAGTGVKSLQWIQTLPTERWTAVTAARSMADKTRAALGTAMRPQD
RLLVGNWVDDSLLAGETFDTILVDYLVGAIEGFAPYWQDRVFERLRPHLA
DHGRLYVVGLEPYVQFEPETESGKIIWEIGRVRDACLLLAGERPYREFPL
DWMLGRLGLAGFRILEARRFPIRYRARYVNGQLNMCLARIERFSSNGLGM
AMRAYVEELRARALQLNERHDGLSHGNDYVIAVEPM
433636051YP_007269678.1 Putative 3-isopropylmalate dehydratase (large subunit) LeuC (isoproMALQTGEPRTLAEKIWDDHIVVSGGGSAPDLIYVDLHLVHEVTSPQAFDG
LRLAGRRVRRPELTLATEDHNVPTVDIDQPIADPVSRTQVETLRRNCAEF
GIRLHSMGNIEQGIVHVVGPQLGLTQPGMTIVCGDSHTSTHGAFGALAMG
IGTSEVEHVLATQTLPLRPFKTMAVNVDGRLPDGVSAKDIILALIAKIGT
GGGQGHVIEYRGSAIESLSMEGRMTICNMSIEAGARAGMVAPDETTYAFL
RGRPHAPTGAQWDTALAYWQRLRTDVGAVFDTEVYLDAASLSPFVTWGTN
PGQGVPLAAAVPDPQLMTDDAERQAAEKALAYMDLRPGTAMRDIAVDAVF
VGSCTNGRIEDLRVVADVLRGRKVADGVRMLIVPGSMRVRAQAEAEGLGE
IFTAAGAQWRQAGCSMCLGMNPDQLASGERCAATSNRNFEGRQGAGGRTH
LVSPAVAAATAVRGTLSSPADLN
433636049YP_007269676.1 Putative DNA-binding protein Hu homolog HupB (histone-like protein)MNKAELIDVLTQKLGSDRRQATAAVENVVDTIVRAVHKGDSVTITGFGVF
EQRRRAARVARNPRTGETVKVKPTSVPAFRPGAQFKAVVSGAQRLPAEGP
AVKRGVGASAAKKVAKKAPAKKATKAAKKAATKAPARKAATKAPAKKAAT
KAPAKKAVKATKSPAKKVTKAVKKTAVKASVRKAATKAPAKKAAAKRPAT
KAPAKKATARRGRK
433636047YP_007269674.1 Polyphosphate kinase Ppk1 (polyphosphoric acid kinase) (ATP-polyphoMMSNDRKVTEIENSPVTEVRPEEHAWYPDDSALAAPPAATPAAISDQLPS
DRYLNRELSWLDFNARVLALAADKSMPLLERAKFLAIFASNLDEFYMVRV
AGLKRRDEMGLSVRSADGLTPREQLGRIGEQTQQLASRHARVFLDSVLPA
LGEEGIYIVTWADLDQAERDRLSTYFNEQVFPVLTPLAVDPAHPFPFVSG
LSLNLAVTVRQPEDGTQHFARVKVPDNVDRFVELAAREASEEAAGTEGRT
ALRFLPMEELIAAFLPVLFPGMEIVEHHAFRITRNADFEVEEDRDEDLLQ
ALERELARRRFGSPVRLEIADDMTESMLELLLRELDVHPGDVIEVPGLLD
LSSLWQIYAVDRPTLKDRTFVPATHPAFAERETPKSIFATLREGDVLVHH
PYDSFSTSVQRFIEQAAADPNVLAIKQTLYRTSGDSPIVRALIDAAEAGK
QVVALVEIKARFDEQANIAWARALEQAGVHVAYGLVGLKTHCKTALVVRR
EGPTIRRYCHVGTGNYNSKTARLYEDVGLLTAAPDIGADLTDLFNSLTGY
SRKLSYRNLLVAPHGIRAGIIDRVEREVAAHRAEGAHNGKGRIRLKMNAL
VDEQVIDALYRASRAGVRIEVVVRGICALRPGAQGISENIIVRSILGRFL
EHSRILHFRAIDEFWIGSADMMHRNLDRRVEVMAQVKNPRLTAQLDELFE
SALDPCTRCWELGPDGQWTASPQEGHSVRDHQESLMERHRSP
433636045YP_007269672.1 Putative glycerol-3-phosphate dehydrogenase [NAD(P)+] GpdA2 (NAD(P)MAGIASTVVVMGAGAWGTALAKVLADAGGEVTLWARRAEVADQINTTRYN
PDYLPGALLPPSIHATADAEEALGGASTVLLGVPAQTMRANLERWAPLLP
EGATLVSLAKGIELGTLMRMSQVIISVTGAEPAQVAVISGPNLASEIAEC
QPAATVVACSDSGRAVALQRALNSGYFRPYTNADVVGTEIGGACKNIIAL
ACGMAVGIGLGENTAAAIITRGLAEIIRLGTALGANGATLAGLAGVGDLV
ATCTSPRSRNRSFGERLGRGETLQSAGKACHVVEGVTSCESVLALASSYD
VEMPLTDAVHRVCHKGLSVDEAITLLLGRRTKAE
433636043YP_007269670.1 Conserved exported protein of unknown function [Mycobacterium canetMTAESDGPPRAVLIAAAALAAAVIGVILVVAANRQAPERPVVIPAVPAPQ
ATGPGCKTLLAALPQRLGEYRRAPVAEPTTAGATAWRTGPNSAPVILRCG
LDRPAEFVVGSAIQVVDRVQWFQVAAQNPDEPGRSTWYTVDRPVYVALTL
PSGSGPTAIQELSDVIDHTIPAVPIDPAPSG
433636041YP_007269668.1 Putative uracil-DNA glycosylase Ung (UDG) [Mycobacterium canettii CMTARPLSELVERGWAAALEPVADQVAHMGQFLRAEIAAGRRYLPAGSNVL
RAFTFPFDNVRVLIVGQDPYPTPGHAVGLSFSVAPDVRPWPRSLANIFDE
YTADLGYPLPSNGDLTPWAQRGVLLLNRVLTVRPSNPASHRGKGWEAVTE
CAIRALAARAAPLVAILWGRDASTLKPILAAGNCVAIESPHPSPLSASRG
FFGSRPFSRTNELLVGMGAEPIDWRLP
433636039YP_007269666.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MTSRAEITSKYAKAYVKASKKDRGRILDQVVEVTGWSRDNARRRLTAAAK
SPPGAGRSIVKRPRKPRSPKYSYDALKVLQRVWAASGGQCGKYLAASMVL
QLDGLERHGELEFGRDRYGSKVREELLAMSAASIDRYLKTAKAKDQISGV
STTKPSPLLRNSIKVRKAGDEVEAEPGFFEGDTVAHCGPTLKGEFARTLN
LTDVHIGWVFTRTVRNNAHTHILAGLEASVIEIPYGITGLDFDNGTEFLN
KPVIGWAGDNGIYFTRSRPYKKNDQATIESKNNHLVRKYAFYYRYDTAEE
RAVLNRMWKLVNDRLNYLTPTIKPIGYASSADGRRRRLYDAPQTPLDRLL
AAGVLSPAQQADLIAYRDSLNPAQIGRQIADLQNRLLILAQEKTEQLYLA
NIPTALPDIRKGIRIKAG
433636037YP_007269664.1 ATP-dependent DNA helicase RecG [Mycobacterium canettii CIPT 140070MASLSDRLDRVLGATAADALDEQFGMRTVDDLLRHYPRSYVEGAARVGIG
DARPEAGEHITIVDVITDTYSFPMKKKPNRKCLRITVGGGRNKVTATFFN
ADYIMRDLTKHTKVMLSGEVGYYKGAMQLTHPAFLILDSPDGKNHGTRSL
KSIADASKAISGELVVEEFERRFFPIYPASTKVQSWDIFKCVRQVLDVLD
RVDDPLPAELRAKHGLIPEDEALRAIHLAESQSLRERARERLTFDEAVGL
QWALVARRHGELSESGPSAAWKSNGLAAELLRRLPFELTAGQREVLDVLS
DGLAANRPLNRLLQGEVGSGKTIVAVLAMLQMVDAGYQCALLAPTEVLAA
QHLRSIRDVLGSLAMGGQLGGAENATRVALLTGSMTAGQKKQVRAEIASG
QVGIVIGTHALLQEAVDFHNLGMVVVDEQHRFGVEQRDQLRAKAPAGITP
HLLVMTATPIPRTVALTVYGDLETSTLRELPLGRQPIATNVIFVKDKPAW
LDRAWRRIIEEAAAGRQAYVVAPRIDESDDTDVQGGVRPSATAEGLFSRL
RSAELAELRLALMHGRLSADDKDAAMAAFRAGEVDVLVCTTVIEVGVDVP
NATVMLVMDADRFGISQLHQLRGRIGRGEHPSVCLLASWVPPDSPAGQRL
RAVAGTMDGFALADLDLKERKEGDVLGRNQSGKAITLRLLSLAEHEEYIV
AARDFCIEAYKNPTDPALALMAARFTSTDRIEYLDKS
433636035YP_007269662.1 Putative oxidoreductase [Mycobacterium canettii CIPT 140070017]MTGESGAAAAPSITLNDEHTMPVLGLGVAELSDDETERAVSAALEIGCRL
IDTAYAYGNEAAVGRAIAASGVAREELFVTTKLATPDQGFTRSQEACRAS
LDRLGLDYVDLYLIHWPAPPVGKYVDAWGGMIQSRGEGHARSIGVSNFTA
EHIENLIDLTFVTPAVNQIELHPLLNQDELRKANAQHTVVTQSYCPLALG
RLLDNPTVTSIASEYVKTPAQVLLRWNLQLGNAVVVRSARPERIASNFDV
FDFELAAEHMDALGGLNDGTRVREDPLTYAGT
433636033YP_007269660.1 Putative lipase/esterase LipN [Mycobacterium canettii CIPT 14007001MTKSLPGVADLRLGANHPRMWTRRVQGIVVNVGVKVLPWIPTPAKRILSA
GRSVIIDGNTLDPTLQLMLSTSRIFGVDGLAVDDDIVASRAHMRAICEAM
PGPQIHVDVTDLSIPGPAGEIPARHYRPTGGGARPLLVFYHGGGWTLGDL
DTHDALCRLTCRDADIQVLSIDYRLAPEHPAPAAVEDAYAAFVWAHEHAS
DEFGALPGRVAVGGDSAGGNLSAVVCQLARDKARHEGGPTPVLQWLLYPR
TDFTAQTRSMGLFGNGFLLTKRDIDWFHTQYLRDSDVDPADPRLSPLLAE
SLSGLAPALIAVAGFDPLRDEGESYAKALRAAGTAVDLRYLGSLTHGFLN
LFQLGGGSAAGTNELISALRAHLSRV
433636031YP_007269658.1 Conserved membrane protein of unknown function [Mycobacterium canetMVAARPAERSGDPAAVRVPVPSAWWVLIGGVIGLFASMTLTVEKVRILLD
PIYVPSCNVNPIVSCGSVMTTPQASLLGFPNPLLGIAGFTVVVVTGVLAV
AKVPLPRWYWIGLAVGILVGVAFVHWLIFQSLYRIGALCPYCMVVWAVIA
TLLVVVASIVFGPMRESRESRGSQERVGARLLYQWRWSLATLWFTTVFLL
IMVRFWDYWSTLI
433636029YP_007269656.1 Putative methyltransferase (methylase) [Mycobacterium canettii CIPTMTRIIGGVAGGRRIAVPPRGTRPTTDRVRESLFNIVTARRDLTGLAVLDL
YAGSGALGLEALSRGAASVLFVESDQRSAAVIARNIEALGLSGATLRRGA
VAAVVAAGTTSPVDLVLADPPYNVDSADVDAILAALGTNGWTREGTVAVV
ERATTCAPLTWPQGWRRWPQRVYGDTRLELAERLFANV
433636027YP_007269654.1 Conserved exported protein of unknown function [Mycobacterium canetMFTARIRALAGMSLLASAIGLAAFGAATGTANAAPTHQPQWGTYTCYDYA
TQTFYECFDPS
433636025YP_007269652.1 Conserved membrane protein of unknown function [Mycobacterium canetMTAAVLGAIGHALALTASMTWEILWALILGFALSAVVQAVVRRSTIVTLL
GDDRPRTLVIATGLGAASSSCSYAAVALARSLFRKGANFTAAMAFEIGST
NLVVELGIILALLMGWQFTAAEFVGSPIMILVLAVLFRLFIGARLIDAAR
EQAERGLAGSMEGHAAMDMSIKREGSFWRRLLSPPGFTSIAHVFVMEWLA
ILRDLILGLLIAGAIAAWVPESFWQSFFLANHPAWSAVWGPIIGPIVAIV
SFVCSIGNVPLAAVLWNGGISFGGVIAFIFADLLILPILNIYRKYYGARM
MLVLLGTFYASMVVAGYLIELLFGTTNLIPSQRSATVMTAEISWNYTTWL
NVIFLVIAAALVVRFITSGGLAMLRMMGGSPDAPHDHDDRHDDHLGH
433636023YP_007269650.1 Transposase [Mycobacterium canettii CIPT 140070017]MEHGNPHDAPQLAPAVERITTRAGRPPGTVTADRGYGEKRVEDDLHDLGV
RTVVIPRKGRPSQARRAEEHRPSFRRTVKWRTGSEGRISTLKRNYGWNRS
CIDGTEGTRIWTGHGILTHNLIKISSLAA
433636021YP_007269648.1 Putative glycosyl transferase [Mycobacterium canettii CIPT 14007001MEETRVAGDLGPHAGTSTAPNAAPEPVARRQRILFVGEAATLAHVVRPFA
LARSLDPSRYEVHFACDPRFNKLLGPLPFPHHPIHTIPSEQVLLKIAQGR
LFYNTRTLRKYIAADRKILNEIAPDVVVGDNRLSLSVSARLAGIPYIAIA
NAYWSPQARRRFPLPDVPWTRFFGVRPVSILYRLYRPLIFALYCLPLNWL
RRKHGLSSLGWDLCRIFTDSDYTLYADVPELVPIYDLPANHRYLGPVLWS
PDVKPPTWWDSLPTERPIIYATLGSSGGKNLLQVVLNALADLPVTVIAAT
AGRNHLKNVPANAFVADYLPGEAAAARSAVVLCNGGSPTTQQALAAGVPV
IGLPSNMDQHLNMEAVARAGAGVLLRTERLNTQGVAAAVNQVLSGAEFRQ
AARRLAEAFGPDFAGFPQHIESALRLVC
433636019YP_007269646.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MKSLKLARFIARSAAFEVSRRYSERDLKHQFVKQLKSRRVDVVFDVGANS
GQYAAGLRRAAYKGRIVSFEPLSGPFTILERKASTDPLWDCRQHALGDSD
GTVTINIAGNAGQSSSVLPMLKSHQNAFPPANYVGTQEASIHRLDSVAPE
FLGLNGVAFLKVDVQGFEKQVLAGGKSTIDDHCVGMQLELSFLPLYEGGM
LIPEALDLVYSLGFTLTGLLPCFIDANNGRMLQADGIFFREDD
433636017YP_007269644.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MRLPGMLRPTAERHFHSIFYLRHNARRQEHLATLGLDLGNKSVLEVGAGI
GDHTQFFLDRGCKVLCTEPRGENLDVIRQRFGSNPNVTVDHLDLDGDLPA
EGHQYDVVYCYGVLYHLSRPAEALAWMCDRAVDLLLLETCVSYSGEDEPF
LVTERASSPSQAITGTGCRPSRVWVMNRLREKMPHVYVTATQPRHRQFPL
DWRANGPIASTGLARAVFVASRAPLNLPTLVEELPMVQRRC
433636015YP_007269642.1 Putative methyltransferase (methylase) [Mycobacterium canettii CIPTMAFSRTHSLLARAGSTSIYKRVWRYWYPLMTRGLGNDEIVFINWAYEEDP
PMDLPLEASDEPNRAHINLYHRTATQVDLGGKQVLEVSCGHGGGASYLTR
TLHPASYTGLDLNPAGIKLCKKRHRLPGLDFVRGDAENLPFDDESFDVVL
NVEASHCYPHFRRFLAEVVRVLRPGGYFPYADLRPSNEIAAWEADFAATP
LRQLSQRQINAEVLRGIGNNSQKSRDLVDRHLPAFLRFAGREFIGVQGTQ
LSRYLEGGELSYRMYCFTKD
433636013YP_007269640.1 Putative fatty-acid-CoA ligase FadD29 (fatty-acid-CoA synthetase) (MSESSLADLLQKAASQYPNRAAYKFIDYDTDPAGFTETVTWWQVHRRAMI
VAEELWIYASSGDRVAILAPQGLEYIIAFMGVLQAGLIAVPLPVPQFGIH
DERISSALRDSAPSIILTTSSVIDEVTTYAPHACAAQGQSAPIVVAVDAL
DLSSSRALDPTRFERPSTAYLQYTSGSTRAPAGVVLSHKNVITNCVQLMS
DYIGDSEKVPSTPVSWLPFYHDMGLMLGIILPMINQDTAVLMSPMAFLQR
PARWMQLLAKHRAQISSAPNFGFELAVRRTSDDDMAGLDLGHVRTIVTGA
ERVNVATLRRFTERFAPFNLSETAIRPSYGLAEATVYVATAGPGRAPKSV
CFDYQQLSVGQAKRAENGSEGANLVSYGAPRASTVRIVDPETRMENPAGT
VGEIWVQGDNVGLGYWRNPQQTEATFRARLVTPSPGTSEGPWLRTGDLGV
IFEGELFITGRIKELLVVDGANHYPEDIEATIQEITGGRVVAIAVPDDRT
EKLVTIIELMKRGRTDEEEKNRLRTVKREVASAISRSHRLRVADVVMVAP
GSIPVTTSGKVRRSASVERYLHHEFSRLDAMA
433636011YP_007269638.1 Putative fatty-acid-Coa ligase FadD22 (fatty-acid-CoA synthetase) (MRNGNLAGLLAEQASEAGWYDRPAFYAADVVTHGQIHDGAARLGEVLRNR
GLSSGDRVLLCLPDSPDLVQLLLACLARGVMAFLANPELHRDDHALAERN
TEPALVVTSDALRDRFQPSRVAEAAELMSEAARVAPGGYEPVGGDALAYA
TYTSGTTGPPKAAIHRHADPLTFVDAMCRKALRLTPEDTGLCSARMYFAY
GLGNSVWFPLATGGSAVINSAPVTPEAAAILSARFGPSVLYGVPNFFARV
IDSCSPDSFRSLRCVVSAGEALELGLAERLMEFFGGIPILDGIGSTEVGQ
TFVSNRVDEWRLGTLGRVLPPYEIRVVAPDGTTAGPGVEGDLWVRGPAIA
KGYWNWPDPPVANEGWLDTRDRVCIDSDGWVTYRCRADDTEVIGGVNVDP
REVERLIIEDDAVAEAAVVAVRESTGASTLQAFLVATSGATIDGSVMRDL
HRGLLNRLSAFKVPHRFAVVDRLPRTPNGKLLRGALRKQSPTKPIWELSL
TEPGSGVRAQPDDPSASNMTIAGGNDGGATLRERLVALRQERQRLVVEAV
CAEAAKMLGEPDPWSVDQDLAFSELGFDSQMTVTLCKRLAAVTGLRLPET
VGWDYGSISGLAQYLEAELAGGHGRLKSAGPVNSGATGLWAIEEQLNKVE
ELVAVIADGEKQRVADRLRALLGAIAGSEAGLGKLIQAASTPDEIFQLID
SELGK
433636009YP_007269636.1 Conserved lipoprotein of unknown function- LppX [Mycobacterium caneMNDGKRAVTSAVLVVLGACLALWLSGCSSPKPDAEEQGVPVSPTASDPAL
LAEIRQSLDATKGLTSVHVAVRTTGKVDSLLGITSADVDVRANPLAAKGV
CTYNDEQGVPFRVQGDNISVKLFDDWSNLGSISELSTSRVLDPAAGVTQL
LSGVTNLQAQGTEVIDGISTTKITGTIPASSVKMLDPGAKSARPATVWIA
QDGSHHLVRASIDLGSGSIQLTQSKWNEPVNVD
433636007YP_007269634.1 Fatty-acid-CoA ligase FadD28 (fatty-acid-CoA synthetase) (fatty-aciMSVRSLPAALRACARLQPHDPAFTFMDYEQDWDGVAITLTWSQLYRRTLN
VAQELSGCGSTGDRVVISAPQGLEYVVAFLGALQAGRIAVPLSVPQGGVT
DERSDSVLSDSSPVAILTTSSAVDDVVQHVARRPGESPPSIIEVDLLDLD
APNGYTFKEDEYPSTAYLQYTSGSTRTPAGVVMSHQNVRVNFEQLMSGYF
ADTDGIPPPNSALVSWLPFYHDMGLVIGICAPILGGYPAVLTSPVSFLQR
PARWMHLMASDFHAFSAAPNFAFELAARRTTDDDMAGHDLGNILTILSGS
ERVQAATIKRFADRFARFNLQERVIRPSYGLAEATVYVATSKPGQPPETV
DFDTESLSAGHAKPCAGGGATSLISYILPRSPIVRIVDSDTCIECPDGTV
GEIWVHGDNVANGYWQKPDESERTFGGKIVTPSPGTPEGPWLRTGDSGFV
TDGKMFIIGRIKDLLIVYGRNHSPDDIEATIQEITRGRCAAISVPGDRST
EKLVAIIELKKRGDSDQDAMARLGAIKREVTSALSSSHGLSVADLVLVAP
GSIPITTSGKVRRGACVEQYRQDQFARLDA
433636005YP_007269632.1 Putative conserved polyketide synthase associated protein PapA5 [MyMFPGSVIRKLSHSEEVFAQYEVFTSMTIQLRGVIDVDALSDAFDALLETH
PVLASHLEQSSDGGWNLVADDLLHSGICVIDGTAATNGSPSGNAELRLDQ
SVSLLHLQLILREGGAELTLYLHHCMADGHHGAVLVDELFSRYTDAATTG
DPGPITPQPTPLSMEAVLAQRGIRKQGLSGAERFMSVMYAYEMPATETPA
VLAHPGLPQAVPVTRLWLSKQQTSDLMAFGREHRLSLNAVVAAAILLTEW
QLRNTPHVPIPYVYPVDLRFVLAPPVAPTEATNLLGAASYLAEIGPNTDI
VDLASDIVATLRADLANGVIQQSGLHFGTAFEGTPPGLPPLVFCTDATSF
PTMRTPPGLEIEDIKGQFYCSISVPLDLYSCAVYAGQLIIEHHGHIAEPG
KSLEAIRSLLCTVPSEYGWIME
433636003YP_007269630.1 Putative daunorubicin-DIM-transport integral membrane protein ABC tMSGPAIDASPALTFNESSASIHQRRLSTGRQMWVLYRRFAAPSLLNGEVL
TTVGAPIIFMVGFYIPFAIPWNQFVGGASSGVASNLGQYITPLVTLQAVS
FAAIGSGFRAATDSLLGVNRRFQSMPMAPLTPLLARVWVAVDRCFTGLVI
SLVCGYVIGFRFHRGALYIVGFCLLVIVIGAVLSFAADLVGTVTRNPDAM
LPLLSLPILIFGLLSIGLMPLKLFPHWIHPFVRNQPISQFVAALRALAGD
TTKTASQVTWPVMAPTLTWLFAFVVILALSSTIVLARRP
433636001YP_007269628.1 Phenolpthiocerol synthesis type-I polyketide synthase PpsE [MycobacMSIPENAIAVVGMAGRFPGAKDVSAFWSNLRRGKESIVTLSEQELRDAGV
SDKTLADPAYVRRAPLLDGIDEFDAGFFGFPPLAAQVLDPQHRLFLQCAW
HALEDAGADPARFDGSIGVYGTSSPSGYLLHNLLSHRDPNAVLAEGLNFD
QFSLFLQNDKDFLATRISHAFNLRGPSIAVQTACSSSLVAVHLACLSLLS
GECDMALAGGSSLCIPHRVGYFTSPGSMVSAVGHCRPFDVRADGTVFGSG
VGLVVLKPLAAAIDAGDRIHAVIRGSAINNDGSAKMGYAAPNPAAQADVI
AEAHAVSGIDSSTVSYVECHGTGTPLGDPIEIQGLRTAFEVSQTSRSAPC
VLGSVKSNIGHLEVAAGIAGLIKTILCLKNKALPATLHYTSPNPELRLDQ
SPFVVQSKYGPWECDGVRRAGVSSFGVGGTNAHVVLEEAPAEAPEVSAHA
EPAGPQVILLSAQTAAALGESRTALAAALETQDGPRLSDVAYTLARRRKH
NVTMAAVVHDREHAATVLRAAEHDNVFVGEAAPDGEHGDRADAAPTSDRV
VFLFPGQGAQHVGMAKGLYDTEPVFAQHFDTCAAGFRDETGIDLHAEVFD
GTATDLERIDRSQPALFTVEYALAKLVDTFGVRAGAYIGYSTGEYIAATL
AGVFDLQTAIKTVSLRARLMHESPPGAMVAVALGPDDVTQYLPPGVELSA
VNDPGNCVVAGPKDQIRALRQRLTDAGIPVRRVRATHAFHTSAMDPMLGQ
FQEFLSRQQLRPPRTPLLSNLTGSWMSDQQVVDPASWTRQISSPIRFADE
LDVVLAAPGRILVEVGPGGSLTGSAMRHPKWSTTHRTVRLMRHPLQDVDD
RDTFLRALGELWSAGVEVDWTPRRPAVPHLVSLPGYPFARQRHWVEPNHT
VWAQAPGANNGSPAGTADGSTAATVDAARNGESQTEVTLQRIWSQCLGVS
SVDRNANFFDLGGDSLMAISIAMAAANEGLTITPQDLYEYPTLASLTAAV
DASFASSGLAKAPEAQANPAVPPNVTYFLDRGLRDTGRCRVPLILRLDPK
IGLPDIRAVLTAVVNHHDALRLHLVGNDGIWEQHIAAPAEFTGLSNRSLP
DGVAAGSPEERAAVLGILAELLEDQTDPNAPLAAVHIAAAHGGPHYLCLA
IHAMVTDDSSRQILATDIVTAFGQRLAGEEITLEPVSTGWREWSLRCAAL
ATHPAALDTRSYWIENSTKATLWLADALPNTDTAHPPRADELTKLSSTLS
VEQTSELDDGRRRFRRSIQTILLAALGRTIAQTVGEGVVAVELEGEGRSV
LRPDVDLRRTVGWFTTYYPVPLACATGLGALAQLDAVHNTLKSVPHYGIG
YGLLRYVYAPTGRVLGAQRTPDIHFRYAGVIPELPSGDAPVQFDSDMTLP
VREPIPGMGHAIELRVYRFGGSLHLDWWYDTRRIPAATAEALERTFPLAL
SALIQEAIAAEHTEHDDSEIVGEPEAGALVDLSSMDAG
433635999YP_007269626.1 Phenolpthiocerol synthesis type-I polyketide synthase PpsC [MycobacMTAATPDRRAIITEALHKIDDLTARLEIAEKSSSEPIAVIGMGCRFPGGV
NNPEQFWDLLCAGRSGIVRVPAQRWDADAYYCDDHTVPGTICSTEGGFLT
SWQPDEFDAEFFSISPREAAAMDPQQRLLIEVAWEALEDAGVPQHTIRGT
QTSVFVGVTAYDYMLTLAGRLRPVDLDAYIPTGNSANFAAGRLAYILGAR
GPAVVIDTACSSSLVAVHLACQSLRGRESDMALVGGTNLLLSPGPSIACS
RWGMLSPEGRCKTFDASADGYVRGEGAAVVVLKRLDDAVRDGNRILAVVR
GSAVNQDGASSGVTVPNGPAQQALLTKALTSSKLTAADIDYVEAHGTGTP
LGDPIELDSLSKVFSDRAGSDQLVIGSVKTNLGHLEAAAGVAGLMKAVLA
VHNGYIPRHLNFHQLTPHASEAASRLRIAADGIDWPTTGRPRRAGVSSFG
VSGTNAHVVIEQAPDPMAAAGTEPQRGPVPAVSTLVVFGKTAPRVAATAS
VLADWLDGPGAAVPLADVAHTLNHHRARQTRFGTVAAVDRRQAVIGLRAL
AAGQSAPGVVAPREGSIGGGTVFVYSGRGSQWAGMGRQLLADEPAFAAAI
AELEPEFVAQGGFSLRDVIAGGKELVGIEQIQLGLIGMQLALTALWRSYG
VTPDAVIGHSMGEVAAAVVAGALTPAQGLRVTAVRSRLMAPLSGQGTMAL
LELDAEATEALIADYPEVSLGIYASPRQTVISGPPLLIDELIDKVRQQNG
FATRVNIEVAPHNPAMDALQPAMRSELADLTPQPPTIPIISTTYADLGIS
LGSGPRFDAEHWATNMRNPVRFHQAIAHAGADHHTFIEISAHPLLTHSIS
DTLRASYDVDNYLSIGTLQRDAHDTLEFHTNLNTTHTTHPPQTPHPPEPH
PVLPTTPWQHTQHWITATSAAYHRPDTHPLLGVGVTDPTNGTRVWESELD
PDLLWLADHVIDDLVVLPGAAYAEIALAAATDTFAVEQDQPWMISELDLR
QMLHVTPGTVLVTTLTGDEQRCQVEIRTRSGSSGWTTHATATVARAEPLA
PLDHEGQRREVTTADLEDQLDPDDLYQRLRGAGQQHGPAFQGIVGLAVTQ
AGVARAQVRLPASARTASREFMLHPVMMDIALQTLGATRTATDLAGGQDA
RQGPSSNSALVVPVRFAGVHVYGDITRGVRAVGSLAAAGDRLVGEVVLTD
ADGQPLLVVDEVEMAVLGSGGGATELTNRLFMLEWEPAPLEKTAEATGAL
LLIGDPAAGDPLLPALQSSLRDRITDLELASAADEATLRAAISRTSWDGI
VVVCPPRANDESMPDEAQLELARTRTLLVASVVETVTRMGARKSPRLWIV
TRGAAQFDAGESVTLAQTGLRGIARVLTFEHSELNATLVDIEPDGTGSLA
ALAEELLAGSEADEVALRDGQRYVNRLVPAPTTTSGDLAAETRHQVVNLD
SSGASRAAVRLQIDQPGRLDALNVHEVKRGRPQGDQVEVRVVAAGLNFSD
VLKAMGVYPGLDGAAPVIGGECVGYVTAIGDEVDGVEVGQRVIAFGPGTF
GTHLGTIADLVVPIPDTLADNEAATFGVAYLTAWHSLCEVGRLSPGERVL
IHSATGGVGMAAVSIAKMIGARIYTTAGSDAKREMLSGLGVEYVGDSRSV
DFADEILELTDGYGVDVVLNSLAGEAIQRGVQILAPGGRFIELGKKDVYA
DASLGLAALAKSASFSVVDLDLNLKLQPARYRQLLQHILQHVADGKLEVL
PVTAFSLHDAADAFRLMASGKHTGKIVISIPQHGSIDAIAAPPPLPLVSR
DGGYLIVGGMGGLGFVVARWLAEQGAGLIVLNGRSAPSDEVAAAIAELNA
SGSRIEVITGDITEPDTAERLVRAVEDAGFRLAGVVHSAMVLADEIVLNM
TDSAARRVFAPKVTGSWRLHVATAARDVDWWLTFSSAAALLGTPGQGAYA
AANSWVDGLVAHRRSAGLPAVGINWGPWADVGRAQFFKDLGVEMINAEQG
LAAMQAVLTADRGRTGVFSLDARQWFQSFPAVAGSSLFAKLHDSAARKSG
QRRGGGAIRTQLDALDAAERPGHLASAIADEIRAVLRSSDPIDHHRPLET
LGLDSLMGLELRNRLEASLGITLPVALVWAYPTISDLATALCERMDYATP
AAAQEISDTEPELSDEEMDLLADLVDASELEAATRGES
433635997YP_007269624.1 Phenolpthiocerol synthesis polyketide synthase PpsA [Mycobacterium MTGSISGEADLRHWLIDYLVTNIGCTPDEVDPDLSLADLGVSSRDAVVLS
GELSELLGKTVSPIDFWEHPTINALAAYLAAPEPSPESDAAVKRGARNSL
DEPIAVVGMGCRFPGGISGPEALWDFLCERRSSIGQVPPQRWQPFEGGPP
EVGAALARTTRWGSFLPDIDAFDAEFFEISPSEADKMDPQQRLLLEVAWE
ALEHAGIPPGTLRRSATGVFAGACLSEYGAMASADLSQVDGWSNSGGAMS
IIANRLSYFLDLRGPSVAVDTACSSSLVAIHLACQSLRTQDCHLAIAAGV
NLLLSPAVFRGFDQVGALSPTGQCRAFDAAADGFVRGEGAGVVVLKRLTD
AQRDGDRVLAVICGSAVNQDGRSNGLMAPNPAAQMAVLRAAYTNAGMQPS
EVDYVEAHGTGTLLGDPIEARALGTVLGRGRPEDSPLLIGSVKTNLGHTE
AAAGIAGFIKTVLAVQHGQIPPNQHFETANPHIPFTDLRMKVVDTQTEWP
ATGHPRRAGVSSFGFGGTNAHVVIEQGQEVPPAPGQGLSPAVSTLVVAGK
TVQRVAATAGMLADWMEGPGADVALADVAHTLNHHRSRQPKFGTVVARDR
TQAIAGLRALAAGQHAPGVVNPAEGSPGPGTVFVYSGRGSQWAGMGRQLL
ADEPAFAAAVAELEPVFVEQAGFSLHDVLANGEELVGIEQIQLGLIGMQL
ALTELWCSYGVRPDLVIGHSMGEVAAAVVAGALTPAEGLRVTATRSRLMA
PLSGQGGMALLELDAPTTEALIADFPQVTLGIYNSPRQTVIAGPTEQIDE
LITRVRARDRFASRVNIEVAPHNPAMDALQPAMRSELADLTPRTPTIGII
STTYADLHTQPVFDAEHWATNMRNPVHFQQAIASAGSGADGAYHTFIEIS
AHPLLTQAIIDTLHSAQPGARYSSLGTLQRDTDDVVTFRTNLNKAHTIHP
PHTPHPPEPHPPIPTTPWQHTRHWITTKYPAGSVGSAPRAGTLLGQHTTV
ATVSASPPSHLWQARLAPDAKPYQGRHRFHQVEVVPASVVLHTILSAATE
LGYSALSEVRFEQPIFADRPRLIQVVADNRAISLASSPAAGTPSDRWTRH
VTAQLSSSPSDSAISSNEHHRANGQPPERAHRDPIPDLTELLAMRGIDGL
PFTWTVASWTQQSSNLTVAIDLPEALPEGSTGPLLDAAVHLAALSDVADS
RLYVPASIEQISLGDVVTGPRSSVTLNRTAHDDDGITVDVIVAAHGGVPS
LSIRSLRYRALDFGLDVGRAQPPASAGPVEAYCDATNFVHTIDWQPQTVP
DAAHPGAEQVTHPGPVAIIGDDGAALCESLEEAGYQPAVVSDGVSQARYV
VYVVDSDPADADETDVDFAVRICTEITGLVRTLAERDADKPAALWILTRG
VHESVAPSALRQSFLWGLAGVIAAEHPELWGGLVDLAINDDLGEFGPALA
ELLAKPSKSILVRRNGVVLAPALAPVRGEPARKSLQCRPDAAYLITGGLG
ALGLLMADWLADRGAHRLVLTGRTPLPPRRDWQLDTLDTELRRRIDAIRA
LEMRGVTVEAVAADVGCREDVQALLAARDRDGAAPIRGIIHAAGITNDQL
VTSMTGDAVRQVMWPKIGGSQVLHDAFPPGSVDFFYLTASAAGIFGIPGQ
GSYAAANSYLDALARARRQQGCHTMSLDWVAWRGLGLAADAQLVSEELAR
MGSRDITPSEAFTAWEYVDGYDVAQAVVVPMPAPAGADGSGANAYLLPAR
NWSVMAATEVRSELEQGLRRIIAAELRVPEKELDTDRPFAELGLNSLMAM
AIRREAEQFVGIELSATMLFNHPTVKSLASYLAKRVAPHDASPDNQISAL
SSSAGSVLDSLFDRIESAPPEAERSV
433635995YP_007269622.1 Putative thioesterase TesA [Mycobacterium canettii CIPT 140070017]MLARHGPRYGGSVNGHSDGSSGEAKQAAPTLYIFPHAGGTAKDYVAFSRE
FSADVKRIAVQYPGQHDRSGLPPLESIPTLADEIFAMMKPSARIDDPVAF
FGHSMGGMLAFEVALRFQSAGHRVLAFFVSACSAPGHIRYKQLQDLSDRE
MLDLFTRMTGMNPDFFTDDEFFVGALPTLRAVRAIAGYSCPPETKLSCPI
YAFIGDKDWIATQDDMDPWRDRTTEGFSIRVFPGDHFYLNDNLPELVSDI
EDKTLQWHDRA
433635993YP_007269620.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MDLGGVRRRISLMARQHGPTAQRHVASPMTVDIARLGRRPGAMFELHDTV
HSPASIGLELIAIDQGALLDLDLRVESVSEGVLVTGTVAAPTVGECARCL
SPVRGRVQVALTELFAYPDSATDETTEEDEFGRVVDETIDLEQPIIDAVG
LELPFSPVCRPDCPGLCPQCGVSLASEPGHRHEQIDPRWAKLVEMLGPES
DTSRGER
433635991YP_007269618.1 Putative formamidopyrimidine-DNA glycosylase Fpg (FAPY-DNA glycosylMPELPEVEVVRRGLQAHVTGRTITEVRVHHPRAVRRHDAGPADLTARLRG
ARINGTDRRGKYLWLTLNTAGVHRPTDTALVVHLGMSGQMLLGAVPCAAH
VRISALLDDGTVLSFADQRTFGGWLLADLVTVDGSVVPVPVAHLARDPLD
PRFDCDAVVKVLRRKHSELKRQLLDQRVVSGIGNIYADEALWRAKVNGAH
VAATLRCRRLGAVLHAAADVMREALAKGGTSFDSLYVNVNGESGYFERSL
DAYGREGENCRRCGAVIRRERFMNRSSFYCPRCQPRPRK
433635989YP_007269616.1 Putative acylphosphatase AcyP (acylphosphate phosphohydrolase) [MycMSAPDVRLTAWVHGWVQGVGFRWWTRCRALELGLTGYAANHADGRVLVVA
QGPRAACQKLLQLLQGDTTPGRVAKVVADWSQSTEQITGFSER
433635987YP_007269614.1 Putative cell division protein FtsY (SRP receptor) (signal recognitMWEGLWIATAVIAALVVIAALTLGLVLYRRRRISLSPRPERGVVDRSGGY
TASSGITFSQTPTTQPAERIDTSGLPAVGDDATVPRDAPKRTIADVHLPE
FEPEPQAPEVPEADAIAPPEGRLERLRGRLARSQNALGRGLLGLIGGGDL
DEDSWQDVEDTLLVADLGPAATASVVSQLRSRLASGNVRTEADARAVLRD
VLINELQPGMDRSIRALPHAGHPSVLLVVGVNGTGKTTTVGKLARVLVAD
GRRVVLGAADTFRAAAADQLQTWAARVGAAVVRGPEGADPASVAFDAVDK
GIAAGADVVLIDTAGRLHTKVGLMDELDKVKRVVTRRASVDEVLLVLDAT
IGQNGLAQARVFAEVVDISGAVLTKLDGTAKGGIVFRVQQELGVPVKLVG
LGEGPDDLAPFEPAAFVDALLG
433635985YP_007269612.1 Putative nitrogen regulatory protein P-II GlnB [Mycobacterium canetMKLITAIVKPFTLDDVKTSLEDAGVLGMTVSEIQGYGRQKGHTEVYRGAE
YSVDFVPKVRIEVVVDDSIVDKVVDSIVRAARTGKIGDGKVWVSPVDTIV
RVRTGERGHDAL
433635983YP_007269610.1 Conserved protein of unknown function- alanine and arginine rich prMQPVSATFNPPLRGWQRRALVQYLGTQPRDFLAVATPGSGKTSFALRIAA
ELLRYRTVEQVTVVVPTEHLKVQWAHAAAAHGLSLDPKFANATAQTSPEY
HGVMVTYSQVASHPTLHRVRTEARKTLVVFDEIHHGGDAKTWGDAIREAF
GDATRRLALTGTPFRSDDSPIPFVSYQPDADGVLRSQADHTYGYAEALAD
GVVRPVVFLAYSGQARWRDSAGEEYEARLGEPLSAEQTARAWRTALDPEG
EWMPAVITAADRRLRQLRAHVPDAGGMIIASDRTTARAYARLLTTMTAEE
PTVVLSDDPGSSARITEFAQGTSRWLVAVRMVSEGVDVPRLSVGVYATNA
STPLFFAQAIGRFVRSRRPGETASIFVPSVPNLLQLASALEVQRNHVLGR
PHRESAHDPLDGDPATRTQTERGGAERGFTALGADAELDQVIFDGSSFGT
ATPTGSDEEADYLGIPGLLDAEQMRALLHRRQDEQLRKRAQLQKGATQPA
TSGASASVHGQLRDLRRELHTLVSIAHHRTGKPHGWIHDELRRRCGGPPI
AAATRAQIKARIDALRQLNSERS
433635981YP_007269608.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MKRVATIRPRSPAVRLHVRGLGLPDETAIQLWIVDGRISTEPLAGADTVF
DGGWILPGLVDAHCHVGLGQHGVIERDEAIAQAETERDVGALLLRDCGSP
TDTRGLDDHEDLPRIIRAGRHLARPKRYIAGFAVELEDESQLPAAVAEQA
RRGDGWVKLVGDWIDRQIGDLAPLWSDDMLKAAIDTAHAQGARVTAHVFG
EDALPGLINAGIDCIEHGTGLTDDTIALMLEHGTALVPTLINLENFPGIA
DAAGRYPTYAAHMRDLYARGYGRVAAAREAGVPVYAGTDAGSTIEHGRIA
DEVAALQRIGMTAHEALGAACWDARRWLGRPGLDDRASADLLCYAQDPRQ
GPGVLQHPDLVILRGRTFGP
433635979YP_007269606.1 Putative D-amino acid aminohydrolase (D-amino acid hydrolase) [MycoMLAWRQLNDLEETVTYDVIIRDGLWFDGTGNAPLTRTLGIRDGVVATVAA
GALDETGCPEVVDAAGKWVVPGFIDVHTHYDAEVLLDPGLRESVRHGVTT
VLLGNCSLSTVYANSEDAADLFSRVEAVPREFVLGALRDNQTWSTPAEYI
EAIDALPLGPNVSSLLGHSDLRTAVLGLDRATDDTVRPTEAELAKMAKLL
DEALEAGMLGMSGMDAAIDKLDGDRFRSRALPSTFATWRERRKLISVLRR
RGRILQSAPDVDNPVSALLFFLASSRIFNRRKGVRMSMLVSADAKSMPLA
VHVFGLGTRVLNKLLGSQVRFQHLPVPFELYSDGIDLPVFEEFGAGTAAL
HLRDQLQRNELLADRSYRRSFRREFDRIKLGPSLWHRDFHDAVIVECPDK
SLIGKSFGAIANERGLHPLDAFLDVLVENGERNVRWTTIVANHRPNQLNK
LAAEPSVHMGFSDAGAHLRNMAFYNFGLRLLKRARDADRAGQPFLSIERA
VYRLTAELAEWFGIGAGTLRQGDRADFAVIDPTHLDESVDGYHEEAVPYY
GGLRRMVNRNDATVVATGVGGAVVFRNGRFRDGYGRSVKSGRYLRAGELG
AALSRSA
433635977YP_007269604.1 Putative D-alanyl-D-alanine carboxypeptidase DacB2 (penicillin-bindMRKLMTAAAALCACAVTVSAGAAWADADVQPAGSVPIPDGPAQTWIVADL
DSGQVLAGRDQNVAHPPASTIKVLLALVALDELDLNSTVVADVADTQAEC
NCVGVKPGRSYTARQLLDGLLLVSGNDAANTLAHMLGGQDVTVAKMNAKA
AAVGATSTHATTPSGLDGPGGSGASTAHDLVVIFRAAMANPVFAQITAEP
SAMFPSDNGEQLIVNQDELLQRYPGAIGGKTGYTNAARKTFVGAAARGGR
RLVIAMMYGLVKEGGPTYWDQAATLFDWGFALNPQASVGSL
433635975YP_007269602.1 Putative 30S ribosomal protein S16 RpsP [Mycobacterium canettii CIPMAVKIKLTRLGKIRNPQYRVAVADARTRRDGRAIEVIGRYHPKEEPSLIE
IDSERAQYWLSVGAQPTEPVLKLLKITGDWQKFKGLPGAQGRLKVAAPKP
SKLELFNAALAAADGGPTTEATKPKKKSPAKKAAKAAEPAPQPEQPDTPA
LGGEQAEPTAES
433635973YP_007269600.1 Putative 16s rRNA processing protein RimM [Mycobacterium canettii CMELVVGRVVKSHGVTGEVVVEIRTDDPADRFAPGTRLRAKGPFDGGAEGS
VVSYVIESVREHGGRLLVRLAGVADRDAADALRGSLFVIDADDLPPIDEP
DTYYDHQLVGLMVQTATGQGVGVVTEVVHTAAGELLAVKRDSDEVLVPFV
RAIVTSVSLDDGIIEIDPPHGLLNLE
433635971YP_007269598.1 Conserved alanine rich lipoprotein of unknown function- LppW [MycobMRARPLTLLTALAAVTLVVVAGCEARVEAEAYSAADRISSRPQAQQQPVE
LLLRAITPPRAPAASPNVGFGELPTRVRQATDEAAAKGATLSVAVLDRAT
GQLVSNGNTQIIATASVAKLFIADDLLLAEAEGKVTLSPEDHHALDVMLQ
SSDDGAAERFWSQDGGNAVVTQVSRRYGLMSTAPPSDGRWWNTISSAPDL
IRYYDMLLDGSGGLPLDRAAVIIADLAQSTPTGIDGYPQRFGIPDGLYAE
PVAVKQGWMCCIGSSWMHLSTGVIGPDRRYIMVIESLQPADDATARATIT
QAVRTMFPNGRI
433635969YP_007269596.1 Putative signal peptidase I LepB (SPAse I) (leader peptidase I) [MyMTETTDSPSERQPGPAEPELSSRDPDIAGQVFDAAPDADSEGDSKAAKTD
ESRPAKRSTLREFAVLAVIAVVLYYVMLTFVARPYLIPSESMEPTLHGCS
TCVGDRIMVDKLSYRFGSPQPGDVIVFRGPPSWNVGYKSIRSHNVAVRWV
QNALSFIGFVPPDENDLVKRVIAVGGQTVQCRSDTGLTVNGRPLKEPYLD
PATMMADPSIYPCLGSEFGPVTVPPGRVWVMGDNRTHSADSRAHCPLLCT
DDPLPGTVPVANVIGKARLIVWPPSRWGVVRSVNPQQGR
433635967YP_007269594.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MSAEDLEKYETEMELSLYREYKDIVGQFSYVVETERRFYLANSVEMVPRN
TDGEVYFELRLADAWVWDMYRPARFVKQVRVVTFKDVNIEEVEKPELRLP
E
433635965YP_007269592.1 Putative formate dehydrogenase accessory protein- FdhD protein homoMGYATAHRRVRHLSADQVITRPETLAVEEPLEIRVNGTPVTVTMRTPGSD
FELVQGFLLAEGVVAHREDVLTVSYCGRRVEGNATGASTYNVLDVALAPG
VKPPDVDVTRTFYTTSSCGVCGKASLQAVSQVSRFAPGGDPATVAADTLK
AMPDQLRRAQKVFARTGGLHAAALFGVDGAMLAVREDIGRHNAVDKVIGW
AFERDRIPLGASVLLVSGRASFELTQKALMAGIPVLAAVSAPSSLAVSLA
DASGITLVAFLRGDSMNVYTRADRIT
433635963YP_007269590.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MALGRAFSVAVRGLDGEIVEIEADITSGLPGVHLVGLPDAALQESRDRVR
AAVTNCGNSWPMARLTLALSPATLPKMGSVYDIALAAAVLSAQQKKPWER
LEKTLLLGELSLDGRVRPVRGVLPAVLAAKRDGWPAVVVPVDNLPEASLV
DGIDVRGVRTLGQLQSWLRGSTGLAGRITTADTTPESAADLADVVGQSQA
RFAVEVAAAGAHNLMLTGPPGVGKTMLAQRLPGLLPSLSGSESLEVTAIH
SVAGLLSGDTPLITRPPFVAPHHSSSVAALVGGGSGMARPGAVSRAHRGV
LFLDECAEISLSALEALRTPLEDGEIRLARRDGVACYPARFQLVLAANPC
PCAPADPQDCICAAATKRRYLGKLSGPLLDRVDLRVQMHRLRAGAFSAAD
GESTSQVRQRVALAREAAAQRWRPHGFRTNAEVSGPLLRRKFRPSSAAML
PLRTALDRGLLSIRGVDRTLRVAWSLADLAGRTSPGIDEVAAALSFRQPG
ARR
433635961YP_007269588.1 Putative mycobactin utilization protein ViuB [Mycobacterium canettiMAGRPLHAFEVVATRHLAPHMVRVVLGGSGFDTFVPSDFTDSYIKLVFVA
DDVDVGRLPRPLTLDSFADLPTAKRPPVRTMTVRHVDAAAREIAVDIVLH
GEHGVAGPWAAGAQRGQPIYLMGPGGAYAPDPAADWHLLAGDESAIPAIA
AALEALPPDAIGRTFIEVAGPDDEIGLTAPDAVEVNWVYRGGRADLVPED
RAGDHAPLIEAVTTTAWLPGQVHVFIHGEAQAVMHNLRPYVRNERGVDAK
WASSISGYWRRGRTEEMFRKWKKELAEAEAGTH
433635959YP_007269586.1 Putative oxidoreductase [Mycobacterium canettii CIPT 140070017]MTVASTAHHTRRLRFGLAAPLPRAGTQMRAFAQAVEAAGFDVLAFPDHLV
PSVSPFAGATAAAMATQRLHTGTLVLNNDFRHPVDTAREAAGVATLAEGR
FELGLGAGHRRSEYDAAGITFDSGATRVARLVESAHLIRALLDAEPVDFD
GQHYRVHAEAGSLVAPPKVRVPLLVGGNGTEVLRLGGHIADIVGLAGISH
NRDATQVRFTHFDADGLADRIAVVRHAAGDRFEAIELNALIQAVVCTNDR
NAAAAELAATLGGITPEQVLESPFLLLGTHEQMAEALAARQRRFGVSYWT
VFDEWAGRASAMRDIAEVIALLRYG
433635957YP_007269584.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MAKSPARRCTAKVRRVLSRSVLILCWSLLGAAPAHADDSRLGWPLRPPPA
VVRQFDAASPNWNPGHRGVDLAGRPGQPVYAAGSATVVFAGLLAGRPVVS
LAHPGGLRTSYEPVVAHVRVGQPVSAPTVIGALAAGHPGCQAAACLHWGA
MWGPASGANYVDPLGLLKSTPIRLKPLSSEGRTLHYRQAEPVFVNEAAAG
ALAGAGHRKSPKQGVFRGAAQGGDIVARQPPGRWVCPSSAGGPIGWHRQ
433635955YP_007269582.1 Putative elongation factor Tsf (EF-Ts) [Mycobacterium canettii CIPTMANFTAADVKRLRELTGAGMLACKNALAETDGDFDKAVEALRIKGAKDVG
KRAERATAEGLVAAKDGALIELNCETDFVAKNAEFQTLADQVVAAAAAAK
PADVDALKGASIGDKTVEQAIAELSAKIGEKLELRRVAIFDGTVEAYLHR
RSADLPPAVGVLVEYRGDDAAAAHAVALQIAALRARYLSRDDVPEDIVAS
ERRIAEETARAEGKPEQALPKIVEGRLNGFFKDAVLLEQASVSDNKKTVK
ALLDVAGVTVTRFVRFEVGQA
433635953YP_007269580.1 Putative transcriptional regulatory protein [Mycobacterium canettiiMGLADDAPLGYLLYRVGAVLRPEVSAALSPLGLTLPEFVCLRMLSQSPGL
SSAELARHASVTPQAMNTVLRKLEDAGAVARPASVSSGRSLPATLTARGR
ALAKRAEAVVRAADARVLARLTAPQQREFKRMLEKLGSD
433635951YP_007269578.1 Putative transposase [Mycobacterium canettii CIPT 140070017]MAVGGDEEKVRAERARAIGLFRYQLIREAADAALSTKERGKMVRELASRE
HVDPFGRRVRMSRQTIDRWIGDWRAGGVDALVPNPRQCTPRTPVEVLELA
VALRRENPQRTAAVIRRILCTQLGWAPDERTLQRNFHRLGLTGAATGSAP
AGFGRFEAEHPNDLWTGDALHGIRITVHKTYLFAFLDDHSRLLPGYRWGY
AEDTVRLAAALRPALASRGVPKAIYVDCGSAFVDTWLLRACAKLGVRLVH
STPGRPEGRGKIERFFRTVREQFLVEISGEPDTVGRHHVTDLNELNRLFA
AWVETVYHRQVHSETGQTPLARWCAAGPVALPAPEALTEAFLWEEHRRVT
KTATVSLHGNSYEVDPALVGRKVELVFDPFDLTRIQVRAGGVPMGLAIPH
HLGRHAHPKAKPETPSAPPRPSGIDYAQLIETAHAAELARGVNYAALTAN
TDQIPGQLDLLTGQEAQPK
433635949YP_007269576.1 Putative transposase [Mycobacterium canettii CIPT 140070017]MMARLKVPEGWCVQAFRFTLNPTQTQAASLARHFGARRKAFNWTVTALKA
DIKAWRADGTESAKPSLRVLRKRWNTVKDQVCVNAQTGQVWWPECSKEAY
ADGIAGAVDAYWNWQSCRAGKRAGKTVGFPRFKKKGRDADRVCFTTGAMR
VEPDRRHLTLPVIGTIRTYENTRRVERLIAKGRARVLAITVRRNGTRLDA
SVRVLVQRPQQRRVALPDSRVGVDVGVRRLATVADAEGTVLEQVPNPRPL
DAALRGLRRVSRARSRCTKGSRRYCERTTELSRLHRRVNDVRTHHLHVLT
TRLAKTHGRIVVEGLDAAGMLRQKGLPGARARRRALSDAALATPRRHLSY
KTGWYGSSLVVADRWFPSSKTCHACRHVQDIGWDEIWQCDGCSITHQRDD
NAAINLARYEEPPSVVGPVGSAVKRGADRKTGPGPAGWP
433635947YP_007269574.1 Putative uridylate kinase PyrH (UK) (uridine monophosphate kinase) MTEPDVAGPPASKPEPASTGAASAAQLSGYSRVLLKLGGEMFGGGQVGLD
PDVVAQVARQIADVVRGGVQIAVVIGGGNFFRGAQLQQLGMERTRSDYMG
MLGTVMNSLALQDFLEKEGIVTRVQTAITMGQVAEPYLPLRAVRHLEKGR
VVIFGAGMGLPYFSTDTTAAQRALEIGADVVLMAKAVDGVFAEDPRVNPE
AELLTAVSHREVLDRGLRVADATAFSLCMDNGMPILVFNLLTDGNIARAV
RGEKIGTLVTT
433635945YP_007269572.1 Putative integral membrane phosphatidate cytidylyltransferase CdsA MTTNDAGTGSPTEKPARGAKQQPPTETSRAGRDLRAAIVVGLSIGLVLIA
VLVFVPRVWVAIVAVATLVATHEVVRRFREAGYLMPVIPLLIGGQAAVWL
TWPFGAVGALAGFGGMVVVCMIWRLLMQDSGPRPTTGGAPSPGNYLPDVS
ATVFLAVWVPLFCSFGAMLVYPENGSGWVFCMMIAVIASDVGGYAVGVLF
GKHPMVPTISPKKSWEGFAGSLVFGITATTITATFLVGKTPWIGALLGVL
FVVTTALGDLVESQVKRDLGIKDMGRLLPGHGGLMDRLDGILPSAVAAWI
VLTLLP
433635943YP_007269570.1 Conserved protein of unknown function- soluble secreted antigen MPTMSLRLVSPIKAFADGIVAVAVAVVLMFGLANTPRAVAADERLQFTATTLS
GAPFDGASLQGKPAVLWFWTPWCPFCNAEAPSLSQVAAANPAVTFVGIAT
RADVGAMQSFVSKYNLNFTNLNDADGVIWARYNVPWQPAFVFYRADGTST
FVNNPTAAMSQDELSGRVAALTS
433635941YP_007269568.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MFGQWEFDVSPTGGIAVASTEVEHFAGSQHEVDTAEVPSAAWGWSRIDHR
TWHIVGLCIFGFLLAMLRGNHVGHVEDWFLITFAAVVLFVLARDLWGRRR
GWIR
433635939YP_007269566.1 Putative integral membrane C-type cytochrome biogenesis protein DipMLTLALVGFLGGLITGISPCILPVLPVIFFSGAQSVDAAQVAKPEGAVAV
RRKRALSATLRPYRVIGGLVLSFGMVTLLGSALLSVLHLPQDAIRWAALV
ALVAIGAGLIFPRFEQLLEKPFSRIPQKQIVTRSNGFGLGLALGVLYVPC
AGPILAAIVVAGATATIGLGTVVLTATFALGAALPLLFFALAGQRIAERV
GAFRRRQREIRIAAGTVAILLAVALVFDLPAALQRAIPDYTASLQQQIST
GTEIREKLNLGGIVNAQNAQLSNCSDGAAQLESCGTAPDLKGITGWLNTP
GNKPIDLKSLRGKVVLIDFWAYSCINCQRAIPHVVGWYQAYKDSGLAVIG
VHTPEYAFEKVPGNVAKGAADLGISYPIALDNNYSTWTNYRNRYWPAEYL
IDATGTVRHIKFGEGDYNVTETLVRQLLNDAKPGVKLPQPSSTTTTPDLT
PRAALTPETYFGVGKVVNYGGGGAYDEGAAVFDYPPSLAADSFALRGRWA
LDYQGATSDANDAAIKLNYHAKDVYIVVGGTGTLTVVRDGKPATLPISGP
PTTHQVVAGDRLASGTLEVRPSKGLQVFSFTYG
433635937YP_007269564.1 Conserved protein of unknown function with PIN domain- possible toxMLCVDVNVLVYAHRADLREHADYRGLLERLANDDEPLGLPDSVLAGFIRV
VTNRRVFTEPTSPQDAWQAVDALLAAPAAMRIRPGERHWMAFRQLASDVD
ANGNDIADAHLAAYALENNATWLSADRGFARFRRLRWRHPLDGQTHL
433635935YP_007269562.1 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Mycobacterium caneMTNSTDGRADGRLRVVVLGSTGSIGTQALQVIADNPDRFEVVGLAAGGAH
LDTLLRQRAQTGVTNVAVADEHAAQRVGDIPYHGSDAATRLVEQTEADVV
LNALVGALGLRPTLAALKTGARLALANKESLVAGGSLVLRAARPGQIVPV
DSEHSALAQCLRGGTPDEVAKLVLTASGGPFRGWSAADLEHVTPEQAGAH
PTWSMGPMNTLNSASLVNKGLEVIETHLLFGIPYDRIDVVVHPQSIIHSM
VTFIDGSTIAQASPPDMKLPISLALGWPRRVSGAAAACDFHTASSWEFEP
LDTDVFPAVELARQAGVAGGCMTAVYNAANEEAAAAFLAGRIGFPAIVGI
IADVLHAADQWAVEPATVDDVLDAQRWARERAQRAVSGMASVAIASTAKP
GAAGRHASTLERS
433635933YP_007269560.1 Conserved protein of unknown function- probable GcpE protein [MycobMTVGLGMPQPPAPTLAPRRATRQLMVGNVGVGSDHPVSVQSMCTTKTHDV
NSTLQQIAELTAAGCDIVRVACPRQEDADALAEIARHSQIPVVADIHFQP
RYIFAAIDAGCAAVRVNPGNIKEFDGRVGEVAKAAGAAGIPIRIGVNAGS
LDKRFMEKYGKATPEALVESALWEASLFEEHGFGDIKISVKHNDPVVMVA
AYEQLAAQCDYPLHLGVTEAGPAFQGTIKSAVAFGALLSRGIGDTIRVSL
SAPPVEEVKVGNQVLESLNLRPRSLEIVSCPSCGRAQVDVYTLANEVTAG
LDGLDVPLRVAVMGCVVNGPGEAREADLGVASGNGKGQIFVRGEVIKTVP
EAQIVETLIEEAMRLAAEMGEQDPGTTPSGSPIVTVS
433635931YP_007269558.1 Conserved protein of unknown function- putative toxin RelE2 [MycobaMPYTVRFTTTARRDLHKLPPRVLCAVVEFAFGDLSREPRRAGKPLRRELA
GMFSAHRGPYRLLYRIDAEHTTVVILRVVHRADIYRR
433635929YP_007269556.1 Putative penicillin-binding lipoprotein [Mycobacterium canettii CIPMVTRTTLASATSGLLLLALVAMSGCTPRPQGPGPAAEKFFAALAIGDTAS
AAQLSDNPNEAREALNAAWAGLQATHLDAQVLSAKYAEDTGTVAYRFSWH
LPKDRIWTYDGQLKMARDEGRWHVRWTTSGLHPKLGEHQTFALRADPPRR
ASVNEVGGTDVLVPGYLYHYSLDASQAGRQLFGTAHAVVDALHPFDDTLN
DPQLLAEQASSSTQPLDLVTLHADDSNRVAAAIGQLPGVVITPQAELLPT
DEHFAPAVLNDVKKAVVDELDGEAGWRVVSVNQNGVDVSVLHEVAPSPAS
SVSITLDRVVQNAAQHAVNTRGGKAMIVVIKPSTGEILAIAQNAGADADG
PVATTGLYPPGSTFKMITAGAAVERDLATPETLLGCPGEIDIGHRTIPNY
GGFDLGVVPMSRAFASSCNTTFAELSSRLPPRGLTQAARRYGIGLDYQVD
GITTVTGSVPPTVDLAERTEDGFGQGKVLASPFGMALVAATVAAGKTPVP
QLIAGRPTAVEGDATPISQKMIDALRPMMRLVVTSGTAKEIAGCGEVFGK
TGEAEFPGGSHSWFAGYRGDLAFASLIVGGGSSEYAVRMTKVMFESLPPG
YLA
433635927YP_007269554.1 Conserved protein of unknown function- possible antitoxin VapB23 [MMSLSNWLRQAGLRQLEAQRQRPLRTAQELREFFASRPEEAGAEPDWQAHL
QVMAESRRRGLPAP
433635925YP_007269552.1 Putative methionine aminopeptidase MapB (MAP) (peptidase M) [MycobaMPSRTALSPGVLSPTRPVPNWIARPEYVGKPAAQEGSEPWVQTPEVIEKM
RVAGRIAAGALAEAGKAVAPGVTTDELDRVAHEYLVDNGAYPSTLGYKGF
PKSCCTSLNEVICHGIPDSTVIADGDIVNIDVTAYIGGVHGDTNATFLAG
DVADEHRLLVDRTREATMRAINTVKPGRALSVIGRVIESYANRFGYNVVR
DFTGHGIGTTFHNGLVVLHYDQPAVETIMQPGMTFTIEPMINLGALDYEI
WDDGWTVVTKDRKWTAQFEHTLLVTDTGVEILTCL
433635923YP_007269550.1 Transposase [Mycobacterium canettii CIPT 140070017]MPSKYDENTKAKAVRLVREHADDYDSEWAAMRAVSARLGMTAETLRKWVR
QAEIDAGEVAGVTSEEAREIRELRRKNRELEQTIEILKAATHFFARECDP
LRR
433635921YP_007269548.1 Putative amidotransferase [Mycobacterium canettii CIPT 140070017]MDLNASRSDGGDPLRPASPRLRSPLGASRPVVGLTAYLEQVRTGVWDIPA
AYLPADYFEGITMAGGVAVLLPPQPVDPESVGCVLDSLHALVITGGYDLD
PAAYGQEPHPATDHPRPGRDTWEFALLRGALQRGMPVLGICRGTQVLNVA
LGGTLHQHLPDILGHSGHRAGNGVFTRLSVHTASGTRLAELIGESADVPC
YHHQAIDQVGEGLVVSAVDVDGVIEALELPGDTFVLAVQWHPEKSLDDLR
LFKALVDAASGYAGRQSQAEPR
433635919YP_007269546.1 Putative short-chain type dehydrogenase/reductase [Mycobacterium caMMDLSQRLAGRVAVITGGGSGIGLAAGRRMRAEGATIVVGDVDVEAGGAA
ADELSGLFVPTDVCDEDAVNGLFDGAAETYGRIDIAFNNAGISPPEDNLI
ENTELAAWQRVQDVNLKSVYLCCRAALRHMVLAGKGSIVNTASFVAVMGS
ATSQISYTASKGGVLAMSRELGVQFARQGIRVNALCPGPVNTPLLQELFA
KNPERAARRMVHVPLGRFAEPDEIAAAVAFLASDDASFITASTFLVDGGI
SSAYVTPL
433635917YP_007269544.1 Conserved protein of unknown function- possible truncated HypB-likeMLEKIFAENDVRANVNRAAFENNGIRALDLMSSPGSGKTTVLGAALDEHA
GQFAIGIIEGDITTDLDAANGRGAQVSLLNTSMAFAPNATSTHLWSTAP
433635915YP_007269542.1 NADPH-dependent mycothiol reductase Mtr [Mycobacterium canettii CIPMETYDIAIIGTGSGNSILDERYASKRAAICEQGTFGGTCLNVGCIPTKMF
VYAAEVAKTIRGASRYGIDGHIDRVRWDDVVSRVFGRIDPIALSGEDYRR
CAPNIDVYRTHTRFGPVQADGRYLLRTDAGEEFTAEQVVIAAGSRPVIPP
AILASGVDYHTSDTVMRIAELPEHIVIVGSGFIAAEFAHVFSALGVRVTL
VIRGSCLLRHCDDTICERFTRIASTKWELRTHRNIVDGQQRGSGVALRLD
DGCTINADLLLVATGRVSNADLLDAEQAGVDVEDGRVIVDEYQRTSARGV
FALGDVSSPYLLKHVANHEARVVQHNLLCDWEDTQSMIVTDHRYVPAAVF
TDPQIAAVGLTENQAVAKGLDISVKIQDYGDVAYGWAMEDTSGIVKLIAE
RGSGRLLGAHIMGYQASSLIQPLIQAMSFGLTAAEMARGQYWIHPALPEV
VENALLGLR
433635913YP_007269540.1 Conserved protein of unknown function- PE-PGRS family protein PE_PGMWYVVASPDLITAAATDLAKIGSTISTANGAAALPTVGVVAAAADEVSMQ
IAALFGAHARTYQTLSTQAAAFHSRFVQALTTAAGSYASVEAANASPLQT
ALDVINAPAQTLLGRPLIGNGADGSTPGQAGGPGGLLYGNGGNGAAGGPN
QAGGAGGNAGLIGNGGAGGAGGAGAVGGNGGTGGLLFGDGGAGGQGGLGV
AGINGGIGGLGGHGGNAVLFGNGGAGGQGGAGAMGVAGTNPTAIGIAAPG
SDGTNQIGNGGNTDLTGGNGGDGNTGGTTVNGGNGGTGGAARNSSGGSGN
AFGGTGGAGGDGANGGTGGTGGEAVTEGGATAVSGAGGNGGNAQAPGGAG
GNGGNGGFAQATTNVTGGNGGNGGTGHDSDSPGGAGGGGGVGGNGGHGGL
LAGHGGTGGAGGNGGTGGSGAPGGAGGAGGKADTANSLGANATVIGGSGG
TGGDGGSALGTGGAGGAGGLGGHGGAGGLLIGNGGAGGAGGLGGAGGAGG
AGGGGGAGGAGGEAIPGGTSTNSVGGDGGAGGNGGNGADGGDGGAPGLGG
AGGAGGWLIGQAGSTGAGGAGGAGGSGGAGGAGGSGGAGGHGDTTSGKNG
SSGTAGFDGNPGQPG
433635911YP_007269538.1 Gcn5-related N-acetyltransferase [Mycobacterium canettii CIPT 14007MTEALRRVWAKDLDARTLYELLKLRVEVFVVEQACPYPELDGRDLLAETR
HFWLETPDGEVTCTLRLMEEHAGGEKVFRIGRLCTKRDARGQGHSNRLLC
AALAEVGDYPCRIDAQAYLTAMYAQHGFVRDGDEFLDDGIPHVPMLRPGS
GQVERP
433635909YP_007269536.1 Putative cobalamin adenosyltransferase CobO (corrinoid adenosyltranMPQGNPLAVPNDGLTTRGRRNMPVLAVHTGEGKGKSTAAFGMALRAWNAG
LDIAVFQFVKSAKWKVGEEAAFRQLGRLHDQHGIGGAVEWHKMGAGWSWT
RTSRKAGTDVDRAAAAADGWAEIALRLATQRHDFYLLDEFTYPLKWGWLD
VDEVVDVLRARPGHQHVVITGRDAPQRLVAAADLVTEMTKVKHPMDAGRK
GQKGIEW
433635907YP_007269534.1 Putative multifunctional enzyme siroheme synthase CysG: uroporphyriMTENPYLVGLRLAGKKVVVVGGGTVAQRRLPLLIASGADVHVIARSVTPA
VEAMDQITLSVRDYRDGDLDGAWYAIAATDDARVNVAVVAEAERRRIFCV
RADIAVEGTAVTPASFSYAGLSVGVLAGGEHRRSAAIRSAIREALQQGVI
TAQSSDVLSGGVALVGGGPGDPELITVRGRRLLAQADVVVADRLAPPELL
AELPPHVEVIDAAKIPYGRAMAQDAINAVLIERARSGNFVVRLKGGDPFV
FARGYEEVLACAHAGIPVTVVPGVTSAIAVPAMAGVPVTHRAMTHEFVVV
SGHLAPGHPESLVNWDALAALTGTIVLLMAVERIELFVDVLLKGGRPADT
PVLVVQHGTMPAQQTLRATLADTPDKVRAAGIRPPAIIVIGAVVGLSGVR
GLNNS
433635905YP_007269532.1 Putative prolyl-tRNA synthetase ProS (proline--tRNA ligase) (ProRS)MITRMSELFLRTLRDDPADAEVASHKLLIRAGYIRPVAPGLYSWLPLGLR
VLRNIERVIRDEMNAIGGQEILFPALLPRAPYETTNRWTQYGDSVFRLKD
RRGNDYLLGPTHEELFTLTVKGEYSSYKDFPLTLYQIQTKYRDEARPRAG
ILRAREFVMKDSYSFDIDAAGLKAAYHAHREAYQRIFDRLQVRYVIVSAV
SGAMGGSASEEFLAESPSGEDAFVRCLESGYAANVEAVVTARPDTLPIDG
LPEAMVHDTGDTPTIASLVAWANEANLGRTVTAADTLKNVLVKVRQPGGD
TELLAIGVPGDREVDDKRLGAALEPADYALLDDDDFAKHPFLVKGYIGPK
ALRENNVRYLVDPRIVDGTSWITGADQPGRHVVGLVAGRDFTADGTIEAA
EVREGDPSPDGAGPLVMARGIEIGHIFQLGSKYTDAFTADVLGEDGKPVR
LTMGSYGIGVSRLVAVVAEQHHDELGLRWPSTVAPFDVHLVIANKDAQAR
AGATALAADLDRLGVEVLLDDRQASPGVKFKDAELLGMPWIVVVGRGWAD
GVVELRDRFSGQTRELVAGASLATEIAAAVTG
433635903YP_007269530.1 Conserved membrane protein of unknown function- alanine rich proteiMPRAAPVINRLTNRPISRRGVLAGGAALAALGVVSACGESAPKAPAVEEL
RSPLDQARHDGALAAAAATAIGIPPQVAAALTVVATQRTSHARALATEIA
RAAGKLVSATSETSSSSPSPTDPAAPPPAVSDVIDSLRTSAGEASRLVAT
TSGYRAGLLASIAASCTASYTVALVPSGPSI
433635901YP_007269528.1 Putative transcription elongation factor NusA [Mycobacterium canettMNIDMAALHAIEVDRGISVNELLETIKSALLTAYRHTQGHQTDARIEIDR
KTGVVRVIARETDEAGNLISEWDDTPEGFGRIAATTARQVMLQRFRDAEN
ERTYGEFSTREGEIVAGVIQRDSRANARGLVVVRIGTETKASEGVIPAAE
QVPGESYEHGNRLRCYVVGVTRGAREPMITLSRTHPNLVRKLFSLEVPEI
ADGSVEIVAVAREAGHRSKIAVRSNVAGLNAKGACIGPMGQRVRNVMSEL
SGEKIDIIDYDDDPARFVANALSPAKVVSVSVIDQTARAARVVVPDFQLS
LAIGKEGQNARLAARLTGWRIDIRGDAPPHPPSQPEPGVSRGMAHDR
433635899YP_007269526.1 Putative translation initiation factor IF-2 [Mycobacterium canettiiMAAGKARVHELAKELGVTSKEVLARLSEQGEFVKSASSTVEAPVARRLRE
SFGGSKPAPAKGTAKSPGKGPDKSLDKALDAAIDMAAGNGKATGAPAKAA
DSGGTAIVSPTTPAAPEPPTAVPPSPQAPHPGMAPGARPGQVPKPGIRTP
RVGNNPFSSAQPADRPIPRPPAPRPGTARPGVPRPGASPGSMPPRPGGAV
GGARPPRPGAPRPGGRPGAPGAGRSDAGGGNYRGGGVGAAPGTGFRGRPG
GGGGGRPGQRGGAAGAFGRPGGAPRRGRKSKRQKRQEYDSMQAPVVGGVR
LPHGNGETIRLARGASLSDFADKIDANPAALVQALFNLGEMVTATQSVGD
ETLELLGSEMNYNVQVVSPEDEDRELLESFDLSYGEDEGGEEDLQVRPPV
VTVMGHVDHGKTRLLDTIRKANVREAEAGGITQHIGAYQVAVDLDGSQRL
ITFIDTPGHEAFTAMRARGAKATDIAILVVAADDGVMPQTVEAINHAQAA
DVPIVVAVNKIDKEGADPAKIRGQLTEYGLVPEEFGGDTMFVDISAKQGT
NIEALEEAVLLTADAALDLRANPDMEAQGVAIEAHLDRGRGPVATVLVQR
GTLRVGDSVVAGDAYGRVRRMVDEHGEDVEVALPSRPVQVIGFTSVPGAG
DNFLVVDEDRIARQIADRRSARKRNALAARSRKRISLEDLDSALKETSQL
NLILKGDNAGTVEALEEALMGIQVDDEVVLRVIDRGVGGITETNVNLASA
SDAVIIGFNVRAEGKATELASREGVDIRYYSVIYQAIDEIEQALRGLLKP
IYEENQLGRAEIRALFRSSKVGLIAGCLVTSGVMRRNAKARLLRDNIVVA
ENLSIASLRREKDDVTEVRDGFECGLTLGYADIKEGDVIESYELVQKERA
433635897YP_007269524.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MTTIDPRSELVDGRRRAGARVDAVGAAALLSAAARVGVVCHVHPDADTIG
AGLALALVLDGCGKRVEVSFAAPATLPESLRSLPGCHLLVRPEVMRRDVD
LVVTVDIPSVDRLGALGDLTDSGRELLVIDHHASNDLFGTANFIDPSADS
TTTMVAEILDAWGKPIDPRVAHCIYAGLATDTGSFRWASVRGYRLAARLV
EIGVDNATVSRTLMDSHPFTWLPLLSRVLGSAQLVSEAVGGRGLVYVVVD
NREWVAARSEEVESIVDIVRTTQQAEVAAVFKEVEPHRWSVSMRAKTVNL
AAVASGFGGGGHRLAAGYMTTGSIDDAVASLRAALG
433635895YP_007269522.1 Putative Sn-glycerol-3-phosphate transport integral membrane proteiMAAPQRARLRSSKERVGDYALFVVLVGPNVALLLLFVYRPLADNIRLSFF
DWNISDPSARFVGLSNYTEWFTRSDTRQIVFNTAVFTGAAVIGSMVLGLA
LAMLLDRPLRGRNLVRSTVFAPFVISGAAVGLAAQFVFDPHFGLIQDLLR
RIGVGVPDFYQDARWALFMVTITYVWKNLGYTFVIYLAALQGVRRDLLET
AEIDGASRWAVFRRVLLPQLRPTTFFLSITVLINSLQVFDVINVMTRGGP
EGTGTTTMVYQVYVETFRNFRAGYGATVATIMFLVLLAVTYYQVRVMDRG
QRQ
433635893YP_007269520.1 Putative Sn-glycerol-3-phosphate-binding lipoprotein UgpB [MycobactMDPLNRRQFLALAAAAAGVTAGCAGMGGGGSVKSGSGPIDFWSSHPGQSS
AAERELIGRFQDRFPTLSVKLIDAGKDYDEVAQKFNAALIGTDVPDVVLL
DDRWWFHFALSGVISPLDDLFGHVDVDTTDYVDSLLADYEFNGRHYAVPY
ARSTPLFYYNKAAWQQAGLPDRGPQAWSEFDEWGPELQRVVGAGRSAHGW
ANADLISWTFQGPNWAFGGAYSDKWTLTFTDAATIAAGNFYRNSIHGKGY
AAVANDIANEFATGILASAVASTGSLAGITASARFDFGAAPLPTGPGAAP
ACPTGGAGLAIPAKLSEERKVNALTFIAFVTNPANTAFFSQRTGYLPVRK
SAVDDPSERQYLADNPRARVALDQLPHTRTQDYARVFLPGGDRIISAGLE
SIGLRGADVTKTFTNIQKQLQVILDRQIMRKLAGHG
433635891YP_007269518.1 Transposase (fragment) [Mycobacterium canettii CIPT 140070017]MEERLKEVIAEVITEKGAWLIEMETMPDHVHLLVEVDPQLGVHKLVKAIK
GRSSRVLRQEFPWLRSRLPSLWTNSYFVATVGGAPLSVINRYVENQKGR
433635889YP_007269516.1 Transposase [Mycobacterium canettii CIPT 140070017]MKNIAVGSRVKVSADGYGVVSHAGMAMVRELADRSGLSAQVTAALADTYR
GPWVYAPGEVFADLAVAVADGADCIDAVGQLCGDREHVLGAKASTTTMWR
LIDERIDAGHLPRVRAARAAARAAAWAAGAAPEAGQWLHIDIDATLVIDH
SDNKEKAGATWKKSFGHHPLLAFLDRPEIAGGEALAGLLRPGGAGSNTAA
DHVSVLAQALAGLPARWRPDPDHRDDPDKPAVLVRCDTAGATHDFADACR
AAGVGFSFGYPVDWRVQDAVDTLNIGQCWYPAIDTDGGIRDGAWVAEATN
LVNLSAWPAGTRLILRKERPHPGAQLRFTDADGMRVTAFITDTPPGVVAG
QVAGLELRHRQHARIEDRIRELKATGLRNLPCHAFDANAAWLEIVLAAAD
LVTWCRLIGFTGHPGLTRAEINTFRYRVLHVAARITRGARRTRLRIDATW
RWAAAIATAWQRVRTAFG
433635887YP_007269514.1 Putative enoyl-CoA hydratase Echa16 (enoyl hydrase) (unsaturated acMTDDILLIDTDQRVRTLTLNRPQSRNALSAALRDRFFTALADAEADDDID
VVILTGADPVFCAGLDLKELAGADRAAGHLTAVAGDDQAGDRRDQRRRGH
RRARAGAAAVLRHPVDVLPTASLNFSSRVMSVELGDGMCRDSGLCGSGRA
GVVPCRRVGGLSQGQWVFRARSVRWAVG
433635885YP_007269512.1 Conserved protein of unknown function with PIN domain- possible toxMTTVLLDSHVAYWWSAEPQRLSMAASQAIEHANELAVAAISWFELAWLAE
QERIQLAIPVLSWLQRLAEHVRTVGITPSVAATAVALPSSFPGDPADRLI
YATAVEHGWRLVTKDRRLRSHRHPRPVTVW
433635883YP_007269510.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MTPALKEWSAAVHALLDGRQTVLLRKGGIGEKRFEVAAQEFLLFPTVAHS
HAQRVRPEHRDLLGPAAADSTDECVLLRAAAKVVAAVTVNRPEGLGAIED
LHIWTAESVRADRLDFRPKHKLAVLVVCAIPLAEPVWLTRTPEYAGCTSW
VQLPLTPRLTAPVHDEAALAEVAARVREAVG
433635881YP_007269508.1 Conserved CRISPR-associated protein of unknown function Csx17 [MycoMAALVLTGCRTTPLSGYLAALGLHRAVHRLLDTGAAGRWDHGTYVLRSRF
ATISDLAQELAAKFVPESIVSPWNSGAGFKTVGKRSTANNTINKVRASDD
PRLAPLRRTIESVDRALDTCRRLGIDPWDKKQKHRVIQVCRNEFPDHAVA
WLDAVATVVDGKKATMSALLGSAGNLGRQELSANYLAQALIVLKHRDTVA
WLTSALDGQQRARFPKGSPGQFDPGGASGPDEPRPVANPWTFLFLVEATL
LFAGRVVRRYGAEYSGAAWPFQVTASTAGFASSAQGERPRAELWAPEWSE
YLSLPQVEHLLVEGRVRWHSRTARSGLDMARAAATFGVDRGIDAFQRHVF
VERHGQSMLAVPAGRVEVGARGGVDLLAPLDPWRNALNLPDPPSDLATRL
RALDQAVFEHARTGGSCELAGVFAALGRCRSAASRSGKVHKANPPRLAFP
YGAKLLDRLRAAAGDDRELRIALALISSRDGDRDNDDVYAAWLKQPYLPA
GLASGLADIARRRGFPLATAEVVTGRVPAVRGARLAFTRGLRLHSADVLA
FVEGTVDYERTAALILGLACVEWRHTPDETLPGKLATPDPIVDLLLPFMS
PWPLTYTSADGEQCSLFVRPGHDWPGRLISGHVADVLNDATRRLRIAGLR
HVVSVRGASHDGTRLAAALMLATTAFDRRAALGRVAVVEHHQVTPTTQEV
PT
433635879YP_007269506.1 Conserved CRISPR-associated protein of unknown function Csb2 [MycobMPTTLVLTFPFGRYHATPWDRHVNEAAVEVPPSPWRLLRALYAVWRCRCP
DLPEDVVHPMLATLATPPAFYVPAHDISHTRHYFPADTFNAQKTSTPCTL
PEYLKRNLTFDAFAAFGKGAQIAARWPVELTPEGHDALRRIAGSIPYFGR
ADSVCSGAVDDDWEPAGHGVWKPLDVAERADTYITATSVLAPELPLAVNG
LLEKPDEVRRGGLRFPAGSRFVAYGLERAADEPGVAAPARPQRAVTAVRF
DLLHPALPPETDAVIYTDLLRQAAVRKQNERCGPDQGDTMLGGKTADGEY
MRARGHAHYLPVVRDRRLTGLVVWTPGTVSDDELDVLCDIQALYDYKRRV
QVRVSGIGAIDQIAPELVGPARTWCAVTPFTPARYPKKNRDEWRRFVVNE
IQRELELRGRERADDVQFVGGPWTAFVRHRPSARMRGDKRQGQAHLPAEF
LRLRFTQPTRGPLTLGWLSHFGLGLFLPEG
433635877YP_007269504.1 Putative CRISPR-associated metal-dependent deoxyribonuclease Cas2 [MTRRRYLMAYDIADPKRLRRVCTLMEDHGERLQYSVFLCDLSVAELSELE
AAVTAVMHLVHDSVVRIDLGPTFSPAAIRQIGRGRRMPADGPQIV
433635875YP_007269502.1 Protein of unknown function [Mycobacterium canettii CIPT 140070017]MSIAHLTILLAVSAPRGVAAAAPTRDDDYINTDPTSTKYVYNTYMPETLT
GRLNFRLSPEQEQALRHAAALTGQSLSGFVLSAAVDHAHDLLARANRIEL
SEAAFRRFVAALDEPGEAAPELVRLARRKSRIPAR
433635873YP_007269500.1 Protein of unknown function [Mycobacterium canettii CIPT 140070017]MVAWESLEAQRDQIAKWVGDGLTVVKIGDLLARQGGDGAASHAAPVLCAA
H
433635871YP_007269498.1 Transposase [Mycobacterium canettii CIPT 140070017]MSAARACADYSQVSKVGMDETAAARVHDYVSVFADMDRARALFATTGRDG
ATVARFAADLSAHGGDPAKVSDTSSDMSAAYIAGIGEHLPNAAMTFDKFH
VVAKLGQAVDAVRRDEVATRPELKRTRWLWLKNWSNLSAKQQAELHRLTR
PSTKLATARALLMARGLPSLLRSAPRLRRRNICAGGVMAPNAHGCNRSRS
SSRWWSATGTASWPGMPAG
433635869YP_007269496.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MTVFRIKPDNYFGDVVLAAADRDGLRIFQYAVRSAHESGQATFDIDGVQQ
RIVRESGTADMELGSQTVVWRFDDTKLIEILDKLSPLIDGEGPGHQYIDD
LNSPAPTLMISVDEYA
433635867YP_007269494.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MKSGELRVNIQQVAATASQWSRRSAELGVLAPPPLGQPFQPTTAAVGGAH
AAVGLAVAAFTARTHVTASAVEAAAAEYANNEAAAAAEMAAVPQTRLV
433635865YP_007269492.1 Conserved protein of unknown function- possible histone acetyltransMSTPALGPVERLDPDRHDTARFSSGVEVLDHWLRRVAPVAAAAGTAATWV
LCRGGRVVGFYALAMGSIERMLVPSRLGRGQPDPVPVLVLARLALDRQEQ
GTGLGGDLLLDALIRSVAGARQYGARALVVDALDARAAEFYGHHGFLPLE
GRRLYRRISDIERALGV
433635863YP_007269490.1 Conserved protein of unknown function (part 1) [Mycobacterium canetMRDRREQQNLVGRHGETLLAEAAFTSVSYRRYTCARCSMRPINSTWSWRA
APGRRVTSP
433635861YP_007269488.1 Conserved protein of unknown function- possible antitoxin MazE9 [MyMKLSVSLSDDDVAILDAYVKRAGLPSRSAGLQHAIRVLRYPTLEDDYANA
WQEWSAAGDTDVWEQTVGDGVGDAPR
433635859YP_007269486.1 putative hydrolase [Mycobacterium canettii CIPT 140070017]MSTTSARPERPTLRTLPGRVGGRALGGLLGLPRATTRYTVTHVRVPMRDG
VHLAADHYAPATSRPAGTLLVRGPYGRGFPFSLVFARLYAARGYHVVLQS
VRGTFGSGGTFEPMVNEAADGADTVAWLREQPWFTGRFGTVGVSYLGFTQ
WALLSDPPPELAAAVITAGPHDLRASVWGTGAFAVNDFLGWSDLVAHQED
PVRVRLAIRQLTSQRRIKQAAAALPLGEGARNLLGTGAPWFESWVQHTDG
DHPFWEPLRIDAALDRVRVPVLLLGGWQDIFLRQTLQQYRRLRGRGVDVA
LTVGPWTHTQLLGKGLATSVRESLDWLDAHVGAGPAVRRPSPVHVFVTGR
GWRHLSDWPPATTERAWYLQPGGGLGETAPASEAPPVTFRYDPADPTPTT
GGPLLSPSGGYRDDSRLATRADVLAFTGATLTQDLCVYGNPVVELEHASD
NPHVDVFVRVSEVEAKGRSRNVSDGYRRLGDAPELVRVELDAVAHRFRAG
SRIRVLIAGGWFPRYARNLGTPEPALTGRQVRPATHAVHLGRSRLLLPVG
TADLAPDGVTA
433635857YP_007269484.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MLRIDPEQWMHSATRVTTQGESLASGHLSSDYRMQAAQFGWQGASAMALN
AKLDDWLEASRALLTRIGDHAYGLQEAAFQHAAAEAARARALARLGVSAD
AVAGPRGA
433635855YP_007269482.1 Conserved lipoprotein of unknown function- LppV [Mycobacterium caneMRWPTAWLLVLVCVMATGCGPNGHGTRAGEEGPLSPERVAELENPLRAKP
PLEDAKDQYRAAVTQLANAITALVPGLTWSMDVDTWTGCGGEYEWTRAKA
AYFMAGFSGPIPDDKWPQAVQIVKDGVEQFGATSFGVMKNKPADHDVYFA
GHGGVEFKFATQVASSLTAKSDCRISQTDTPKPSPTPTPQAPAPDGGR
433635853YP_007269480.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MTWKGSGQETVGAEPTLWAISDLHTGHLGNKPVAESLYPSSPDDWLIVAG
DVAERTDEIRWSLDLLRRRFAKVIWAPGNHELWTTNRDPMQVFGRARYDY
LVNMCDEMGVVTPEHPFPVWTERGGPATIVPMFLLYDYSFLPEGANSKAE
GVAIAKERNVVATDEFLLSPEPYPTRDAWCHERVAATRARLEQLDWMQPT
VLVNHFPLVRQPCDALFYPEFSLWCGTTKTADWHTRYNAVCSVYGHLHIP
RTTWYDGVRFEEVSVGYPREWRRRKPYSWLRQVLPDPQYAPGYLNDFGGH
FVITPEMRTQAAQFRERLRQRQSR
433635851YP_007269478.1 tRNA pseudouridine synthase B [Mycobacterium canettii CIPT 14007001MSATGPGIVVVDKPAGMTSHDVVGRCRRIFSTRRVGHAGTLDPMATGVLV
IGIERATKILGLLTAAPKSYAATIRLGQTTSTEDAEGQVMQSVPAGHLTV
EAIDAAMVRLRGEIRQVPSAVSAIKVGGRRAYRLARQGHSVQLEARPIRI
DRFELRAARRRDQLIDIDVEIDCSSGTYIRALARDLGDALGVGGHVTALR
RTRVGRFDLDQARSLDDLAERPALSLSLDEACLLMFARRDLTAEEARAAA
NGRSLPSAGIDGVYAVRDADGRVIALLRDEGTGTKSVAVLRPATMHPG
433635849YP_007269476.1 Putative acyl-CoA dehydrogenase FadE21 [Mycobacterium canettii CIPTMFEWSDTDLMVRDAVRQFIDKEIRPHQDALETGELSPYPIARKLFSRFGL
DVLLAESVNQMLDRERGKREKPDSSGGFGLADQASMVAVLVSELAGVSIG
LLSTVAVSLGLGAATIMSRGTLAQKERWVPKLVTLEKIAAWAITEPDSGS
DAFGGMKTHVTRDGEDYILNGHKTFITNGPYADVLVVYAKLAAGEPAADW
RNRPVLVFVLDAGMPGLTQGKPFKKMGMMSSPTGELFFDNVRLTPDRLLC
AEGDGRDSARANFAVERLGVALMSLGIINECHRLCVDYAKTRTLWGRNIG
QFQLIQLKLAKMEVARINVQNMVFQAIERLKAGKQPTLAEASAIKLYSSE
AATDVAMEAVQLFGGNGYMAEYRVEQLARDAKSLMIYAGSNEVQVTHIAK
GLLG
433635847YP_007269474.1 Conserved protein of unknown function- alanine rich protein [MycobaMSTFRECRSMFDAAVKSYQSGDLANARAAFGRLTVENPDMSDGWLGLLAC
GDHHLDTLAGAHQHSEALYSETRRVGLTDGELSAVVMAPMYLGLRVWSRA
TIGLAYASALIIADRHDEAAATLDDPVITEDTGAAQYRQFVMATLFHKTR
SWSNLLKVTEISPPSGATDVRDEVADAVAALASTAAASLGQFQFALELAE
QVSTTNPRVTADVTLTRAWCLRELGDDDAARVALSATTTGDAPRTNTTAE
QAGSPQPKFRHPYDDGRDLLVARRRPPAGDGWRKAVTKMTFGRVNPEPSA
KREQTDELIQRICAPLADVHKLAFVSAKGGVGKTTMTVLVGNAVARLRGD
RVMAVDVDADLGDLSARFSERGGPQTNIEHFVSSQHTKRYADVRVHTVMN
KDRLEMLGAQNDPRSTYKFGPEDYGAAMQILETHCNVILLDCGTPVNGPL
FSNILNDVTGLVVVASEDVRGVEGALVTLDWLGAHGFGRLLQHTVVVLNA
IQKTRSFVDCGAAENQFRKRVPDFFRIPYDPHLATGLAVDFSSLKRRTRN
AVMDLAGGLAQHYPASRVRPRGEDSWKTWIETMRQVG
433635845YP_007269472.1 Putative 30s ribosomal protein S15 RpsO [Mycobacterium canettii CIPMALTAEQKKEILRSYGLHETDTGSPEAQIALLTKRIADLTEHLKVHKHDH
HSRRGLLLLVGRRRRLIKYISQIDVERYRSLIERLGLRR
433635843YP_007269470.1 Bifunctional protein polyribonucleotide nucleotidyltransferase GpsIMSAAEIDEGVFETTATIDNGSFGTRTIRFETGRLALQAAGAVVAYLDDDN
MLLSATTASKNPKEHFDFFPLTVDVEERMYAAGRIPGSFFRREGRPSTDA
ILTCRLIDRPLRPSFVDGLRNEIQIVVTILSLDPGDLYDVLAINAASAST
QLGGLPFSGPIGGVRVALIDGTWVGFPTVDQIERAVFDMVVAGRIVEGDV
AIMMVEAEATENVVELVEGGAQAPTESVVAAGLEAAKPFIAALCTAQQEL
ADAAGKSGKPTVDFPVFPDYGEDVYYSVSSVATDELAAALTIGGKAERDQ
RIDEIKTQVVQRLADTYEGREKEVGAALRALTKKLVRQRILTDHFRIDGR
GITDIRALSAEVAVVPRAHGSALFERGETQILGVTTLDMIKMAQQIDSLG
PETSKRYMHHYNFPPFSTGETGRVGSPKRREIGHGALAERALVPVLPSIE
EFPYAIRQVSEALGSNGSTSMGSVCASTLALLNAGVPLKAPVAGIAMGLV
SDDIQVEGAVDGVVERRFVTLTDILGAEDAFGDMDFKVAGTKDFVTALQL
DTKLDGIPSQVLAGALEQAKDARLTILEVMAEAIDRPDEMSPYAPRVTTI
KVPVDKIGEVIGPKGKVINAITEETGAQISIEDDGTVFVGATDGPSAQAA
IDKINAIANPQLPTVGERFLGTVVKTTDFGAFVSLLPGRDGLVHISKLGK
GKRIAKVEDVVNVGDKLRVEIADIDKRGKISLILVADEDSTAAATDAATV
TS
433635841YP_007269468.1 Putative alanine rich oxidoreductase [Mycobacterium canettii CIPT 1MVLGFWDIAVPIVGAPMAGGPSTPALAAAVSNAGGLGFVAGGYLSADRLA
DDIAAARAATTGPIGANLFVPQPSVADWAQLEYYADELEEVAEYYHTEVG
QPVYGDDDDWVRKLEVVADVRPEVVSFTFGAPPPDVVQRLSALGLLVSIT
VTSVYEAGVAIAAGADSLVVQGPAAGGHRGTFAPDMEPGTESLHQLLDRI
GSAHDVPLVAAGGLGTAEDVAAVLRRGAIAAQVGTALLLADEAGTNAAHR
AALKNPEFDATLVTRAFSGRYARGLANNFTRLLDHVAPLGYPEVHQMTKP
IRAAAVQADDPHGTNLWAGSAHRKTRPGPAADIIASLTPDVCSA
433635839YP_007269466.1 Putative conserved AsnC family transcriptional regulator [MycobacteMDRRILSLLHGDARMPNNALADTVGIAPSTCHGRVRRLVDLGVIRGFYTD
IDPVAVGLPLQAMISVNLQSSARGKIRSFIQQIRRKRQVMDVYFLAGADD
FILHVAARDTEDLRSFVVENLNADADVAGTQTSLIFEHLRGAAPI
433635837YP_007269464.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MNVEVHSAPGWRAGSSPLGYAQLYLPTRDVYWGDMSGIYVNAVATFSEGA
AMVSVDDRATGPHSSESRAADHERLVLEPRDVEFDWTNLPFHYVPNEPMA
THVLNVLHMLLPAGEEFFVRVFKKTLPLIKDDQLRLDVQGFIGQEAMHSQ
AHSGVVDHFDAQGVDVTAFTNQIRWLFEKLLGESPRRSPRRQYSWLLEQV
SFIAAIEHYTAVLGEWILNSPQLDAVGADPVMLDMLRWHGAEEVEHKAVA
FDTMKHLRAGYWRQVRAQLTVTPVMLLLWIRGVRFMYSVDPYLPPGTKPR
RRDYLKAARRGLVPGLPRLLRVVGDYYKPGFHPSQLGGLGAAVDYLAVSP
AARASH
433635835YP_007269462.1 Putative Gcn5-related N-acetyltransferase [Mycobacterium canettii CMHYPVWRQSWTGILDPYLLDMIGSPKLWVEESYPQSLKRGGWSMWIAESG
GQPIGMTMFGPDIAHPDRIQIDALYVAEDSQRHGIGGRLLNRALHSHPSA
DMILWCAEKNSKARGFYEKKDFHIDGRTFTWKPLSGVNVPHVGYRLYRSA
PPG
433635833YP_007269460.1 Dihydrodipicolinate reductase DapB (DHPR) [Mycobacterium canettii CMRVGVLGAKGKVGATMVRAVAAADDLTLSAELDAGDPLSLLTDGNTEVVI
DFTHPDVVMGNLEFLIDNGIHAVVGTTGFTAERFQQVESWLVAKPNTSVL
IAPNFAIGAVLSMHFAKQAARFFDSAEVIELHHPHKADAPSGTAARTAKL
IAEARKGLPPNPDATSTSLPGARGADVDGIPVHAVRLAGLVAHQEVLFGT
EGETLTIRHDSLDRTSFVPGVLLAVRRIAERPGLTVGLEPLLDLH
433635831YP_007269458.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MRRLLIVHHTPSPHMQEMFEAVVSGATDPEIEGVEVVRRPALTVSPIEML
EADGYLLGTPANLGYISGALKHAFDVCYYPCLDTTRGRSFGAYIHGNEGT
EGAERAVDAITTGLGWVQAAETVVVMGKPSKADIEACWNLGATVAAQLMG
433635829YP_007269456.1 Conserved protein of unknown function- PE family protein [MycobacteMSFLTTQPEELAAAAGKLETIGSAMVAQNAAAAAPTTTGVIPAAADEISV
LQASLFTAYGTLYQQVSAEAAAVYDLFVKTLGVSAGTYAATEAANSSAAA
SPLSGIASIFGSTSGKVPSWISDIANIFNIGAGNWASAASDLLGLASGGL
LPAAEEAALEEGLEGAGLSELGAAEAAVGEAPIAAGLGAAPLAAGLSRAS
SIGALSVPPSWAGQANLVSSTSTLQGAGWTTAAPHAAAGTVIPGMPGLAS
ATRSSAGFGAPRYGAKPIVMPKPAV
433635827YP_007269454.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MSESATAGARSSRIPFGIIRNHEAVRPRRSRHLNHARDRRRWSQWLTSGV
RLCRRRQSR
433635825YP_007269452.1 Transposase [Mycobacterium canettii CIPT 140070017]MKNIAVGSRVKVSADGYGVVSHAGMAMVRELADRSGLSAQVTAALADTYR
GPWVYAPGEVFADLAVAVADGADCIDAVGQLCGDREHVLGAKASTTTMWR
LIDERIDAGHLPRVRAARAAARAAAWAAGAAPEAGQWLHIDIDATLVIDH
SDNKEKAGATWKKSFGHHPLLAFLDRPEIAGGEALAGLLRPGGAGSNTAA
DHVSVLAQALAGLPARWRPDPDHRDDPDKPAVLVRCDTAGATHDFADACR
AAGVGFSFGYPVDWRVQDAVDTLNIGQCWYPAIDTDGGIRDGAWVAEATN
LVNLSAWPAGTRLILRKERPHPGAQLRFTDADGMRVTAFITDTPPGVVAG
QVAGLELRHRQHARIEDRIRELKATGLRNLPCHAFDANAAWLEIVLAAAD
LVTWCRLIGFTGHPGLTRAEINTFRYRVLHVAARITRGARRTRLRIDATW
RWAAAIATAWQRVRTAFG
433635823YP_007269450.1 Dihydrofolate reductase DfrA (DHFR) (tetrahydrofolate dehydrogenaseMVGLIWAQATSGVIGRGGDIPWRLPEDQAHFREITMGHTIVMGRRTWDSL
PAKVRPLPGRRNVVLSRQADFMASGAEVVGSLEEALTSPETWVIGGGQVY
ALALPYATRCEVTEVDIGLPREAGDALAPVLDETWRGETGEWRFSRSGLR
YRLYSYHRS
433635821YP_007269448.1 Putative type I restriction/modification system specificity determiMSRVEKVEKVRLGDHLDFSNGHTSPASEPSGRYPVYGANGVIGYSAQHNA
RGPLIVVGRVGSYCGSLRYCESDVWVTDNALACRAKKPEETRYWYYALLG
FGLNRYRAGSGQPLLSQSILRNVSIPAVAAPDRPRIGEVLGAFDDKIAAN
DRVIQAAEALMLAIVGRLSECVPLSSLASRSTACLDPERFASSVAYYSFS
AFDGGAQPSRVGGRTIRSAKLVVSQPCVLFPKLNPRIPRIWNITSLPSEM
ALASTEFVVLRPVDVDTSALWAALRQPAVQAELRQLVAGMTGSRQRIQPH
ELLRARVRDVRRLTPGHAAAIATLGALCNGRRIESARLASCRDALLRLLM
SGMDGLPASG
433635819YP_007269446.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MIVDTSAIVAIVSGESGAQALKEALERSPNSRMSAANYVELCAVMQRRDR
PEIARLVDRLLDDYGIQVEAFDADQARVAAQAYRDYGRGSGHPARLNLGD
TYSYALAQVTGEPLLFRGDDFTHTDIRPACT
433635817YP_007269444.1 Conserved protein of unknown function with PIN domain- possible toxMTTRYLLDKSAAYRAHLPAVRHRLEPLMERGLLARCGITDLEFGVSARSR
EDHRTLGTYRRDALEYVNTPDTVWGRAWEIQEALTNKGLHRSVKIPDLII
AAVAEHHGISVMHYDQDFERIAAITRQPVEWVVAPGTA
433635815YP_007269442.1 Type I restriction/modification system specificity determinant HsdSMSDGWKTLRFGEVLELQRGHDLPAASRGSGTVPVIGSFGVTGMHDTAAYD
GPGVAIGRSGAAIGTATFVAGPFWPLDTCLFVRDFKGNDPR
433635813YP_007269440.1 Putative thymidylate synthase ThyX (TS) (TSase) [Mycobacterium caneMAETAPLRVQLIAKTDFLAPPDVPWTTDADGGPALVEFAGRACYQSWSKP
NPKTATNAGYLRHIIDVGHFSVLEHASVSFYITGISRSCTHELIRHRHFS
YSQLSQRYVPEKDSRVVVPPGMEDDADLRHILTEAADAARATYSELLAKL
EAKFADQPNAILRRKQARQAARAVLPNATETRIVVTGNYRAWRHFIAMRA
SEHADVEIRRLAIECLRQLAAVAPAVFADFEVTTLADGTEVATSPLATEA
433635811YP_007269438.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MDVDLPPPGPLTSGGLRVTALGGINEIGRNMTVFEHLGRLLIIDCGVLFP
GHDEPGVDLILPDMRHVEDRLDDIEALVLTHGHEDHIGAIPFLLKLRPDI
PVVGSKFTLALVAEKCREYRITPVFVEVREGQSTRHGVFECEYFAVNHST
PDALAIAVYTGAGTILHTGDIKFDQLPPDGRPTDLPGMSRLGDTGVDLLL
CDSTNAEIPGVGPSESEVGPTLHRLIRGADGRVIVACFASNVDRVQQIID
AAVALGRRVSFVGRSMVRNMRVARQLGFLRVADSDLIDIAAAETMAPDQV
VLITTGTQGEPMSALSRMSRGEHRSITLTAGDLIVLSSSLIPGNEEAVFG
VIDALSKIGARVVTNAQARVHVSGHAYAGELLFLYNGVRPRNVMPVHGTW
RMLRANAKLAASTGVPQESILLAENGVSVDLVAGKASISGAVPVGKMFVD
GLIAGDVGDITLGERLILSSGFVAVTVVVRRGTGQPLAAPHLHSRGFSED
PKALEPAVRKVEAELESLMAANVTDPIRIAQGVRRTVGKWVGETYRRQPM
IVPTVIEV
433635809YP_007269436.1 Putative 3-ketoacyl-(acyl-carrier-protein) reductase [MycobacteriumMIDRPLEGKVAFITGAARGQGRAYAVRLAADGANIIAVDICEQIATVPYP
LSTADDLAATVELVEDAGGGIVARQGDVRDRASLSVALQAGLDEFGRLDI
VVANAGIAMMQAGDDGWRDVIDVNLTGVFHTVQVAIPTLIEQGTGGSIVL
ISSAAGLVGIGSSDPGSLGYAAAKHGVVGLMRPYANHLAPQNIRVNSVHP
CGVDTPMINNEFFQQWLATADMDAPHNLGNALPVELVQPTDIANAVAWLA
SEEARYVTGVTLPVDAGFVNKR
433635807YP_007269434.1 DNA translocase FtsK [Mycobacterium canettii CIPT 140070017]MRAVWVMAAKGTGGAARSIGRARDIEPGHRRDGIALVLLGLAVVVAASSW
FDAARPVGAWVDALLRTFIGSAVVLLPLVAAAVAVVLMRTLPNPDSRPRL
ILGASLIGLSFLGLCHLWAGSPEAPESRLRAAGFIGFAIGGPLSDGLTAW
IAAPLLFIGALFGLLLLAGITIREVPDAMRAMFGTRLLPREYADDFEDFA
DFDGDDADTVEVARQDFSDGYYDEAPLCPDDGPPAWPSAEVPQDDTATMP
EPAVGRGFGKRGSRKDTQVLDRVVEGPYTLPSLDLLIAGDPPKKRSAANT
HMAGAIGEVLTQFKVDAAVTGCTRGPTVTRYEVELGPGVKVEKITALQRN
IAYAVATESVRMLAPIPGKSAVGIEVPNTDREMVRLADVLTAPSTRRDHH
PLVIGLGKDIEGDFISANLAKMPHLLVAGSTGSGKSSFVNSMLVSLLTRA
TPEEVRMILIDPKMVELTPYEGIPHLITPIITQPKKAAAALAWLVDEMEQ
RYQDMQASRVRHIDDFNAKVRSGAITAPLGSQREYRPYPYVVAIVDELAD
LMMTAPRDVEDAIVRITQKARAAGIHLVLATQRPSVDVVTGLIKTNVPSR
LAFATSSLTDSRVILDQAGAEKLIGMGDGLFLPMGASKPLRLQGAYVSDE
EIHAVVTACKEQAEPEYTEGVTTAKPTAERTDVDPDIGDDMDVFLQAVEL
VVSSQFGSTSMLQRKLRVGFAKAGRLMDLMETRGIVGPSEGSKAREVLVK
PDELAGTLAAIRGDGGE
433635805YP_007269432.1 Putative PGP synthase PgsA3 (CDP-diacylglycerol--glycerol-3-phosphaMSRSTRYSVAVSAQPETGQITGRARIANLANILTLLRLVMVPVFLLALFY
GGGHHSAARVVAWAIFATACITDRFDGLLARNYGMATEFGAFVDPIADKT
LIGSALIGLSMLGDLPWWVTVLILTRELGVTVLRLAVIRRGVIPASWGGK
LKTFVQAVAIGLFVLPLSGPLHVAAVVVMAAAILLTVITGVDYVTRALRD
IGGIRQTAS
433635803YP_007269430.1 Conserved 35 kDa protein of unknown function- alanine rich protein MANPFVKAWKYLMALFSSKIDEHADPKVQIQQAIEEAQRTHQALTQQAAQ
VIGNQRQLEMRLNRQLADIEKLQVNVRQALTLADQATAAGDAAKATEYNN
AAEAFAAQLVTAEQSVEDLKTLHDQALSAAAQAKKAVERNAMVLQQKIAE
RTKLLSQLEQAKMQEQVSASLRSMSELAAPGNTPSLDEVRDKIERRYANA
IGSAELAESSVQGRMLEVEQAGIQMAGHSRLEQIRASMRGEALPAGGTTA
TPRPATETSGGAIAEQPYGQ
433635801YP_007269428.1 Protein of unknown function [Mycobacterium canettii CIPT 140070017]MPAPYLVQRMREIHERDENRQRHAQVDVQRRRDQPERGQHQHRRNRDADH
HPDGRTLAGQIVAHPVSHRVRQPRPVAIADVLPRVGPRADCVVAHSLQGS
PRRRERRRGQTAHQRLGRRSGNAIACPLYLENAAGPEPDTKRAEGRRFGA
FGGGDLRWMADRVPRQGSGLRGLGSRSGAGVPQGADARGWRHTADGVPRV
GQPAIRRGVPGFWCWLDHVLTGFGGRNAICAIEDGVEPRVAWWALCTDFD
VPRSMGRRTPGG
433635799YP_007269426.1 Epoxide hydrolase [Mycobacterium canettii CIPT 140070017]MAELTETSPKAVEAIRAVEAFLNALQNEDFDTVDAALGDDLVYENVGFSR
IRGGRRTATLLRRMQGRIGFEVKIHRIGADGAAVLTERTDALIIGPLRVQ
FWVCGVFEVDDGRIILWRDYFDVYDMLKGLLRGLVALVVPSLKATL
433635797YP_007269424.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MLAGVRLTEFHERVALHFGAAYGSSVLLDHVLTGFDGRSAAQAIEDGVEP
RDVWRALCADFDVPHDLW
433635795YP_007269422.1 Protein RecA [Mycobacterium canettii CIPT 140070017]MTQTPDREKALELAVAQIEKSYGKGSVMRLGDEARQPISVIPTGSIALDV
ALGIGGLPRGRVIEIYGPESSGKTTVALHAVANAQAAGGVAAFIDAEHAL
DPDYAKKLGVDTDSLLVSQPDTGEQALEIADMLIRSGALDIVVIDSVAAL
VPRAELEGEMGDSHVGLQARLMSQALRKMTGALNNSGTTAIFINQLRDKI
GVMFGCGSWYTNVTLADGSTEKLGKIVNQKMDVEVMSYDFESGKIVPRRV
TNWFNNGRAEEFLHFKVDRAGSGTGRGHASLAMTRNHLIRTPAGWREAED
IRVGDRVMLAQPCLLSDQQWEVVLGSLMGDGCLSPPVRQDSESARLRIGH
GAQQSAYLDWKVSLLENIPHSRTVNSKGAVFVDFSPLAELHELRSAVYLG
DGKKFLSEEYLKGLTPLSLAIWYMDDGSFSLRSKGLQQRTQGGSGRIEIC
VEAMSEGSQARLRDYLHDTYGLDIRLRKAGAAAKAVLVFSTAATAKFQEL
VAPYVAPCMEYKLLPRFRGRSIVTPQFIEPTMELMPARVTEIESKTDYPI
MSRFDIEVEDSHNYFADGVMVHNSPETTTGGKALKFYASVRMDVRRVETL
KDGTNAVGNRTRVKVVKNKCSPPFKQAEFDILYGKGISREGSLIDMGVDQ
GLIRKSGAWFTYEGEQLGQGKENARNFLVENADVADEIEKKIKEKLGIGA
VVTDDPSHDGVLPAPVDF
433635793YP_007269420.1 Conserved protein of unknown function- alanine and arginine-rich prMVAHDAAAGVTGEGAGAPVRRAPSRTYQVRTYGCQMNVHDSERLAGLLEA
AGYRRATDGSEADVVVFNTCAVRENADNRLYGNLSHLAPRKRANPDMQIA
VGGCLAQKDRDAVLRRAPWVDVVFGTHNIGSLPTLLERARHNKVAQVEIA
EALQQFPSSLPSSRESAYAAWVSISVGCNNSCTFCIVPSLRGREVDRSPA
DILAEVRSLVNDGVLEITLLGQNVNAYGVSFADPALPRNRGAFAELLRAC
GDIDGLERVRFTSPHPAEFTDDVIEAMAQTRNVCPALHMPLQSGSDRILR
AMRRSYRAERYLGIIERVRAAMPHAAITTDLIVGFPGETEDDFAATLDVV
RQARFAAAFTFQYSKRPGTPAAEFDGQLPKVVVQERYERLVALQEQISLE
ANRALVGQTVEVLVATGEGRKDTVTARMSGRARDGRLVHFTAGQPRVRPG
DVITTTVTEAAPHHLIADAGVLTHRRTRAGDTHTARQPGRAVGLGMPGVG
PPVGAAKSGGCR
433635791YP_007269418.1 Conserved protein of unknown function- alanine and arginine rich prMTADEPRSDDSSGSAPQPAATPVPRPGPRPGPRPVPRPTSYPVGAHPPSD
PHRFGRIDDDGTVWLVSASGERIVGSWQAGDPEAAFAHFGRRFDDLSTEI
MLMDERLASGTGDARKIKAHAIALAETLPTACVLGDVDALADRLTSIRDR
AEVIAAADRSRREEHRAAQTARKEALAAEAEELAANATQWKVAGDRLRAI
LDEWKTISGVDRKVDDALWKRYSTARDTFNRRRGSHFAELDRERSGVRQS
KERLCERAEELSESTDWTATSAEFRKLLADWKAAGRASKDVDDALWRRFK
AAQDCFFTARNAATAEKDAELRANADAKEALLAEAERLDTANHEAARAAL
RSIAEKWDAIGKVPRERSAELERRLRAVEKKVREAGESDWSDPQARARAE
QFRARAEQFEHQAEKAAAAGRTKEAEEAMANAEQWRQWAEAAADALTRRP
433635789YP_007269416.1 Conserved protein of unknown function- alanine rich protein [MycobaMLSAIGIVPSAPVLVPELAGAAAAELADLGAAVIAAASLLPKRWIAVGTG
RADDVVRPTAVGTFAGFGTDVRVGLAPQDGDGVAVPVELPLCALLTAWVR
GRARPEARAQVHVYASDHGSDAAVARGRQLRADIDREPDPIGVLVVADGL
NTLTPRAPGGYDPDGAGMQRALDDALASGDLAVLTRLPAQVLGRVAFQVL
AGLAEPGPRSVKEFYRGAPHGVGYFAGVWQP
433635787YP_007269414.1 Putative diaminopimelate epimerase DapF (DAP epimerase) [MycobacterMIFAKGHGTQNDFVLLPDVEAELVLTAARVAALCDRRKGLGADGVLRVTT
AGAAQAVGVLDSLPEGVRVTDWYMDYRNADGSAAQMCGNGVRVFAHYLRA
SGLEVRDEFVVGSLAGPRPVTCHHVEATYADVSVDMGKANRLGAGEAVVG
GRRFHGLAVDVGNPHLACVDSQLTVDGLAALDVGAPVSFDGAQFPDGVNV
EVLTAPVDGAVWMRVHERGVGETRSCGTGTVAAAVAALAAVGSATGTLTV
HVPGGEVVVTVTDATSLLRGPSVLVARGDLADDWWNAMG
433635785YP_007269412.1 Putative acyl-CoA dehydrogenase FadE20 [Mycobacterium canettii CIPTMGSAIKYQRTLFEPEHELFRESYRAFLDRHVAPYHDEWEKTKIVDRGVWL
EAGKQGFLGMAVPEEYGGGGNPDFRYNTIITEETCAGRYSGIGFGLHNDI
VAPYLLALATEEQKRRWFPNFCTGELITAIAMTEPGTGSDLQGITTRAVK
HGDHYVLNGSKTFITNGINSDLVIVVAQTDPEKGAQGFSLLVVERGMAGF
ERGRQLDKIGLDAQDTAELSFTDVAVPAENLLGQEGMGFIYLMQNLPQER
ISIAIMAAAGMESVLEQTLQYAKERKAFGRSIGSFQNSRFLLAELATEAT
VVRIMVDEFIKLHLAGKLTAEQAAMAKWYATEKQVYLNDRCLQLHGGYGY
MREYPVARAYLDSRVQTIYGGTTEIMKEIIGRGLGV
433635783YP_007269410.1 Conserved transmembrane alanine and glycine rich protein of unknownMNGQRGQLSTLIGRTLLGLAATAVTAVLLAPTVAASPIGDAEDAMMAAWE
KAGGDTSTLGVRKGDVYPIGDGFALDFAGGKMFFTPATGAKYLYGPLLDK
YESLGGAADSDLGFPTINEVPGLAGPDSRVSTFSASDNPVIFWTPEHGAF
VVRGALNAAWDKLGSSGGVLGAPVGDETYDGEVTAQKFSGGEVSWNRATK
EFTTVPAVLAEQLQGLQVAMDPSAAINMAWRAAGGAAGRLGAKKGGQYPI
GGDGIAQDFVGGKVFFSPATGANAVEGEILAKYESLGGPVSSDLGFPIAN
ESDGGFGPSSRIVRFSAADKPVIFWTPDHGAFVVRGAMVAAWDKLRGPNG
KLGAPVGDQTVDGDVVSQKFTGGKISWNRAKNTFTTDPANLAPLLSGLQV
SGQNQPSTSAMPPPGKKFTWHWWWLGAAALGVLLVVMVALVVFGLRRRRR
GYDAAAYDDDRAGDVEYGTAADGDWPPDEDFGSEHFGFGDQFPPEPAAPD
AGSTPRVSWPRGAGAAVGDAEHLPGEEGYGSDLLSGPSNVGVEEEDTDAV
DTTPTPVVSQADLSEVGPDLIVPERVVPETFAPQAFVPEAVAPEAVPPDV
HAADLADTGLPAAAVSAAEDRGGRHAAAEPPEPPSAGVRPAIHLPLEDPY
QMPNGYPVKASVSFGLYYPPGSALYHDTLAELWFASEEVAQVNGFIRAD
433635781YP_007269408.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MTPVRPPHTPDPLNLRGPFDGPRWRRAEPAQSRRPGRSRPGGAPLRYHRT
GVGMSRAGHGSRPVTPATTVGLALLAAAITLWLGLVAQFGQMITGGSADG
SSGRVPDRLAVVRVETGESLHDVAVRVAPNAPTRQVADRIRELNGLQTAA
LVVGQTLIAPVD
433635779YP_007269406.1 Putative transposase [Mycobacterium canettii CIPT 140070017]MTRDLAPALEALSPLLGSWVGRGAGKYPTIRPFEYLEEVVFAHVGKPFLT
YTQQTRAVADGKPLHSETGYLRVCRPGCVELVLAHPSGITEIEVGTYSVT
GDVIELELSTRADGSIGLAPTAKEVTALDRSYRIDGDELSYSLQMRAVGQ
PLQDHLAAVLHRQR
433635777YP_007269404.1 Putative hydrolase [Mycobacterium canettii CIPT 140070017]MTERKRNLRPVRDVAPPTLQFRTVHGYRRAFRIAGSGPAILLIHGIGDNS
TTWNGVHAKLAQRFTVIAPDLLGHGQSDKPRADYSVAAYANGMRDLLSVL
DIERVTIVGHSLGGGVAMQFAYQFPQLVDRLILVSAGGVTKDVNIVFRLA
SLPMGSEAMALLRLPLVLPAVQIAGRIVGKAIGTTSLGHDLPNVLRILDD
LPEPTASAAFGRTLRAVVDWRGQMVTMLDRCYLTEAIPVQIIWGTKDVVL
PVRHAHMAHAAMPGSQLEIFEGSGHFPFHDDPARFIDIVERFMDTTEPAE
YDQAALRALLRRGGGEATVTGSADTRVAVLNAIGSNERSAT
433635775YP_007269402.1 Pyridine nucleotide transhydrogenase- soluble [Mycobacterium canettMREYDIVVIGSGPGGQKAAIASAKLGKSVAIVERGRMLGGVCVNTGTIPS
KTLREAVLYLTGMNQRELYGASYRVKDRITPADLLARTQHVIGKEVDVVR
NQLMRNRVDLIVGHGRFIDPHTILVEDQARREKTTVTGDYIIIATGTRPA
RPSGVEFDEERVLDSDGILDLKSLPSSMVVVGAGVIGIEYASMFAALGTK
VTVVEKRDNMLDFCDPEVVEALKFHLRDLAVTFRFGEEVTAVDVGSAGTV
TTLASGKQIPAETVMYSAGRQGQTDHLDLHNAGLEVQGRGRIFVDDRFQT
KVDHIYAVGDVIGFPALAATSMEQGRLAAYHAFGEPTDGITELQPIGIYS
IPEVSYVGATEVELTKSSIPYEVGVARYRELARGQIAGDSYGMLKLLVST
EDLKLLGVHIFGTSATEMVHIGQAVMGCGGSVEYLVDAVFNYPTFSEAYK
NAALDVMNKMRALNQFRR
433635773YP_007269400.1 Iron-dependent repressor and activator IdeR [Mycobacterium canettiiMNELVDTTEMYLRTIYDLEEEGVTPLRARIAERLEQSGPTVSQTVSRMER
DGLLRVAGDRHLELTEKGRALAIAVMRKHRLAERLLVDVIGLPWEEVHAE
ACRWEHVMSEDVERRLVKVLNNPTTSPFGNPIPGLVELGVGPEPGADDAN
LVRLTELPAGSPVAVVVRQLTEHVQGDIDLITRLKDAGVVPNARVTVETT
PGGGVTIVIPGHENVTLPHEMAHAVKVEKV
433635771YP_007269398.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MWDSRVMKHGLRLGFNGQFDDFDDFDDKGRPVLITAAAPSYEVEHRARVR
KYLTLMAFRVPALILAAIAYGAWHNGLISLLIVAASVPLPWMAVLIANDR
PPRRADEPRRFDGARRRIPLFPTAERPALEPRRQPAERSAPRGFADHG
433635769YP_007269396.1 Conserved membrane protein of unknown function- alanine and leucineMSDQVPKPHRHHIWRITRRTLSKSWDDSIFSESAQAAFWSALSLPPLLLG
MLGSLAYVAPLFGPDTLPAIEKSALSTAHSFFSPSVVNEIIEPTIGDITN
NARGEVASLGFLISLWAGSSAISAFVDAVVEAHDQTPLRHPVRQRFFALF
LYVVMLVFLVATAPVMVVGPRKVSEYIPESLANLLRYGYYPALILGLTVG
VILLYRVALPVPLPTHRLVLGAVLAIAVFLIATLGLRVYLAWITRTGYTY
GALATPIAFLLFAFFGGFAIMLGAELNAAVQEEWPAPATHAHRLGNWLKA
RIGVGTTTYSSTAQHSAVAAEPPS
433635767YP_007269394.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MRMTPDPAVLVHLCGVQEWSHARERGGIYPESDKTGYIHLSTLEQVHLPA
NRLYRGRADLVLLYIDLAALDSPVRWEPGVPTDPRSMLFPHLYGPLPVRA
VIGAAAYPPAGDGSFGPAPEFRSATADPT
433635765YP_007269392.1 RNA polymerase sigma factor SigA (Sigma-A) [Mycobacterium canettii MAATKASTATDEPVKRTATKSPAASASGAKTGAKRTAAKSASGSPPAKRA
TKPAARSVKPASAPQDTTTSTIPKRKTRAAAKSAAAKVPSARGHATKPRA
PKDAQHEAATDPEDALDSVEELDAEPDLDVEPGEDLDLDAADLNLDDLED
DVAPDADDDLDSGDHEDHEDLEAEAAVAPGQTADDDEEIAEPTEKDKASG
DFVWDEDESEALRQARKDAELTASADSVRAYLKQIGKVALLNAEEEVELA
KRIEAGLYATQLMTELSERGEKLPAAQRRDMMWICRDGDRAKNHLLEANL
RLVVSLAKRYTGRGMAFLDLIQEGNLGLIRAVEKFDYTKGYKFSTYATWW
IRQAITRAMADQARTIRIPVHMVEVINKLGRIQRELLQDLGREPTPEELA
KEMDITPEKVLEIQQYAREPISLDQTIGDEGDSQLGDFIEDSEAVVAVDA
VSFTLLQDQLQSVLDTLSEREAGVVRLRFGLTDGQPRTLDEIGQVYGVTR
ERIRQIESKTMSKLRHPSRSQVLRDYLD
433635763YP_007269390.1 Putative extragenic suppressor protein SuhB [Mycobacterium canettiiMTRPDNEPARLRSVAENLAAEAAAFVRGRRAEVFGITRAGDGDGAVRAKS
SPTDPVTVVDTDTERLLRDRLAQLRPGDPILGEEGGGPADVTATPSDRVT
WVLDPIDGTVNFVYGIPAYAVSIGAQVGGITVAGAVADVAARAVYSAATG
LGAHLTDERGRHVLRCTGVAELSMALLGTGFGYSVRCREKQAELLAHVVP
LVRDVRRIGSAALDLCMVAAGRLDAYYEHGVQVWDCAAGALIAAEAGARV
LLSTPRAGGAGLVVVAAAPGIADELLAALQRFNGLEPIPD
433635761YP_007269388.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MPTDYDAPRRTETDDVSEDSLEELKARRNEAASAVVDVDESESAESFELP
GADLSGEELSVRVVPKQADEFTCSSCFLVHHRSRLASEKNGVMICTDCAA
433635759YP_007269386.1 Putative deoxyuridine 5'-triphosphate nucleotidohydrolase Dut (dUTPMSTTLAIVRLDPGLPLPSRAHDGDAGVDLYSAEDVELAPGHRALVRTGVA
VAVPFGMVGLVHPRSGLATRVGLSIVNSPGTIDAGYRGEIKVALINLDPA
APIVVHRGDRIAQLLVQRVELVELVEVSSFDEAGLASTSRGDGGHGSSGG
HASL
433635757YP_007269384.1 Conserved protein of unknown function- alanine rich protein [MycobaMAVDLDGVTTVLLPGTGSDNDYVRRAFSAPLRRAGAALVTPVPHPGRLID
GYRAALDDAARDGPVVVGGVSLGAAVAAAWALEHPDRAVAVLAALPAWTG
EPELAPAAQAARYTAARLRCDGLAATTTRMRASSPVWLAEELTRSWRVQW
PQLPDAMEEAAAYVAPSRAELARLVAPLAVAAAVDDPIHPLQVAADWVSV
APHAALRTVTLDEIGADAAALGSACLAALAEVSGA
433635755YP_007269382.1 Conserved membrane protein of unknown function- alanine and leucineMNANRTSAQRLLAQAGGVSGLVYSSLPVVTFVVASSAAGLLPAIGFALSM
AALILLWRLLRRESARPVVAGFCGVAVCALIAYLVGQSKGYFLLGIWMSL
LWAVVFTLSILIRRPIVGYLWSWLSGRDRGWREVSCAVFAFDVATLGWTL
VFAARFIVQRHLYDADKTGWLGVARIGMGWPLTALAALATYAAIKAAQRA
ILASHDAAAVGGAAEFDADAGRE
433635753YP_007269380.1 Trk system potassium uptake protein CeoB [Mycobacterium canettii CIMRVVVMGCGRVGASVADGLSRIGHEVAIIDRDSAAFNRLSPQFAGERVLG
QGFDRDVLLRAGIEGADAFAAVSSGDNSNIISARLARETFGVPRVVARIY
DAKRAEVYERLGIPTIATVPWTTDRLLNALMQDTETAKWRDPTGTVAVAE
VVLHEDWVGHRATDLEQATGARIAFLIRFGTGVLPEPKTVLQAGDKVYIA
AISGRAAEAAAIAALPPSEDFESGARR
433635751YP_007269378.1 Putative antibiotic-transport ATP-binding protein ABC transporter [MTALNRAVASARVGTEVIRVSGLTFRYPKAAEPAVRGMDFTVGRGEIFGF
LGPNGAGKSTTQKLLIGLLRDHGGQATVWDKEPARWGPDYYERIGVSFEL
PNHYQKLTGYENLRFFASLYAGATADPMQLLAAVGLADDAHTLVGKYSKG
MQMRLTFARSLINDPELLFLDEPTSGLDPVNARKIKDIIVDLKSRGRTIF
LTTHDMATADELCDRVAFVVDGRIVALDSPTELKVARSRRRVRVEYRGDD
GRLETAEFGMDGLADDPAFHSVLRNHHVETIHSREASLDDVFVEVTGRQL
T
433635749YP_007269376.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MRAISRLASPRALAAFGRNDIRGTYRDPLLVMLVIAPVIWTTGVALLTPL
FTEMLARRYGFDLVPYYPLVLTAFLLLTSIIVAGALAAFLVLDEIDAGTM
TALRVTPVPLSVFFGYRAVTVMVVTTIYVVATMSCSGILEPGLVGSLIPI
GLVAGLSAVVTLLLILALANNKIQGLAMVRALGMLIAGLPCLPWFISSNW
NLAFGVLPPYWAAKAFWVASDHGTWWPYLVAGAVYNLAIVWVLFRRFRAK
HA
433635747YP_007269374.1 Putative arsenic-transport integral membrane protein ArsA [MycobactMSVVAVTIFVAAYVLIASDRVNKTMVALSGAAAVVVLPVITSHDIFYSHD
TGIDWDVIFLLVGMMIIVGVLRQTGVFEYAAIWAAKRARGSPLRIMILLV
LVTALASALLDNVTTVLLIAPVTLLVCDRLDINATSFLMAEVFASNIGGA
ATLVGDPPNIIIASRAGLTFNDFLLHLTPLVVIVLIALIAVLPRLFGSIT
VEPDRIADVMSLDEGEAIRDRRLLVKCGAVLVLVFAAFIAHPVLHIQPSL
VALLGAGMLIVVSSLTRSEYLSSVEWDTLLFFAGLFIMVGALVKTGVVND
LARAATQLTGGNIVATAFLILGVSAPISGIIDNIPYVATMTPLVAELVAV
MGGQPGTDTPWWALDLGADFGGNLTAIGASANVVMLGIARRAGAHISFWE
FTRKGAVVTAVSIALAAIYLWLRYFVLLH
433635745YP_007269372.1 Putative 1-deoxy-D-xylulose 5-phosphate synthase Dxs1 (1-deoxyxylulMLQQIRGPADLQHLSQAQLRELAVEIREFLIHKVAATGGHLGPNLGVVEL
TLALHRVFDSPHDPIIFDTGHQAYVHKMLTGRCQDFATLRKKGGLSGYPS
RAESEHDWVESSHASAALSYADGLAKAFELTGHRNRHVVAVVGDGALTGG
MCWEALNNIAASRRPVIIVVNDNGRSYAPTIGGVADHLATLRLQPAYEQA
LETGRDLVRAVPLVGGLWFRFLHSVKAGIKDSLSPQLLFTDLGLKYVGPV
DGHDERAVEVALRSARRFGAPVIVHVVTRKGMGYPPAEADQAEQMHSTVP
IDPATGQATKVAGPGWTATFSDALIGYAQKRREIVAITAAMPGPTGLTAF
GQRFPDRLFDVGIAEQHAMTSAAGLAMGGLHPVVAIYSTFLNRAFDQIMM
DVALHKLPVTIVLDRAGITGSDGASHNGMWDLSMLGIVPGIRVAAPRDAT
RLREELGEALDVDDGPTALRFPKGDVGEDIPALERRGGVDVLAVPAGGLN
HDVLLVAIGAFAPMALAVAKRLHNQGIGVTVIDPRWVLPVSDGVRELAAQ
HKLLVTLEDNGVNGGAGSAVSAALRRAEIDVPCRDVGLPQEFYQHASRSE
VLADLGLTDQDVARRITGWVAALGTGVCASDAIPEHLD
433635743YP_007269370.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MGVPPACGGRSDEEERRLTSAEPAPFREAVAAMNAVTVRPEIELGPIRPP
QRLAPYSYALGAEIKHPELDVIPERCEGDAFGRLIMLYDPDGSDAWDGTI
RLVAYVQADLDSSEAVDPLLPEVAWSWLVDALTARTDQVRALGGTVTATT
SVRYGDISGPPRAHQLELRASWTATTPDLGAHVQAFCDVLEHAAGLPPAG
VTDLGSRSRA
433635741YP_007269368.1 Putative uroporphyrinogen decarboxylase heme (uroporphyrinogen III MLRRCGVPVVAALRPVNTPARTRRDLASSPYLAAVTGRKPSRVPVWFMRQ
AGRSLPEYRALRERYSMLAACFEPEVACEITLQPIRRYDVDAAILFSDIV
VPLRAAGVDLDIVADVGPVIADPVRTAADVAAMKPLDPQAIQPVLVAASL
LVAELGDVPLIGFAGAPFTLASYLVEGGPSRHHAHAKAMMLAEPASWHAL
MAKLTDLTIAFLNGQIDAGVDAIQVFDSWAGALSPTDYRQYVLPHTARVF
AALGEHGVPMTHFGVGTAELLGAMSEAVTAGERPGRGAVVGVDWRTPLTD
AAARVVPGTALQGNLDPAVVLAGWPAVERAARAVVDDGRRAIDAGAAGHI
FNLGHGVLPESDPAVLADLVSLVHSL
433635739YP_007269366.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MARLDYDALNATLRYLMFSVFSVSPGALGDQRDAIIDDASTFFKQQEERG
VVVRGLYDVAGLRADADFMVWTHAERVEALQATYADFRRTTTLGRACTPV
WSGVGLHRPAEFNKSHIPAFLAGEEPGAYICVYPFVRSYEWYLLPEEERR
RMLAEHGMAARGYKDVRANTVPAFALGDYEWILAFEAPELDRIVDLMREL
RATDARRHTRAETPFFTGPRVPVEQLVHSLP
433635737YP_007269364.1 Putative peptide methionine sulfoxide reductase MsrB [MycobacteriumMTRPKLELSDDEWRQKLTPQEFDVLRRAGTERPFTGEYTDTTTAGIYQCR
ACGVELFRSTEKFESHCGWPSFFDPKSSDAVTLRPDHSLGMTRTEVLCAN
CDSHLGHVFEGEGYPTPTDKRYCINSISLRLVPGSV
433635735YP_007269362.1 Putative secreted protease [Mycobacterium canettii CIPT 140070017]MATVVGMSRHMTSAAMLVALTCSATVLAACVPAFGADPRFATYSGAGPQG
AATTTPPPAGPPPLAAPKNDLSWHDCTSRVYSNAGIPAAAGVKLECASYD
TDLDPLVGGSTAVSIGVVRARSNQTPSDAGPLVFTTGSDLPSSTQLPVWL
AHAGIDVLRSHPIVAVDRRGMGMSSPIDCRDHFDRDEMRDQAQFQAGDDP
VANLSDISNTATTDCTDAIAPGESAYDNTHAASDIERLRKLWDVPALAFV
GIGNGTQVALAYAASRPDNVARLILDSPIALGVSAEAAAEQQVQGQQAAL
DAFAAQCVAVNCALGSDPKGAVSALLSAARSGDGPGGASVAAVANAVATA
LGFPDSGRVDSTTKLADALAAARSGDMNLLSALINRADTTRDTDGQFVSS
CSDAVNRPTPDRVRELVVAWGKLYPQFGAVAALNLVKCVHWPSSSPPQPP
KDLKVDVLLLGVQNDPIVGNEGVAATAATVINANAASKRVMWQGIGHGAS
IYSSCAVPPLVAYLDTGKLPDTDTYCPA
433635733YP_007269360.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MTLIAARRYSATMHGSASEACGSVGHLVDRHPSVSPVLLISQLRPPPTFA
QVSFATYRPDPAEPTQAAAVAACQDFCRQAVERRAGRKKWFGKQEVLPGV
GLYLDGGFGVGKTHLLASAYYQLPGTGPDAPTCPKAFATFGELTQLAGVF
GFADCIDLLANYTAVCIDEFELDDPGNTTLISRLLSALVERGVSVAATSN
TLPEQLGEGRFAAQDFLREINTLAKIFSTVRIEGPDYRHRDLPPAPQPLP
EREVAAWAAGIDGATLDDFDALCAHLATMHPSRYLTLIEGVTAVFLTGVH
GIDDQSVALRLVALTDRLYDAGIPVVASGAKLDTIFSEEMLAGGYRKKYL
RATSRLLALTAGFRPPGS
433635731YP_007269358.1 Conserved exported protein of unknown function- alanine and valine MRRWLIVLSIFLVAATSVAAPRAWAQDAPIGRIGDTLRVDTGSYVADVTV
SSVVPVDPPPGFGYTRSGVPIKSFPGSSVNRADVTVRAVRVPNPFILATN
FSFDGVTPFADAYKPRPCDAPDWLDAALGNAPQGSIVRGGVYWDAYRDPV
STVILLDKKTGQHLAQWNL
433635729YP_007269356.1 Conserved exported protein of unknown function (modular protein) [MMVVARFAAQDACAPLLWDDQGIMKLLLTMTGLAAMIGMAAPAYADSKDDE
FLASLDAAGLTYQDPGRTIAAAKAVCTWADAGKGAVEVVDEIQNSNPGLH
GDSAARFLAIAANVYCPKALWGGSWEGPASGRKSGGAVADSRRRVELARR
GPA
433635727YP_007269354.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MTAKKQMKQDIAALLAEEAEAIDADRDAPITDATTATRGHGRSKTLQIRL
NPEELVELERVAAGRGLPTSTVAREAILRLIRPTEAREAARRRLVDVIDE
YVEAFEADEAKNPGFRESMRKHLSECDQHGATAFDVALPMMVLALLRNEA
EHGQGCSSRG
433635725YP_007269352.1 Putative arsenic-transport integral membrane protein ArsC [MycobactMTETVTRTAAPAVVGKLSTLDRFLPVWIGSAMAAGLLLGRWIPGLHTALE
RVQLDGISLPIALGLLIMMYPVLAKVRYDRLDTVTGDRKLLLSSLLLNWV
LGPALMFALAWLLLADLPEYRTGLIIVGLARCIAMVIIWNDLAGGDREAA
AVLVALNSIFQVAMFAALGWFYLSVLPGWLGLEQTTIATSPWQIAKSVLI
FLGIPLLAGYLSRRIGEKTKGRNWYESRFLPKVGPWALYGLLFTIVILFA
LQGDQITGRPLDVARIALPLLAYFAIMWVGGYLLGAALRLRYRRTTTLAF
TAASNNFELAIAVAIATYGATSGQALAGVVGPLIEVPVLVGLVYVSLALR
NRLAGPNATHDADKPSVLFVCVHNAGRSQMAAGLLTHWAGDRIEVRSAGT
EPAGQVNPTAVAAMAEMGIDITANAPTLLTGGQVQSSDVVITMGCGDACP
YFPGVSYRNWKLPDPAGQPLDVVRMIRDDIADRVQALIAELLATAKTR
433635723YP_007269350.1 Conserved protein of unknown function- cadmium inducible protein CaMSRVQLALNVDDLEAAITFYSRLFNAEPAKRKPGYANFAIADPPLKLVLL
ENPGTGGTLNHLGVEVGSSNTVHAEIARLTEAGLVTEKEIGTTCCFATQD
KVWVTGPGGERWEVYTVLADSETFGSGPRHNDTSDGEASMCCDGQVAVGA
SG
433635721YP_007269348.1 Conserved integral membrane protein of unknown function [MycobacterMVVRSILLFVLAAVAEIGGAWLVWQGVREQRGWLWAGLGVIALGVYGFFA
TLQPDAHFGRVLAAYGGVFVAGSLAWGMALDGFRPDRWDVIGALGCMAGV
AVIMYAPRGH
433635719YP_007269346.1 Conserved membrane protein of unknown function- DedA [MycobacteriumMDVEALLQSIPPLMVYLVVGAVVGIESLGIPLPGEIVLVSAAVLSSHPEL
AVNPIGVGGAAVIGAVVGDSIGYSIGRRFGLPLFDRLGRRFPKHFGPGHV
ALAERLFNRWGVRAVFLGRFIALLRIFAGPLAGALKMPYPRFLAANVTGG
ICWAGGTTALVYFAGMAAQHWLERFSWIALVIAVIAGITAAILLRERTSR
AIAELEAEHYRKAGTTAA
433635717YP_007269344.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MVAADHRALGSNKSYPASQTAEAIWPPARTLRYDRQSPWLATGFDRRMSQ
TVTGVGVQNCAVSKRRCSAVDHSSRTPYRR
433635715YP_007269342.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MLPLGANITLAELPEPELRQLFPHEELQIPVSCGGLGAGAGGRMDMRAVG
LVPVRRASRYRTGLFVLIHSYLTLMGRGARLRLSR
433635713YP_007269340.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MTDNEHVGKTCQIDVLIEEHDERTRAKARLSWAGRQMVGVGLARLDPADE
PVAQIGDELAIARALSDLANQLFALTSSDIEASTHQPVTGLHH
433635711YP_007269338.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MLHRDDHINPPRPRGLDVPCARLRATNPLRALARCVQAGKPGTSSGHRSV
PHTADLRIEAWAPTRDGCIRQAVLGTVESFLDLESAHAVHTRLRRLTADR
DDDLLVAVLEEVIYLLDTVGETPVDLRLRDVDGGVDVTFATTDASTLVQV
GAVPKAVSLNELRFSQGRHGWRCAVTLDV
433635709YP_007269336.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MHQEAMMNLAIWHPRKVQAATIYQVTDRLHDGRTARVPGDEITSTVSGWL
SELGAQSPLADELARAVRIGDWPAAYAIGEHLSVEIAVAV
433635707YP_007269334.1 Hypoxic response protein 1 [Mycobacterium canettii CIPT 140070017]MTTARDIMNAGVTCVGEHETLTAAAQYMREHDIGALPICGDDDRLHGMLT
DRDIVIKGLAAGLDPNTATAGELARDSIYYVDANASIQEMLNVMEEHQVR
RVPVISEHRLVGIVTEADIARHLPEHAIVQFVKAICSPMALAN
433635705YP_007269332.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MSGRGEPTMKPIIVGIDGSHAAITAALWGVDEAISRAVPLRLVSVIKPTH
PSPADYDRDLAHAERSLREAQSAVEAAGKLVKIETDIPRGPAGPVLVEAS
RDAEMICVGSVGIGRYASSILGSTATELAEKAHCPVAVMRSKVDQPASDI
NWIVVRMTDAPDNEAVLEYAAREAKLRQAPILALGGRPEELREIPDGEFE
RRVQDWHHRHPDVRVYPITTHTGIARFLADHDERVQLAVIGGGEAGQLAR
LVGPSGHPVFRHAECSVLVVRR
433635703YP_007269330.1 Putative methyltransferase (methylase) [Mycobacterium canettii CIPTMANKRGNAGQPLPLSDRDDDHMQGHWLLARLGKRVLRPGGVELTRTLLAR
AEVSDADVLELAPGLGRTAAEILARNPRSYVGAESDPNAANLVRDVLAGR
GDVRVTDAADTGLADASADVVIGEAMLTMQGNAAKHTIVAEAARVLRPGG
RYAIHELALVPDDVAEQVRTDLRQSLARALKVNARPLTVAEWSHLLAGHG
LVVEHVVTAPMALLQPRRVIADEGLLGALRFAGNLLIHRAARRRVLLMRH
TFRRHRERLTAVAIVAHKPHVDS
433635701YP_007269328.1 Conserved membrane protein of unknown function [Mycobacterium canetMSAGPAIEVAVAFVWLGMVVAISFLEAPLKFRAAGVTLQIGLGIGRLVFR
ALNTVEVGFALVILAIVVVGPTPARIAAAFSVALAALAVQLIAVRPRLTR
RSNQVLAGLQAPRSRGHHIYVGLEIVKVVALLVAGILLLNG
433635699YP_007269326.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MDPVRRQLYQFVCSQSMPVSRDQAADAVGIPRHQAKFHLDRLTAEGLLDT
EYARLTGRSGPGAGRTAKLYRRAGRDIALSLPQREYELAGRLMAAAIVLS
ATTGEPTVEVLNRIAHDYGQAMGAAAATRPPSDPAAALELTLDVLRKYGY
EPRRPAGPGDDEVELVNCPFHALAREQTELACNMNHALITGVADALAPHS
PAVRLAPGPARCCVVLKRCSAHDPE
433635697YP_007269324.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MDLNALADLPLTYPEVGATAAGRLPAGYNHLDVVTQIGTGQQRFEQAADA
VMHWGMQRSAGLRVRASSETAVVSAVVVVTMLGFLRAPCRVVYVIDEPDL
RGFAYGTLPGHPECGEERFAVRCDPMTSVVFAEVLSFSRPATWASKAAGP
LGAVTQRFIAQRYLRAV
433635695YP_007269322.1 Threonyl-tRNA synthetase [Mycobacterium canettii CIPT 140070017]MSAPARPAPGADGGDPSQARIRVPAGTTAAAAVSEAGLPRRGTPDAIVVV
RDVDGKLRDLSWVPTVDAEVIPVAANTDDGRSVIRHSTAHVLAQAVQELF
PQAKLGIGPPITDGFYYDFDVPEPFTPEDLAALEKRMRQIVKEGQLFDRR
VYESTEQARAELAGEPYKLELVDDKSGDTEIMEVGGDELTAYDNLNPRTR
ERVWGDLCRGPHIPTTKHIPAFKLTRSSAAYWRGDQKNASLQRIYGTAWE
SQEALDRHLEFIEEAQRRDHRKLGVELDLFSFPDEIGSGLAVFHPKGGIV
RRELEDYSRRKHTEAGYQFVNSPHITKAQLFHTSGHLDWYADGMFPAMHI
DAEYNADGSLRKPGQDYYLKPMNCPMHCLIFRARGRSYRELPLRLFEFGT
VYRYEKSGVVHGLTRVRGLTMDDAHIFCTRDQMRDELRSLLRFVLDLLAD
YGLTDFYLELSTKDPEKFVGAEEVWEEATTVLAEVGAESGLELVPDPGGA
AFYGPKISVQVKDALGRTWQMSTIQLDFNFPERFGLEYTAADGTRQRPVM
IHRALFGSIERFIGILTEHYAGAFPAWLAPVQVVGIPVADEHVAYLEEVA
TQLKSHGVRAEVDASDDRMAKKIVHHTNHKVPFMLLAGDRDVAAGAVSFR
FGDRTQINGVARDDAVAAIVAWIADRENAVPTAELVKVAGRE
433635693YP_007269320.1 Putative PI synthase PgsA1 (phosphatidylinositol synthase) (CDP-diaMSKLPFLSRAAFARITTPIARGLLRVGLTPDVVTILGTTASVAGALTLFP
TGKLFAGACVVWFFVLFDMLDGAMARERGGGTRFGAVLDATCDRISDGAV
FCGLLWWIAFHMRDRPLVIATLICLVTSQVISYIKARAEASGLRGDGGFI
ERPERLIIVLTGAGVSDFPFVPWPPALSVGMWLLAVASVITCVQRLHTVW
TSPGAIDRMAIPGKGDR
433635691YP_007269318.1 GDP-mannose-dependent alpha-(1-2)-phosphatidylinositol mannosyltranMRIGMICPYSFDVPGGVQSHVLQLAEVMRTRGHLVSVLAPASPHAALPDY
FVSGGRAVPIPYNGSVARLRFGPATHRKVKKWLAHGDFDVLHLHEPNAPS
LSMLALNIAEGPIVATFHTSTTKSLTLTVFQGILRPMHEKIVGRIAVSDL
ARRWQMEALGSDAVEIPNGVDVDSFASAARLDGYPRQGKTVLFLGRYDEP
RKGMAVLLDALPKVVQRFPDVQLLIVGHGDADQLRGQAGRLAAHLRFLGQ
VDDAGKASAMRSADVYCAPNTGGESFGIVLVEAMAAGTAVVASDLDAFRR
VLRDGEVGHLVPVDPPDLQAAALADGLIAVLENDVLRERYVAAGNAAVRR
YDWSVVASQIMRVYETVAGSGAKVQVAS
433635689YP_007269316.1 Conserved protein of unknown function- PPE family [Mycobacterium caMNFAVLPPEVNSARIFAGAGLGPMLAAASAWDGLAEELHAAAGSFASVTT
GLAGDAWHGPASLAMTRAASPYVGWLNTAAGQAAQAAGQARLAASAFEAA
LAATVSPAMVAANRTRLASLVAANLLGQNAPAIAAAEAEYEQIWAQDVAA
MFGYHSAASAVATQLAPIQEGLQQQLQNVLAQLASGNLGSGNVGVGNIGN
DNIGNANIGFGNRGDANIGIGNIGDRNLGIGNTGNWNIGIGITGNGQIGF
GKPANPDVLVVGNGGPGVTALVMGGTDSLLPLPNIPLLEYAARFITPVHP
GYTATFLETPSQFFPFTGLNSLTYDVSVAQGVTNLHTAIMAQLAAGNEVV
VFGTSQSATIATFEMRYLQSLPAHLRPGLDELSFTLTGNPNRPDGGILTR
FGFSIPQLGFTLSGATPADAYPTVDYAFQYDGVNDFPKYPLNVFATANAI
AGILFLHSGLIALPPDLASGVVQPVSSPDVLTTYILLPSQDLPLLVPLRA
IPLLGNPLADLIQPDLRVLVELGYDRTAHQDVPSPFGLFPDVDWAEVAAD
LQQGAVQGVNDALSGLGLPPPWQPALPRLF
433635687YP_007269314.1 Putative pyridoxine biosynthesis protein SnzP [Mycobacterium canettMDPAGNPATGTARVKRGMAEMLKGGVIMDVVTPEQARIAEGAGAVAVMAL
ERVPADIRAQGGVSRMSDPDMIEGIIAAVTIPVMAKVRIGHFVEAQILQT
LGVDYIDESEVLTPADYAHHIDKWNFTVPFVCGATNLGEALRRISEGAAM
IRSKGEAGTGDVSNATTHMRAIGGEIRRLTSMSEDELFVAAKELQAPYEL
VAEVARAGKLPVTLFTAGGIATPADAAMMMQLGAEGVFVGSGIFKSGAPE
HRAAAIVKATTFFDDPDVLAKVSRGLGEAMVGINVDEIAVGHRLAQRGW
433635685YP_007269312.1 Putative glutamine amidotransferase SnoP [Mycobacterium canettii CIMSVPRVGVLALQGDTREHLAALRECGAEPMTVRRRDELDAVDALVIPGGE
STTMSHLLLDLDLLGPLRARLADGLPAYGSCAGMILLASEILDAGAAGRQ
ALPLRAMNMTVRRNAFGRQVDSFEGDIEFAGLDDPVRAVFIRAPWVERVG
DGVQVLARAAGHIVAVRQGAVLATAFHPEMTGDRRIHQLFVDIVTSAA
433635683YP_007269310.1 Conserved protein of unknown function with PIN domain- possible toxMLLCDTNIWLALALSGHVHHRASRAWLDTINAPGVIHFCRATQQSLLRLL
TNRTVLGAYGSPPLTNREAWAAYAAFLDDDRIVLAGAEPDGLEAQWRAFA
VRQSPAPKVWMDAYLAAFALTGGFELVTTDTAFTQYGGIELRLLAK
433635681YP_007269308.1 Putative spermidine synthase SpeE (putrescine aminopropyltransferasMTSTRQAGESTEASVRWRAVLLAAVAACAACGLVYELALLTLSASLNGGG
IVATSLIVAGYIAALGAGALLIKPLLAHAAIAFIAVEAVLGIIGGLSAAA
LYAAFAFLDELDGSTLVLAVGTALIGGLVGAEVPLLMTLLQRGRVAGAAD
AGRTLANLNAADYLGALVGGLAWPFLLLPQLGMIRGAAVTGIVNLAAAGV
VSIFLLRHVVSGRQLVTALCALAAALGLIATLLVHSHDIETTGRQQLYAD
PIIAYRHSAYQEIVVTRRGDDLRLYLDGGLQFCTRDEYRYTESLVYPAVS
DGARSVLVLGGGDGLAARELLRQPGIEQIVQVELDPAVIELARTTLRDVN
AGSLDNPRVHVVIDDAMSWLRGAAVPPAGFDAVIVDLPDPDTPVLGRLYS
TEFYALAARALAPGGLMVVQAGSPYSTPTAFWRIISTIRSAGYAVTPYHV
HVPTFGDWGFALARLTDIAPTPAVPSTAPALRFLDQQVLEAATVFSGDIR
PRTLDPSTLDNPHIVEDMRHGWD
433635679YP_007269306.1 Conserved membrane protein of unknown function [Mycobacterium canetMSRNRLFLVAGILAVAAAVSLISGITLLNRDVGSYIASHYRQESRDGNGT
RYLCTGSPKQVAATLVKYQTPAARASHTDTEYLRYRNNIVTVGPDGTYPC
IIRVENLSAGYNHGAYVFLGPGFTPGSPSGGSGGSPGGPGGSK
433635677YP_007269304.1 Conserved membrane protein of unknown function [Mycobacterium canetMGNLLVVIAVALFIAAIVVLVVAIRRPKTPATPGGRRDPLAFDAMPQFGP
RQLGPGAIVSHGGIDYVVRGSVTFREGPFVWWEHLLEGGDTPTWLSVQED
DGRLELAMWVKRTDLGLQPGGQHVIDGVTFQETERGHAGYTTEGTTGLPA
GGEMDYVDCASAGQRADESMLLSFERWAPDMGWEIATGKSVLAGELTVYP
APPVSA
433635675YP_007269302.1 Conserved protein of unknown function- possible antitoxin [MycobactMRTTIDVAGRLVIPKRIRERLGLRGNDQVEITERDGRIEIEPAPTGVELV
REGSVLVARPERPLPPLTDEIVRETLDRTRR
433635673YP_007269300.1 Putative holliday junction DNA helicase RuvA [Mycobacterium canettiMIASVRGEVLEVALDHVVIEAAGVGYRVNATPATLATLRQGTEARLITAM
IVREDSMTLYGFPDGETRDLFLTLLSVSGVGPRLAMAALAVHDAPALRQV
LADGNVAALTRVPGIGKRGAERMVLELRDKVGVAATGGALSTNGHAVRSP
VVEALVGLGFAAKQAEEATDTVLAANHDATTSSALRSALSLLGKAR
433635671YP_007269298.1 Conserved protein of unknown function- PE-PGRS family [MycobacteriuMSFVTAAPEMLATAAQNVANIGTSLSAANATAAASTTSVLAAGADEVSQA
IARLFSDYATHYQSLNAQAAAFHHSFVQTLNAAGGAYSSAEAANASAQAL
EQNLLAVINAPAQALFGRPLIGNGANGTAASPNGGDGGILYGNGGNGFSQ
TTAGVAGGAGGSAGLIGNGGNGGAGGAGAAGGAGGAGGWLLGNGGAGGPG
GPTDVPAGTGGAGGAGGDAPLIGWGGNGGPGGFAAFGNGGAGGNGGASGS
LFGVGGAGGVGGSSEDVGGTGGAGGAGRGLFLGLGGDGGAGGTSNNNGGD
GGAGGTAGGRLFSLGGNGGNGGAGTAIGSNAGNGGAGGDSSALIGYAQGG
SGGLGGFGESTGGDGGLGGTGAVLIGTGVGGFGGLGGGSNGTGGAGGTGG
TGATLIGLGAGGVGGIGGFAVNVGNGVGGLGGQGGQGAALIGLGAGGAGG
AGGATVVGLGGNGGDGGDGGGLFSIGVGGDGGNAGNGAMPANGGNGGNAG
VIANGSFAPSFVGFGGNGGNGVNGGTGGTGGSGGILFGANGANGPS
433635669YP_007269296.1 4-aminobutyrate aminotransferase GabT (gamma-amino-N-butyrate transMASLQQSRRLVTEIPGPASQALTHRRAAAVSSGVGVTLPVFVARAGGGIV
EDVDGNRLIDLGSGIAVTTIGNSSPRVVDAVRTQVAEFTHTCFMVTPYEG
YVAVAEQLNRITPGSGPKRSVLFNSGAEAVENAVKIARSYTGKPAVVAFD
HAYHGRTNLTMALTAKSMPYKSGFGPFAPEIYRAPLSYPYRDGLLDKQLA
TDGELAAARAIGVIDKQVGANNLAALVIEPIQGEGGFIVPAEGFLPALLG
WCRKNHVVFIADEVQTGFARTGAMFACEHEGPDGLEPDLICTAKGIADGL
PLSAVTGRAEIMNAPHVGGLGGTFGGNPVACAAALATIATIESDGLIKRA
RQIERLVTDRLTTLQAVDDRIGDVRGRGAMIAVELVKSGTTEPDAGLTER
LATAAHAAGVIILTCGMFGNIIRLLPPLTIGDELLSEGLDIVCAILADL
433635667YP_007269294.1 Putative protein-export membrane protein SecD [Mycobacterium canettMASSSAPVHPARYLSVFLVMLIGVYLLVFFTGDKHTAPKLGIDLQGGTRV
TLTARTPDGSAPSREALAQAQQIISARVNGLGVSGSEVVVDGDNLVITVP
GNDGSEARNLGQTARLYIRPVLNSMPAQPAAEEPQPAPSAEPQPPGQPAA
PPPAQSGAPASPQPGAQPRPYPQDPTPSPNPTSPASPPPAPPAEAPATDP
RKDLAERIAQEKKLRQSTNQYMQMVALQFQATRCESDDILAGNDDPKLPL
VTCSTDHKTAYLLAPSIISGDQIQNATSGMDQRGIGYVVDLQFKGPAANI
WADYTAAHIGTQTAFTLDSLVVSAPQIQEAIPGGRTQISGGDPPFTAATA
RQLANVLKYGSLPLSFESSEAQTVSATLGLSSLRAGMIAGAIGLLLVLVY
SLLYYRVLGLLTALSLVASGSMVFAILVLLGRYINYTLDLAGIAGLIIGI
GTTADSFVVFFERIKDEIREGRSFRSAVPRGWARARKTIVSGNAVTFLAA
AVLYFLAIGQVKGFAFTLGLTTILDLVVVFLVTWPLVYLASKSSLLAKPA
YNGLGAVQQVARERRAMARTGRG
433635665YP_007269292.1 Conserved lipoprotein of unknown function [Mycobacterium canettii CMAPRRRRHTRIAGLRVVGTATLVAATTLTACSGSAAAQIDYVVDGALVTY
NTNTVIGAASAGAQAFARTLTGFGYHGPDGQVVADRDFGTVSVVGGSPLI
LDYQISDDAVYSDGRPVTCDDLVLAWAAQSGRFPGFDAATQAGYVDIANI
ECTAGQKKARVSFIPDRSVVDHSQLFTATSLMPSHVIADQLHIDVTAALL
SNNVSAVEQIARLWNSTWDLKPGRSHDEVRSRFPSSGPYKIESVLDDGAV
VLVANDRWWGTKAITKRITVWPQGADIQDRVNNRSVDVVDVAAGSSGSLV
TPDSYQRTDYPSAGIEQLIFAPQGSLAQSRTRRALALCVPRDAIARDAGV
PIANSRLSPATDDALTDADGAAEARQFGRVDPAAARDALGGTPLTVRIGY
GRPNARLAATIGTIADACAPAGITVSDVTVDTPGPQALRDGKIDVLLAST
GGATGSGSSGSSAMDAYDLHSGNGNNLSGYANAQIDGIISALAVSADPAE
RVRLLAEAAPVLWDEMPTLPLYRQQRTLLMSTKMYAVSRNPTRWGAGWNM
DRWALAR
433635663YP_007269290.1 Putative GTP pyrophosphokinase RelA (ATP:GTP 3'-pyrophosphotransferMAEDQLTAQAVAPPTESSAALEPALETPESPVETLKTSISASRRVRARLA
RRMTAQRSTTNPVLEPLVAVHREIYPKADLSILQRAYEVADQRHASQLRQ
SGDPYITHPLAVANILAELGMDTTTLVAALLHDTVEDTGYTLEALTEEFG
EEVGHLVDGVTKLDRVVLGSAAEGETIRKMITAMARDPRVLVIKVADRLH
NMRTMRFLPPEKQARKARETLEVIAPLAHRLGMASVKWELEDLSFAILHP
KKYEEIVRLVAGRAPSRDTYLAKVRAEIVNTLTASKIKATVEGRPKHYWS
IYQKMIVKGRDFDDIHDLVGVRILCDEIRDCYAAVGVVHSLWQPMAGRFK
DYIAQPRYGVYQSLHTTVVGPEGKPLEVQIRTRDMHRTAEYGIAAHWRYK
EAKGRNGVLHPHAAAEVDDMAWMRQLLDWQREAADPGEFLESLRYDLAVQ
EIFVFTPKGDVITLPTGSTPVDFAYAVHTEVGHRCIGARVNGRLVALERK
LENGEVVEVFTSKAPNAGPSRDWQQFVVSPRAKTKIRQWFAKERREEALE
TGKDAMAREVRRGGLPLQRLVNGESMASVARELHYADVSALYTAIGEGHV
SAKHVVQRLLAELGGIDQAEEELAERSTPATMPRRPRSTDDVGVSVPGAP
GVLTKLAKCCTPVPGDVIMGFVTRGGGVSVHRTDCTNAASLQQQAERIIE
VLWAPSPSSVFLVAIQVEALDRHRLLSDVTRALADEKVNILSASVTTSGD
RVAISRFTFEMGDPKHLGHLLNAVRNVEGVYDVYRVTSAA
433635661YP_007269288.1 Putative glyoxalase II (hydroxyacylglutathione hydrolase) (GLX II) MLITGFPAGLLACNCYVLAERPGTDAVIVDPGQGAMGTLRRILDKNRLTP
AAVLLTHGHIDHIWSAQKVSDTFGCPTYVHPADRFMLTDPIYGLGPRIAQ
LVAGAFFREPKQVVELDRDGDKIDLGGISVNIDHTPGHTRGSVVFRVLQA
TNNDKDIVFTGDTLFERAIGRTDLAGGSGRDLLRSIVDKLLVLDDSTVVL
PGHGNSTTIGAERRFNPFLEGLSR
433635659YP_007269286.1 Haloalkane dehalogenase DhaA (1-chlorohexane halidohydrolase) [MycoMTAFGVEPYGQPKYLEIAGKRMAYIDEGKGDAIVFQHGNPTSSYLWRNIM
PHLEGLGRLVACDLIGMGASDKLSPSGPESYSYGEQRDFLFALWDALDLG
DHVVLVLHDWGSALGFDWANQHRDRVQGIAFMEAIVTPMTWADWPPAVRG
VFQGFRSPQGEPMALEHNIFVEGVLPGAILRQLSDEEMNHYRRPFVNGGE
DRRPTLSWPRNLPIDGEPAEVVAVVNEYRSWLEETDMPKLFINAEPGAII
TGRIRDYVRSWPNQTEITVPGVHFVQEDSPEEIGAAIAQFVRRLRSAAGV
433635657YP_007269284.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MGADLKQPQDADSPPKGVSRRRFLTTGAAAVVGTGVGAGGTALLSSHLRG
PAVWHQRGRSGAPPVGGLHLQYGRNASTDMVVSWHTTDTVGNPRVMLGTP
TSGFGSVVAAETRTYRDGKSNTEVRVNHAHLTNLTPDTDYVYAAVHDGTT
PELGTARTAPSGRKPLRFTSFGDQSTPALGRLADGRYVSDNIGSPFAGDI
TIAIERIAPLFNLINGDLCYANLAQDRIRTWSDWFDNNTRSARYRPWMPA
AGNHENEVGNGPIGYDAYQTYFAVPDSGSSPQLRGLWYSFTAGSVRVISL
HNDDVCYQDGGNSYVRGYSGGEQRRWLQAELANARRDSEIDWVVVCMHQT
AISTADDNNGADLGIRQEWLPLFDQYQVDLVVCGHEHHYERSHPLRGALG
TDTRTPIPVDTRSDLIDSTRGTVHLVIGGGGTPKPTNALLFPQPRCQVIT
GVGDFDPAIRRKPSIFVLEDAPWSAFRDRDNPYGFAAFDVDPGQPGGTTS
IKATYYAVTGPFGGLTVIDQFTLTKPRGG
433635655YP_007269282.1 Conserved membrane protein of unknown function [Mycobacterium canetMPAGVGNASGSVLDMTSVRTVPSAVALVTFAGAALSGVIPAIARADPVGH
QVTYTVTTTSDLMANIRYMSADPPSMAAFNADSSKYMITLHTPITGGQPL
VYTATLANPSQWAIVTASGGLRVNPEFHCEIVVDGQVVVSQNGGSGVQCS
TRPW
433635653YP_007269280.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MYPCERVGLSFTETAPYLFRNTVDLAVTPEQLFEVLADPQAWPRWATVIT
KVTWTSPEPFGAGTTRIVEMRGGIVGDEEFLSWEPFTRMAFRFNECSTRA
VGAFAEDYRVQAIPGGCRLTWTMAQKLAGPARPAMFVCRPLLNLALRRFL
RNLRRYTDARFAAAQQS
433635651YP_007269278.1 Putative aspartyl-tRNA synthetase AspS (aspartate--tRNA ligase) (ASMFVLRSHAAGLLREGDAGQQVTLAGWVARRRDHGGVIFIDLRDASGIAQV
VFRDPQDTEVLAQAHRLRAEFCVSVAGVVEIRPEGNANPEIATGEIEVNA
TSLTVLGECAPLPFQLDEPAGEELRLKYRYLDLRRDDPAAAIRLRSRVNA
AARAVLARHDFVEIETPTITRSTPEGARDFLVPARLHPGSFYALPQSPQL
FKQLLMVAGMERYYQIARCYRDEDFRADRQPEFTQLDMEMSFVDAEDIIA
ISEEVLTELWALIGYRIPMPIPRIGYAEAMRRFGTDKPDLRFGLELVECT
DFFSDTTFRVFQAPYVGAVVMPGGASQPRRTLDGWQDWAKQRGHRGLAYV
LVAEDGTLGGPVAKNLTEAERTGLADHVGAKPGDCIFFSAGPVKSSRALL
GAARVEIANRLGLIDPDAWAFVWVVDPPLFEPADEATAAGEVAVGSGAWT
AVHHAFTAPKPEWEDRIESDTGSVLADAYDIVCNGHEIGGGSVRIHRRDI
QERVFAVMGLDKAEAEEKFGFLLEAFMFGAPPHGGIAFGWDRTTALLAGM
DSIREVIAFPKTGGGVDPLTDAPAPITAQQRKESGIDAQPKRVEQS
433635649YP_007269276.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MATWDDVARIVGGLPLTTEQAPHDWRVGRKLLAWERPLRKSDREALTRGG
SEPPSGDIVGVRVSDEGVKFALIADEPGVYFTTPHFDGYPAVLVRLAEIE
VRDLEELITEAWLMQAPKQLVQEFLANSG
433635647YP_007269274.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MRDFHCPNCGQRLAFENSACLSCGSALGFSLGRMALLVIADDADVQLCAN
LHLAQCNWLVPSDQLGGLCSSCVLTIERPSDTNTAGLAEFARAEGAKRRL
IAELHELKLPIVGRDQDPDHGLAFRLLSSAHENVTTGHQNGVITLDLAEG
DDVHREQLRVEMDEPYRTLLGHFRHEIGHYYFYRLIASSSDYLSRFNELF
GDPDADYSQALDRHYRGGPPEGWQDSFVSSYATMHASEDWAETFAHYLHI
RDALDTAAWCGLAPASATFDRPALGPSAFNTIIDKWLPLSWSLNMVNRSM
GHDDLYPFVLPAAVLEKMRFIHTVVDEVAPDFEPAHSRRTV
433635645YP_007269272.1 Conserved long protein of unknown function- putative transglutaminaMSIKVALEHRTSYTFDRLVRVYPHIVRLRPAPHSRTSIEAYSLRIEPADH
FINWQQDALGNFLARLVFPNPMRQLRITVGLIADLKVINPFDFFIEDWAE
IWPCAGMAYPKALADDLRPYLRPVDEDGDGSGPGELTQAWVRNFTVPDGT
RTIDFLVALNRAINADVGYCVRMEPGVQTPDFTLRTGVGSCRDSAWLLVS
ILRQFGLAARFVSGYLVQLASDIEALDGPSGPAADFTDLHAWAEAYIPGA
GWIGLDPTSGLLAGEGHIPLAATPHPASAAPISGGTDVCDTVLEFSNTVT
RVHEDPRVTLPYTDESWKTICEVGQRVDERLAAADVRLTVGGEPTFVSVD
NQVAEEWRTAADGPHKRERASDLAARLKAVWAPQGLIHRGQGRWYPGEPL
PRWQIALYWRTDGRPLWTNDALLADPWGAPPADPVDDDAAYRVLAGIADG
LGLPIWQVRPAYEDPLSRLAAAVRMPAGDPVESGDDLGCDTNPDTPTGRA
ALLARLDEAITSPAAYVLPLHRRDDGQGWASANWRLRRGRIVLLEGDSPA
GLRLPLDSISWRPPRASFDADPVAVRSTLPAQPHTDRAVVEDPETAPTTA
LVAEVRGGLVHIFLPPTDALEHFIDLVARVEAAATTANCPVVIEGYGPPP
DPRLTSTTITPDPGVIEVNIAPTASFAEQRQQLETLYQQARLARLTTEAF
DVDGTHGGTGGGNHITLGGVTPADSPLLRRPDLLVSLLTYWQRHPSLSYL
FAGRFVGTTSQAPRVDEGRAEALYELEIAFAEILRLSPSSGGGRPQPWVT
DRALRHLLTDITGNTHRAEFCIDKLYSPDSARGRLGLLELRGFEMPPHLH
MAMVQSLLVRSLVAWFWDQPLRAPLIRHGANLHGRYLLPHFLIHDIADVA
ADLRAHGIAFETSWLDPFTEFRFPRIGTAVFDGIEIELRGAIEPWHTLGE
EATAAGTARYVDSSVERIQVRIIGADRHRYVVTCNGYPMPLLATDNPDIH
VGGVRFKAWQPPSALHPTITVDGPLRFELIDIATATSCGGCTYHVAHPGG
RAYDEPPVNAVEAEARRARRFEATGFTPGKLDLSDIREKQARISTDIGAP
GILDLRRVRTVQQ
433635643YP_007269270.1 Putative glutamine-transport ATP-binding protein ABC transporter GlMGGLTISDLVVEYSSGGYAVRPIDGLSLDVAPGSLVILLGPSGCGKTTLL
SCLGGILRPKSGSIKFDDVDITTLEGAALAKYRRDKVGIVFQAFNLVSSL
TALENVMVPLRAAGVSRAAARKRAEELLTRVNLGERMKHRPGDMSGGQQQ
RVAVARAIALDPQLILADEPTAHLDFIQVEEVLRLIRSLAQGDRVVVVAT
HDSRMLPLADRVLELMPAQVSPNQPPETVHVKAGEVLFEQSTMGDLIYVV
SEGEFEIVRELADGGEELVKTAAPGDYFGEIGVLFHLPRSATVRARSDAT
AVGYTAQAFRERLGVTRVADLIEHRELASE
433635641YP_007269268.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MAEQKVKRNVELAGVDVILVHRMLKNEVPVSEYLFMTDVVAQCLDESVRK
LATPLTHDFEGIGETSTHYIDLATSDMPPAVPDHSFFGLLWADVKFEWHA
LPYLLGFKKACAGFRSLGRGATEEPAEMG
433635639YP_007269266.1 Putative RarA-like recombination factor protein [Mycobacterium caneMPEAMSDGLFDVPGVPMTSGHDLGASAGAPLAVRMRPASLDEVVGQDHLL
APGSPLRRLVEGSGVASVILYGPPGSGKTTLAALISQATGRRFEALSALS
AGVKEVRAVIEVARRALLNGERTVLFIDEVHRFSKTQQDALLSAVENRVV
LLVAATTENPSFSVVAPLLSRSLILQLRPLTADDIRAVVQRAIDDPRGLG
REVVVAPEAVDLLVQLAAGDARRALTALEVAAEAAQAAGELVSVQTIERS
VDKAAVRYDRDGDQHYDVVSAFIKSVRGSDVDAALHYLARMLVAGEDPRF
IARRLMILASEDIGMADPTALPVAVAAAQTVALIGMPEAQLTLAHATIHL
ATAPKSNAVTTALAAAMNDIKAGKAGLVPAHLRDGHYSGAAALGNAQGYK
YSHEDPDGVVAQQYPPDELVDVDYYRPTGRGGEREIAGRLDRLRAIIRKK
RG
433635637YP_007269264.1 Conserved protein of unknown function- thought to be involved in thMTGGATGALPRTMKEGWIVYARSTTIQAQSESIDAGIAHVRDVVMPALQG
VDGCIGVSLLVDRQSGRCIATSAWETAEAMHASREQVTPIRDRCAEMFGG
TPAVEEWEIAAMHRDHRSAEGACVRATWVKVPADQVDQGIEYYKSSVLPQ
IEGLDGFCSASLLVDRTSGRAVSSATFDSFDAMERNRDQSNALKATSLRE
AGGEELDECEFELALAHLRVPELV
433635635YP_007269262.1 Putative alanyl-tRNA synthetase AlaS (alanine--tRNA ligase) (alaninMQTHEIRKRFLDHFVKAGHTEVPSASVILDDPNLLFVNAGMVQFVPFFLG
QRTPPYPTATSIQKCIRTPDIDEVGITTRHNTFFQMAGNFSFGDYFKRGA
IELAWALLTNSLAAGGYGLDPERIWTTVYFDDDEAVRLWQEVAGLPAERI
QRRGMADNYWSMGIPGPCGPSSEIYYDRGPEFGPAGGPIVSEDRYLEVWN
LVFMQNERGEGTTKEDYQILGPLPRKNIDTGMGVERIALVLQDVHNVYET
DLLRPVIDTVARVAARAYDVGNHEDDVRYRIIADHSRTAAILIGDGVSPG
NDGRGYVLRRLLRRVIRSAKLLGIDAAIVGDLMATVRNAMGPSYPELVAD
FERISRIAVAEETAFNRTLASGSRLFEEVASSTKKSGATVLSGSDAFTLH
DTYGFPIELTLEMAAETGLQVDEIGFRELMAEQRRRAKADAAARKHAHAD
LSAYRELVDAGPTEFTGFDELRSQARILGIFVDGKRVPVVAHGVAGGAGE
GQRVELVLDRTPLYAESGGQIADEGTISGTGSSEAARAAVTDVQKIAKTL
WVHRVNVESGEFVEGDTVIAAVDPGWRRGATQGHSGTHMVHAALRQVLGP
NAVQAGSLNRPGYLRFDFNWQGPLTDDQRTQVEEVTNEAVQADFEVRTFT
EQLDKAKAMGAIALFGESYPDEVRVVEMGGPFSLELCGGTHVSNTAQIGP
VTILGESSIGSGVRRVEAYVGLDSFRHLAKERALMAGLASSLKVPSEEVP
ARVANLVERLRAAEKELERVRMASARAAATNAAAGAQRIGNVRLVAQRMS
GGMTAADLRSLIGDIRGKLGSEPAVVALIAEGESQTVPYAVAANPAAQDL
GIRANDLVKQLAVAVEGRGGGKADLAQGSGKNPTGIDAALDAVRSEIAVI
ARVG
433635633YP_007269260.1 Conserved membrane protein of unknown function [Mycobacterium canetMPDGGHRHRAQPVSVRPNRHRRTRVSRAQRRHAQQIRRRRRVAGGFALSL
LVVVVVAAVVVGAKLWQTMLGSGNDYTGPGKRDIVIQIRAGDSTTAVGET
LLKHGVVATVRAFVDAAHGNTAISSIQPGFYRMRTEISAASAVARLTDPH
NRVGKLVIPEGRQLDDTTDMKTNVVNPGIFALISRATCVDLDGTQRCVSV
ADLRAAASRSTPTMLSVPRWAVGPVMELGTDHRRIEGLIAPGTFNIDPSA
SAETILATLISAGAVEYMKSGLVDTAKSLGLSPYDILVVASLVQQEANTQ
DFPKVARVIYNRLHEHRTLEFDSTVNYPLDRREVATSDTDRAQRTPWNTY
MAQGLPATAICSPGVDALHAAEHPVPGDWLYFVTIDSQGTTLFTRDYQQH
LANIELAKHNGVLDSAR
433635631YP_007269258.1 Conserved membrane protein of unknown function [Mycobacterium canetMLAAAVLAWMGVLCVCDVRQRRLPNRLTLPGAGVILLFAGLAGRGVPALA
GAAALAGVYLLVHLALPAAMGAGDVKLAIGLGGLTGCFGVQVWFLAALGA
PLLTAVCGLVVMRWGVRSLPHGPSMCVASVGAVGLALVEPGAISV
433635629YP_007269256.1 Conserved protein of unknown function- possible antitoxin [MycobactMKRLQIYIDEDVDRALAVEARRRRTSKAALIREYVAEHLRQPGPDPVDAF
VGSFVGEADLSASVDDVVYGKHE
433635627YP_007269254.1 Conserved protein of unknown function with PIN domain- possible toxMKLIDTTIAVDHLRGEPAAAVLLAELINSGEEIAASELVRFELLAGVRES
ELAALEAFFSAVVWTRVTEDIARIGGRLARRYRSSHRGIDEVDYLIAATA
IVVDVDLLTTNVCHFPMFRDLQPPY
433635625YP_007269252.1 Conserved protein of unknown function with PIN domain- possible toxMMVFCVDTSAWHHAAQPEVAHRWLAALSADQIGICDQARLEILYSAKSAT
DYDELADELDGLTRIPIDTETFTRAYQVQRELAHVGGLHHRSVKIADLII
AAAAELSGTVLWHYDEDYDRVAAITGQPTEWIVPRGTL
433635623YP_007269250.1 Conserved protein of unknown function with PIN domain- possible antMSSVAEGARPTTRATSPGSTHLADDSDANPVSTTIVAGAIQGSRVGYPAL
AQAGSRNPGHTTALLWAQAPQCIFFIIE
433635621YP_007269248.1 Conserved protein of unknown function. Probable exported lipoproteiMGPRPVSRTLVRWRCIVALTMIGISTALIGGCTMNYNPDTSPHLTDEQKI
QLIDSMRHKGSFEAARERLTTTARIIADRISAAIPGQTWKFNDDSYGQDF
YKNGSLCKELSADIARRPMAKPVDFGSTFSAEDFKIAANIVREEAAKYGA
TTESSLFNESAKRDYDVQGNGYEFNLGQINFATLLITGECLLLQKVLDLP
PGQLPPEPPIWPTTSTPE
433635619YP_007269246.1 Conserved alanine rich protein of unknown function [Mycobacterium cMDVAGGTQARLRVTADGLQALAGRCATLAGELSAAVAPSGAVSSWQANAV
AVNAAHARAGAAGAAVSARMRATAAALGQAAHRYTRQDAAAAAALGAVRP
WGTR
433635617YP_007269244.1 Shikimate kinase AroK (SK) [Mycobacterium canettii CIPT 140070017]MAPKAVLVGLPGSGKSTIGRRLAKALGVGLLDTDVAIEQRTGRSIADIFA
AYGEQEFRRIEEDVVRAALAGHDGVLSLGGGAVTSPGVRAALAGHTVVYL
EISAAEGVRRTGGNTVRPLLAGPDRAEKYRALMAQRAPLYRRVATMRVDT
NRRSPGAVVRHILSRLQVPSPSEAAT
433635615YP_007269242.1 3-dehydroquinate dehydratase AroD (AroQ) (3-dehydroquinase) (type IMSELIVNVINGPNLGRLGRREPAVYGGTTHDELVALIEREAAELGLKAVV
RQSDSEAQLLDWIHRAADAAEPVILNAGGLTHTSVALRDACAELTAPLIE
VHISNVHAREEFRRHSYLSPIATGVIVGLGIQGYLLALRYLAEHAGT
433635613YP_007269240.1 Putative cytoplasmic peptidase PepQ [Mycobacterium canettii CIPT 14MTHSQRRDKLKAQIAASGLDAMLISDLINVRYLSGFSGSNGALLVFADER
DAVLATDGRYRTQAASQAPDLEVAIERAVGRYLAGRAGEAGVGKLGFESH
VVTVDGLDALAGALEGKNTELVRASGTVESLREVKDAGELALLRLACEAA
DAALTDLVARGGLRPGRTERQVSRELEALMLDHGADAVSFETIVAAGANS
AIPHHRPTDAVLQAGDFVKIDFGALVAGYHSDMTRTFVLGKAADWQLEIY
QLVAEAQQAGRQALLPGAELREVDAAARQLIADAGYGERFGHGLGHGVGL
QIHEAPGIAATSVGTLLAGSVVTVEPGVYLPGRGGVRIEDTLVVAGGTPK
MPETAGQTPELLTRFPKELAIL
433635611YP_007269238.1 N utilization substance protein B homolog- transcription antiterminMSDRKPVRGRHQARKRAVDLLFEAEVRGISAAEVVDTRAALAEAKPDIAR
LHPYTAAVARGVSEHAAHIDDLITAHLRGWTLDRLPAVDRAILRVSVWEL
LHAADVPEPVVVDEAVQLAKELSTDDSPGFVNGVLGQVMLVTPQLRAAAQ
AVRGGA
433635609YP_007269236.1 Putative amino acid decarboxylase [Mycobacterium canettii CIPT 1400MNPNSVRPRRLHVSALAAVANPSYTRLDTWNLLDDACRHLAEVDLAGLDT
THDVARAKRLMDRIGAYERYWLYPGAQNLATFRAHLDSHSTVRLTEEVSL
AVRLLSEYGDRTALFDTSASLAEQELVAQAKQQQFYTVLLADDSPATAPD
SLAECLRELRNPADEVQFELLVVASIEDAITAVALNGEIQAAIIRHDLPL
RSRDRVPLMTTLLGTDGDEAVANETHDWVECAEWIRELRPHIDLYLLTDE
SIAAETQDEPDVYDRTFYRLNDVTDLHSTVLAGLRNRYATPFFDALRAYA
AAPVGQFHALPVARGASIFNSKSLHDMGEFYGRNIFMAETSTTSGGLDSL
LDPHGNIKTAMDKAAVTWNANQTYFVTNGTSTANKIVVQALTRPGDIVLI
DRNCHKSHHYGLVLAGAYPMYLDAYPLPQYAIYGAVPLRTIKQALLDLEA
AGQLHRVRMLLLTNCTFDGVVYNPRRVMEEVLAIKPDICFLWDEAWYAFA
TAVPWARQRTAMIAAERLEQMLSTAEYAEEYRNWCASMDGVDRSEWVDHR
LLPDPNRARVRVYATHSTHKSLSALRQASMIHVRDQDFKALTRDAFGEAF
LTHTSTSPNQQLLASLDLARRQVDIEGFELVRHVYNMALVFRHRVRKDRL
ISKWFRILDESDLVPDAFRSSTVSSYRQVRQGALADWNEAWRSDQFVLDP
TRLTLFIGATGMNGYDFREKILMERFGIQINKTSINSVLLIFTIGVTWSS
VHYLLDVLRRVAIDLDRSQKAASGADLALHRRHVEEITQDLPHLPDFSEF
DLAFRPDDASSFGDMRSAFYAGYEEADREYVQIGLAGRRLAEGKTLVSTT
FVVPYPPGFPVLVPGQLVSKEIIYFLAQLDVKEIHGYNPDLGLSVFTQAA
LARMEAARNAVATVGAALPAFEVPRDASALNGTVNGDSVLQAAADDA
433635607YP_007269234.1 Conserved protein of unknown function with PIN- possible toxin VapCMTTWILDKSAHVRLVAGATPPAGIDLTDLAICDIGELEWLYSARSATDYD
SQQTSLRAYQILRAPSDIFDRVRHLQRDLAHHRGMWHRTPLPDLFIAETA
IHHRAGVLHHDRDYRRIAAVRPGFQACELSRGH
433635605YP_007269232.1 Conserved exported protein of unknown function [Mycobacterium canetMSVSRRDVLKFAAATPGVLALGVVASSLRAAPASAGSLGTLLDYAAGVIP
ASQIRAAGAAGAIRYVSDRRPGGAWMLGKPIQLSEARDLSGNGLKIVSCY
QYGKGSTADWLGGASAGVQHARRGSELHAAAGGPTSAPIYASIDDNPSYE
QYKNQIVPYLRSWESVIGHQRTGVYANSKTIDWAVNDGLGSYFWQHNWGS
PKGYTHPAAHLHQVEIDKRKVGGVGVDVNQILKPQFGQWA
433635603YP_007269230.1 Holo-[acyl-carrier-protein] synthase [Mycobacterium canettii CIPT 1MGIVGVGIDLVSIPDFAEQVDQPGTVFAETFTPGERRDASDKSSSAARHL
AARWAAKEAVIKAWSGSRFAQRPVLPEDIHRDIEVVTDMWGRPRVRLTGA
IAEYLADVTIHVSLTHEGDTAAAVAILEAP
433635601YP_007269228.1 Thiol peroxidase- thioredoxin-dependent [Mycobacterium canettii CIPMTNTSRLALGDKAPAFTLPDADGNKVSLADYRGRRVIVYFYPAASTPGCT
KQACDFRDNLRDLNDAGLDVIGISPDKPDKLAKFRDAQGLTFPLLSDPDR
EVLTAWGAYGEKQMYGKTVQGVIRSTFVVDEDGKIVVAQYNVKATGHVAK
LRRDLSV
433635599YP_007269226.1 Conserved lipoprotein of unknown function- lipoprotein LppS [MycobaMPQVGIAAQAGRTRVRRAWLTALMMTAVMIGAVACGSGRGPAPIKVIADK
GTPFADLLVPKLTASVTDGAVGVTVDAPVSVTAADGVLAAVTMVNDNGRP
VAGRLSPDGLRWSTTEQLGYNRRYTLNATALGLGGAATRQLTFQTSSPAH
LTMPYVMPGDGEVVGVGEPVAIRFDENIADRVAAEKAIKITTNPPVEGAF
YWLNNREVRWRPEHFWKPGTAVDVAVNTYGVDLGEGMFGEDNVQTHFTIG
DEVIATADDNTKILTVRVNGEVVKSMPTSMGKDSTPTANGIYIVGSRYKH
IIMDSSTYGVPVNSPNGYRTDVDWATQISYSGVFVHSAPWSVGAQGHTNT
SHGCLNVSPSNAQWFYDHVKRGDIVEVVNTVGGTLPGIDGLGDWNIPWDQ
WRAGNAKA
433635597YP_007269224.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MTADWVVTFTFDADPSMETMDAWETQLEGFDALVSRVPGHGIDVTVYAPG
DWSVFDALAKMAGEVMPVVQAKSPIAVQIISEPEHRLRAEAFTTPELMSA
AEIADELGVSRQRVHQLRSTAGFPAPLADLRGGAVWDAAAVRRFAETWER
KPGRPHTGTAKFAYSWAVGPAVGRSGKAPNVRWRVENPDKIRFVLRNIGD
DIAEDVEVDLSRIDAITRNLPKKAVIRPGEGLNMVLIAAWGHPLPNQLYV
RWAGQDEWAAVPLYPAH
433635595YP_007269222.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MFRSLWGRVEDAISAGQIRSVDEVQHELARRDDDAKRWADGQTGLFCPLD
EQIQQAVRHILRLYPNMVRQGGRRSAADPFVIALAMVNNGTVVTQETATG
NIEKPRIPDVCDALGVPWLTLMGYIEAQGWTF
433635593YP_007269220.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MSASASADKVVCECGELCVPKQLASAIRNPYGLVRGWRCRICNEHQGQPV
KMAQDHEEEVRIRWGETVDELHAALDRADDYKAKMLAAFRSRDAVLREFE
KLGRYHQSAGHGCLCGKRNCATLSIIDSNYIYGHIDRMNRRDELG
433635591YP_007269218.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MGTESAAGGPGGPAQRIAAGYAVEGQALQLGTVVVDGEPHPSAQIRIPLA
TVNRHGLVAGATGTGKTKTLQLIAEQLSAAGVAVLMADVKGDLSGLARPG
EAADKTAARAKDTGDDWVPTAFPVEFLSLGASGVGVPVRATISSFGPILL
AKVLGLNATQESTLGLIFHWADQRGLPLLDLKDLRAVITHLTSDEGKAEL
KSLGAVSPTTAGVILRALVNLEAEGADTFFGEPELRPTDLLRVDSQGRGI
ISLLEFGSQALRPVLFSTFLMWVLADLFTFLPEVGDLDKPKLVFFFDEAH
LLFTDASKAFLEQVEQTVKLIRSKGVGVFFCTQLPTDLPNDVLSQLGARI
QHALRAFTPDDHKALRKTVRTYPKTDVYDLESALTSLGTGEAVVTVLSEK
GAPTPVAWTRMRAPRSLMAAIGAEAIGAAAQASSLQAVYGQTIDRPSAHE
MLSATLAQESPRTQAPAPRGQYDPLPWPDGIELPPMPAPVEPQGPAVWEE
ILKNPTVKSVLNTTAREITRSIFGTGRRRRK
433635589YP_007269216.1 Conserved membrane protein of unknown function- leucine and alanineMNNPGSRTGTLLHFRVVAWAMWDCGSTGLNAIVTTFVFSVYLTSAVGQGL
PGGTSPASWLGRAGAVAGLTIGVLAPVVGVWVESPHRRRVALSVLTGTAV
ALTCAMFLIRDDPRYLWAGLVLLAATAASSDLSSVPYNAMLRQLSTPSTA
GRISGFGWASGYVGSVALLLVIYLGFMSGSGSQRGLLQLPVANGLNVRMA
MLVAAAWLALLGLPLLLVAHRLPDSGAASHPSTGLLGGYRKLWTEISAEW
RRDRNLVYFLVASAIFRDGLAAIFAFGAVLGVNAYGLTQADVLIFGAAAS
VVAAVGAVLGGFVDHRIGSKPVIVGSLAAIIAAALTLLTLSGPTAFWACG
LLLCVFIGPAQSSARALLLHMAQHGKEGVAFGLYTMTGRAVSFLGPWLFS
VFVDVFHAVRAGLGGVCLVLTTGLLLMLRVQVSRHGGALTTAQSS
433635587YP_007269214.1 Putative transcriptional regulatory protein (probably TetR-family) MTASAPDGRPGQPEATNRRSQLKSDRRFQLLAAAERLFAERGFLAVRLED
IGAAAGVSGPAIYRHFPNKESLLVELLVGVSARLLAGARDVTTRSANLAA
ALDGLIEFHLDFALGEADLIRIQDRDLAHLPAVAERQVRKAQRQYVEVWV
GVLRELNPGLAEADARLMAHAVFGLLNSTPHSMKAADSKPARTVRARAVL
RAMTVAALSAADRCL
433635585YP_007269212.1 Putative succinyl-CoA:3-ketoacid-coenzyme A transferase (alpha subuMDKVVATAAEAVADIANGSSLAVGGFGLCGIPEALIAALVDSGVTDLETV
SNNCGIDGVGLGLLLQHKRIRRTVSSYVGENKEFARQFLAGELEVELTPQ
GTLAERLRAGGMGIPAFYTPAGVGTQVADGGLPWRYDASGGVAVVSPAKE
TREFDGVTYVLERGIRTDFALVHAWQGDRHGNLMYRHAAANFNPECASAG
RITIAEVEHLVEPGEIDPVTVHTPGVFVHRVVHVPNPAKKIERETVRQ
433635583YP_007269210.1 Putative acetyl-/propionyl-CoA carboxylase (beta subunit) AccD1 [MyMTTPSIAIAPSFADEHRRLVAELNNKLAAAALGGNERARERHVSRGKLLP
RERVDRLLDPGSPFLELAPLAAGGMYGDESPGAGIITGIGRVSGRQCVIV
ANDATVKGGTYYPMTVKKHLRAQEVALQNLLPCIYLVDSGGAFLPRQDEV
FPDREHFGRIFYNQATMSAKGIPQVAAVLGSCTAGGAYVPAMSDEAVIVR
KQGTIFLGGPPLVKAATGEIVSAEELGGGDLHSRTSGVTDHLADDDEDAL
RIVRAIADTFGPCEPAQWDVGRSVEPKYPQAELYDVVPPDPRVPYDVHEV
VVRIVDGGEFSEFKAKYGKTLVTAFARIHGHPVGIVANNGVLFSESALKG
AHFIELCDKRKIPLLFLQNIAGFMVGRDYEAGGIAKHGAKMVTAVACARV
PKLTVVIGGSYGAGNYSMCGRAYSPRFLWMWPNARISVMGGEQAASVLAT
VRGEQLTAAGTPWSPDEEEAFKAPIRAQYEDQGNPYYSTARLWDDGIIDP
ADTRTVVGLALSLCAHAPLDQVGYGVFRM
433635581YP_007269208.1 Putative acyl-CoA dehydrogenase FadE19 (MMGC) [Mycobacterium canettMADFARTVVAPVSAKHDAEHSFPYEIVAKMGEMGLFGLPFPEEYGGMGGD
YFALSLVLEELGKVDQSVAITLEAAVGLGAMPIYRFGTEEQKQKWLPDLT
SGRALAGFGLTEPGAGSDAGSTRTTARLEGDEWIINGSKQFITNSGTDIT
SLVTVTAVTGTTGTAADAKKEISTIIVPSGTPGFTVEPVYNKVGWNASDT
HPLTFADARVPRENLLGARGSGYANFLSILDEGRIAIAALATGAAQGCVD
ESVKYANQRQSFGQPIGAYQAIGFKIARMEARAHVARTAYYDAAAKMLAG
KPFKKEAAIAKMISSEAAMDNSRDATQIHGGYGFMNEYPVARHYRDSKVL
EIGEGTTEVQLMLIARSLGLQ
433635579YP_007269206.1 Putative citrate (pro-3S)-lyase (beta subunit) CitE (citrase) (citrMNLRAAGPGWLFCPADRPERFAKAAAAADVVILDLEDGVAEAQKPAARNA
LRDTPLDPERTVVRINAGGTADQARDLEALAGTAYTTVMLPKAESAAQVI
ELAPCDVIALVETARGAVCAAEIAAADPTVGMMWGAEDLIATLGGSSSRR
ADGAYRDVARHVRSTILLAASAFGRLALDAVHLDILDVEGLQEEARDAAA
VGFDVTVCIHPSQIPVVRKAYRPSHEKLAWARRVLAASRNERGAFAFEGQ
MVDSPVLTHAETMLRRAGEATSE
433635577YP_007269204.1 Putative pyruvate dehydrogenase E1 component (beta subunit) PdhB (pMTQIADRPARPDETLAVAVSDITQSLTMVQAINRALHDAMAADERVLVFG
EDVAVEGGVFRVTEGLADTFGADRCFDTPLAESAIIGIAVGLALRGFVPV
PEIQFDGFSYPAFDQVVSHLAKYRTRTRGEVDMPVTVRIPSFGGIGAAEH
HSDSTESYWVHTAGLKVVVPSTPSDAYWLLRHAIACPDPVMYLEPKRRYH
GRGMVDTSRPEPPIGHAMVRRSGTDVTVVTYGNLVSTALSSADTAEQQHD
WSLEVIDLRSLAPLDFDTIAASIQRTGRCVVMHEGPRSLGYGAGLAARIQ
EEMFYQLEAPVLRACGFDTPYPPARLEKLWLPGPDRLLDCVERVLRQP
433635575YP_007269202.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MALLDVNALVALAWDSHIHHARIREWFTANATLGWATCPVTEAGFVRVST
NPKVLPSAIGIADARRVLAALRAVGGHRFLADDVSLVDDDVPLIVGYRQV
TDAHLLTLARRRGVRLVTFDAGVFTLAQQRPTTQVELLTIL
433635573YP_007269200.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MSRRIINEFGVQIYGATIGDTWAGLVRAVLDLGSQCLDEDRERIALSNVR
IKSSVQNYPDITIEEHCNSDQLKAMLDFMFNTDIMEDVDVVKSFSRGAKS
YHRRIKEGRMMEFVIERLSLIPESKKAVVVFPTYEDYAAVMRNHRDDYLP
CLVSIQFRLLPDGNDYVFHTTFYSRSMDAWQKGHGNLLSIAKLSDWVREN
VSARIGRKIMLGPLDGMICDVHIYKETYAEAYKRLANLDLRRTQFDVVRN
433635571YP_007269198.1 Conserved protein of unknown function- PE-PGRS family protein PE_PGMSYVIATPEMMATTALDLARIGSTINAANAAAATPTAAVVAAGADEVSAG
IAALFSAHAQEYQALSAQAAAFHDQLVHTLTAAASWYTATEIANAAAMRA
VLGAVNAPTQTLLGRPLIGDGAHGTAPGQPGGAGGLLFGNGGNGAAGAVG
QVGGAGGAAGLFGIGGAGGAGGAGAPGGTGGTGGWLAGGGGIGGMGGAGG
GAGGAGGNAGLFGNGGAGGVGGAGGGAGGTGGNAGWFGHGGAGGVGGVGA
AGANGATPGQDGAAGVAGVHDGAGGNGLAGSDGGDGGAGGVGGDGGRGGW
LLGNGGAGGVGGVGGAGGAGAAGGDGGDGATGINGPAGISAAGGDGGAGG
NGGAGGNGGVGGAGGAGGSAGLLGHVGPAGDGGAGGGGGLGGAPGDGGAG
GNGGSWLTAGDGGAGGRGGDPGLGGAGGAGGASGGAGARAGSNGLAASND
GPGSGGNGGKGGNGAHAPVAGAHGGNGGPGGNGGLVGDGGAGGHGGDGAA
GAGYADMTAIFPGSSGTPGEDGGNGGAGGAGGAGGAHAGDGGAGGAGGNG
GAGGAGGNGAHGLNAVLVSDGGNGGDGGAGGRGGDGGAGGAGGDAPAGRA
GSQGAGGDGGAGGVGGAPGNGGSGGRGDMAFNDGDGGAGGDGGDPGAGGK
GGAGGAGATEGVTGATGATVHSGGNGGKGGNGADATVAGANGGKGGAGGN
GGLVGDGGAGGDGGSGAAGANGANVGEDGADGTLSGQPGEGSEANSGQGG
VGGGGAGGAGGDGGAGSSALGSGGNGGRGDAGQAGGAGGAGGAGGAGGSV
SGDGGPGGKGGAGGAGGAGASGGGGGKGASGADSAEAVGGAGGKGGDGGD
GGVGGDGGPGGDGGAGGAAPAGQVGSHGVGGVGGDGGLGGAGGSGGDGGH
GSDGGDGGDGGDPGAGGLGGLGGDSGNGARAASGVDASDHGPGSGGNGGN
GGNGAQASVAGGAGGNGGDGGNAGRVGDGGAGGNGGDGAAGANGANSGAP
GSDALALGQPGGNGGQGDAGQAGGVGGAGGAGGAGGSVSGDGGPGGNGGA
GGNGGVGASGGAGARGANGIDSIGGTGGAGGDGGDGGAGGGGGLGGDGGS
GGAAPSGKVGSHGTGGVGGDGGLGGAGGVGGAGGNGGLGITVGGDGGAGG
NGGDPGAGGLGGLGGDSGNGTSAANGVDASNYGPLTGGDGGAGGSGAKAA
AAGGDGGTGGDGGNAGLFGDGGAGGDGADGTAAEVLGGDGGSGGAGGKGG
DAGDIGDGGTGGKGGDGAHGALGGLTVAGGNGGSGGAGGAGGAGGAFLGD
GGNGGAGGQGGAGRGGSPGGGGGVGGHGGAGGDAGMNGGGGTGGQGGNGA
AGGAGWSPDSDLKGFDGFDGGSGGAGGDGGAGGAGGTQTGDGGDGGAGGL
GGAGGVGGNAVDGFDINETTGRDGGDGGDGGYGGWGGAGGNGGAGGSAPA
GEVGNRGVGGAGGDGGSGGDAGNGGLGGDGFTYLADFDGEPGGDGGDGGD
GGWGRPGGQGGFGSTNGAHGKAGFGAPGGDGGDGGNGGHGGDGNGSFADA
GDGGPGGNGGNGGLGGAGRDGGAPGGDGGDGGTGGSGGFGAPPPRSVGGG
DGGDGGRGGDGGRGAGGLTSGGVGSSGESGGSGNGRGDPGSGGSGGEGGE
GGPSISVNVT
433635569YP_007269196.1 Conserved protein of unknown function- PE-PGRS family protein [MycoMSLVIATPQLLAAAAVDLASIGSQLSAAHAAAALPTTEVVAAAADEVSAA
IAGVFGAHAREYQALSGQVAVFHERFVQALTAAAGWYAGTEAAAERSLLG
AVNAPTEALLGRPLIGNGADGTAPGQPGAAGGLLFGNGGNGAAGGFGQAG
GTGGAAGLIGNGGNGGAGGTGAAGGAGGNGGWLYGHGGNGGDGGTSVAGG
IGGAGGNGGNAGLFGNGGAGGIGGAGRAGISGVNPTPGPAASTGTSPADV
SGNGDQTGGDGGTGGHGTAATPTGGTGGDGATATADSGKATGGAGGDGGT
AAFGGGGGNGGNGGNAGGNFVSAIGGDGGNGSDGVAAGSGGGSGGAGGGA
FVHIATATSTGGSGGFGGNGAASAASGADGGAGGPGGHGGAGGLLFGDGG
NGGAGGAGGNGGDGATGGPGGSGGNAGIARFDSPDPEAEPDVVGGKGGDG
GKGGSGLGVGGAGGAGGAGGNGGAGGLLFGNGGNGGNAGAGGDGGAGVAG
GVGGNGGGGGTATFHEDPVAGVWAVGGVGGDGGSGGSSLGVGGVGGAGGV
GGKGGASGMLIGNGGNGGSGGVGGAGGVGGAGGDGGNGGSGGNASTFGDE
NSIGGAGGTGGNGGNGANGGNGGAGGIAGGAGGSRGFLSGAAGVSGADGI
GGAGGAGGAGGAGGSGGEAGAGGLTNGPGSPGVSGTEGMAGAPG
433635567YP_007269194.1 Putative carboxylesterase LipQ [Mycobacterium canettii CIPT 1400700MHIASVTSRCSRAGAEALRQGAQLAADARDTCRAGALLLRGSPCAIGWVA
GWLSAEFPARVVTGHALSRISPRSIGRFGTSWAAQRADQILHAALVDAFG
PDFRDLVWHPTGEQSEAARRSGLLHLPHIPGPHRRYAAQTSDIPYGPGGR
ENLLDIWRRPDLAPGRRAPVLIQVPGGAWTINGKRPQAYPLMSRMVELGW
ICVSINYSKSPRCTWPAHIVDVKRAIAWVRENIADYGGDPDFITMTGGSA
GAHLAALAALSANDPALQPGFESADTAVQAAAPYYGVYDLTNAENMHEMM
MPFLEHFVMRSRYVDNPGLFKAASPISYVHSEAPPFFVLHGEKDPMVPSA
QSRAFSAALRDAGAATVSYAELPNAHHAFDLAATVRSRMVAEAVSDFLGV
IYGRRMGARKGSLALSSPPAS
433635565YP_007269192.1 Putative transmembrane phospholipid biosynthesis bifunctional enzymMSAADEQGEERATRKSAPDLRLPGSVAEILASPAGPKVGAFFDLDGTLVA
GFTAVILTQERLRRRDMGVGELLGMVQAGLNHTLGRIEFEDLIGKAAAAL
AGRLLTDLEEIGERLFAQRIESRIYPEMRELVRAHVARGHTVVLSSSALT
IQVGPVARFLGINNMLTNKFETNEDGILTGGVLKPILWGPGKATAVQRFA
AEHDIDLKDSYFYADGDEDVALMYLVGNPRPTNPEGKMAAVAKRRGWPIL
KFNSRGGVGIRRQLRTLAGLSTIVPVAAGAVGIGVLTGSRRRGVNFFTST
FSQLLLATSGVHLNVIGKENLTAQRPAVFIFNHRNQVDPVIAGALVRDNW
VGVGKKELASDPIMGTLGKLLDGVFIDRDDPVAAVETLHTVEERARNGLS
IVIAPEGTRLDTTEVGSFKKGPFRIAMAAKIPIVPIVIRNAEIVASRNST
TINPGTVDVAVFPPIPVDDWTLDALPDRIAEVRQLYLDTLADWPVDGLPA
VDLYAEQKAARKARAQVAKATAKRVPAKKAPAKSAANKGAAATKAATKKA
SPKAKPSESKIAGKDGEASASPSSSAKGRS
433635563YP_007269190.1 Conserved exported protein of unknown function [Mycobacterium canetMKTRNPRTLLTWLLGAIVTGLYVVFATGCQLQAPAPPTPEIGWSGPQAPL
PAPDAAPTHLGV
433635561YP_007269188.1 Putative macrolide-transport ATP-binding protein ABC transporter [MMAEFIYTMKKVRKAHGDKVILDDVTLSFYPGAKIGVVGPNGAGKSSVLRI
MAGLDKPNNGDAFLATGATVGILQQEPPLNEDKTVRGNVEEGMGDIKIKL
DRFNEVAELMATDYTDELMEEMGRLQEELDHADAWDLDAQLEQAMDALRC
PPADEPVTNLSGGERRRVALCKLLLSKPDLLLLDEPTNHLDAESVQWLEQ
HLASYPGAILAVTHDRYFLDNVAEWILELDRGRAYPYEGNYSTYLEKKAE
RLAVQGRKDAKLQKRLTEELAWVRSGAKARQAKSKARLQRYEEMAAEAEK
TRKLDFEEIQIPVGPRLGNVVVEVDHLDKGYDGRTLIKDLSFSLPRNGIV
GVIGPNGVGKTTLFKTIVGLEAPDSGSVKVGETVKLSYVDQARAGIDPRK
TVWEVVSDGLDYIQVGQTEVPSRAYVSAFGFKGPDQQKPAGVLSGGERNR
LNLALTLKQGGNLILLDEPTNDLDVETLGSLENALLNFPGCAVVISHDRW
FLDRTCTHILAWEGDDDNEAKWFWFEGNFGAYEENKVERLGVEAARPHRV
THRKLTRD
433635559YP_007269186.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MSVGFVTPVGVRWSDIDMYQHVNHATMVTILEEARVPFLKDAFGADITST
GLLIADVRVTYKGQLRLSDSPLQVTIWTKRLRAVDFTLGYEVRSANAEPD
SRPAVIAESQLAAFHIEEQRLVRLSPHHREYLQRWFRG
433635557YP_007269184.1 Conserved membrane protein of unknown function- alanine and prolineMPDTPFAEPYPEQRPPWGVPPPGWDGPSRPAPSTTPRSPGRWSLVAALAL
AVVSLGVGIVGWFHPQPHDKPSPAPSAPTFTSQQISDAKENVCAAHRIVR
QAAVLNTNQANPVPGDPTGDLAVAANARLALYSGGDYLLRRLTAEPATPA
ELRDAVRSLANALQELAVNYLAGAPDSVVTALRLALERDTRAVDPLCV
433635555YP_007269182.1 Putative alpha-glucosidase AglA (maltase) (glucoinvertase) (glucosiMDQHQRPDPMGEPWWSRAVFYQVYPRSFADNNGDGVGDLDGLASRLDHLQ
QLGVDAIWINPVTVSPMADHGYDVADPRDIDPLFGGMPAFERLVAAAHRR
GIKVTMDVVPNHTSSAHPWFQAALADLPGSPARDRYFFRDGRGPYGSLPP
NNWESVFGGPAWTRVREPDGNPGQWYLHLFDTEQPDLNWDNPEILDDFEK
TLRFWLEHGVDGFRIDVAHGMAKPPGLPDSPDLGIEVLHHRDDDPRFNHP
NVHAIHRDIRTVIDEYPGAVTVGEVWVHDNARWAEYLRPDELHLGFNFRL
ARTEFNAAAIRDAVANSLAAAALQNATPTWTLANHDVGREVSRYGGGEIG
LRRAKAMAMVMLALPGVVFLYNGQELGLPDVQLPDEVLQDPTWERSGRTE
RGRDGCRVPIPWSGNIPPFGFSTCPDTWLPMPPEWAALTAEKQRADAGST
LSFFRLALRLRRERSEFDGDVEWLAAPDDALIFRRHGGGLVCALNAAGRP
LALPAGEPILASAPLTDATLPPNAAAWLV
433635553YP_007269180.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MAHGKKRRGHRSSGVAAGVTGPASCLHSVHSHRLASGVETHPPNRHESAS
IWNRRRVLLLNSTYEPLTALSMRRAIVMVICGKADVVHEDPSGPVIHSAT
RSILVPSVIQLRSYVRVPYRARVPMTRAALMHRDRFCCAYCGGKADTVDH
VVPRSRGGAHSWENCVACCSPCNHRKGDRLLTELGWALRRAPLPPTGPHW
RLLSAVKELDPSWARYLGEGAA
433635551YP_007269178.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MTHRSSRLEVGPVARGDVATIEHAELPPGWVLTTSGRISGVTEPGELSVH
YPFPIADLVALDDALTYGSRACQVRFAIYLGDLGRDTAARAREILGKVPT
PDNAVLLAVSPNQCAIEVVYGSQVRGRGAESAAPLGVAAASSAFEQGELV
DGLISAIRVLSAGIAPG
433635549YP_007269176.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MLEKAPQKSVADFWFDPLCPWCWITSRWILEVAKVRDIEVNFHVMSLAIL
NENRDDLPEQYREGMARAWGPVRVAIAAEQAHGAKVLDPLYTAMGNRIHN
QGNHELGEVITQSLADAGLPAELAKAATSDAYDDALRKSHHAGMDAVGED
VGTPTIHVNGVAFFGPVLSKIPRGEEAGKLWDASVTFASYPHFFELKRTR
TEPPQFD
433635547YP_007269174.1 Putative DNA glycosylase [Mycobacterium canettii CIPT 140070017]MPEGHTLHRLARLHQRRFGGAPVSVSSPQGRFAASASALNGRVLRRASAW
GKHLFHHYAGCPVVHVHLGLYGTFTEWARPADGLLPEPAGKVRMRMVGAE
FGTDLRGPTVCEAIDDGQVADVVARLGPDPLRSDANPLLAWSRITKSRRP
IGALLMDQTVIAGVGNVYRSELLFRHRIDPYRHGHGIGEPEFDAAWHDLV
SLMRVGLRRGKIIVVRPEHDHGPPSYLPDRPRTYVYRRAGQPCRVCGEVI
RTALLEGRNVFWCPACQT
433635545YP_007269172.1 Trigger factor [Mycobacterium canettii CIPT 140070017]MKSTVEQLSPTRVRINVEVPFAELEPDFQRAYKELAKQVRLPGFRPGKAP
AKLLEARIGREAMLDQIVNDALPSRYGQAVAESDVQPLGRPNIEVTKKEY
GQDLQFTAEVDIRPKISLPDLSALTVSVDPVEVGEDDVDAELQSLRTRFG
TLTAVDRPVAVGDVVSIDLSATVDGEDIPNAAAEGLSHEVGSGRLIAGLD
DAVVGLSADESRVFTAKLAAGEHAGQQAQVTVTVRSVKERELPEPDDEFA
QLASEFDSIDELRASLNDQVRQAKRAQQAEQIRNATIDALLEQVDVPLPE
SYVQAQFDSVLHSALSGLNHDEARFNELLVEQGSSRAAFDAEARTASEKD
VKRQLLLDALADELQVQVGQDDLTERLVTTSRQYGIEPQQLFGYLQERNQ
LPTMFADVRRELAIRAAVEAATVTDSDGNTIDTSEFFGKRVSAGEAEQAE
PADEGAPRAASDEATT
433635543YP_007269170.1 Proteolytic subunit of ClpA-ClpP and ClpX-ClpP ATP-dependent serineMNSQNSQIQPQARYILPSFIEHSSFGVKESNPYNKLFEERIIFLGVQVDD
ASANDIMAQLLVLESLDPDRDITMYINSPGGGFTSLMAIYDTMQYVRADI
QTVCLGQAASAAAVLLAAGTPGKRMALPNARVLIHQPSLSGVIQGQFSDL
EIQAAEIERMRTLMETTLARHTGKDAGVIRKDTDRDKILTAEEAKDYGII
DTVLEYRKLSAQTA
433635541YP_007269168.1 Homocysteine S-methyltransferase MmuM (S-methylmethionine:homocysteMELVSDSVLISDGGLATELEARGHDLSDPLWSARLLVDAPHAITAVHTAY
FRAGAQIATTASYQASFEGFAARGIGHDDATVLLRRSVELARAARDEVGV
GGLSVAASVGPYGAALADGSEYRGRYGLSVAALMRWHLPRLEVLVDAGAD
VLALETIPDIDEAEALVNLVRRLATPAWLSYTINGTRTRAGQPLTDAFAV
AAGVPEIVAVGVNCCAPDDVLPAIAFAVAHTGKPVIVYPNSGEGWDGRRR
AWVGPRRFSGSSGQLAREWVAAGARIVGGCCRVRPVDIAEIGRALTTAPP
RG
433635539YP_007269166.1 Conserved membrane protein of unknown function- possible transporteMSGTVVAVPPRVARALDLLNFSLADVRDGLGPYLSIYLLLIHDWDQASIG
FVMAVGGIAAIVAQTPIGALVDRTTAKRALVVAGAVLVTAAAVAMPLFAG
LYSISVLQVVTGIASSVFAPALAAITLGAVGPQFFARRIGRNEAFNHAGN
ASAAGATGALAYFFGPVVVFWVLAGMALISVLATLRIPPDAVDHDLARGM
DHAPGEPHPQPSRFTVLAHNRELVIFGAAVVAFHFANAAMLPLVGELLAL
HNRDEGTALMSSCIVAAQVVMVPVAYVVGTKADAWGRKPIFLVGFAVLTA
RGFLYTLSDNSYWLVGVQLLDGIGAGIFGALFPLVVQDVTHGTGHFNISL
GAVTTATGIGAALSNLVAGWIVVVAGYDAAFMSLGALAGAGFLLYLVAMP
ETVDSDVRVRSRPTLGGK
433635537YP_007269164.1 Putative oxidoreductase (beta subunit) [Mycobacterium canettii CIPTMTRSGDEAQLMTGVTGDLAGTELGLTPSLTKNAGVPTTDQPQKGKDFTSD
QEVRWCPGCGDYVILNTIRNFLPELGLRRENIVFISGIGCSSRFPYYLET
YGFHSIHGRAPAIATGLALAREDLSVWVVTGDGDALSIGGNHLIHALRRN
INVTILLFNNRIYGLTKGQYSPTSEVGKVTKSTPMGSLDHPFNPVSLALG
AEATFVGRALDSDRNGLTEVLRAAAQHRGAALVEILQDCPIFNDGSFDAL
RKEGAEERVIKVRHGEPIVFGANGEYCVVKSGFGLEVAKTADVAIDEIIV
HDAQVDDPAYAFALSRLSDQNLDHTVLGIFRHISRPTYDDAARSQVVAAR
NAAPSGTAALQSLLHGRDTWTVD
433635535YP_007269162.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MHDATGGAGFVRPDLTAFCRLDELGVEVTGQYLDSDRAVLACRITDEDRW
CRRCGEQGQVRDTVTRRLAHEPFGWRPTTLVLTVRRYRCAGCAHVWRQDS
SAAAEPRAKLSRHGLRWALEAVVCQHLTMARVAEGLGVSWNTANDAVLAE
GKRVLIDDAGRFDEVTVIGVDEHVWRHTRRGDKYVTVIIDLTGIREGTGP
ARLLDMVEGRSKQAFKTWLAEREESWRQAVEVVAMDGFTGFKTATSEELP
DAVAVMDPFHVVRLGGEALDKCRRRVQLDTCGHRGRKTDPLYAARRTLQT
GADLLTDKQKDRPTKLFAVDTHIEVETTWGIYQRMISAYRHPDRRRGREL
MSTLIESISDAVPAALTQVITLGRTLKKRAADVLAYFDRPGTSNGPTEAI
NGRLEHLRGSALGFRNLTHYIARSLLEAGGFKPRLHPRS
433635533YP_007269160.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MAFRDILVLFSMKTLLTLAMATASSTALTTVGVSGARLITYCVGMEDI
433635531YP_007269158.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MTATPREFDIVLYGATGFVGKLTAEYLARAGGDARIALAGRSTQRVLAVR
EALGESAQTWPILTADASLPSTLQAMAARAQVVLTTVGPYTRYGLPLVAA
CAAAGTDYADLTGEPMFMRNSIDWYHKQAADTGARIVHACGFDSVPSDLS
VYALYHAAREDGAGELTDTNCVVRSFRGGFSGGTIASMLEVLSTASNDPD
ARRQLSDPYTLSPDRGAEPELGPQPDLPSRRGRRLAPELAGVWTAGFIMA
PTNTRIVRRSNALLAWAYGRRFRYSEAMSVGSTVLAPVVSVVGGGVGNAM
FGLASRYIRLLPRGLVKRVVPKPGTGPSAAARERGYYRIETYTTTTAGAR
YLARMAQDGDPGYQATSVLLGECGLALALDRDKLSDMRGVLTPAAAMGDA
LLERLPAAGVSLQTTRLAS
433635529YP_007269156.1 Putative folylpolyglutamate synthase protein FolC (folylpoly-gamma-MNSTSSGPPDSGSATGAVPTPDEIASLLQVEHLLDQRWPETRIDPSLTRI
SALMDLLGSPQRSYPSIHIAGTNGKTSVARMVDALVTALHRRTGRTTSPH
LQSPVERISIDGKPISPAQYVATYREIEPLVQLIDQQSQASAGKAGPAMS
KFEVLTAMAFAAFADAPVDVAVVEVGMGGRWDATNVINAPVAVITPISID
HVDYLGADIAGIAGEKAGIITRAPDGSPDTVAVIGRQVPKVMEVLLAESV
RADASVAREDSEFAVLRRQIAVGGQVLQLQGLGGVYSDIYLPLHGEHQAH
NAVLALASVEAFFGAGAQRQLDNDAVRAGFAAVTSPGRLERMRSAPTVFI
DAAHNPAGASALAQTLAHEFDFRFLVGVLSVLGDKDVDGILAALEPVFDS
VVVTHNGSPRALDVEALALAAGERFGPDRVRTAENLRDAIDVATALVDDA
AAADRKALSGTGIVITGSVVTAGAARTLFGREPQ
433635527YP_007269154.1 Putative nucleoside diphosphate kinase NdkA (NDK) (NDP kinase) (nucMTERTLVLIKPDGIERQLIGEIISRIERKGLTIAALQLRTVSAELASQHY
AEHEGKPFFGSLLEFITSGPVVAAIVEGTRAIAAVRQLTGGTDPVQTAAP
GTIRGDFGLETQFNLVHGSDSAESAQREIALWFPGA
433635525YP_007269152.1 C4-dicarboxylic acid- orotate and citrate transporter [MycobacteriuMTAPLDRPPVTDLPANNKGRDRTHWLYLAVIFAVIAGVIVGLTAPSTGKS
LTVLGTVFVNLIKMMIAPVIFCTIVLGIGSVRKAAAVGKVGGLALAYFLT
MSSVALGIGLIVGNLLSPGRDLHLRPGAVGSGAALAGQAAESHGIAGFIQ
QIIPRSLPSALTEGNVLQVLLVALLVGFAVQGLGPAGESILRAVENLQKL
VFKVLVMVLWLAPIGAFGAIANIVATTGFNAVTNLLLLMAGFYLTCVVFV
FGVLGVLLRIVSGLSIFRLLRYLAREYLLIFATSSSEVVLPRLITKMKHL
GVQSSTVGVVVPTGYSFNLDGTAIYLTMASLFIADAMGHRLTWGEQIALL
AFMIIASKGAAGVSGAGLATLAGGLQAHRPELLDGVGLIVGIDRFMSEAR
SLTNFSGNAVATILVASWTKTIDLSKADEVLRGRDPFDESTMVDPHDEQP
PAATPHGGGVPTSPALCDFEQVSLGGLVGRPAGPQRADVDG
433635523YP_007269150.1 Putative 50s ribosomal protein L27 RpmA [Mycobacterium canettii CIPMAHKKGASSSRNGRDSAAQRLGVKRYGGQVVKAGEILVRQRGTKFHPGVN
VGRGGDDTLFAKTAGAVEFGIKRGRKTVSIVGSTTA
433635521YP_007269148.1 Glutamate 5-kinase [Mycobacterium canettii CIPT 140070017]MRSPHRDAIRTARGLVVKVGTTALTTPSGMFDAGRLAGLAEAIERRMKAG
SDVVIVSSGAIAAGIEPLGLSRRPKDLATKQAAASVGQVALVNSWSAAFA
RYGRTVGQVLLTAHDISMRVQHTNAQRTLDRLRALHAVAIVNENDTVATN
EIRFGDNDRLSALVAHLVGADALVLLSDIDGLYDSDPRKTADATFIPEVS
GPADLDGVVAGRSSHLGTGGMASKVSAALLAADAGVPVLLAPAADAATAL
ADASVGTVFAARPARMSARRFWVRYAAEATGALTLDTGAVRAVVRQRRSL
LAAGITAVSGRFYGGDVVELRAPDAAMVARGVVAYDASELATMVGRSTSE
LPGELRRPVVHADDLVAVSAKQAKQV
433635519YP_007269146.1 Conserved membrane protein of unknown function [Mycobacterium canetMLQRTNVVQPLNTLRMVWIQVAGIILATAGIAATVYAQLAMGDSWRIGVD
EQENTTLVRTGPFKWVRNPIYTAMIAFGLGLLLVTPNLVALAGFTLLVAT
LEVHVRRVEEPYLLRTHGAAYRSYTASVGRFVPGVGLIR
433635517YP_007269144.1 Putative cyclase (adenylyl-or guanylyl-) (adenylate-or guanylate-) MTSGEALDSVAEGESTPARKRHKNVLRRRPHFRASIQSKLMVLLLLTSIV
SVAAIAAIVYQSGRTSLRAAAYERLTQLRESQKRAVETLFSDLTNSLVIY
ERGLTVVDAVVRFTAGFDQLADATISPAQQQAIVNYYNNEFITPVERTTG
DKLDITALLPTSPAQRYLQAYYTAPFTSDQDAMRLDDAGDGSAWSAANAQ
FNSYFREIVTRFDYDDAVLLDTRGNIVYTLSKDPDLGTNILTGPYRESNL
RDAYLKALGANAVDFTWITDFKPYQPQLGVPTAWLVAPVEAGGKTQGVLA
LPLPIDKINKIMTADRQWQAAGMGSGTETYLAGPDSLMRSDSRLFLQDPE
EYRKQVVAAGTSPDVVNRAIQFGGTTLLQPVATEGLRAAQRGQTGTVTST
DYTGSRELEAYAPLNVPDSDLHWSILATRNDSEAFAAVASFSRALVLVTV
GIIVVICVASMLIAHAMVRPIRRLEVGTQKISAGDYEVNIPVKSRDEIGD
LTAAFNEMSRNLETKEELLNEQRKENDRLLLSMMPEPVVERYRLGEQTIA
QEHQDVTVLFADILGLDEISSGLSGNELVKIVDELVRQFDSAAEHLGVER
IRTLHNGYLASCGVTTPRLDNIPRTVDFAVEMRRIVDRFNCQTGNDLHLR
VGINTGDVISGLVGRSSVVYDMWGAAVSLAYQMHSGSPQPGIYVTSQVYE
AMRDVWQFTAAGTISVGGLEEPIYRLSERS
433635515YP_007269142.1 Conserved membrane protein of unknown function [Mycobacterium canetMGLRDADERWDTVGQAIGLFLRGHTLRTAAPTALIVGTVLCAVNQGATLA
EGAATIGTWVRMVINYLVPFLVASVGYLGARRGIRRASGRSDPSAQ
433635513YP_007269140.1 Conserved protein of unknown function- PPE family protein [MycobactMHFEAYPPEVNSANIYAGPGPDSMLAAARAWRSLDVEMTAVQRSFNRTLL
SLMDAWAGPVVMQLMEAAKPFVRWLTDLCVQLSEVERQIHEIVRAYEWAH
HDMVPLAQIYNNRAERQILIDNNALGQFTAQIADLDQEYDDFWDEDGEVM
RDYRLRVSDALSKLTPWKAPPPIAHSTGLVAPVSPSTASSRTDT
433635511YP_007269138.1 Alkyl hydroperoxide reductase subunit C- AhpC (alkyl hydroperoxidasMPLLTIGDQFPAYQLTALIGGDLSKVDAKQPGDYFTTITSDEHPGKWRVV
FFWPKDFTFVCPTEIAAFGKLNDEFEDRDAQILGVSIDSEFAHFQWRAQH
NDLKTLPFPMLSDIKRELSQAAGVLNADGVADRVTFIVDPNNEIQFVSAT
AGSVGRNVDEVLRVLDALQSDELCACNWRKGDPTLDAGELLKASA
433635509YP_007269136.1 Conserved protein of unknown function- possible LysR/OxyR-like tranMRGTAYATRRSMPPNTRAVWLATVVQCVTGGLGVTLIPQTAAAVETTRSR
LELARFVAPARRDESVWCLALSAAARSPTASCRDYRQADQGRPSSTPDRI
ATTQPDRCAARPERAVLPGQRKPVTLGQ
433635507YP_007269134.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MTVPARPTPLFADIADVSRRLAETGYLPDTATATAVFLADRLGKPLLVEG
PAGVGKTELARAVAQATGSGLVRLQCYEGVDEARALYEWNHAKQILRIQA
GSGDWEATKTDVFSEEFLLQRPLLTAIRRTEPTVLLIDETDKADIEIEGL
LLEVLSDFAVTVPELGTLTATRAPFVLLTSNATRELSEALKRRCLYLHID
FPTPELERRILLSRVPELPEHFAEELVRIIGVLRGMQLKKVPSIAETIDW
GRTVLALGLDTIDDAVVAATLGVVLKHQSDQQRATGELRLN
433635505YP_007269132.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MDNLPIESAESTRLAKAAMTRRFYTRSVVKGEITLPAVPSMIDEYVTMCA
GLFAGVGRTFSDEELAHLRAVLQGQLAEAYAASQRSTIVISYNAPMGPTL
HYQVRAQWRTVAQEYENWIATREPPLFGTEPDARVWALANEAADPTTHRV
LEIGAGTGRNALALARRGHPVDVVEMTPKFADIIRSDAERESLDVRVIMR
DVFSTMDDLRQDYQLMVLSEVVPDFRTTQQLRNLFELAAQCLAPGARLVF
NAFLANGDYAPDQAAREFGQQMYTGMCTRAEMSAAAAGLPLELVADDSVY
DYEKTHLPPGAWPPTSWYADWIRGLDVFTTNVENCPIEMRWLVFRRRR
433635503YP_007269130.1 Putative nicotinate-nucleotide adenylyltransferase NadD (deamido-NAMGGTFDPIHYGHLVAASEVADLFDLDEVVFVPSGQPWQKGRQVSAAEHRY
LMTVIATASNPRFSVSRVDIDRGGPTYTKDTLADLHALHPDSELYFITGA
DALASIMSWQGWEELFELARFVGVSRPGYELRNEHITSLLGQLAKDALTL
VEIPALAISSTDCRQRAEQSRPLWYLMPDGVVQYVSKCRLYCGACDAGAR
STTSLATGNGI
433635501YP_007269128.1 Putative phosphoglycerate mutase (phosphoglyceromutase) [MycobacterMRARRLVMLRHGQTDYNVGSRMQGQLDTELSELGRTQAVAAAEVLGKRQP
LLIVSSDLRRAYDTAVKLGERTGLVVRVDTRLRETHLGDWQGLTHAQIDA
DAPGARLAWREDATWAPHGGESRVDVAARSRPLVAELVASEPEWGGADEP
DRPVVLVAHGGLIAALSAALLKLPVANWPALGGMGNASWTQLSGHWAPGS
DFESIRWRLDVWNASAQVSSDVL
433635499YP_007269126.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MTVVVVTDTSCRLPADLREQWSIRQVPLHILLDGLDLRDGVDEIPDDIHK
RHATTAGATPVELSAAYQRALADSGGDGVVAVHISSALSGTFRAAELTAA
ELGPAVRVIDSRSAAMGVGFAALAAGRAAAAGDELDTVARAAAAAVSRIH
AFVAVARLDNLRRSGRISGAKAWLGTALALKPLLSVDDGKLVLVQRVRTV
SNATAVMIDRVCQLVGDRPAALAVHHVADPAAANDVAAALAERLPACEPA
MVTAMGPVLALHVGAGAVGVCVDVGASPPA
433635497YP_007269124.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MRTELPAERLQRRLGAVPDIDSHAASAHSDPEPHDPTDDGPDHDEPRDDP
NSLLPRWLPDTSRGQGWVDRIRADPGRAGAVALAVIAALAVLVTVFTLIR
DRTEPVMSAKLPPVEPVSPTNPRSSASPGSPDRSGLPVVVSVVGLVHTPG
LVTLAPGARIADALQAAGGAVDGADTVGLNMARQLGDGEQIVVGLAPPSG
QPRVLGSSVGAGTPGPAGTSGTATTGPKTAPKTAEVFDLNTATVEQLDAL
PGIGPVTAAAIVAWRQRNGRFTSVDQLADVDGIGPARLDKLRNLVRV
433635495YP_007269122.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MHLVLGDEELLVERAVADVLRSARQRAGTADVPVSRMRAGDVGAYELAEL
LSPSLFAEERIVVLGAAAEAGKDAAAVIESAAADLSAGTVLVVVHSGGGR
AKSLANQLRSMGAQVHQCARITKVSERADFIRSEFASLWVKVDDETVTAL
LDAVGSDVRELASACSQLVADTGGAVDAAAVRRYHSGKAEVRGFDIADKA
VAGDVAGAAEALRWAMMRGEPLVVLADALAEAVHTIGRVGPQSGDPYRLA
AQLGMPPWRVQKAQKQARRWSRDTVATAMRLVAELNANVKGAAADADYAL
ESAVRQVAELVADRGR
433635493YP_007269120.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MRRVSLPNQLNETRRRSPTRGERIFGGYNTSDVYAMAFDEMFDAQGIVRG
PYKGIYAELAPSDASELKARADALGRAFIDQGITFSLSGQERPFPLDLVP
RVISAPEWTRLERGITQRVKALECYLDDIYGDQEILRDGVIPRRLVTSCE
HFHRQAVGIVPPNGVRIHVAGIDLIRDDRGDFRVLEDNLRSPSGVSYVME
NRRTMARVFPNLFATHRVRAVDDYASHLLRALRNSAATNEADPTVVVLTP
GVYNSAYFEHSLLARQMGVELVEGRDLFCRDNQVYMRTTEGERQVDVIYR
RIDDAFLDPLQFRADSVLGVAGLVNAARAGNVVLSSAIGNGVGDDKLVYT
YVPTMIEYYLHEKPLLANVETLRCWLDDEREEVLDRIRELVLKPVEGSGG
YGIVFGPEASQAELAAVSQKIRDDPRSWIAQPMMELSTVPTRIEGTLAPR
YVDLRPFAVNDGNEVWVLPGGLTRVALVEGSRVVNSSQGGGSKDTWVLAP
RASAAARELGAAQIVRSLPQPLCDPTVDASGYEPHDQQPQQQQQQQQQAF
H
433635491YP_007269118.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MWRTRVVHTTGYVYQSPVTASYNEARLTPRSSSRQNLVLNRVETIPATRS
YRYIDYWGTAVTAFDLHAPHTELTVTSSSVVETERPEPLAAKVTWADLQS
TAVIDRFDEVLRPTPHTPASARVDAVGRRIRKCHEPSEAVVAAARWARSE
LDYIPGTTSVHSSGLDALEQGKGVCQDFVHLSLMVLRSMGIPCRYVSGYL
HPKRDAVVGKTVDGRSHAWVQAWTGGWWHYDPTNDNEITEQYISVGVGRD
YTDVSPLKGIYSGEGVTDLDVVVEITRLA
433635489YP_007269116.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MLEITLLGTGSPIPDPDRAGPSTLVRAGAQAFLVDCGRGVLQRAAAVGVG
AAGLSAVLLTHLHSDHIAELGDVLITSWVTNFAADPAPLPIIGPPGTAEV
VEATLKAFGHDIGYRIAHHADLTTPPPIEVHEYTAGRAWDRDGVTIRVAP
TDHRPVTPTIGFRIESDGASVVLAGDTVPCDSLDQLAAGADALVHTVIRK
DIVTQIPQQRVKDICDYHSSVQEAAATANRAGVGTLVMTHYVPAIGPGQE
EQWRALAATEFSGQIEVGNDLHRVEVHPRR
433635487YP_007269114.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MQRFAENLVFTEAPKLVRQLHNTQETLRTIRQAVKITANIMTTAVPPPPA
EIAAGRPVTSTSFPTAARARKLVYAPDLDGRADPGEIVWTWVAYEQDPTR
GKDRPVLVVGRDRSVLLGLLVSSQERHAADRDWVGIGSGAWDYEGRESWV
RLDRVLDVPEESIRREGAILEREVFDVVAARLRADYAWR
433635485YP_007269112.1 Conserved lipoprotein of unknown function- LppR [Mycobacterium caneMTNRWRWVVPLCAVFLAAGCTTTTAGKAGPAPNAVPRPLTGALIQRVPLD
GAALSKLLNQPFQALPPFPPVFGGSDSLGDSDVSARPADCVGVGYLAQRN
AYRSVEVKSVARVSWRHDGSSVKVDDVDEGVVALPTAAAADDLFARFSAH
WKECDGTTLTVPASTFGQRSITDVRVADSVVAATVSLRRGTHSILASVPQ
ARAVGVRGNCVVEVAVTFFGITHPSDQGSADISTSAVDIAHAMMDRISEL
S
433635483YP_007269110.1 Conserved membrane protein of unknown function [Mycobacterium canetMGPMNGFLSWWDGVELWLSGLPFALQALAVMPVVLALAYFTAALLDALLG
RVIQLIRRARRPDQAPR
433635481YP_007269108.1 Putative sulfate-binding lipoprotein SubI [Mycobacterium canettii CMLSLTLSEASCIASASRWRHIIPAGVVCALIAGIGVGCHGGPSDVVGRAG
PDRAHTSITLVAYAVPEPGWSAVIPAFNASEQGRGVQVITSYGASADQSR
GVADGKPADLVNFSVEPDIARLVKAGKVDKDWDADATKGIPFGSVVTFVV
RAGNPKNIRDWDDLLRPGIEVITPSPLSSGSAKWNLLAPYAAKSDGGRNN
QAGIDFVNTLVNEHVKLRPGSGREATDVFVQGSGDVLISYENEAIATERA
GKPVQHVTPPQTFKIENPLAVVATSTHLGAATAFRNFQYTVQAQKLWAQA
GFRPVDPAVAADFADLFPVPAKLWTIADLGGWGSVDPQLFDKATGSITKI
YLRATG
433635479YP_007269106.1 Putative sulfate-transport integral membrane protein ABC transporteMTSVPAARYLVRSVALGYVFVLLIVPVALILWRTFEPGFGQFYAWISTPA
AISALNLSLLVVAIVVPLNVIFGVTTALVLARNRFRGKGVLQAIIDLPFA
VSPVIVGVSLILLWGSAGALGFVEQDLGFKIIFGLPGIVLASMFVTCPFV
VREVEPVLHELGTDQEQAAATLGSGWWQTFWRITLPSIRWGLTYGIVLTV
ARTLGEYGAVIIVSSNLPGTSQTLTLLVSDRYHRGAEYGAYALSTLLMAV
SVVVLIVQMVLDARRARAVSEG
433635477YP_007269104.1 Conserved protein of unknown function- PE PGRS family [MycobacteriuMSFLIASPEALAATATDLTGIGSAISAANAVAAAPTTEILAAGTDEVSTA
ISALFGAHAQAYQALSAHVAAFHDQFVHTLTAGAGSYMAAEAAAASPLQA
LQLELLNAINAPTLALLGRPLIGDGTDAAPGSGGAGGAGGILIGNGGDGG
SGAADMPGGAGGAAGLFGNGGAGGTGGFGATGTGGTGGAGGAGGLFGAGG
NGGNGGLSTLHNGGAGGAGGAGGLFGAGGAGGTGGASDLAGTGRGGVGGA
GGAGGLFGIGGAGGGGGSAVAIGGDGGAGGAGGVFSGGGAGGAGGAGAIA
GDGGAGGNAGTLPTVGGLFGAGGAGGAGGAGDAIGGSGGAGGTGGLLGGG
GGAGGAGGFGEAIGGDGGTGGNAGLLFGAGGAGGNGGGASNGASIGGGGG
SGGAGGMLYGAGGVGGNGGAAVAIGGDGGAGGRAGAIGNGGDGGNGGTSN
TPGGSGGDGGNGGNAGLIGNGGNGGNAEIVISGGSVAGTGGNGGLLLGFN
GTNGLP
433635475YP_007269102.1 Gamma-glutamyltranspeptidase GgtB [Mycobacterium canettii CIPT 1400MSVWLRAGALVAAVMLSLSGCGDVHTGTPSAAGPCEIVPNGTPAPKTPPA
TVPSSRNPATNPEIATGYRRDMTVVRTAHYAAATANPLATQVACRVLRDG
GTAADAVVAAQAVLGLVEPQSSGIGGGGYLVYFDARTGSVQAYDGREVAP
AAATENYLRWVSDVDRSAPRPNARASGRSIGVPGILRMLEMVHNEHGRTP
WRDLFAPAVTLADGGFDISARMGAAISDAAPQLRDDPEARKYFLNPDGSP
KPAGTRLTNPAYSKTLSAIASAGANAFYSGDIAHDIVAAASDTSNGRTPG
LLTIEDLAGYLAKRRQPLCTTYRGREICGMPSSGGVAVAATLGILEHFPM
SDYAPSKVDLNGGRPTVMGVHLIAEAERLAYADRDQYIADADFVRLPGGS
LTTLVDPGYLAARAALISPQHSMGSARPGDFGAPTAVAPPVAEHGTSHLS
VVDSYGNAATLTTTVESAFGSYHLVDGFILNNQLSDFSAEPHAVDGSPVA
NRVEPGKRPRSSMAPTLVFEHSSAGRGALYAVLGSPGGSMIIQFVVKTLV
AMLDWGLNPQQAVSLVDFGAANSPRTNLGGENPEINTSDDGDHDPLVQGL
RALGHRVNLAEQSSGLSAIIRSEAGWAGGADPRREGAVMGDDA
433635473YP_007269100.1 Putative 3'-phosphoadenosine 5'-phosphosulfate reductase CysH (PAPSMSGETTRLTEPQLRELAARGAAELDGATATDMLRWTDETFGDIGGAGGGV
SGHRGWTTCNYVVASNMADAVLVDLAAKVRPGVPVIFLDTGYHFVETIGT
RDAIESVYDVRVLNVTPEHTVAEQDELLGKDLFARNPHECCRLRKVVPLG
KTLRGYSAWVTGLRRVDAPTRANAPLVSFDETFKLVKVNPLAAWTDQDVQ
EYIADNDVLVNPLVREGYPSIGCAPCTAKPAEGADPRSGRWQGLAKTECG
LHAS
433635471YP_007269098.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MAIFGRGHGASEPGGTGEPAETPGRGRLTRSVIGWVGAVAVVVSLAGSGW
CGWVLFEKHQTDVAAGQALQAARSYIVKLATMDCERIDHNMRDILEGSTG
EFKDKYGKSSAHLRQLLADNRVATHGTVVAASVKSATTNKVVVLMFIDQS
VSNRNSPTPQIDRSRIKVIMDKVNGRWLASKVELL
433635469YP_007269096.1 Putative oxygen-independent coproporphyrinogen III oxidase HemN (coMPGQPFGVYLHVPFCLTRCGYCDFNTYTPAELGGVSPDRWLLALRAELEL
AAAKLDAPTVHTVYVGGGTPSLLGGERLATLLDMVRDHFVLAPDAEVTTE
ANPESTWPEFFATIRAAGYTRVSLGMQSVAPRVLATLDRVHSPGRAAAAA
TEAIAEGFTHVNLDLIYGTPGESDDDLVRSVDAAVQAGVDHVSAYALVVE
HGTALARRVRRGELAAPDDDVLAHRYELVDARLSAAGFAWYEVSNWCRPG
GECRHNLGYWDGGQWWGAGPGAHGYIGVTRWWNVKHPNTYAEILAGATLP
VAGFEQLGADALHTEDVLLKVRLRQGLPLARLGAAERERAEAVLADGLLD
YHGDRLVLTGRGRLLADAVVRTLLG
433635467YP_007269094.1 Isochorismate synthase MbtI [Mycobacterium canettii CIPT 140070017]MSELSVATGAVSTASSSIPMPAGVNPADLAAELAAVVTESVDEDYLLYEC
DGQWVLAAGVQAMVELDSDELRVIRDGVTRRQQWSGRPGAALGEAVDRLL
LETDQAFGWVAFEFGVHRYGLQQRLAPHTPLARVFSPRTRIMVSEKEIRL
FDAGIRHREAIDRLLATGVREVPQSRSVDVSDDPSGFRRRVAVAVDEIAA
GRYHKVILSRCVEVPFAIDFPLTYRLGRRHNTPVRSFLLQLGGIRALGYS
PELVTAVRADGVVITEPLAGTRALGRGPAIDRLARDDLESNSKEIVEHAI
SVRSSLEEITDIAEPGSAAVIDFMTVRERGSVQHLGSTIRARLDPSSDRM
AALEALFPAVTASGIPKAAGVEAIFRLDECPRGLYSGAVVMLSADGGLDA
ALTLRAAYQVGGRTWLRAGAGIIEESEPEREFEETCEKLSTLTPYLVARQ
433635465YP_007269092.1 Bifunctional enzyme MbtA: salicyl-AMP ligase (Sal-AMP ligase)-salicMPPKAADGRRPSPDGGLGGFVPFPADRAASYRAAGYWSGRTLDTVLSDAA
RRWPDRLAVADAGDRPGHGGLSYAELDQRADRAAAALHGLGITPGDRVLL
QLPNGCQFAVALFALLRAGAIPVMCLPGHRAAELGHFAAVSAATGLVVAD
VASGFDYRPMARELVADHPTLRHVIVDGDPGPFVSWAQLCAQAGTGSPAP
PADPGSPALLLVSGGTTSMPKLIPRTHDDYVFNATASAALCRLSADDVYL
VVLAAGHNFPLACPGLLGAMTVGATAVFAPDPSPEAAFAAIERHGVTVTA
LVPALAKLWAQSCEWEPVTPKSLRLLQVGGSKLEPEDARRVRTALTPGLQ
QVFGMAEGLLNFTRIGDPPEVVEHTQGRPLCPADELRIVNADGEPVGPGE
EGELLVRGPYTLNGYFAAERDNERCFDPDGFYRSGDLVRRRDDGNLVVTG
RVKDVICRAGETIAASDLEEQLLSHPAIFSAAAVGLPDQYLGEKICAAVV
FAGAPITLAELNGYLDRRGVAAHTRPDQLVAMPALPTTPIGKIDKRAIVR
QLGIATGPVTTQRCH
433635463YP_007269090.1 Polyketide synthetase MbtC (polyketide synthase) [Mycobacterium canMSDNDPVVIVGLAIEAPGGVETADDYWTLLSEQREGLGPFPTDRGWALRE
LFDGSRRNGFKPIHNLGGFLSSATTFDPEFFRISPREATAMDPQQRVGLR
VAWRTLENSGINPDDLAGHDVGCYVGASALEYGPALTEFSHHSGHLITGT
SLGVISGRIAYTLDLAGPALTVDTSCSSALAAFHTAVQAIRAGDCDLALA
GGVCVMGTPGYFVEFSKQHALSDDGHCRPYSAHASGTAWAEGAAMFLLQR
RSRATADRRRVLAEVRASCLNSDGLSDGLTAPSGDAQTRLLRRAIAQAAV
VPADVGMVEGHGTATRLGDRTELRSLAASYGTAPAGRGPLLGSVKSNIGH
AQAAAGGLGLVKVILAAQHAAIPPTLHVDEPSREIDWEKQGLRLADKLTP
WRAVDGWRTAAVSAFGMSGTNSHVIVSMPDTVSAPERGPECGEV
433635461YP_007269088.1 Peptide synthetase MbtE (peptide synthase) [Mycobacterium canettii MWFVQMADPSGALLNICVSYRITGDIDLARLRDAVNAVARRHRILRTTYP
VGDDGVAQPTVHADLRPGWTQYDLTDLSQRAQRLRLEVLAQREFCAPFEL
SRDAPLRITVVRTAADEHVLLLVAHHIAWDDGSWRVFFTDLTQAYSRADL
GADLGPEHRPSAASGPDTIEADLNYWRAIMADPPEPLELPGPAGTCVPTS
WRAARATLRLPADTAARVATMAKNTGCTPYMVLLAAFGALVHRYTHSDDF
LVAAPVLNRGAGTEDAIGYFGNTVAMRLRPQSAMSFRELLTATRDIASGA
FAHQRINLDRVVRELNPDRRHGAERMTRVSFGFREPDGGGFNPPGIECER
YDLRSNITQLPLGFMVEFDRAGVLVEAEHLVEILEPALAKQMLRHFGVLL
DNALAAPDNTLSGLALMDERDAARLREVSRGERFDTPVKTLVDLVNEQTT
RTPDATAVVYEGQHFTYHDLNEASNRLAHWLIEQGIGSEDRVAVLLDKSP
DLIVTALGVVKSGAVYVPVDPSYPQDRLDFILADCDAKLVLRTPVRELAG
YRSDDPTDADRIRPLRPDNTAYLIYTSGTTGLPKGVAVPHRPVAEYFVWF
KGEYDVDDTDRLLQVASPSFDVSIAEIFGTLACGARMVIPRPGGLTDIGY
LTALLRDEGITAMHFVPSLLGLFLSLPGVSQWRTLQRVPIGGEPLPGEVA
DKFHATFDALLHNFYGPTETVINASRFKVVGPQGTRIVPIGRPKINTTMH
LLDDSLQPVPTGVIGEIYIGGTHVAYGYHRRAGLTAERFVADPFNPGSRM
YRSGDLARRNADGDIEFVGRADEQVKIRGFRIELGDVAAAIAVDPTVGQA
VVVVSDLPRLGKSLVGYVTPAAGGDGPADVGVDLDRIRARVAAALPEYML
PAAYVVLDEIPITAHGKIDRAALPEPQIASDTEFRAPQTATERRLAQLFG
ELLGRDRVGADDSFFDLGGHSLLATKLVAAVRNAFGVDVGVREIFEFATV
TALAGHIDTLDSDSARPRLTRVDHDGPVRLSSSQMRSWFNYRFDGPNAVN
NIPFAAALHGPCDTNAFAAAITDVVARHEILRTVYREIGGVPHQIIQPPA
EVPVRCAAGSDAAWLRAELNNERGYVFDLETDWPIRAALLSTPEQTVLSL
VVHHIAGDHWSAGVLFTDLLTAYRARSTGQRPSWAPLPVQYADYSVWQSA
LLDDGAGIVGPQRDYWIRQLGGLAGETGLRPDFPRPALLSGAGDAVEFRL
GAAIRDKLAAVSRDLGVTEFMLLQAAVAVVLHKAGGGVDVPIGAPVAGRS
EANLDQLIGFFINIVVLRNDLRGNPSLREVLQRTRQMALAAYAHQDLPFD
QVVEAVNPQRSLSRNPLFDIVVHVREQMPQDHVIDTGPDGDTTLRVLEPT
FDAAQADLSVNFFACGDEYRGHVIYRTELYERATAQRFADWLVRVVEAFA
DRPDQPLREVEMVSAQARRRILDRSNAGAGTARVYLLDDALKPVPVGVVG
DVYYGGGPAVGARLARPSETATRFVADPFAAQPGSRLYRNGERGVWKADG
QLELLAEIERLPTAQAAPVPAEPADTETERALAAILADVLEVGEVGRYDD
FFNLGGDSILATQVAARARDGGIPLTARMVFEHPVLCELAAAVDAKPHVE
AEPDDKHHAPMSTSGLSPDELSALTASWDQWP
433635459YP_007269086.1 Lysine-N-oxygenase MbtG (L-lysine 6-monooxygenase) (Lysine N6-hydroMNPTLAVLGAGAKAVAVAAKASVLRDMGVDVPDVIAVERIGVGANWQASG
GWTDGAHRLGTSPEKDVGFPYRSALVPRRNAELDERMTRYSWQSYLIATA
SFAEWIDRGRPAPTHRRWSQYLAWVADHIGLKVIHGEVERLAVTGDRWAL
CTHETTVQADALMITGPGQAEKSLLPGNPRVLSIAQFWDRAAGHDRINAE
RVAVIGGGETAASMLNELFRHRVSTITVISPQVTLFTRGEGFFENSLFSD
PTDWAALTFDERRDALARTDRGVFSATVQEALLADDRIHHLRGRVAHAVG
RQGQIRLTLSTNRGSENFETVHGFDLVIDGSGADPLWFTSLFSQHTLDLL
ELGLGGPLTADRLQEAIGYDLAVTDVTPKLFLPTLSGLTQGPGFPNLSCL
GLLSDRVLGAGIFTPTKHNDTRRSGEHQSFR
433635457YP_007269084.1 Conserved protein of unknown function- low molecular weight antigenMKMVKSIAAGLTAAAAIGAAAAGVTSIMAGGPVVYQMQPVVFGAPLPLDP
ASAPDVPTAAQLTSLLNSLADPNVSFANKGSLVEGGIGGTEARIADHKLK
KAAEHGDLPLSFSVTNIQPAAAGSATADVSVSGPKLSSPVTQNVTFVNQG
GWMLSRASAMELLQAAGN
433635455YP_007269082.1 Putative heat shock protein transcriptional repressor HrcA [MycobacMGSADERRFEVLRAIVADFVATQEPIGSKSLVERHNLGVSSATVRNDMAV
LEAEGYITQPHTSSGRVPTEKGYREFVDRLEDVKPLSSAERRAIQSFLES
GVDLDDVLRRAVRLLAQLTRQVAVVQYPTLSTSTVRHLEVIALTPARLLM
VVITDSGRVDQRIVELGDVIDDHQLTQLREILGQALEGKKLSAASVAVAD
LASQLGGAGGLGDAVGRAATVLLESLVEHTEERLLLGGTANLTRNAADFG
GSLRSILEALEEQVVVLRLLAAQQEAGKVTVRIGHETASEQMVGTSMVST
AYGTAHTVYGGMGVVGPTRMDYPGTIASVAAVALYIGDVLGAR
433635453YP_007269080.1 16S ribosomal RNA methyltransferase RsmE [Mycobacterium canettii CIMVAMLFYVDTLPDTGAVAVVDGDEGFHAASVRRIRPGEQLVLGDGVGGLA
RCVVEQAGRGGLRARVLRRWSVPPVRPPVTVVQALPKSERSELAIELATE
AGADAFLAWQAARCVANWDGARVDKGLRRWRAVVRSAARQSRRARIPPVD
GVLSTPMLVQRVREEVAAGAAVLVLHEEATERIVDIAAAQAGSLMLVVGP
EGGIAPDELAALTDAGAVAVRLGPTVLRTSTAAAVALGAVGVLTSRWDAP
ASDCESGDVTRR
433635451YP_007269078.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MVLPKPTPRGRELIRQAAKVALHPTPEWLDELDRATLAAHPSIAADPALA
TVVSRANRSHLIHFATANLRKPGQPVPANLGPDPLRMARDLVRRGLDASA
LDVYRVGQNVAWQRWTEIAFGLTTDPQELHELLTLPFRSASEFIDATLAG
LAAQMQLEYDELTRDVHAEHRRIVELILDGAPISRQSAEAKLGYPLDRSH
TAAIIWYDDPDDNQNHLDHTARAFGRALGCPQPLIAVASAATRWVWVSDA
ATLDTDRIHQVLDHAPHARIAVGTTARGIDGFRRSHRDALATQRMLARLR
SQQRLAFFADIHMIAVLTENPDSAADFITSTLGDLESASPQLLTTVLTYI
NEQCNASRAAHVLHTHRNTLLRRLETAQRLLPRPLDHTIIQVAVAISALQ
WRGSQTSDPVETPVEGITSPPPESLGRRRSRLAQLER
433635449YP_007269076.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MREHLMSIEVANESGIDVSEAELVSVARFVIAKMDVNPCAELSMLLLDTA
AMADLHMRWMDLPGPTDVMSFPMDELEPGGRPDAPEPGPSMLGDIVLCPE
FAAEQAAAAGHSLGHELALLTIHGVLHLLGYDHAEPDEEKEMFALQDRLL
EEWVADQVEAYQHDRQDEKDRRLLDKSRYFDL
433635447YP_007269074.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MRRPITLAEQLDAEDAKLVVLARAAMARAEAGAGAAVRDVDGRTYAAAPV
ALSALELTGLQAAVAAAVSSGATGLQAAVLVAGSVDDPGIAAVRELAPTA
AIIVTDRAGNPL
433635445YP_007269072.1 Putative amidase AmiA2 (aminohydrolase) [Mycobacterium canettii CIPMVGASGSDAGAISGSGNQRLPTLTDLLYQLATRAVTSEELVRRSLRAIDV
SQPTLNAFRVVLTESALADAAAADKRRAAGDTAPLLGIPIAVKDDVDVAG
VPTAFGTQGYVAPATDDCEVVRRLKAAGAVIVGKTNTCELGQWPFTSGPG
FGHTRNPWSRRHTPGGSSGGSAAAVAAGLVTAAIGSDGAGSIRIPAAWTH
LVGIKPQRGRISTWPLPEAFNGVTVNGVLARTVEDAALVLDAASGNVEGD
RHQPPPVTVSDFVGIAPGPLKIALSTHFPYTGFRAKLHPEILAATQRVGD
QLELLGHTVVKGNPDYGLRLSWNFLARSTAGLWEWAERLGDEVTLDRRTV
SNLRMGHVLSQAILRSARRHEAADQRRVGSIFDIVDVVLAPTTAQPPPMA
RAFDRLGSFGTDRAIIAACPSTWPWNLLGWPSINVPAGFTSDGLPIGVQL
MGPANSEGMLISLAAELEAVSGWATKQPQVWWTS
433635443YP_007269070.1 Long chain (C50) Z-isoprenyl diphosphate synthase (Z-Decaprenyl DipMARDARKRTSSDFPQLPAAPDDYPTFPDTSTWPVVFPELPAAPYGGPCRP
PQHTSKAAAPRIPADRLPNHVAIVMDGNGRWATQRGLARTEGHKMGEAVV
IDIACGAIELGIKWLSLYAFSTENWKRSPEEVRFLMGFNRDVVRRRRDTL
KKLGVRIRWVGSRPRLWRSVINELAVAEEMTKSNDVITINYCVNYGGRTE
ITEATREIAREVAAGRLNPERITESTIARHLQRPDIPDVDLFLRTSGEQR
SSNFMLWQAAYAEYIFQDKLWPDYDRRDLWAACEEYASRTRRFGSA
433635441YP_007269068.1 Putative zinc uptake regulation protein Zur [Mycobacterium canettiiMSAAGVRSTRQRAAISTLLETLDDFRSAQELHDELRRRGENIGLTTVYRT
LQSMASSGLVDTLRTDTGESVYRRCSEHHHHHLVCRSCGSTIEVGDHEVE
AWAAEVATKHGFSDVSHTIEIFGTCSDCRS
433635439YP_007269066.1 Putative glycyl-tRNA synthetase GlyS (glycine--tRNA ligase) (GlyRS)MHHPVAPVIDTVVNLAKRRGFVYPSGEIYGGTKSAWDYGPLGVELKENIK
RQWWQSVVTGRDDVVGIDSSIILPREVWVASGHVDVFHDPLVESLITHKR
YRADHLIEAYEAKHGHPPPNGLADIRDPETGEPGQWTPPREFNMMLKTYL
GPIETEEGLHYLRPETAQGIFVNFANVVTTARKKPPFGIGQIGKSFRNEI
TPGNFIFRTREFEQMEMEFFVEPATAKEWHQYWIDNRLQWYIDLGIRREN
LRLWEHPKDKLSHYSDRTVDIEYKFGFMGNPWGELEGVANRTDFDLSTHA
RHSGVDLSFYDQINDVRYTPYVIEPAAGLTRSFMAFLIDAYTEDEAPNTK
GGMDKRTVLRLDPRLAPVKAAVLPLSRHADLSPKARDLGAELRKCWNIDF
DDAGAIGRRYRRQDEVGTPFCVTVDFDSLQDNAVTVRERDAMTQDRVAMS
SVADYLAVRLKGS
433635437YP_007269064.1 Conserved protein of unknown function- PPE family protein (PPE40) [MVVNFSVLPPEINSGRMFFGAGSGPMLAAAAAWDGLAVELGLAAESFGLV
TSGLAGGSGQAWQGAAAAAMVAAAAPYAGWLAAAAARAGGAAVQAKAVAG
VFEAARAAMVDPVVVAANRSAFVQLVLSNVFGQNAPAIAAAEAAYEQMWA
ADVAAMGGYHGGASAAAAALAPWQQAVPGLSGLLDSAQSSAQAVTAQAVG
STVPGPLQGINFGFGNIGSLNLGSGNTGDTNVGSGNIGNTNLGGGNIGSF
NLGSGNQGDINLGIGNVGNLNLGSGNFGSQNLGSGNIGSTNVGSGNIGST
NVGSGNIGDTNFGNGNNGNFNFGSGNTGSNNIGFGNTGSGNFGFGNTGNN
NFGIGLTGDGQIGIGGLNSGSGNIGFGNSGTGNVGLFNSGTGNVGFGNSG
TANTGFGNAGNVNTGFWNGGSTNTGFANAGAGNTGFFDAGNYNFGSLNAG
NINSSFGNSGDGNSGFLNAGDVNSGVGNAGDVNTGLGNSGNINTGGFNAG
TLNTGFFSAMTQAGPNSGFFNAGTGNSGFGHNDPAGSGNSGIQNSGFGNS
GYVNTSTTSMFGGNSGVLNTGYGNSGFYNAAVNNTGIFVTGVMSSGFFNF
GTGNSGLLVSGNGLSGFFKNLFG
433635435YP_007269062.1 Conserved protein of unknown function- ESAT-like protein EsxJ (ESATMVATRFMTDPHAMRDMAGRFEVHAQTVEDEARRMWASSQNISGAGWSGLA
EATSLDTMTQMNQAFRNIVNMLHGVRDGLVRDANNYEQQEQASQQILSS
433635433YP_007269060.1 Conserved protein of unknown function- PPE family- PPE38-like proteMAADLRASASSFDAVIAGLAAGPWSGPASVAMAGAAAPYVGLVECGGRAG
GVVGWSGYRGGDGV
433635431YP_007269058.1 Putative membrane-associated phospholipase C 1 PlcA (MTP40 antigen)MSRREFLTKLTGAGAAAFLMDWAAPVIEKAYGAGPCPGHLTDIEHIVLLM
QENRSFDHYFGTLSSTNGFNAASPAFQQMGWNPMTQALDPAGVTIPFRLD
TTRGPFLDGECVNDPEHQWVGMHLAWNGGANDNWLPAQATTRAGPYVPLT
MGYYTRQDIPIHYLLADTFTICDGYHCSLLTGTLPNRLYWLSANIDPAGT
DGGPQLVEPGFLPLQQFSWRIMPENLEDAGVSWKVYQNKGLGRFINTPIS
NNGLVQAFRQAADPRSNLARYGIAPTYPGDFAADVRANRLPKVSWLVPNI
LQSEHPALPVALGAVSMVTALRILLSNPAVWEKTALIVSYDENGGFFDHV
TPPTAPPGTPGEFVTVPNIDAVPGSGGIRGPLGLGFRVPCIVISPYSRGP
LMVSDTFDHTSQLKLIRARFGVPVPNMTAWRDGVVGDMTSAFNFATPPNS
TRPNLSHPLLGALPKLPQCIPNVVLGTTDGALPSIPYRVPYPQVMPTQET
TPVRGTPSGLCS
433635429YP_007269056.1 Putative phospholipase C 3 PlcC [Mycobacterium canettii CIPT 140070MSRRAFLAKAAGAGAAAVLTDWAAPVIEKAYGAGPCSGHLTDIEHIVLCL
QENRSFDHYFGTLSAVDGFDTPTPLFQQKGWNPETQALDPTGITLPYRIN
TTGGPNGVGECVNDPDHQWIAAHLSWNGGANDGWLPAQARTRSVANTPVV
MGYYARPDIPIHYLLADTFTICDQYFSSLLGGTMPNRLYWISATVNPDGD
QGGPQIVEPAIQPKLTFTWRIMPQNLSDAGISWKVYNSKLLGGLNDTSLS
RNGYVGSFKQAADPRSDLARYGIAPAYPWDFIRDVINNTLPQVSWVVPLT
VESEHPSFPVAVGAVTIVNLIRVLLRNPAVWEKTALIIAYDEHGGFFDHV
TPLTAPEGTPGEWIPNSVDIDKVDGSGGIRGPIGLGFRVPCFVISPYSRG
GLMVHDRFDHTSQLQLIGKRFGVPVPNLTPWRASVTGDMTSAFNFAAPPD
PSPPNLDHPVRQLPKVAKCVPNVVLGFLNEGLPYRVPYPQTTPVQESGPA
RPIPSGIC
433635427YP_007269054.1 Conserved protein of unknown function- ESAT-6 like protein EsxP (EsMHAQTVEDEARRMWASAQNISGAGWSGMAEATSLDTMTQMNQAFRNIVNM
LHGVRDGLVRDANNYEQQEQASQQILSS
433635425YP_007269052.1 Conserved membrane protein of unknown function [Mycobacterium canetMRLVRLLGMVLTILAAGLLLGPPAGAQPPFRLSNYVTDNAGVLTSSGRTA
VTAAVDRLYADRRIRLWVVYVENFSGQSALNWAQRTTRTSELGNYDALLA
VATTGREYAFLVPSAMPGVSEGQVDNVRRYQIEPALHDGDYSGAAVAAAN
GLNRSPSSSSRVVLLVTVGIIVIVVAVLLVVMRHRNRRRRADELAAARRV
DPTNVMALAAVPLQALDDLSRSMVVDVDNAVRTSTNELALAIEEFGERRT
APFTQAVNNAKAALSQAFTVRQQLDDNTPETPAQRRELLTRVIVSAAHAD
RELASQTEAFEKLRDLVINAPARLDLLTQQYVELTTRIGPTQQRLAELHT
EFDAAAMTSIAGNVTTATERLAFADRNISAARDLADQAVSGQQAGLVDAV
RAAESALGQARALLDAVDSAATDIRHAIASLPAVVADIRAGIKRANDLLQ
QAQKPQSGHTGNLLAARNAAARALDRARGDGAVDPLAVFAQLTKADADLD
RLLATLAEEQATADRLNRSFEQALFTAQSRVRAVSEYIDTRRGSIGPEAR
TRLAEAKRQLQAAHDRKSSNPTEAIAYANAASTLAAHAQSLANADVQSAQ
RAYTRRGGNNAGAMLGGIIIGDLLSGGTRGGLGGWIPTSFGGSSNAPGSS
PDGGFFGGGGRF
433635423YP_007269050.1 Putative DNA primase DnaG [Mycobacterium canettii CIPT 140070017]MSGRISDRDIAAIREGARIEDVVGDYVQLRRAGADSLKGLCPFHNEKSPS
FHVRPNHGHFHCFGCGEGGDVYAFIQKIEHVSFVEAVELLADRIGHTISY
TGAATSVQRDRGSRSRLLAANAAAAAFYAQALQSDEAAPARQYLTERSFD
AAAARQFGCGFAPSGWDSLTKHLQRKGFEFKELEAAGLSRQGRHGPMDRF
HRRLLWPIRTAAGEVIGFGARRLFDDDAMEAKYVNTPETPLYKKSAVMFG
IDLAKRDIAKGHQAVVVEGYTDVMAMHLAGVTTAVASCGTAFGGEHLAML
RRLMMDDSFFRGELIYVFDGDEAGRAAALKAFDGEQKLAGQSFVAVAPDG
MDPCDLRLKCGDAALRDLVARRTPLFEFAIRAAIAGMDLDSAEGRVAALR
RCVPMVGQIKDPTLRDEYARQLAGWVGWADVAQVIGRVRGEAKRSKHPRL
GRLGSTTIARAAQRPTAGPPAELAVRPDPRDPTLWPQREALKSALQYPAL
AGPVFDALTVEGFTHPEYAAVRAAIDTAGGTSAGLSGAQWLDMVRQQTTS
TVTSALISELGVEAIQVDDDKLPRYIAGVLARLQEVWLGRQIAEVKSKLQ
RMSPIEQGDEYHALFGDLVAMEAYRRSLLEQASGDDLTA
433635421YP_007269048.1 Conserved lipoprotein of unknown function [Mycobacterium canettii CMQVGGRQHVFEKLASILGLVAAPLMLLGLSACGRSADKTSEPTCPTEPID
AADSSTTPDPSCVVRATEINGNGSPIQTWTGSYDAAATQSGGVCGGTCNF
HATVRFTVDEGQISGSVDQVYQAAMVAIATRPTSPSLAP
433635419YP_007269046.1 Putative conserved transmembrane transport protein MmpL9 [MycobacteMVPGEVHMSDTPSGPHPIIPRMIRLAAIPIVLCWLGFTVFVNVAVPPLEA
IGETRAVAVAPDDAQSMRAMRRAGKVFNEFDSNSIAMLVLESDQPLGEKA
HRYYDHLVDTLVLDQSHIKHIQDFWRDPLTAAGAVSADGKAAYVQLYLAG
NMGEALANESVEAVRKIVANSTPPEGIRTYVTGPAALFADQIAAGDRSMK
LITGLTFAVITVLLLLVYRSIATTLLILPMVFIGLDATRGTIAFLGYHGM
VGLSTFVVNILTALAIAAGTDYAIFLVGRYQEARHIGQNREASFYTMYRG
TANVILGSGLTIAGATYCLSFARLTLFHTMGPPLAIGMLVSVAAALTLAP
AIIAIAGRFGLLDPKRRLKTRGWRRVGTAVVRWPGPILATSVALALVGLL
ALPGYRPGYNDRYYLRAGTPVNRGYAAADRHFGPARMNPEMLLVESDQDM
RNPAGMLVIDKIAKEVLHVSGVERVQAITRPQGVPLQHASIPFQISMMGA
TQTMSLPYMRERMADMLTMSDEMLVAINSMEQMLDLVQQLNDVTHEMAAT
TREIKATTSELRDHLADIDDFVRPLRSYFYWEHHCFDIPLCSATRSLFDT
LDGVDTLTDQLRALADAMNKMEALTPQFLALLPPMITTMKTMRTMMLTMR
STISGVQDQMADMQDHATAMGQAFDTAKSGDSFYLPPEAFDNAEFQQGMK
LFLSPNGKAVRFVISHESDPASTEGIDRIEAIRAATKDAIKATPLQGAKI
YIGGTAATYQDIRDGTKYDVLIVGIAAVCLVFIVMLMITQSLIASLVIVG
TVLLSLGTAFGLSVLIWQHFVGLQVHWTIVAMSVIVLLAVGSDYNLLLVS
RFKEEVGAGLKTGIIRAMAGTGAVVTSAGLVFAFTMASMAVSELRVIGQV
GTTIGLGLLFDTLVVRSFMTPSIAALLGRWFWWPNMIHSRPTVLEAHTPQ
GARRIQPHPHRG
433635417YP_007269044.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MTSRAEITSKYAKAYVKASKKDRGRILDQVVEVTGWSRDNARRRLTAAAK
SPPGAGRSIVKRPRKPRSPKYSYDALKVLQRVWAASGGQCGKYLAASMVL
QLDGLERHGELEFGRDRYGSKVREELLAMSAASIDRYLKTAKAKDQISGV
STTKPSPLLRNSIKVRKAGDEVEAEPGFFEGDTVAHCGPTLKGEFARTLN
LTDVHIGWVFTRTVRNNAHTHILAGLEASVIEIPYGITGLDFDNGTEFLN
KPVIGWAGDNGIYFTRSRPYKKNDQATIESKNNHLVRKYAFYYRYDTAEE
RAVLNRMWKLVNDRLNYLTPTIKPIGYASSADGRRRRLYDAPQTPLDRLL
AAGVLSPAQQADLIAYRDSLNPAQIGRQIADLQNRLLILAQEKTEQLYLA
NIPTALPDIRKGIRIKAG
433635415YP_007269042.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MRAGRWGPGMTGLDPAEFLSLVEAAALAPSADNRREFQLEHAGRRVRLWG
DQTWRSAPEHRRIMSLVAIGAAVENVKLRAGRLGFETKVCWFPDSGNPGL
VAEIDVDRLPQTRVDPIEVAIERRRTNRRVRFRGPPLSQGELGALSAEAT
GIDGIQLHWFDSPETRKQILRLVRLAETERFRSRELHEELFSAVRFDIGW
TASSDDGLPPGSLEVEAWMRPMFRGLRHWRVLRLLRTVGMHHALGLRAAY
LPCRLAPHVGALTTSLDLASGALTAGAVFERIWLRTTLLGAELQPFAASA
VLSLPACEWVAPHVRAALVGGWNLLAPGHWPMMVFRIGHARAPSVRTMRQ
SVEAYCYAPAERSGSDSESRFA
433635413YP_007269040.1 Putative serine acetyltransferase CysE (SAT) [Mycobacterium canettiMLTAMRGDIRAARERDPAAPTALEVIFCYPGVHAVWGHRLAHWLWQRGAR
LLARAAAEFTRILTGVDIHPGAVIGARVFIDHATGVVIGETAEVGDDVTI
YHGVTLGGSGMVGGKRHPTVGDRVIIGAGAKVLGPIKIGEDSRIGANAVV
VKPVPPSAVVVGVPGQVIGQSQPSPGGPFDWRLPDLVGASLDSLLTRVAR
LEALGGGPQAAGVIRPPEAGIWHGEDFSI
433635411YP_007269038.1 Putative conserved integral membrane transport protein [MycobacteriMNRTQLLTLIATGLGLFMIFLDALIVNVALPDIQRSFAVGEDGLQWVVAS
YSLGMAVFIMSAATLADLYGRRRWYLMGVSLFTLGSIACGLAPSIAVLTT
ARGAQGLGAAAVSVTSLALVSAAFPEAKEKARAIGIWTAIASIGTTTGPT
LGGLLVDQWGWRSIFYVNVPMGALVLFLTLCYVEESRNERARRFDLSGQL
LFIVAVGALVYAVIEGPQIGWTSVQTIAMLWTAAVGCALFVWLERRSSNP
MMDLTLFRDSSYALAIATICTVFFAVYGMLLLTTQFLQNVRGYTPSVTGL
MILPFSAAVAIVSPLVGHLVGRIGARVPILAGLCMLMLGLLTLIFSEHRS
SALVLVGLGLCGSGVALCLTPITTVAMTAVPAERAGMASGIMSAQRAIGS
TIGFAVLGSVLAAWLSATLEPHLERAVPDPVQRHVLAEIIIDSANPRAHV
GGIVPRRHIEHRDPVAIAEEDFIEGIRVALLVATATLAVVFLAGWRWFPR
DVNTAGSDAKREAAYSDDRRVRG
433635409YP_007269036.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MIPDAVSEAIGIPADDIPMAARWIGSRPCSLTGQPNAMGDEMGDLEPGLA
GQRCVDRLVTGRQSIHLLAIAGHRVRRRTAVGAQTSSAAPAFNLVQP
433635407YP_007269034.1 Putative nitrite extrusion protein 1 NarK1 (Nitrite Facilitator 1) MEQHTLLQREESPRSPAAPSLRRLGGSRHITHWDPEDLGAWEAGNKGIAR
RNLLWSVVTVHLGYSVWTLWPVLELLMPQDVYGFSTSDKFLLGTIATLFG
AFLRMPYALASAIFGGRNWATFSAIVLLIPAIGTTVLLTHPGLPLWPYLV
CAALTGLGGGNFASSMSNANAFYPHRLKGSALGIAGGVGNLGVPAIQLVG
LLAIATVGERKPYLVCALYVVLVAIAVIGVSLFMNNVEQHRVQVSRLRPI
VSAVLSTRDTWLLSLLYLGTFGSFIGFSFVFGQVLQTNFLACGQSPAHAT
LHAVELAFVGPLLAAVARIYGGRLADRVGGSRLTLIVFVAMTLAAGLLIS
ASTLEGRHVGQHRGATMVGYFVCFVALFVLSGLGNGSVYKMIPTIFEACS
RSLDLSEAERRDWSRIISGVVIGFVAAFGALGGVGINMALRESYLSTGSG
TDAFWIFMMCYAAAAVLTWKVYDGRTVTDMGMSQPALVPQPASTPAELIG
PRSQSDRFSGCSISA
433635405YP_007269032.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MSPFPAAANRSEVGGPLPGLGADLLAVVARLNRLATQRIQMPLPAAQARL
LATIEAQGEARIGDLAAVDHCSQPTMTTQVRRLEDAGLVTRTADPGDARA
VRIRITPEGIRTLTAVRADRAAAIEPQLALLPPADRRVLADAVDVLRRLL
DHAATTPGRATRQ
433635403YP_007269030.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MTTTSAPARNGTRRPSRPIVLLIPVPGSSVIHDLWAGTKLLVVFGISVLL
TFYPGWVTIGMMAALVLAAARIAHIPRGALPSVPRWLWIVLAIGFLTAAL
AGGTPVVAVGGVQLGLGGALHFLRITALSVVLLALGAMVSWTTNVAEISP
AVATLGRPFRVLRIPVDEWAVALALALRAFPMLIDEFQVLYAARRLRPKR
MPPSRKARRQRHARELIDLLAAAITVTLRRADEMGDAITARGGTGQLSAH
PGRPKLADWVTLAITAMASGTAVAIESLILHS
433635401YP_007269028.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MENTQRPSFDCEIRAKYRWFMTDSYVAAARLGSPARRTPRTRRYAMTPPA
FFAVAYAINPWIDVTAPVDVQVAQAQWEHLHQTYLRLGHSVDLIEPISGL
PDMVYAANGGFIAHDIAVVARFRFPERAGESRAYASWMSSVGYRPVTTRH
VNEGQGDLLMVGERVLAGYGFRTDQRAHAEIAAVLGLPVVSLELVDPRFY
HLDTALAVLDDHTIAYYPPAFSTAAQEQLSVLFPDAIVVGSADAFVFGLN
AVSDGLNVVLPVAAMGFAAQLRAAGFEPVGVDLSELLKGGGSVKCCTLEI
HP
433635399YP_007269026.1 Putative ornithine aminotransferase (C-terminus part) RocD2 (ornithMIADEIQSGLACTGYPFACDHGGVLPDIYLLGKTLGGGAVPLSAMVADRE
IFGVVHPGEHGSTFGGNPLAAAIGTPVVSMVVWGECQARSAKLGAHLHQR
LADLIGDGAVALRGLGWWADVDIERALAIGTDMSMRLADRGVLLKDTYGA
ALRFAPPLVITAQEIDCAVRRFADALWEAGS
433635397YP_007269024.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MTIVVGYLAGKVGPSALHLAVRVARMHKTSLTVATIVRRHWPTPSLARVD
AEYELWSEQLAAASAREAQRYLRRLADGIEVSYHHRAHRSVSAGLLDVVE
ELEAEVLVLGSFPSGRRARVLIGSTADRLLHSSPVPVAITPRRYRCYTDR
LTRLSCGYSATSGSVDVVRRCGHLASRYGVPMRVITFAVRGRTMYPPEVG
LHAEASVLEAWAAQARELLEKLRINGVVSEDVVLQVVTGNGWAQALDAAD
WQDGEILALGTSPFGDVARVFLGSWSGKIIRYSPVPVLVLPG
433635395YP_007269022.1 Putative sugar-transport integral membrane protein ABC transporter MSSPSRVSNTAVYAVLTIGAVITLSPFLLGLLTSFTSAHQFATGTALQLP
RPPTLANYADIADAGFRRAAVVTALMTAVILLGQLTFSVLAAYAFARLQF
RGRDALFWVYVATLMVPGTVTVVPLYLMMAQLGLRNTFWALVLPFMFGSP
YAIFLLREHFRLIPDDLINAARLDGANTLDVIVHVVIPSSRPVLAALAMI
TVVSQWNNFMWPLVITSGHKWRVLTVATADLQSRFNAQWTLVMAATTVAI
VPLIALFVTFQRHIVASIVVSGLK
433635393YP_007269020.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MTPNRGIDEDFLDLPRQQLADAALSAAATAGASHADLRVHRISTEIIQLR
DGELETAVISRELGLAVRVIVAGTWGFASHAELAPDVAAATARHAVHVAT
VLAALNTERVRLAPEPVYTDAEWVSNYRIDPFGVPASEKIAVLRDYSGRL
LDADGIDHVSASLNAVKEQTFYADTFGSSITQQRVRLLPCLDAVAVDSAA
GNFESMRTLAPPTARGWEVVAGDEIWNWTDELAQLPSLLAEKVRAPSVMP
GPTDLVIDPTNLWLTIHESIGHATEYDRAIGYEAAYAGTSFATPDKLGTL
RYGSPVMNVTADRTAEFGLATVGYDDEGVAAQSWDLVRDGVFVGYQLDRA
FAPRLGEPRSNGCSYADSPHHVPIQRMANVSLQPGIEDLSTADLIGRVDD
GIYVVGDKSWSIDMQRYNFQFTGQRFFRIRGGQLYGQLRDVAYQSSTTDF
WNAMEAVGGPSTWRMGGAINCGKAQPGQVAAVSHGCPSALFRGVNVLNTR
TEGGR
433635391YP_007269018.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MATSSGDITINRHPPLNCAVDRHDESRRSPLRRGPLANGLRERQAGVLFE
HYESQFDSFG
433635389YP_007269016.1 Putative integrase (fragment-part2) [Mycobacterium canettii CIPT 14MSLAISAGANVKVVQRLLGHATAAMTLDRFGHLLSDDLAGVAGLLGQAIK
SAAASPRYSDADSVAVENISAAS
433635387YP_007269014.1 Transposase (fragment 2) [Mycobacterium canettii CIPT 140070017]MFLPHCRKSAHPGAKKALAEIWNAEDKRHALDAIKAFEAAYGAKYPKAVA
KITDDLDQLLAFYDFPAEHWVHLRTTNPIESTFSTVRNRSKITKGPGSRA
AGIAMAYKLIEAAQSRWRAVNAPHLVALVRAGAKFENGKLLERTDEPATE
EARKEAA
433635385YP_007269012.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MALWREDDPEIFAATIVAAAEQLGVQPLAVEKDYWVCEVLRAIVTAHREQ
IVFKGGTSLEKLRIIQRFSEDLDLLVLGDYANVRAAKRAMKTMLDTAASA
IGVEYRDRKSAGDLGTATQEAWLDLPLTHSDQSGGLADPKSVLVELGQTG
GPKPALQAHVESLLYRELRATDLVGGQWDDLRPFEVAILHPGRTLIEKLL
RVNNFVVDPTKRATLHGLPRIGRQFYDIWALLGDASVMTLLADTVMVSDI
LASVFEVSQAFGGDHPIPDGGFATSEAFNPSGEFAKDLRREHDTAMTTFH
YGTERPTFDEVLERVHSCSKLLDLERD
433635383YP_007269010.1 Protein of unknown function [Mycobacterium canettii CIPT 140070017]MTGTGRAGLEPATNGFGFGGSRDVSWQPVISQCRKGLRCRLVPNDGPRIP
AGSRP
433635381YP_007269008.1 Transposase [Mycobacterium canettii CIPT 140070017]MTMTLADTAAVAVADDGYVGSGKGPRGERPKRRTFTAEYKLGILEQYESL
TEPGARGALLRKEGLYSSHITEWKRLRDAGALDALAAKPSGPKPAQTEAD
KRAAKLEAENARLAAELAKAKQANEVLGKLSELLSLLSNSSDGETRQNL
433635379YP_007269006.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MHEVDNVTYVVDENLLRLGAGLVAVRKDTARFGRPPVDDLLPQGILDTDW
IPIVGGRGWVVISNDRHLRTRPVEAELAIAHKLKVVHLHGRVGGQSAWAQ
LTRLAARWPAIEHQYEKAPEGPWWLSVRRSGTAVMEFAPGAVER
433635377YP_007269004.1 Transposase [Mycobacterium canettii CIPT 140070017]MICAFIDERREEFGVVPICRALAVHGVQIAPRTYWAHRSAAPSKRALWDT
TITEILAGIYEPDAQGKRPPESLYGSLKMWAHLRRQGIPVARCTVERIMR
YHNWRGVVRATKVRTTIADPAAERAPDLVKRRFKAVRPDVLWVADFTYVQ
LVCGRFVYTAFVIDVYAGVIVGWECSNSKHAGFVESALRQAAALRRRQGH
ALAGGTIHHSDAGSQYTAIHFGETLMIEGLVPSIGTVGDALDNALCETTI
GLYKTECVREGSPFRNGPLTTVADVESITSAWVHWYNTARLMHRLDRRPP
AEVEAEYYAQQPIGQHTGHT
433635375YP_007269002.1 Transposase [Mycobacterium canettii CIPT 140070017]MTMTLADTAAVAVADDGYVGSGKGPRGERPKRRTFTAEYKLGILEQYESL
TEPGARGALLRKEGLYSSHITEWKRLRDAGALDALAAKPSGPKPAQTEAD
KRAAKLEAENARLAAELAKAKQANEVLGKLSELLSLLSNSSDGETRQNL
433635373YP_007269000.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MNSGVEKMYKNNIAIAIGTLTMAVEFSMVSANAEPAPPPGQDPHMPNSAM
GYCPGGGFGGITGWGYCDGIRYPDGSYWHQVRVPAPFVGTTLTLSCVIDD
GSPVPPLAAPGSCGGSA
433635371YP_007268998.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MEGKIDMAARRQVTNKLRTQYRKASKADKGKILDRVVATTGMGRSTARRM
LTGPGLPDPAEQVDGRSLRARGFSDDARALLEHVWALMGMPCGKYLVVML
ELWLPLLTAAGDLDKPFATDAALAELTAMSAATVDRYLKPIRDKMRIKGI
STTKPSPLLRNSISIRTCADEAPDAPGVIEADTVAHCGPTLIGEFARTLT
MTDLVTGWTENHSIRNNASKWIVEGIEALQACFPFAMVIFDSDCGAEFIN
HEVAAWLQARDIEQTRSRPYQKNDQAHVESKNNHVVRKHAFYWRYDTGQE
LELLNRMWRLVSLRLNFFPPTKKAVGYTTTADGRRKRIYDKPATPWQRLQ
ASDALDAQQLSIVAARVDGINPADLTRQINTIQMQLLDLAKAKTDALAPA
RHIDLAALQPSINRLAKTT
433635369YP_007268996.1 Conserved membrane protein of unknown function [Mycobacterium canetMTDNECPADSRRRHVLRLALFAGILLGLFYLVAVARVIHVDGVRSAVAAT
GPIAPLAYVVVSAALGALFVPGPILAAGSGVLFGPLLGTFVTLGATVGTA
VVASFLGRRAGRNDAQALLGVDRAHRLDAQIERRGLWAVVGQRFVPGISD
ALASYTFGAFGVPLWQMAVGSFIGSAPRAFAYTALGASITDLSSPLAYSA
IAVWCVTAIIGAFAARRWYRKWRARPRGRVRPGPAHDR
433635367YP_007268994.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MSHDIATEEADDGALDRCVLCDLTGKRVDVKEATCTGRSATTLEQAFAVE
HDAGFDDFLHGPVGPWSAP
433635365YP_007268992.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MHAKVGDYLVVKGTTTERHDQHAEIIEVRSADGSPPYVVRWLVNGHQTTV
YPGSDAVVVTATEHAEAEKRAAARAGHAAT
433635363YP_007268990.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MVATRGRPCPTNFSRPQRPRVAGNGTKSQRCRGRLTTSMLGVAPEAKGPP
VKVHHLNCGTMNAFGIALLCHVLLVETDDGLVLVDTGFGIQDCLDPGRVG
LFRHVLRPAFLQAETAARQIEQLGYRTSDVRHIVLTHFDFDHIGGIADFP
EAHLHVTAAEARGAIHAPSLRERLRYRRGQWAHGPKLVEHGPDGEPWRGF
ASAKPLDAIGTGVVLVPMPGHTRGHAAVAVDAGHRWVLHCGDAFYHRGTL
DGRFRVPFVMRAEEKLLSYNRNQLRDNQARIVELHRRHDPDLLIVCAHDP
DLYQLARDTA
433635361YP_007268988.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MKYLDVDGIGQVSRIGLGTWQFGSREWGYGDRYATGAARDIVKRARALGV
TLFDTAEIYGLGKSERILGEALGDDRTEVVVASKVFPVAPFPAVIKNRER
ASARRLQLNRIPLYQIHQPNPVVPDSVIMPGMRDLLDSGDIGAAGVSNYS
LARWRKADAALGRPVVSNQVHFSLAHPDALEDLVPFAELENRIVIAYSPL
AQGLLGGKYGLDNRPGGVRALNPLFGTENLRRIEPLLATLRAIAVDVDAK
PAQVALAWLISLPGVVAIPGASSVEQLEFNVAAADIELNAQSRDALTDAA
RAFRPVSTGRFLTDMVREKVSRR
433635359YP_007268986.1 Haloalkane dehalogenase 1 [Mycobacterium canettii CIPT 140070017]MDVLRTPDSRFEHLVGYPFAPHYVDVTAGDTQPLRMHYVDEGPGDGPPIV
LLHGEPTWSYLYRTMIPPLSAAGHRVLAPDLIGFGRSDKPTRIEDYTYLR
HVEWVTSWFENLDLHDVTLFVQDWGSLIGLRIAAEHGDRIARLVVANGFL
PAAQGRTPLPFYVWRAFARYSPVLPAGRLVNFGTVHRVPAGVRAGYDAPF
PDKTYQAGARAFPRLVPTSPDDPAVPANRAAWEALGRWDKPFLAIFGYRD
PILGQADGPLIKHIPGAAGQPHARIKASHFIQEDSGPELAERMLSWQQAT
433635357YP_007268984.1 Putative aminotransferase [Mycobacterium canettii CIPT 140070017]MIPNPLEELTLEQLRSQRTSMKWRAHPADVLPLWVAEMDVKLPPTVADAL
RRAIDDGDTGYPYGTEYAEAVREFACQRWQWHDLEVSRTAIVPDVMLGIV
EVLRLITDRGDPVIVNSPVYAPFYAFVSHDGRRVIPAPLQGDGRIDLDAL
QEAFSSARASSGPSGNVAYLLCNPHNPTGSVHTADELRGIAERAQRFGVR
VVSDEIHAPLIPSGARFTPYLSVPGAENAFALMSASKAWNLGGLKAALAI
AGREAAADLARMPEEVGHGPSHLGVIAHTAAFRTGGNWLDALLRGLDHNR
TLLGALVDEHLPGVQYRWPQGTYLAWLDCRELGFDDVASDEMTEGLAVVS
DLSGPARWFLDHARVALSSGHVFGIGGAGHVRINFATSRAILIEAVSRMS
RSLLERR
433635355YP_007268982.1 Putative thiosulfate sulfurtransferase SseB [Mycobacterium canettiiMQARDQVLITAAELAGMIQAGDPVSILDVRWRLDEPDGRAAYLQGHLPGA
VFVSLEDELSDHTIAGRGRHPLPSGASLQATVRRCGIRHDVPVVVYDDWN
RAGSARAWWVLTAAGIANVRILDGGLPAWRSAGGSIETGQVSPQLGNVTV
LHDDLYAGQRLTLTAQQAGAGGVTLLDARAPERFRGDVEPVDAVAGHIPG
AINVPSGSVLADDGTFLGSGALNALLSDHGIDHGGRVGVYCGSGVSAAVT
VAALAVIGQDAALFPGSWSEWSSDPTRPVGRGTA
433635353YP_007268980.1 Putative CDP-diacylglycerol pyrophosphatase Cdh (CDP-diacylglycerolMPKSRRAVSLSVLIGTVIAALAGALIAVTVPARPNRPEADREALWKIVHD
RCEFGYRRTGAYAPCTFVDEQSGTALYKADFDPYQFLLIPLARITGIEDP
ALRESAGRNYLYDAWAARFLVTARLNNSLPESDVVLTINPKNARTQDQLH
IHISCSSPTTSAALRNVDTSEYVGWKQLPIDLGGRRFQGLAVDTKAFESR
NLFRDIYLKVTADGKKMENASIAVANVAQDQFLLLLAEGTEDQPVAAETL
QDHDCSITKS
433635351YP_007268978.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MTTVDFHFDPLCPFAYQTSVWIRDVRAQLGITINWRFFSLEEINLVAGKK
HPWERDWSYGWSLMRIGALLRRTDMSLLDRWYAAIGHELHTLGGKPHDPE
VARRLLCDVGVNAAILDAALDDPTTHDDVRADHQRVVAAGGYGVPTLFLD
GQCLFGPVLVDPPTGPAALNLWSVVTGMAGLPHVYELQRPKSPADVELIA
QQLRPYLDGRDWVSINRGEIVDIDRLAGRS
433635349YP_007268976.1 Putative esterase LipM [Mycobacterium canettii CIPT 140070017]MGAPSLTHVIRQIGALAVAAVTTAATINAYRPLARNGFASLWSWFIGLVV
TEFPLPTLASQLGGLVLTAQRLTRPVRAVSWLVAAFSALGLLNLSRAGRQ
ADAQLTAALDSGLGADRRTASAGLWRRPAGGGTAKTPGPLRMLRIYRDYA
HDGDISYGEYGRANHLDIWRRPDLDLTGTAPVLFQIPGGAWTTGNKRGQA
HPLMSHLAELGWICVAINYRHSPRNTWPDHIIDVKRALAWVKAHISEYGG
DPDFIAITGGSAGGHLSSLAALTPNDPRFQPGFEEADTRVQAAVPFYGVY
DFTRLQDAMHPMMLPLLERMVVKQPRTANMQSYLDASPVTHISADAPPFF
VLHGRNDSLVPVQQARGFVDQLRQVSKQPVVYAELPFTQHAFDLLGSARA
AHTAIAVEQFLAEVYATQHAGSEPGPAVAIP
433635347YP_007268974.1 Putative transcription regulator (LysR family) [Mycobacterium canetMPLSSRMPGLTCFEIFLAIAEAGSLGGAARELGLTQQAVSRRLASMEAQI
GVRLAVRTTRGSRLTPAGIVVAEWAARLLEVANEIDAGLGSLRTEGRQRI
RVVASQTIAEQLMPHWLLSLRAADMRRGGTVPEVILTATNSEHAIAAIRD
GIADLGFIENPCPPRGLGSVVVARDELVVVVPPGHKWARRSRVVSARELA
QTPLVTREPSSGIRDSLTAALRDALGEDMQQAPPVLELSSAAAVRAAVLA
GAGPAAMSRLAIADDLAFGRLLAVDIPALNLRRQLRAIWVGGRTPPAGAI
RDLLSHITSRST
433635345YP_007268972.1 Putative dehydrogenase [Mycobacterium canettii CIPT 140070017]MSEMTARFSEIVGNANLLTGDAIPEDYAHDEELTGPPQKPAYAAKPATPE
EVAQLLKAASENGVPVTARGSGCGLSGAARPVEGGLLISFDRMNKVLEVD
TANQVAVVQPGVALTDLDAATADTGLRYTVYPGELSSSVGGNVGTNAGGM
RAVKYGVARHNVLGLQAVLPTGEIIRTGGRMAKVSTGYDLTQLIIGSEGT
LALVTEVIVKLHPRLDHNASVLAPFADFDQVMAAVPKILASGLAPDILEY
IDNTSMAALISTQNLELGIPDQIRDSCEAYLLVALENRIADRLFEDIQTV
GEMLMELGAVDAYVLEGGSARKLIEAREKAFWAAKALGADDIIDTVVPRA
SMPKFLSTARGLAAAADGAAVGCGHAGDGNVHMAIVCKDPEKKKKLMTDI
FALAMELGGAISGEHGVGRAKTGYFLELEDPVKISLMRRIKQSFDPAGIL
NPGVVFGDT
433635343YP_007268970.1 Cytochrome P450 125 cyp125 [Mycobacterium canettii CIPT 140070017]MTATVLLEVPFSARGDRIPDAVAELRTREPIRKVRTVTGAEAWLVSSYAL
CTQVLEDRRFSMKETAAAGAPRLNALTVPPEVVNNMGNIADAGLRKAVMK
AITPKAPGLEQFLRDTANSLLDNLITEGAPADLRNDFADPLATALHCKVL
GIPQEDGPKLFRSLSIAFMSSADPIPAAKINWDRDIEYMAGILENPNITT
GLMGELGRLRKDPAYSHVSDELFATIGVTFFGAGVISTGSFLTTALISLI
QRPQLRNLLHEKPELIPAGVEELLRINLSFADGLPRLATADIQVGDVLVR
KGELVLVLLEGANFDPEHFPNPGSIELDRPNPTSHLAFGRGQHFCPGSAL
GRRHAQIGIEALLKKMPGVDLAVPIDQLVWRTRFQRRIPERLPVLW
433635341YP_007268968.1 Transposase (fragment) [Mycobacterium canettii CIPT 140070017]MKNIAVGSRVKVSADGYGVVSHAGMAMVRELADRSGLSAQVTAALADTYR
GPWVYAPGEVFADLAVAVADGADCIDAVGQLCGDREHVLGAKASTTTMWR
LIDERIDAGHLPRVRAARAAARAAAWAAGAAPEAGQWLHIDIDATLVIDH
SDNKEKAGATWKKSFGHHPLLAFLDRPEIAGGEALAGLLRPGGAGSNTAA
DHVSVLAQALAGLPARWRPDPDHRDDPDKPAVLVRCDTAGATHDFADACR
AAGVGFSFGYPVDWRVQDAVDTLNIGQCWYPAIDTDGGIRDGAWVAEATN
LVTCRRGRPGPG
433635339YP_007268966.1 Conserved membrane protein of unknown function [Mycobacterium canetMNRHSMAASDRGLQAERTTLAWTRTAFALLVNGVLLTLKDTQGADGPAGL
IPAGLAGAAASCCYVIALQRQRALSQRPLPARITPRGQVHILATAVLVLM
VVTAFAQLL
433635337YP_007268964.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MTTPPDKARRRFLRDAYKNAERVARTALLTIDQDQLEQLLDYVDERLGEQ
PCDHTARHAQRWAQSHRIEWEALAEGLQEFGGYCDCEIVMNVEPEAIFG
433635335YP_007268962.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MANDARPLARLANCRVGDQSSATHAYTVGPVLGVPPTGGVDLRYGGRAGI
GRSETVADHGAVGRRYPQPCAGQIRLSELRVTILLRCETLCETAQLLRCP
PLPVTVLRLSEFGGS
433635333YP_007268960.1 Putative cytochrome P450 124 Cyp124 [Mycobacterium canettii CIPT 14MGLNTAIATRVNGTPPPEVPIADIELGSLDFWALDDDVRDGAFATLRREA
PISFWPTIELPGFVAGNGHWALTKYDDVFYASRHPDIFSSYPNITINDQT
PELAEYFGSMIVLDDPRHQRLRSIVSRAFTPKVVARIEAAVRDRAHRLVS
SMIANNPDRQADLVSELAGPLPLQIICDMMGIPEADHQRIFHWTNVILGF
GDPDLATDFDEFMQVSADIGAYATALAEDRRVNHHDDLTSSLVEAEVDGE
RLSSREIASFFILLVVAGNETTRNAITHGVLALSRYPEQRDRWWSDFDGL
APTAVEEIVRWASPVVYMRRTLTQDIELRGTKMAAGDKVSLWYCSANRDE
SKFADPWTFDLARNPNPHLGFGGGGAHFCLGANLARREIRVAFDELRRQM
PDVVATEEPARLLSQFIHGIKTLPVTWS
433635331YP_007268958.1 Conserved protein of unknown function- proline rich protein [MycobaMATGARPALGLSIGVTNLAAVAADHSITRKPVLTLYRQRPPEVGVPSENP
RLDEPGLVITDFVDRVGDSVGIVAADGSVYRSEALVADALLALAYTATGG
RALPGSVTVTYPAHWGPAAVAALDSALRRASEWSHGTSSTAQPLSLLPDA
AAALYAIRADPGIPARGIVAVCDFGGSGTGITLVDAADEYRPVAATVRHQ
AFSGDLIDQSLLSYVMSELPGTGAFDPAGTSAIGSLTKLRTECRNAKERL
SSSTVTTLTDALGGDIRLTRNELEDTIRDSLDSVGRALEQTLARSGIRTA
ELVAIVSVGGGANIPAVTTTLSGRFCVPVVRKPRPQLTAAFGGALWAARR
PGDTSATVLTAVTSATATAPADAPASVLQPALAWSEADEDSHIGPAPGYT
AARPSLSFDHDAHAEPEPKSPPIPWYRLPAVIITGTTVAVLLVGAALAIG
LSTGDQPTAPGTPERPGVTTTAAPPPSPAPASDGPTTEPAPPVQAPATGG
PAPPLQQPLPPPPTTTNTQPAVTTDVITPAPTTPTSAPPATTQPPATTQP
PATTQPPATTSPSPPPIPPIPPIPEIPQLPPGIPQVPGIGQFSAISGS
433635329YP_007268956.1 Conserved membrane protein of unknown function- possible apolipoproMLIGMALRAGARRQPVIGCAAALVFGGLPALAFPAPSWWWLAWFGLVPLL
LVVRAAPTSWEGALRAWTGMGGFVLATQYWLVTSAGPMLVLLAAGLGVLW
LPAGWLAHRLLSVPVTTCRVGAALVVVPSAWVAAEAVRSWQSLGGPWALL
GASQWSQPVTLASASLGGVWLTSFLLVATNTAIASVLVCRATGGRLVALG
CVIGCAGLGPASYLLGSVPVGGPTVRVALVQAGDIADAAARLAAGEEFTA
AVADQRPDLVVWGESSVGQDLTRHPDVLARLAELSQRVGADLLVNVDAPA
PDGGIYKSAVLVGAHEAVGSYRKTRLVPFGEYVPLRPLFGWITRYSKAAA
KDRQRGAGPVVLAVNSLHIAPLISYEMTFSDLTRHAAQLGAALLVYQSST
STFQGSWAQPQLAAQPAVRAVEAGIPAVHASLSGDSSAFDTRGRRLAWCS
AEFNGAIVVNVPLASNVTPYLRLGDWVPVTAFVVMGAGFAVFLRRSLARV
SDCADK
433635327YP_007268954.1 S-nitrosomycothiol reductase MscR [Mycobacterium canettii CIPT 1400MSQTVRGVVSRQKGEPVELVDIVVPDPGPGEALVDVTACGVCHTDLTYRE
GGINDEYPFLLGHEAAGIVEAVGPGVTAVEPGDFVILNWRAVCGQCRACK
RGRPRYCFDTFNAEQKMTLTDGTALTPALGIGAFADKTLVHSGQCTKVDP
AADPAVAGLLGCGVMAGLGAAINTGGVTRDDTVAVIGCGGVGDAAIAGAA
LVGAKRIIAVDTDDTKLDWARTFGATHTVNAREVDVVQAIGGLTDGFGVD
VVIDAVGRPETYQQAFYARDLAGTVVLVGVPTPDMRLDMPLVDFFSHGGA
LKSSWYGDCLPESDFPTLIDLYLQGRLPLQRFVSERIGLEDVEEAFHKMH
GGKVLRSVVML
433635325YP_007268952.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MTALEVLGGWPVPAAAAAVIGPAGVLATHGDTARVFALASVTKPLVARAA
QVAVEEGVVNLDTPAGPPGSTVRHLLAHTSGLAMHSDQALARPGTRRMYS
NYGFTVLAESVQRESGIEFGRYLTEAVCEPLGMVTTRLDGGPAAAGFGAS
STVADLAVFAGDLLRPSTVSAQMHADATTVQFPGLDGVLPGYGVQRPNDW
GLGFEIRNSKSPHWTGECNSTRTFGHFGQSGGFIWVDPKADLALVVLTAR
DFGDWALDLWPAISDAVLAEYT
433635323YP_007268950.1 Conserved membrane protein of unknown function [Mycobacterium canetMTLAHALRATTAIAVVVGVALASLLWQLLLVSAGAFLGSRATASVRRMTV
LAGNAVVAAFGAVLVVHAFA
433635321YP_007268948.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MIPGQLSRREIGRVTALTNPLSGHGAAVKAAHGAIARLKHRGVNVVEIVG
GDAHDARHLLAAAVAKGTDAVMVTGGDGVVSNALQVLAGTDIPLGIIPAG
TGNDHAREFGLPTKNPKAAADIVVDGWTETIDLGRIQGDNGVEKWFGTVA
ATGFDSLVNDRANRMRWPHGRMRYYIAMLAELSRLRPLPFRLVLDGTEEI
IADLTLADFGNTRSYGGGLLICPNADHSDGLLDITMAQSDSGTKLLRLFP
TIFKGAHVELDEVSTTRAKTVHVECPGINVYADGDFACPLPAEISAVPAA
LQVLRPHHG
433635319YP_007268946.1 Putative transcriptional regulatory protein- TetR family [MycobacteMQRVTLAEIARRAGVSRPTVYRRWPDTRSILADVLTTHIVRIMWQVQAHG
EDREAVVDRVVKVADGVLNDDVVMTLMRSEMGLVYIAERLGTSQWMMVET
VADWLRVAQQRGSVRPGNPRQLATMVVLLTQSTIQSAQIVRPVLDAGALA
TELTYALNGYLS
433635317YP_007268944.1 Acetyl/propionyl-CoA carboxylase (beta subunit) AccD6 [MycobacteriuMTIMAPEAVGESLDPRDPLLRLSNFFDDGSVELLHERDRSGVLAAAGTVN
GVRTIAFCTDGTVMGGAMGVEGCTHIVNAYDTAIEDQSPIVGIWHSGGAR
LAEGVRALHAVGQVFEAMIRASGYIPQISVVVGFAAGGAAYGPALTDVVV
MAPESRVFVTGPDVVRSVTGEDVDMASLGGPETHHKKSGVCHIVADDELD
AYDRGRRLVGLFCQQGHFDRSKAEAGDTDIHALLPESSRRAYDVRPIVTA
ILDADTPFDEFQANWAPSMVVGLGRLSGRTVGVLANNPLRLGGCLNSESA
EKAARFVRLCDAFGIPLVVVVDVPGYLPGVDQEWGGVVRRGAKLLHAFGE
CTVPRVTLVTRKTYGGAYIAMNSRSLNATKVFAWPDAEVAVMGAKAAVGI
LHKKKLAAAPEHEREALHDELAAEHERIAGGVDSALDIGVVDEKIDPAHT
RSKLTEALAQAPARRGRHKNIPL
433635315YP_007268942.1 3-oxoacyl-[acyl-carrier protein] synthase 1 KasA (beta-ketoacyl-ACPMSQPSTANGGFPSVVVTAVTATTSISPDIESTWKGLLAGESGIHALEDEF
ITKWDLPVKIGGHLKDPVDSHMGRLDMRRMSYVQRMGKLLGGQLWESAGS
PEVDPDRFAVVVGTGLGGAERIVESYDLMNAGGPRKVSPLAVQMIMPNGA
AAVIGLQLGARAGVMTPVSACSSGSEAIAHAWRQIVMGDADVAVCGGVEG
PIEALPIAAFSMMRAMSTRNDEPERASRPFDKDRDGFVFGEAGALMLIET
EEHAKARGAKPLARLLGAGITSDAFHMVAPAADGVRAGRAMTRSLELAGL
SPADIDHVNAHGTATPIGDAAEANAIRVAGCQQAAVYAPKSALGHSIGAV
GALESVLTVLTLRDGVIPPTLNYETPDPEIDLDVVAGEPRYGDFRYAVNN
SFGFGGHNVALAFGRY
433635313YP_007268940.1 Malonyl CoA-acyl carrier protein transacylase [Mycobacterium canettMIALLAPGQGSQTEGMLSPWLQLPGAADQIAAWSKAADLDLARLGTTAST
EEITDTAVAQPLIVAATLLAHQELARRCVLAGKDVIVAGHSVGEIAAYAI
AGVIAADDAVALAATRGAEMAKACATEPTGMSAVLGGDETEVLSRLEQLD
LVPANRNAAGQIVAAGRLTALEKLAEDPPAKARVRALGVAGAFHTEFMAP
ALDGFAAAAANIATAEPTATLLSNRDGKPVTSAAAAMDTLVSQLTQPVRW
DLCTATLREHTVTAIVEFPPAGTLSGIAKRELRGVPTRAVKSPADLDELA
NL
433635311YP_007268938.1 Putative pyruvate dehydrogenase E1 component AceE (pyruvate decarboMASYLPDIDPEETSEWLESFDTLLQRCGPSRARYLMLRLLERAGEQRVAI
PALTSTDYVNTIPTELEPWFPGDEDVERRYRAWIRWNAAIMVHRAQRPGV
GVGGHISTYASSAALYEVGFNHFFRGKSHPGGGDQVFIQGHASPGIYARA
FLEGRLTAEQLDGFRQEHSHVGGGLPSYPHPRLMPDFWEFPTVSMGLGPL
NAIYQARFNHYLHDRGIKDTSDQHVWCFLGDGEMDEPESRGLAHVGALEG
LDNLTFVINCNLQRLDGPVRGNGKIIQELESFFRGAGWNVIKVVWGREWD
ALLHADRDGALVNLMNTTPDGDYQTYKANDGGYVRDHFFGRDPRTKALVE
NMSDQEIWNLKRGGHDYRKVYAAYRAAVDHKGQPTVILAKTIKGYALGKH
FEGRNATHQMKKLTLEDLKEFRDTQRIPVSDAQLEENPYLPPYYHPGLNA
PEIRYMLDRRRALGGFVPERRTKSKALTLPGRDIYAPLKKGSGHQEVATT
MATVRTFKEVLRDKQIGPRIVPIIPDEARTFGMDSWFPSLKIYNRNGQLY
TAVDADLMLAYKESEVGQILHEGINEAGSVGSFIAAGTSYATHNEPMIPI
YIFYSMFGFQRTGDSFWAAADQMARGFVLGATAGRTTLTGEGLQHADGHS
LLLAATNPAVVAYDPAFAYEIAYIVESGLARMCGENPENIFFYITVYNEP
YVQPPEPENFDPEGVLRGIYRYHAATEQRTNKAQILASGVAMPAALRAAQ
MLAAEWDVAADVWSVTSWGELNRDGVAIETEKLRHPDRPAGVPYVTRALE
NARGPVIAVSDWMRAVPEQIRPWVPGTYLTLGTDGFGFSDTRPAARRYFN
TDAESQVVAVLEALAGDGEIDPSVPVAAARQYRIDDVAAAPEQTTDPGPG
A
433635309YP_007268936.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MPIATVCTWPAETEGGSTVVAADHASNYARKLGIQRDQVIQEWGWDEDTD
DDIRAAIEEACGGELLDEDTDEVIDVVLLWWRDGDGDLVDTLMDAIGPLA
EDGVIWVVTPKTGQPGHVLPAEIAEAAPTAGLMPTSSVNLGNWSASRLVQ
PKSRAGKR
433635307YP_007268934.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MTSDQLPATKADLYAAVDAMRADMRELLEQISTLIREATQK
433635305YP_007268932.1 Cobalamin biosynthesis transmembrane protein CobD [Mycobacterium caMFASTWQTRAVGVLVGCLLDVVFGDPKRGHPVALFGRAAAKLEQITYRDG
RVAGAVHVGLLVGAVGLLGAALQRLPGRRWPVAATATATWAALGGTSLAR
TGRQMSDLLERDDVEAARRLLPSLCGRDPAQLGGPGLTRAALESVAENTA
DAQVVPLLWAASGGVPAVLGYRAINTLDSMIGYRSPRYLRFGWAAARLDD
WANYVGARATAVLVVICAPVVGGSPRGAVRAWRRDAARHPSPNAGVVEAA
FAGALDVRLGGPTRYHHELQIRPTLGDGRSPTVADLRRAVVLSRVVQAGA
AVLAVMLVYRRRP
433635303YP_007268930.1 Phosphotyrosine protein phosphatase PtpA (protein-tyrosine-phosphatMSDPLHVTFVCTGNICRSPMAEKMFAQQLRHRGLGDAVRVTSAGTGNWHV
GSCADERAAGVLRAHGYPTDHRAAQVGTEHLAADLLVALDRNHARLLRQL
GVEAARVRMLRSFDPRSGTHALDVEDPYYGDHSDFEEVFAVIESALPGLH
DWVDERLARNGPS
433635301YP_007268928.1 Conserved protein of unknown function- probable VapC16-like toxin (MTKSVMRVGVHEAKTRLSELLRLVDGGQEVEIARRGEPVAKLVPLHPQET
RRLGIDHGVYRVPDDFDAPLSDDVLETFHR
433635299YP_007268926.1 Putative aminotransferase CobC [Mycobacterium canettii CIPT 1400700MLWILGPHTGPLLFDAVASLDTSPLAAARYHGDQDVAPGMLDFAVNVRHD
RPPEWLVRQLAALLPELARYPSTDDVHRAQDAVAERHGRTRDEVLPLVGA
AEGFALLPNLSPVRAAIVVPAFTEPAIALSAAGITAHHVVLKPPFVLDTA
HVPDDADLVVVGNPTNPTSVLHLREQLLELRRPGRILVVDEAFADWVPGE
PQSLAGDSLPDVLVLRSLTKTWSLAGLRVGYALGSPDVLARLTVQRAHWP
LGTLQLTAIAACCAPRAVAAAAADVVRLTALRAEMVAGLRSVGAEVVDGA
APFVLFNIADADGLRNYLQSKGIAVRRGDTFVGLDARYLRAAVRPEWPVL
VAAIAEWAKRGGRR
433635297YP_007268924.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MKAGVAQQRSLLELAKLDAELTRIAHRATHLPQRAAYQQVQAEHNAANDR
MAALRIAAEDLDGQVSRFESEIDAVRKRGDRDRSLLTSGATDAKQLADLQ
HELDSLQRRQASLEDALLEVLERREELQAQQTAESRALEALRADLVAAQQ
ALDEALAEIDQVRHQHSSQRDMLTATLDPELVGLYERQRAGGGPGAGRLQ
GHRCGACRIEIGRGELAQISAAAEDEVVRCPECGAILLRLEGFEE
433635295YP_007268922.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MTRWDKRVDSGDWDAIAAEVSEYGGALLPRLITPGEAARLRKLYADDSLF
RSTIDMASKRYGAGQYRYFHAPYPEPIERLKQALYPKLLPIARNWWAKLG
REAPWPDSLDDWLASCHAAGQTRSTALMLKYGTNDWNALHQDLYGELVFP
LQVVINLSDPETDYTGGEFLLVEQRPRAQSRGTATQLPQGHGYVFTTRDR
PVRTSRGWSASPVRHGLSTIRSGERYAMGLIFHDAA
433635293YP_007268920.1 Putative 3-methyl-2-oxobutanoate hydroxymethyltransferase PanB [MycMSEQTIYGANTPGGSGPRTKIRTHHLQRWKADGHKWAMLTAYDYSTARIF
DEAGIPVLLVGDSAANVVYGYDTTVPISIDELIPLVRGVVRGAPHALVVA
DLPFGSYEAGPTAALAAATRFLKDGGAHAVKLEGGERVAEQIACLTAAGI
PVMAHIGFTPQSVNTLGGFRVQGRGDAAEQTIADAIAVAEAGAFAVVMEM
VPAELATQITGKLTIPTVGIGAGPNCDGQVLVWQDMAGFSGAKTARFVKR
YADVGGELRRAAMQYAQEVAGGVFPADEHSF
433635291YP_007268918.1 Exported protease [Mycobacterium canettii CIPT 140070017]MVAMWRRRPLSSALLSFGLLLGGLPLAAAPLAGATEEPGAGQTPGAPVAA
PQQSWNSCREFIADTSEIRTARCATVSVPVDYDQPGGTQAKLAVIRVPAT
GQRFGALLVNPGGPGASAVDMVAAMAPAIADTDILRHFDLVGFDPRGVGH
STPALRCRTDAEFDEYRRDPMADYSPAGVTHIEGVYRQLAQDCVDRMGSS
FLANIGTASVARDMDMVRQALGDDQINYLGYSYGTELGTAYLERFGTHVR
AMVLDGAIDPAVSPIEESISQMAGFQTAFNDYAADCARSPACPLGTDPAQ
WVNRYHALVDPLVQKPGKTSDPRGVSYADATTGTINALYSPQRWKYLTSG
LLGLQRGTDAGDLLVLADDYDGRDADGRYSNDQDAFNAVRCVDAPTPADP
AAWVAADQRIRQVAPFLSYGQFTGSAPRDLCALWPVPATSTPHPAAPAGA
GKVVVVSTTHDPATPYQSGVDLARQLGAPLITFDGTQHTAVFDGNQCVDS
AVVHYFLDGTLPPTSLRCAP
433635289YP_007268916.1 Glutamate-ammonia-ligase adenylyltransferase GlnE (glutamine-syntheMVVTKLATQRPKLPSVGRLGLVDPPAGERLAQLGWDRHEDQSHVDLLWSL
SRAPDADAALRALIRLSENPDTGWDELNAALLRERSLRGRLFSVLGSSLA
LGDHLVAHPQSWKLLRGKVTLPSHDQLQRSFVECVEESAGMPGSLVHRLR
TRYRDYVLMLAALDLAATVEDEPVLPFTVVAARLADAADAALAAALRVAE
ASVCGEHPPPRLAVIAMGKCGARELNYVSDVDVIFVAERSDPRNARVASE
MMRVASAAFFEVDAALRPEGRNGELVRTLESHIAYYQRWAKTWEFQALLK
ARPVVGDAELGERYLTALMPMVWRACEREDFVVEVQAMRRRVEQLVPADV
RGRELKLGSGGLRDVEFAVQLLQLVHARSDESLRVASTVDALAALGEGGY
IGREDAANMTASYEFLRLLEHRLQLQRLKRTHLLPDPEDEEAVRWLARAA
HIRPDGRNDAAGVLREELKKQNVRVSKLHTKLFYQPLLESIGPTGLEIAH
GMTLEAAGRRLAALGYEGPQTALKHMSALVNQSGRRGRVQSVLLPRLLDW
MSYAPDPDGGLLAYRRLSEALATESWYLATLRDKPAVAKRLMHVLGTSAY
VPDLLMRAPRVIQQYEDGPAGPKLLETEPATVARALIASASRYPDPERAI
AGARTLRRRELARIGSADLLGLLEVTEVCRALTSVWVAVLQAALDVMIRA
SLPDDGRAPAAIAVIGMGRLGGAELGYGSDADVMFVCEPATGVDDARAVK
WSTSIAERVRALLGTPSVDPPLELDANLRPEGRNGPLVRTLGSYAAYYEQ
WAQPWEIQALLRAHAVAGDAELGQRFLRMVDKTRYPPDGVSADSVREIRR
IKARIESERLPRGADPNTHTKLGRGGLADIEWTVQLLQLQHAHQVPALHN
TSTLQSLDVIAAADLVPAADVELLRQAWLTATRARNALVLVRGKPTDQLP
GPGRQLNAVAVAAGWRNDDGGEFLDNYLRVTRRAKAVVRKVFGS
433635287YP_007268914.1 Conserved membrane protein of unknown function [Mycobacterium canetMTAKSPPDYPGKTLGLPDTGPGSLAPMGRRLAALLIDWLIAYGLALLGVE
FGVWSTPMLSTVVLVIWLLLGVAAVRLFGFTPGQLALGLVVVAVGGHQPV
GIGRLVVRGLLIGLVVPPLFTDSDGRGLHDRLTATAVVRR
433635285YP_007268912.1 Putative lipoate biosynthesis protein A LipA (Lipoyl synthase) [MycMSVAAEGRRLLRLEVRNAQTPIERKPPWIKTRARIGPEYTELKNLVRREG
LHTVCEEAGCPNIFECWEDREATFLIGGDQCTRRCDFCQIDTGKPAELDR
DEPRRVADSVRTMGLRYATVTGVARDDLPDGGAWLYAATVRAIKELNPST
GVELLIPDFNGEPTRLAEVFESGPEVLAHNVETVPRIFKRIRPAFTYRRS
LGVLTAARDAGLVTKSNLILGLGETSDEVRTALGDLRDAGCDIVTITQYL
RPSARHHPVERWVKPEEFVQFARFAEGLGFAGVLAGPLVRSSYRAGRLYE
QARTSRALASR
433635283YP_007268910.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MANAVVAIAGSSGLIGSALTAALRAADHTVLRIVRRAPANSEELHWNPES
GEFDPHALTDVDAVVNLCGVNIAQRRWSGAFKQSLRDSRITPTEVLSAAV
ADAGVATLINASAVGYYGSTKDRVVDENDSAGTGFLAQLCVDWEAATRPA
QQSGARVVLARTGVVLSPAGGMLRRMRPLFSVGLGARLGSGRQYMSWISL
EDEVRALQFAIAQPNLSGPVNLTGPAPVTNAEFTTAFGRAVNRPTPLMLP
SVAVRAAFGEFADEGLLIGQRAIPSALERAGFQFHHNTIGEALGYATTRP
G
433635281YP_007268908.1 Putative short-chain dehydrogenase EphD [Mycobacterium canettii CIPMPATQQISRLVDSPDGVRIAVYHEGNPDGPTVVLVHGFPDSHVLWDGVVP
LLAERFRIVRYDNRGVGRSSVPKPISAYTMAHFADDFDAVIGELSPGEPV
HVLAHDWGSVGVWEYLRRPGASDRVASFTSVSGPSQDHLVNYVYGGLRRP
WRPRTFVRAISQTLRLSYMALFSVPVVAPLLLRVALSSAAVRRNMVGDIP
VDQIHHSETLARDAAHSVKTYPANYFRSFSSSRRGRAIPIVDVPVQLIVN
SQDPYVRPYGYDQTARWVPRLWRRDIKAGHFSPMSHPQVMAAAVHDFADL
ADGKQPSRALLRAQVGRPRGYFGDTLVSVTGAGSGIGRETALAFAREGAE
IVISDIDEATVKDTAAEIGARGGIAYPYVLDVSDAEAVEAFAERVSAEHG
VPDIVVNNAGIGQAGRFLDTPAEQFDRVLAVNLGGVVNGCRAFGRRLVER
GTGGHIVNVSSMAAYAPLQSLSAYCTSKAATYMFSDCLRAELDAAGVGLT
TICPGVIDTNIVATTGFHAPGTDEEKIDGRRGQIDKMFALRSYGPDKVAD
AIVSAVKKKKPIRPVAPEAYALYGISRVLPQALRSTARLRVI
433635279YP_007268906.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MCDSLDFDALEAAGIANPRERAGLLTYLDELGFTVEEMVQAERRGRLFGL
AGDVLLWSGPPIYTLATAADELGLSADDVARAWSLLGLTVAGPDVPTLSQ
ADVDALATWVALKALVGEDGAFGLLQVLGTAMARLAEAESTMIRAGSPNI
QMTHTHDELATARAYRAAAEFVPRIGALIDTVHRHHLASARTYFEGVIGD
TSASVTCGIGFADLSSFTALTQALTPAQLQDLLTEFDAAVTDVVHADGGR
LVKFIGDAVMWVSSSPERLVRAAVDLVDHPGARAAELQVRAGLAYGTVLA
LNGDYFGNPVNLAARLVAAAAPGQILAAAQLRDMLPDWPALAHGPLTLKG
FDAPVMAFELHDNPRARDADTPRPAASD
433635277YP_007268904.1 Putative branched-chain amino acid transaminase IlvE [MycobacteriumMTSGSLEFTVLRAANPATDAQRESMLREPGFGKYHTDHMVSIDYAEGRGW
HNARVIPYGPIELDPSAIVLHYAQEVFEGLKAYRWADGSIVSFRADANAA
RLRSSARRLAIPELPDAVFIESLRQLIAVDKAWVPGAGGEEALYLRPFIF
ATEPGLGVRPATQYRYLLIASPAGAYFKGGIAPVSVWVSTEYVRACPGGT
GAAKFGGNYAASLLAQAEAAENGCDQVVWLDAAERRYIEEMGGMNIFFVL
GSGGSARLVTPELSGSLLPGITRDSLLQLAIDAGFAVEERRIDIDEWQKK
AAAGEITEVFACGTAAVITPVARVRHGASEFTIADGQPGEVTMALRDTLT
GIQRGTFADTHGWMARLG
433635275YP_007268902.1 Putative cobalamin 5'-phosphate synthase CobS [Mycobacterium canettMMRSLATAFAFATVIPTPGSATTPMGRGPMTALPVVGAALGALAAAIAWA
GAQVFGPSSPLSGMLTVAVLLVVTRGLHIDGVADTADGLGCYGPPQRALV
VMRDGSTGPFGVAAVVLVIALQGLAFATLTSVGIAGITLAVLSGRVTAVL
VCRRSVPAAHGSTLGTQVAGTQPAPVVAAWLAVLLAVSVPAGPRPWQGPI
AVLVAVTAGAALAAHCVHRFGGITGDVLGSAIELSTTVSAVTLAGLARL
433635273YP_007268900.1 Conserved membrane protein of unknown function [Mycobacterium canetMKLLGHRKSHGHQRADASPDAGSRDGCRPDSGRASGSDTSRGSQTTGPKG
RPTPKRSQSRRHTKKGPVAPAPMTAAQARARRKSLAGPKLSREERRAEKA
ANRARMTERRERMMAGEEAYLLPRDRGPVRRYVRDVVDSRRNLLGLFMPS
ALTLLFVMFAVPQVQLFLSPAMLILMALMTIDAIILGRKVGRLVDTKFPS
NTESRWRLGLYAAGRASQIRRLRAPRPQVERGGDVG
433635271YP_007268898.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MTVQNEPSAKTHGVILTEAAAAKAKSLLDQEGRDDLALRIAVQPGGCAGL
RYNLFFDDRTLDGDQTAEFGGVRLIVDRMSAPYVEGASIDFVDTIEKQGF
TIDNPNATGSCACGDSFN
433635269YP_007268896.1 Adenosine kinase [Mycobacterium canettii CIPT 140070017]MTIAVTGSIATDHLMRFPGRFSEQLLPEHLHKVSLSFLVDDLVMHRGGVA
GNMAFAIGVLGGEVALVGAAGADFADYRDWLKARGVNCDHVLISETAHTA
RFTCTTDVDMAQIASFYPGAMSEARNIKLADVVSAIGKPELVIIGANDPE
AMFLHTEECRKLGLAFAADPSQQLARLSGEEIRRLVNGAAYLFTNDYEWD
LLLSKTGWSEADVMAQIDLRVTTLGPKGVDLVEPDGTTIHVGVVPETSQT
DPTGVGDAFRAGFLTGRSAGLGLERSAQLGSLVAVLVLESTGTQEWQWDY
EVAASRLAGAYGEDAAAEIVAVLA
433635267YP_007268894.1 Putative transmembrane cytochrome C oxidase (subunit II) CtaC [MycoMTPRGPGRLQRLSQCRPQRGSGGPARGLRQLALAAMLGALAVTVSGCSWS
EALGIGWPEGITPEAHLNRELWIGAVIASLAVGVIVWGLIFWSAVFHRKK
NTDTELPRQFGYNMPLELVLTVIPFLIISVLFYFTVVVQEKMLQIAKDPE
VVIDITSFQWNWKFGYQRVNFKDGTLTYDGADPERKRAMVSKPEGKDKYG
EELVGPVRGLNTEDRTYLNFDKVETLGTSTEIPVLVLPSGKRIEFQMASA
DVIHAFWVPEFLFKRDVMPNPVANNSVNVFQIEEITKTGAFVGHCAEMCG
TYHSMMNFEVRVVTPNDFKAYLQQRIDGKTNAEALRAINQPPLAVTTHPF
DTRRGELAPQPVG
433635265YP_007268892.1 Conserved membrane protein of unknown function- MmpS3 [MycobacteriuMSGPNPPGREPDEPESEPVSDTGDERASGNHLPPVAGGGDKLPSDQTGET
DAYSRAYSAPESEHVTGGPYVPADLRLYDYDDYEESSDLDDELAAPRWPW
VVGVAAIIAAVALVVSVSLLVTRPHTSKLATGDTTSSAPPVQDEITTTKP
APPPPPPAPPPTTEIPTATETQTVTVTPPPPPPPATTTAPPPATTTTAAA
PPPTTTTPTGPRQVTYSVTGTKAPGDIISVTYVDAAGRRRTQHNVYIPWS
MTVTPISQSDVGSVEASSLFRVSKLNCSITTSDGTVLSSNSNDGPQTSC
433635263YP_007268890.1 Ubiquinol-cytochrome C reductase cytochrome b subunit [MycobacteriuMSPKLSPPNIGEVLARQAEDIDTRYHPSAALRRQLNKVFPTHWSFLLGEI
ALYSFVVLLITGVYLTLFFDPSMVDVTYNGVYQPLRGVEMSRAYQSALDI
SFEVRGGLFVRQIHHWAALMFAAAIMVHLARIFFTGAFRRPRETNWVIGS
LLLILAMFEGYFGYSLPDDLLSGLGLRAALSSITLGMPVIGTWLHWALFG
GDFPGTILIPRLYALHILLLPGIILALIGLHLALVWFQKHTQFPGPGRTE
HNVIGVRVMPVFAFKSGAFFAAIVGVLGLMGGLLQINPIWNLGPYKPSQV
SAGSQPDFYMMWTEGLARIWPPWEFYFWHHTIPAPVWVAVIMGLVFVLLP
AYPFLEKRFTGDYAHHNLLQRPRDVPVRTAIGAMAIAFYMVLTLAAMNDI
IALKFHISLNATTWIGRIGMVILPPFVYFITYRWCIGLQRSDRSVLEHGV
ETGIIKRLPHGAYIELHQPLGPVDEHGHPIPLQYQGAPLPKRMNKLGSAG
SPGSGSFLFADSAAEDAALREAGHAAEQRALAALREHQDSIMGSPDGEH
433635261YP_007268888.1 Putative ubiquinol-cytochrome C reductase QcrC (cytochrome C subuniMTKLGFTRSGGSKSGRTRRRLRRRLSGGVLLLIALTIAGGLAAVLTPTPQ
VAVADESSSALLRTGKQLFDTSCVSCHGANLQGVPDHGPSLIGVGEAAVY
FQVSTGRMPAMRGEAQAPRKDPIFDEAQIDAIGAYVQANGGGPTVVRNPD
GSIATQSLRGNDLGRGGDLFRLNCASCHNFTGKGGALSSGKYAPDLAPAN
EQQILTAMLTGPQNMPKFSNRQLSFEAKKDIIAYVKVATEARQPGGYLLG
GFGPAPEGMAMWIIGMVAAIGLALWIGARS
433635259YP_007268886.1 Anthranilate phosphoribosyltransferase TrpD [Mycobacterium canettiiMALSAEGSSGGSRGGSPKAEAASVPSWPQILGRLTDNRDLARGQAAWAMD
QIMTGNARPAQIAAFAVAMTMKAPTADEVGELAGVMLSHAHPMPADTVPD
DAVDVVGTGGDGVNTVNLSTMAAIVVAAAGVPVVKHGNRAASSLSGGADT
LEALGVRIDLGPDLVARSLAEVGIGFCFAPRFHPSYRHAAAVRREIGVPT
VFNLLGPLTNPARPRAGLIGCAFADLAEVMAGVFAARRSSVLVVHGDDGL
DELTTTTTSTIWRVAAGSVDKLTFDPAGFGFARAQLDQLAGGDAQANAAA
VRAVLGGARGPVRDAVVLNAAGAIVAHAGLSSRAEWLPAWEEGLRRASAA
IDTGAAEQLLARWVRFGRQI
433635257YP_007268884.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MARSGPDTSGGTAPGPGAPVVIDCDDCAARGPGCRDCVVSVLIGVPESLS
HDERAALEVLADVGLAPRLRLVPVRRQRGSGVA
433635255YP_007268882.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MRDGPAAPAQVVAPADGFVALRVADDRTVRLLSLGGAATDRLLSRVAAGI
HAAVDEVVAFWGTDWSHDIFVVAAGSDEQFHAAAGGGLASQWADIAAITV
VDRVDPARRTVVGQRIVFAPGAARMSQTALRIVLGHELFHYAARADTALD
APRWLAEGVADFVARPKTAPPADAVSVALSLPSDTDLDTPGPQRSLAYDR
AWWFARFVAAAYGTAKLRELYLATCGVGHFDLATAARHVLGIDAAGLLAR
WQRWLMG
433635253YP_007268880.1 Putative long-chain-fatty-acid-CoA ligase FadD15 (fatty-acid-CoA syMREISVPAPFTVGEHDNVAAMVFEHERDDPDYVIYQRLIDGVWTDVTCAE
AANQIRAAALGLISLGVQAGDRVVIFSATRYEWAILDFAILAVGAVTVPI
YETSSAEQVRWVLQDSEAVVLFAETDSHATMVAELSGSVPALREVLQIAG
SGPNALDRLTEAGASVDPAELTARLAALRSTDPATLIYTSGTTGRPKGCQ
LTQSNLVHEIKGARAYHPTLLRKGERLLVFLPLAHVLARAISMAAFHSKV
TVGFTSDIKNLLPMLAVFKPTVVVSVPRVFEKVYNTAEQNAANAGKGRIF
AIAAQTAVDWSEACDRGGPGLLLRAKHAVFDRLVYRKLRAALGGNCRAAV
SGGAPLGARLGHFYRGAGLTIYEGYGLSETSGGVAISQFNDLKIGTVGKP
VPGNSLRIADDGELLVRGGVVFSGYWRNEQATTEAFTDGWFKTGDLGAVD
EDGFLTITGRKKEIIVTAGGKNVAPAVLEDQLRAHPLISQAVVVGDAKPF
IGALITIDPEAFEGWKQRNSKTAGASVGDLATDPDLIAEIDAAVKQANLA
VSHAESIRKFRILPVDFTEDTGELTPTMKVKRKVVAEKFASDIEAIYNKE
433635251YP_007268878.1 Conserved protein of unknown function TB16.3 [Mycobacterium canettiMADKTTQTIYIDADPGEVMKAIADIEAYPQWISEYKEVEILEADDEGYPK
RARMLMDAAIFKDTLIMSYEWPEDRQSLSWTLESSSLLKSLEGTYRLAPK
GSGTEVTYELAVDLAVPMIGMLKRKAERRLIDGALKDLKKRVEG
433635249YP_007268876.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MSGAHTDVRPELRKLAQAILDGIDPAVRVAAAMASGGGPGTGKCQQVWCP
LCALAALVTGEQHPLLTVIADHSLALLEVIRAIVDDIDRSAKPPPEGPPG
GGQTGASGGENTNGEGSMKSHYQAIPVTIEE
433635247YP_007268874.1 Putative alpha(1->2)mannosyltransferase. Probable conserved integraMSAWRAPEVGSRLGRRVWWCLLWLLAGVALGYVAWRLFGHTPYRIDIDIY
QMGARAWLDGRPLYGGGVLFHTPIGLNLPFTYPPLAAVLFSPFAWLQMPA
ASVAITVLTLVLLVVSTTVVLTGLDAWPTSRLVPAPARLRRLWLAVLIVA
PATIWLEPISSNFAFGQINVVLMTLVIVDCFPRRTPWPRGLMLGLGIALK
LTPAVFLLYFLLRRDGRAALTALASFAVATLLGFVLAWRDSWEYWTHTLH
HTDRIGAAALNTDQNIAGALARLTIGDDERFALWVAGSLLVLAATIWAMR
RVLRAGEPTLAVICVALFGLVVSPVSWSHHWVWMLPAVLVTGLLGWRRRN
VALAMLSLAGVVLMRWTPIDLLPQHRETTAVWWRQLAGMSYVWWALAVIV
VSGLTVTARMTPQRSLTRGLTPAPTAS
433635245YP_007268872.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MRYFYDTEFIEDGHTIELISIGVVAEDGREYYAVSTEFDPERAGSWVRAH
VLPKLPPPASQLWRSRQQIRLDLEEFLRIDGTDSIELWAWVGAYDHVALC
QLWGPMTALPPTVPRFTRELRQLWEDRGCPRMPPRPRDVHDALVDARDQL
RRFRLITSTDDAGRGVAR
433635243YP_007268870.1 Putative serine/threonine-protein kinase PknL [Mycobacterium canettMVEAGTRDPLESALLDSRYLVQAKIASGGTSTVYRGLDVRLDRPVALKVM
DSRYAGDEQFLTRFRLEARAVARLNNRALVAVYDQGKDGRHPFLVMELIE
GGTLRELLIERGPMPPHAVVAVLRPVLGGLAAAHRAGLVHRDVKPENILI
SDDGDVKLADFGLVRAVAAASITSTGVILGTAAYLSPEQVRDGNADPRSD
VYSVGVLIYELLTGHTPFTGDSALSIAYQRLDVDVPRASAVIDGVPPQFD
ELVACATARNPADRYADAIEMGAELEAIAEELALPEFRVPAPRNSAQHRS
AALYRSRITQQGQLGAKPVHHPTRQLTRQPGDCCEPASGSQPEHEPITGQ
FAGIAMEEFIWARQHARRMVLVWVSVVLAITGLVASAAWTIGSNLSGLL
433635241YP_007268868.1 Integral membrane alpha(1->6)mannosyltransferase [Mycobacterium canMTTPAHAPAVDLATAKDAVVQHLSRLCEFATGPQGGPARLGFAGAVLITA
GGLGAGSVRQHDPLLESIHMSWLRFGHGLVLSSILLWAGVGVMLLAWLGL
GRRVLAGEATEFTMRATTVIWLAPLLLSVPVFSRDTYSYLAQGALLRDGL
DPYAVGPVGNPNALLDDVSPIWTITTAPYGPAFILVAKFVTIIVGNNVVA
GTMLLRLCMLPGLALLVWATPRLAGHLGTHGPTALWICVLNPLVLIHLMG
GVHNEMLMVGLMTAGIALTVQGRNVAGIILITVAIAVKATAGIALPFLVW
VWLRHLRERRGYRPVQAFLAAAAISLLIFVAVFAVLSAVAGVGLGWLTAL
AGSVKIINWLTVPTGAANVIHALGRGLFTVDFYTLLRITRLIGIVIIAVS
LPLLWWRFRRDDRAALTGVAWSMLIVVLFVPAALPWYYSWPLAVAAPLAQ
SRRAIAAIAGLSTWVMVIFKPDGSHGMYSWLHFWIATACALTAWYVLYRS
PDRRGVQAATPVVNTP
433635239YP_007268866.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MTLNTIALELVPPNLEGGKERAIEDARKVVQYSAASGLDGRIRHVMMPGM
IAEDDDRPIPMQPKLDVLDFWSIIKPELAGVHGLCTQVTAFMDEPSLHRR
LVDLSDAGMEGIVFVGVPRTMQDGEGSGVAPTDALSLYRQLVANRGVIVI
PTRDGEQGRLNFKCGRGATYGMTQLLYSDAIVGFLREFARTTEHRPEILL
SFGFVPKVETRIGLINWLIQDPGNAAVADEQAFVQKLAGSEPARRRRLMV
DLYKRVLDGVADLGFPLSIHLEATYGVSVAAFETFAEMLAYWSPAEPGKP
N
433635237YP_007268864.1 Gcn5-related N-acetyltransferase [Mycobacterium canettii CIPT 14007MAIFLIDLPPSDMERRLGDALTVYVDAMRYPRGTETLRAPMWLEHIRRRG
WQAVAAVEVTAAEQAEAADTAALPSAAELSNAPMLGVAYGYPGAPGQWWQ
QQVVLGLQRSGFPRLAIARLMTSYFELTELHILPRAQGRGLGEALARRLL
AGRDEDNVLLSTPETNGEDNRAWRLYRRLGFTDIIRGYHFAGDPRAFAIL
GRTLPL
433635235YP_007268862.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MFLGTYTPKLDDKGRLTLPAKFRDALAGGLMVTKSQDHSLAVYPRAEFEQ
LARRASKAPRSNPEARAFLRNLAAGTDEQHPDSQGRITLSADHRRYASLS
KDCVVIGAVDYLEIWDAQAWQNYQQIHEENFSAASDEALGDIF
433635233YP_007268860.1 Conserved membrane protein of unknown function- proline rich proteiMRAKREAPESRSSDRRRRADGPAAATRRTTTNSAPSRRIRSRAGKTSAPG
REARVSRPGPQTSPMLRPFDRPAPAKNTSQAKARAKARKAKAPKLVRPTL
MERLAARLTSIDLRPRTLANKVPFVVLVIGSLGVGLGLTLWLSTDAAERS
YQLSNARERTRMLQQHKEALERDVREAASAPALAEAARRQGMIPTRDTAH
LVQDPDGNWVVVGTPKPADGVPPPPLNTKLPEDPPPPPKPAAVPLEVPVR
VTPGPDDPAPPARSGPEVLVRTPDGTATLGGATHLPTQAGPQLPGPVPMP
GAPGPMPAPPFGAVPSPPPAENPVPLQGGAAPPAGLPGPAPVAATPGLSG
GSQPMVAPPAPVPANGEQFGPVTAPVPTAPGAPR
433635231YP_007268858.1 Conserved protein of unknown function- uncharacterized PE-PGRS famiMSFVIAAPEVMAAAATDLANIGSTISAASAAAAGPTTGILAAGADEVSVA
ISALFGSHAQSYQTLSAQLAAFHNQFVQALNAGAGSYASAEVANVQQSLL
NAINAPTQTLLGRPLIGNGADGGPGQNGGPGGLLYGNGGNGGAGDTANPN
GGNGGSAGLIGNGGAGGAGAATGAGGAGGNGGWLYGNGGPGGAAGLGTAG
GVSPAGGAGGAAGLWGHGGAGGAGGSASGAPAAGGAGGDGGRGGLLYGDG
GAGGAGGNGNNGVTGVNGGNGGAGGAAGLIGNGGAGGDGGNGGNSNTGAS
GGAGGAGGAALIGNGGDGGHGGNGGHGNSGGAGGAGGAGGHVGLFGNGGN
AGAGGNGGNDNSSTLADAGSGGAGAAGGNGGLFYGNGGTGGRGGNGGLST
AGTSGGDGGIDGAGGIGGLIGSGGGGGDGGNGGIAPTPGNAGDGGAGGNA
RLIGDGGRGGNGGEGGDGPPGVKGDGGNGGTGGNAVVIGNGGNGGAGGFG
IPVGSGGTGGSRGVLFGTPGANGADG
433635229YP_007268856.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MKFVNHIEPVAPRRAGGAVAEVYAEARREFGRLPEPLAMLSPDEGLLTAG
WATLRETLLAGQVPRGRKEAVAAAVAASLRCPWCVDAHTTMLYAAGQTDT
AAAILAGAAPAAGDPNAPYVAWAAGTGTPAGQPAPFGPDVAAEYLGTAVQ
FHFIARLVLVLLDETFLPGGPRAQQLMRRAGGLVFARKVRAEHRPGRSTR
RLEPRRLPDDLAWATPSEPIATAFAALSHHLDGAPHLPPPGRQVVRRVVG
SWRGEPMPMSSRWTNEHTAELPADLHAPTRLALLTGLAPHQVTDDDVAAA
RSLLDTDAALVGALAWAAFTAARRIGTWIGAAAEGQVSRQNPTG
433635227YP_007268854.1 UDP-N-acetylmuramoyl-tripeptide:D-alanyl-D-alanine ligase [MycobactMIGLTVAQIAEIVGGAVADISPRDAAHRRVTGTVEYDSRAVGPGGLFLAL
PGARADGHDHAASAVAAGAAVVLAARPVGVPAIVVPPVAVPNGLAGVLEH
DNDGSGAAVLAALAKLATAVAAQLVAGGLTIVGITGSSGKTSTKDLMAAV
LAPLGEVVAPPGSFNNELGHPWTVLRATRRTDYLILEMAARHRGNIAALA
EIAPPSIGVVLNVGTAHLGEFGSREVIAQTKAELPQAVPRSGAVILNADD
PAVAAMAKLTEARVVRVSRDNIGDVWAGPVSLDELARPRFTLHAHDAQAE
VRLGVCGDHQVTNALCAAAVALQCGASIEQVAAALTAAPPVSRHRMQVTT
RGDGVTVIDDTYNANPDSMRAGLQALAWIAHQPEATRRSWAVLGEMAELG
EDAIAEHDRIGRLAVRLDVSRLVVVGTGRSISAMHHGAVLEGAWGSGEAT
ADHGADRTAVNVADGDAALALLRAELRPGDVVLVKASNAAGLGAVADALV
ADDTCGSARP
433635225YP_007268852.1 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase [Mycobacterium caMLDPLGPGAPVLVAGGRVTGQAVAAALTRFGATPTVCDDDPVMLRPHAER
GLPTVSSSDAVQQITGYALVVTSPGFSPATPLLAAAAAAGVPIWGDVELA
WRLDAAGCYGPPRRWLVVTGTNGKTTTTSMLHAMLIAGGRRAVLCGNIGS
AVLDVLDEPAELLAVELSSFQLHWAPSLRPDAGAVLNIAEDHLDWHATMA
EYTAAKARALTGRVAVAGLDDSRAAALLDGSPAQVRVGFRLGEPAAGELG
VRDAHLVDRAFSDELTLAPVASIPVQGPVGVLDALAAAALARSVGVPAGA
IADAVRSFRVGRHRAEVVAVADGITYVDDSKATNPHAARASVLAYPRVVW
IAGGLLKGASLQAEVAAMASRLVGAVLIGRDRAAVAEALSRHAPDVPVVQ
VVAGEDTGMPATVEVIVACVLDVAKGDKAGETVGAAVMTAAVAAARRMAQ
PGDTVLLAPAGASFDQFTGYADRGEAFATAVRAVIR
433635223YP_007268850.1 Putative UPD-N-acetylglucosamine-N-acetylmuramyl-(pentapeptide) pyrMKDTVSQPAGGRGATAPRPADAASPSCGSSPSVDSLSVVLAGGGTAGHVE
PAMAVADALVALDPRVRITALGTVRGLETRLVPQRGYHLELITAVPMPRK
PGGDLARLPSRVWRAVREARDVLDDVDADVVVGFGGYVALPAYLAARGLP
LPPRRRRRIPVVIHEANARAGLANRVGARTADRLLSAVPDSGLRRAEVVG
VPVRASITALDRAVLRAEARAHFGFPDDARVLLVFGGSQGAVSLNRAVSG
AAADLAAAGVCVLHAHGPRNVLELRRRAQGDPPYVAVPYLDRMELAYAAA
DLVICRAGAMTVAEVSAVGLPAIYVPLPIGNGEQRLNALPVVNAGGGMVV
ADAALTPELVARQVAGLLTDPARLAAMTAAAARVGHRDAAGQVARAALAV
ATGAAARTTT
433635221YP_007268848.1 Putative cell division protein FtsQ [Mycobacterium canettii CIPT 14MTEHNADPQIERVADDAADEEAVTEPLATESQDEPAEHPEFEGPRRRARR
ERAERRAAQARATAIEQARRAAKRRARGQIVSEPNPAKPAARGVVRGLKA
LLATVVLAVVGIGLSLALYFTPAMSAREIVIIGIGAVSREEVLDAARVRP
AMPLLQIDTQQVADRVATIRRVASARVQRQYPSALRITIVERVPVVVKDF
PDGPHLFDRDGVDFATDPPPPALPYFDVDNPGPSDPTTKAALQVLTALHP
EVASQVGRIAAPSVASITLTLADGRVVIWGTTDRCEEKAEKLAALLTQPG
RTYDVSSPDLPTVK
433635219YP_007268846.1 Conserved protein of unknown function- YfiH [Mycobacterium canettiiMLASTRHIARGDTGNVSVRIRRVTTTRAGGVSAPPFDTFNLGDHVGDDPA
AVAANRARLAAAIGLPGNRVVWMNQVHGDRVKVVDQPCNTALDDTDGLVT
ATPRLALAVVTADCVPVLMADARAGIAAAVHAGRAGAQRGVVVRALEVML
SLGAQVRDISALLGPAVSGRNYEVPAAMADEVEAALPGSRTTTAAGTPGL
DLRAGIACQLRDLGVESIDVDPRCTVADPTLFSHRRDAPTGRLASLVWME
433635217YP_007268844.1 Cell division protein SepF [Mycobacterium canettii CIPT 140070017]MSTLHKVKAYFGMAPMEDYDDEYYDDRAPSRGYARPRFDDDYGRYDGRDY
DDPRSDSRGDLRGEPADYPPPGYRGGYADEPRFRPREFDRAEMTRPRFGS
WLRNSTRGALAMDPRRMAMMFEDGHPLSKITTLRPKDYSEARTIGERFRD
GTPVIMDLVSMDNADAKRLVDFAAGLAFALRGSFDKVATKVFLLSPADVD
VSPEERRRIAETGFYAYQ
433635215YP_007268842.1 Conserved protein of unknown function- Wag31 [Mycobacterium canettiMPLTPADVHNVAFSKPPIGKRGYNEDEVDAFLDLVENELTRLIEENSDLR
QRINELDQELAAGGGAGVTPQATQAIPAYEPEPGKPAPAAVSAGMNEEQA
LKAARVLSLAQDTADRLTSTAKAESDKMLADARANAEQILGEARHTADAT
VAEARQRADAMLADAQSRSEAQLRQAQEKADALQADAERKHSEIMGTINQ
QRTVLEGRLEQLRTFEREYRTRLKTYLESQLEELGQRGSAAPVDSNADAG
GFDQFNRGKN
433635213YP_007268840.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MEAPPYAGDPTFKRLRRSFQPADLLPELQAAGVHYTIAVEAADDPAENEA
LLATARHHDWIARVIGWVPLADPDEVTESSTHGRHRPDASWRRDLRCPGL
LPPGCHQPLLVVGLVGQQPEMRPMNPPSGFLRRTPTRRFRDRRDAGRVLA
DELASYRGRDRLLVLGLARGGVPVGWEVASVLGAELDVFLVRKLGVPQWR
ELAMGALASGGGVVMNDDVVSSLRITDQQVRAAIDSETAELQRRELAYRG
GRPVVDPRARIVILVDDGIATGASMLAAVRTIRATGPESIVVAVPVGPAT
ACRELAAEADDVVCATMPAAFEAVGQVYDDFHQVTDDEVRELLATPTTGA
AT
433635211YP_007268838.1 Conserved protein of unknown function- possible toxin ParE2 [MycobaMTRRLRVHNGVEDDLFEAFSYYADAAPDQIDRLYNLFVDAVTKRIPQAPN
AFAPLFKHYRHIYLRPFRYYVAYRTTDEAIDILAVRHGMENPNAAEAEIS
GRTFE
433635209YP_007268836.1 Conserved protein of unknown function- TB18.6 [Mycobacterium canettMTTSPDPYAALPKLPSFSLTSTSITDGQPLATPQVSGIMGAGGADASPQL
RWSGFPSETRSFAVTVYDPDAPTLSGFWHWAVANLPANVTELPEGVGDGR
ELPGGALTLVNDAGMRRYVGAAPPPGHGVHRYYVAVHAVKVEKLDLPEDA
SPAYLGFNLFQHAIARAVIFGTYEQR
433635207YP_007268834.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MSSRPAARRTWLPTGWDSEMSDEYEWAPLRLPPEVTRVSASTRLSIEAEY
RGWELARVRLYTDGSRRVLLRRKKSRWADAETNRRPDQPQLWL
433635205YP_007268832.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MTVTADRHLADKREEFAVEDISTGIFASGYGQVGDGRSFSFHIEHRSLVV
EIYRPRMAGPVPQAEDVVATAVRGLVDIDLTDERSLAAAVRDSVASAAPV
SR
433635203YP_007268830.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MTVILLRHARSTSNTAGVLAGRSDGVDLDEKGREQATGLIDRIGDLPIRA
VASSPMLRCQRTVEPLAAALCLEPLIDDRFSEVDYGEWTGRKIGDLVDEP
LWRVVQAHPSAAVFPGGEGLAQVQTRAVAAVREHDRRLADQHGNDVLWLA
CTHGDVIKAVIADAFGMHLDSFQRITADPGSVSVVRYTQLRPFVLHVNHT
GARLAPALQAAASAQGASPEPNAAVPPGDAVIGGSTD
433635201YP_007268828.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MLADGELTVLGRIRSASNATFLCESTLGLRSVHCVYKPVSGERPLWDFPD
GTLAGRELSAYLVSTQLGWNLVPHTIIRDGPAGIGMLQLWVQQPGDAVGS
DPPPGLDLVDLFPAHRPRPGYLPVLRAYDYAGDEVVLMHADDIRLRRMAV
FDVLINNADRKGGHILCGIDGQVYGVDHGLCLHVENKLRTVLWGWAGKPI
DDQILQAVAGLADALGGPLAEALAGRIAAAEIGALRRRAQSLLDQPVMPG
PNGHRPIPWPAF
433635199YP_007268826.1 Putative monophosphatase CysQ [Mycobacterium canettii CIPT 14007001MVSPAAPDLTDDLTDAELAADLAADAGKLLLQVRAEIGFDQPWTLGEAGD
RQANSLLLRRLQAERPGDAVLSEEAHDDLARLKSDRVWIIDPLDGTREFS
TPGRDDWAVHIALWRRSSNGQPEITDAAVALPARGNVVYRTDTVTSGAAP
AGVPGTLRIAVSATRPPAVLHRIRQTLAIQPVSIGSAGAKAMAVIDGYVD
AYLHAGGQWEWDSAAPAGVMLAAGMHASRLDGSPLRYNQLDPYLPDLLMC
RAEVAPILLGAIADAWR
433635197YP_007268824.1 Putative oxidoreductase [Mycobacterium canettii CIPT 140070017]MTSLQGKVVFITGAARGIGAEVARRLHNKGAKLVLTDLSKSELAVMGAEL
GGDDHLLTVVADVRDLPAMQAAAETAVERFGGIDVVVANAGIASYGSVLK
VDPQAFRRVLDVNLLGNFHTVRATLPALIDRRGYVLIVSSLAAFAAPPGM
APYNMSKAGNEHFANALRLEVAHLGVSVGSAHMSWIDTALVRDTKADLPA
FAELLARLPWPLNKTTSVNKCAAAFVNGIEGRKDRVYCPGWVALFRWLKP
LLSTRVGQRPIRNTVAKLMPQMDAEVAALGRFASAYTESLENS
433635195YP_007268822.1 Putative L-asparagine permease AnsP1 [Mycobacterium canettii CIPT 1MSAASQRVDAFGEEAGYHKGLKPRQLQMIGIGGAIGTGLFLGAGGRLAKA
GPGLFLVYAVCGVFVFLILRALGELVLHRPSSGSFVSYAREFFGEKAAYA
VGWMYFLHWAMTSIVDTTAIATYLQRWTVFTVFPQWVLALVALTVVLSMN
LISVEWFGELEFWAALIKVLALMGFLVVGTVFLAGRYPVDGHSTGLSLWN
NHGGLFPTSWLPLLIVTSGVVFAYSAVELVGTAAGETAEPEKIMPRAINS
VVARIAIFYVGSVALLALLLPYTAYKAGESPFVTFFSKIGFHGAGDLMNI
VVLTAALSSLNAGLYSTGRVMHSIAMSGSAPRFTARMSKSGVPYGGIVLT
AVITLFGVALNAFKPGEAFEIVLNMSALGIIAGWATIVLCQLRLHKLANA
GIMQRPRFRMPFSPYSGYLTLLFLLVVLVTMASDKPIGTWTVATLIIVIP
ALTAGWYLVRKRVMAVARERLGHTGPFPAVANPPVRSRD
433635193YP_007268820.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MTPSEGNAPLPELHNTVVVAAFEGWNDAGDAASDAVAHLAASWQALPIVE
IDDEAYYDYQVNRPVIRQVDGVTRELQWPAMRISHCRPPGSDRDVVLMCG
VEPNMRWRTFCDELLAVIDKLNVDTVVILGALLADTPHTRPVPVSGAAYS
AASARQFGLQETRYEGPTGIAGVFQSACVGAGIPAVTFWAAVPHYVSHPP
NPKATIALLRRVEDVLDVEVPLADLPAQAEAWEREITETIAEDHELAEYV
QTLEQHGDAAVDMNEALGNIDGDALAAEFERYLRRRRPGFGR
433635191YP_007268818.1 Conserved protein of unknown function- PPE family [Mycobacterium caMTFPMWFAVPPEVPSAWLSTGIGPGPLLAAARAWHALAAQYTEIATELAS
VLAAVQASSWQGPSADRFVAAHQPFRYWLTHAATVATAAAAAHETAAAGY
TSALGGMPTLAELAANHAMHGALVTTNFFGVNTIPIALNEADYLRMWIQA
ATVMSHYQAVAHESVAATPSTPPAPQIVTSAASSAASSGFPDPTKLILQL
LKDFLELLRYLAVELLPGPLGNLIAQVLDWFISFVSGPVFTFLAYLVLDP
LIYFGPFAPLTSPVLLPAGLTGLAGLGAVSGPAAPMVESVHSDGPSRQNW
PAATGVTPVGTNPAAPVTTPAPAPTTSAAPAVPSTPGSSAAQGLYAVGGP
DGEGFNPIAKTTARAGVTTDAAAPAAKLPGDQAQSSASKATRLRRRLRQH
RFEFLADDGRLTMPNGAEMADVAAGNRGLDALGFTGTIPKSAPGSATGLT
HLGGGFADVLSEPMLPHTWDGSD
433635189YP_007268816.1 ATP phosphoribosyltransferase HisG [Mycobacterium canettii CIPT 140MLRVAVPNKGALSEPATEILAEAGYRRRTDSKDLTVIDPVNNVEFFFLRP
KDIAIYVGSGELDFGITGRDLVCDSGAQVRERLALGFGSSSFRYAAPAGR
NWMTADLAGMRIATAYPNLVRKDLAAKGIDATVIRLDGAVEISVQLGVAD
AIADVVGSGRTLSQHDLVAFGEPLCDSEAVLIERDGTDGQDQTEARDQLV
ARVQGVVFGQQYLMLDYDCPRSALQKATAITPGLESPTIAPLADPDWVAI
RALVPRRDVNGIMDELAAIGAKAILASDIRFCRF
433635187YP_007268814.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MTDQPDPPTPRPALSPSRAADFKQCPLLYRFRAIDRLPEATSAAQLRGSV
VHAALEQLYGLPAGLRSPDTARSLVQHAWDQMVAAEPELAGELDPGQRTQ
LLEDARALVSGYYRLEDPTRFDPQCCEQRVEVELADGTLLRGYIDRIDVA
ATGELRVVDYKTGKAPPAARALAEFKAMFQMKFYAVALFRSRGVPPTRLR
LIYLADGQLLDYSPDRDELLRFEKTLMAIWRAIQSAGETGDFRPNPSRLC
DWCPHQQRCPAFGGTPPPYPGWPTEPAA
433635185YP_007268812.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MWIGWLEFDVLLGDVRSLKQKRSVTRPLVAELQRKFSVSAAETGSHDLYR
RAGIGVAVVSGDRSHAVDILDNAERLVAAHPEFELLSVRRGLHRSDD
433635183YP_007268810.1 Mycobacterial proteasome ATPase Mpa [Mycobacterium canettii CIPT 14MGESERSEAFGIPRDSPLSSGDAAELEQLRREAAVLREQLENAVGSHAPT
RPARDIHQLEARIDSLAARNSKLMETLKEARQQLLALREEVDRLGQPPSG
YGVLLATHDDDTVDVFTSGRKMRLTCSPNIDAASLKKGQTVRLNEALTVV
EAGTFEAVGEISTLREILADGHRALVVGHADEERVVWLADPLIAEDLPDG
LPEALNDDTRPRKLRPGDSLLVDTKAGYAFERIPKAEVEDLVLEEVPDVS
YADIGGLSRQIEQIRDAVELPFLHKELYREYSLRPPKGVLLYGPPGCGKT
LIAKAVANSLAKKMAEVRGDDAHEAKSYFLNIKGPELLNKFVGETERHIR
LIFQRAREKASEGTPVIVFFDEMDSIFRTRGTGVSSDVETTVVPQLLSEI
DGVEGLENVIVIGASNREDMIDPAILRPGRLDVKIKIERPDAEAAQDIYS
KYLTEFLPVHADDLAEFDGDRSACIKAMIEKVVDRMYAEIDDNRFLEVTY
ANGDKEVMYFKDFNSGAMIQNVVDRAKKNAIKSVLETGQPGLRIQHLLDS
IVDEFAENEDLPNTTNPDDWARISGKKGERIVYIRTLVTGKSSSASRAID
TESNLGQYL
433635181YP_007268808.1 Conserved membrane protein of unknown function [Mycobacterium canetMSLSVRRPPAARASAIVEAESWFLKRGLPSVLTMRGRCRRLWPRSAPMLA
AWAVVEGCLMAVFFVTDGGEVFISATPTTAQWVILALLAVALPLASLVGW
LVSQISTGRGQAAVATMAVAFAAASDVIESGPIQLLRTAVVVGLVLLQTG
CGVGSVLGWAVRMTLEHLATVGTLAVRALPIVLLTALVFFNTYVWLMAAN
INGERLTLAMVFLLAIAGAFVVSKTVERVRPLLRSTTVMPQGSQSLAGTP
FATMGDPSPGFPLTRVERLNVVFLLAASQLVEILVVASVGAAIYLVLGMI
ILTPPLLQEWTHYDSMTTTVLGMTFPAPDSLIRMCLFLGALTFMYISARA
VDDAEYRAMFLDPLIDDLHTALLARNRYRNNVVTARCAGVDAGHVDD
433635179YP_007268806.1 Prokaryotic ubiquitin-like protein Pup [Mycobacterium canettii CIPTMAQEQTKRGGGGGDDDDIAGSTAAGQERREKLTEETDDLLDEIDDVLEEN
AEDFVRAYVQKGGQ
433635177YP_007268804.1 Proteasome alpha subunit PrcA; assembles with beta subunit PrcB [MyMSFPYFISPEQAMRERSELARKGIARAKSVVALAYAGGVLFVAENPSRSL
QKISELYDRVGFAAAGKFNEFDNLRRGGIQFADTRGYAYDRRDVTGRQLA
NVYAQTLGTIFTEQAKPYEVELCVAEVAHYGETKPPELYRITYDGSIADE
PHFVVMGGTTEPIANALKESYAENASLTDALGIAVAALRAGSADTSGGDQ
PTLGVASLEVAVLDANRPRRAFRRITGAALQALLVDQESPESDG
433635175YP_007268802.1 Conserved protein of unknown function- PE family protein [MycobacteMSFVNVDPFGMLAAAATLESLGSHMAVSNAAMASVTTKVPPPAADYVSKK
LSLFFSSHGQQYQVQAARGTAFHRKLVRTLANGALAYEEVEIANNESF
433635173YP_007268800.1 Conserved protein of unknown function- possible antitoxin [MycobactMRTTVTLDDDVEQLVRRRMAERQVSFKKALNDAIRDGASGRPAPSHFSTR
TADLGVPAVNLDRALQLAADLEDEELVRRQRRGS
433635171YP_007268798.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MLEDIGLGNRLQRGRSYARKGQVISLDLDAGLVTAQVQGSRARPYRIRIG
IPAFGKSQWAQVEQCLAENAWYAAKLLSGEMPDDIDDVFAGLGLSLFPGT
ARELSLDCSCPDYAVPCKHLAATFYLLAESFDEDPFTILTWRGRDREDLL
ANLAAARADGAAPAADHDEQVARPLTDCLDSYYARQADINLPSQPATPSM
LLDQLPDTGLGARGRPLTELLRPAYHALTHHHNSAGG
433635169YP_007268796.1 Conserved protein of unknown function. Member of Mycobacterium tubeMAGALFEPSFAAAHPAGLLRRPVTRTVVLSVAATSIAHMFEISLPDPTEL
CRSDDGALVAAIEDCARVEAAASARRLSAIAELTGRRTSADQRADWACDF
WDCAAAEVAAALTISHGKASGQMHLSLALNRLPQVAALFLAGHLGARLFS
IIAWRTYLVRDPHALSLLDAALAEHAGAWGPLSAPKLEKAIDSWIDRYDP
GALRRSRISARTRDQCIGDPDEDAGTAALWGRLYATDAAMLDRRRTEMAH
GVCEDDPRTLAQRRADALGALAAGADHLACGCGKPDCPSGAGNDERAAGV
VIHVVADASALDAQPDPHLSGDEPPSRPLTPETTLFEALTPDPEPDPPAT
HAPAALITTGGGVVPAPLLAELIRGGATISQVRHPGDLAAEPHYRPSAKL
AEFVRMRDLTCRFPGCDVPAEFCDIDHSVPWPLGPTHPSNLKCACRKHHL
LKTFWTGWRDVQLPDGTVIWTAPNGHTYTTHPGSRIFFPTWHTTTAELPQ
TPTAAVNVDARGLMMPRRRRTRAAELAHRINAERALNDAYMAERNKPPPF
433635167YP_007268794.1 Proteasome accessory factor A PafA [Mycobacterium canettii CIPT 140MQRRIMGIETEFGVTCTFHGHRRLSPDEVARYLFRRVVSWGRSSNVFLRN
GARLYLDVGSHPEYATAECDGLVQLVTHDRAGEWVLEDLLVDAEQRLADE
GIGGDIYLFKNNTDSAGNSYGCHENYLIVRAGEFSRISDVLLPFLVTRQL
ICGAGKVLQTPKAATYCLSQRAEHIWEGVSSATTRSRPIINTRDEPHADA
EKYRRLHVIVGDSNMSETTTMLKVGTAALVLEMIENGVAFRDFSLDNPIR
AIREVSHDVTGRRPVRLAGGRQASALDIQREYYTRAVEHMQTREPNAQIE
QVVDLWGRQLDAVESQDFAKVDTEIDWVIKRKLFQRYQDRYDMELSHPKI
AQLDLAYHDIKRGRGIFDLLQRKGLAARVTTDEEIAEAVDQPPQTTRARL
RGEFISAAQEAGRDFTVDWVHLKLNDQAQRTVLCKDPFRAVDERVKRLIA
SM
433635165YP_007268792.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MSALSTRLVRLLNMVPYFQANPRITRAEAAAELGVTAKQLEEDLNQLWMC
GLPGYSPGDLIDFEFRGDTIEVTFSAGIDRPLKLTSPEATGLLVALRALA
DIPGVVDPQAARSAIAKIAAAAGAAAAVAEQAPTESPAAAAVRAAVRDSR
ALTIDYYAASHDTLTTRIVDPIRVLLIGGHSYLEAWSREAEGVRLFRFDR
IVDAAELGEPAVPPESARQAPPDTSLFDGDPSLPSATLRVAPSASWMLEY
YPIRELRQLPDGSCEVAMTYASEDWMTRLLLGFGSDVRVLAPESLAQRVR
DAATAALDAYQAAAPP
433635163YP_007268790.1 Putative Sec-independent protein translocase transmembrane protein MRAAGLLKRLNPRNRRSRVNPDATMSLVDHLTELRTRLLISLAAILVTTI
FGFVWYSHSIFGLDSLGEWLRHPYCALPQSARADISADGECRLLATAPFD
QFMLRLKVGMAAGIVLACPVWFYQLWAFITPGLYQKERRFAVAFVIPAAV
LFVAGAVLAYLVLSKALGFLLTVGSDVQVTALSGDRYFGFLLNLLVVFGV
SFEFPLLIVMLNLAGLLTYERLKSWRRGLIFAMFVFAAIFTPGSDPFSMT
ALGAALTVLLELAIQIARVHDKRKAKREAAIPDDEASVIDPPSPVPAPSV
IGSHDDVT
433635161YP_007268788.1 Conserved membrane protein of unknown function [Mycobacterium canetMSGPQGSDPRQPWQPPGQGADHSSDPTVAAGYPWQQQPTQEATWQAPAYT
PQYQQPADPAYPQQYPQPTPGYAQPEQFGAQPTQLGVPGQYGQYQQPGQY
GQPGQPGQYAPPGQYPGQYGPYGQSGQGSKRSVAVIGGVIAVMAVLFIGA
VLILGFWAPGFFVTTKLDVIKAQAGVQQVLTDETTGYGAKNVKDVKCNNG
SDPTVKKGATFECTVSIDGTAKRVTVTFQDNKGTYEVGRPQ
433635159YP_007268786.1 Putative dipeptidase PepE [Mycobacterium canettii CIPT 140070017]MDSRRFDAEVYARRLALAAAATADAGLAGLVITPGYDLCYLIGSRAETFE
RLTALVVPAAGAPAVVLPRLELAALKQSAAAELGLRVCDWVDGGDPYGLV
SAVLGGAPVATAVTDSMPALHMLPLADALGVLPVLATDVLRRLRMVKEET
EIDALRKAGAAIDRVHARVPEFLVPGRTEADVAADIAEAIVAEGHSEVAF
VIVGSGPHGADPHHGYSDRELREGDIVVVDIGGTYGPGYHSDSTRTYSIG
VPDSDVAQPYSVLQRAQRAAYEAIRPGVTAEQVDAAARDVLAEAGLAEYF
VHRTGHGIGLCVHEEPYIVAGNDLPLAAGMAFSIEPGIYFPGRWGARIED
IVIVTDDGAVSVNNCPHELIVVPVS
433635157YP_007268784.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MLAGLRPSIGIVGDALDNALCESTIGPHRTEYIREGSPYRSGPIRTLADL
EDIASAWVEHTCHTQQGVRIPGRLQPA
433635155YP_007268782.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MRSATSTSTPTGSHRSVGHWPVHRVQIASRTYFVERAAAPSKRALWDTTI
TEILAGYYEPDAEGKRPPECLYGSLKMWAHR
433635153YP_007268780.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MTSIESHPEQYWAAAGRPGPVPLALGPVHPGGPTLIDLLMALFGLSTNAD
LGGTNADIEGDDTDRRAHAADAARKFSANEANAAEQMQGVGAQGMAQMAS
GIGGALSGALGGVMGPLTQLPQQAMQAGQGAMQPLMSAMQQAQGAEGLGA
VDDARLVDSIGGEPGLGGGAGGGDFGGGGAGGTTPTGYLGPPPVPTSSPP
TTPAGAPAKSVTMPPPGGASPASAHMGAAGMPMVPPGAMGARGEGSGQEK
PVEKRVTAPAVPNGQPVKGRLTVPPSAPTTKPTDGKPVVRRRILLPEHKD
FGRIAPDEKADAGE
433635151YP_007268778.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MTNTPPPTTGQWTPTHPPAPRSSIWQAVGLAIALVLGAAALIVALTRPTA
SGPAATVATTAAATYTAEETAAAHQKLCEVYKRAARSVQIDTHGDSPALS
RVSTVNGALMLEQAVNSAPALAPADRAAALTLAEAYTSATSAASSAHRDD
REWQAVMDDVNAKDAQMKAVCSGS
433635149YP_007268776.1 Protein of unknown function [Mycobacterium canettii CIPT 140070017]MIIEPGAGVTADGLVEHTLCRIVDIRHCGCSYIVGHGVRLLDNEVHRGNF
RLHRAFAGKYLVDLLITGLCDLCQSITQMVHCIRDAIALLAFDRTLVRDG
GQTLLPTPIPLHQIVSSAPLVYC
433635147YP_007268774.1 Conserved exported protein of unknown function [Mycobacterium canetMAAVASIAIAAVALGAAALIVALTRPTNSGPATAAGTTAEPTYTAAETGA
AHQKLCEVYKLAARSVQIDTHGDSQALAGVSLVNGALMLEQVLTTVPALP
SGDRAAAVALADAYTNTNAMGSFTHRDDPEWQTVLDDVNAKDARMKAVCG
GG
433635145YP_007268772.1 Exported protein of unknown function [Mycobacterium canettii CIPT 1MALASGGVGLLGWAWVVAGVVVLTTGDISEPPAAGEEGVTAAPEMGPVGA
DGAAGGVVTGGRRSAP
433635143YP_007268770.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MLREGRLFALGGAVVTVEADVDLVERRLAAGELSCPFCGGVLAGWGRARA
RQLRGVDGPVELHPRRSRCTGCGVTHVLLPVTALLRRADTAAVVVSALVA
KGGSRVGFRRIAAGVARPAETVRGWLRRFAERAEAVRSVFTVWLAAVAAD
PVMPDAAGGVFIDAVSAMVALAAAIGRRFSLPRVSLAEVAVAVSGGRLLA
PGWPGEPVQHESTLPAARITP
433635141YP_007268768.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MDKLISYYGFSRIPFGRDLAPSMLHRHGAHNEAVARIGWCVADRRIGVVT
GEVGAGKTVAVRAALTALDRSRHAVIYLPDPTVGVRGIHHRIVASLGGQP
LTHHATLAPQAADALAAEQAERGRTPVVVVEEAHLLGYDQLEALRLLTNH
DLDSSSPFACLLIGQPTLRRRMKLGVLAALDQRIGLRYAMPPMTDKETAS
YLRHHLALAGRDDTLFSDDAVTLVHQTSRGYPRAVNNLALQALLAAFAAD
KTIVDATPPDTSRRGHFMPTRSHRQRRHHAHPECRSTVRLLQLPSLCTPL
PVSSLRWRPWFGLPRRRRDRGMSRASLIEFQQLCGVGGRFRCRGRCSCGW
RPRLRFGRCGVVPRGGAPFRPGWVRVRRYLVRCALAGRRSPRATRVGDH
433635139YP_007268766.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MQLRHINIRALIAEAGGDPWAIEHSLHAGRPAQIAELAEAFHAAGRCTAE
ANAAFEEARRRFEAAWNRENGDHPINDSDEVQRVTAALGAQSLQLPKIGV
DLENIAADLAEAQRAAAGRITTLESQLQRIDGQLDQALELEHDPRLTAAE
RSELDALIACLEQDAIDDTASALGQLQSIRAEYSDHLQQSLAMLRADGYD
GAGLQGLDAPQSPVKPEEPIQIPPPGTGAPEVHRWWTSLTSEERQRLIAE
HPEQIGNLNGVPVSARSDANIAVMTRDLNRVRDIATRYRTSVDDVLGDPA
KYGLSAGDITRYRNADETKKGLDHNARNDPRNPSPVYLFAYDPMAFGGKG
RAAIAIGNPDTAKQTAVIVPGTSSSVKGGWLHDDHDDALNLFNQAKAADP
NNPTAVIAWMGYDAPNDFTDPRIATPMLARIGGAALAEDVNGLWVTHLGV
GQHVTVLGHSYGSTTVADAFAMGGMHANDAVLLGCPGTDLAHSAASFHLD
GGRVYVGAASTDPISMLGQLDSLSQYVNRGNLAGQLQGLAVGLGTDPAGD
GFGSVRFRAEVPNSDGINPHDHSYYYHRGSEALRSMADIASGHGDALASD
GMLAQPRHQPGVEIDIPGLGSVEIDIPGTPASIDPEWSRPPESITDDHVF
DAPLHR
433635137YP_007268764.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MGSDELQVALGQLVVTASQWQGLGAQLAAEATPPASGQPFQATTAAVSRI
NAAIGGAVAEFATRTHATATAVTAAAAAYAHQEATAAGEMAR
433635135YP_007268762.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MVVCLIGGVAGFLWPRPVGRLRGGCYFAFMGVAWVLLAISAIANAVKGSL
WWGIWSLGLLVLIPAVVYGKMRRSRRISSDQDR
433635133YP_007268760.1 Putative pyridoxamine 5'-phosphate oxidase (PNP/PMP oxidase) (pyridMAMVNTTTRLSDDALAFLSERHLAMLTTLRADNSPHVVAVGFTFDPKTHI
ARVITTGGSQKAVNADRSGLAVLSQVDGARWLSLEGRAVVNSDIDAVRDA
ELRYAQRYRTPRPNPRRVVIEVQIERVLGSADLLDRA
433635131YP_007268758.1 Putative precorrin-6Y methyltransferase CobL [Mycobacterium canettiMIIVVGIGADGMTGLSEHARSELRRATVIYGSKRQLALLDDTVTAERWEW
PTPMLPAVQGLSPDGADLHVVASGDPLLHGIGSTLIRLFGPDNVTVLPHV
SAVTLACARMGWNVYDTEVISLVTAQPHTAVRRGGRAIVLSGDRSTPRAL
AVLLTEHGRGDSKFSVLEQLGGPAERRRDGTARAWACDPPLDVDELNVIA
VRYLPDERTSWAPDGAFAHDGQITKHPIRVLTLAALAPRPGQRLWDVGAG
SGAIAVQWCRSWPGCTAVAFERDERRRRNIGFNAAAFGVSVDVRGDAPDA
FDDAARPSVIFLGGGVTQPGLLEACLDSLPAGGNLVANAVTVESEAALAH
AYSRLGGELRRFQHYLGEPLGGFTGWRPQLPVTQWSVTKR
433635129YP_007268756.1 Putative precorrin-6x reductase CobK [Mycobacterium canettii CIPT 1MTRVLLLGGTAEGRALAKELHPHVEIVSSLAGRVPNPALPIGPVRIGGFG
GVEGLRGWLREERIDAVVDATHPFAVTITAHAAQVCGELGLPYLVLARPP
WDPGTAIIAVSDIEAADVVAEQGYSRVFLTTGRSGIAAFANSDAWFLIRV
VTAPDGTALPRRHKLVLSRGPYGYHDEFALLREQRIDALVTKNSGGKMTR
AKLDAAAALGISVVMIARPLLPAGVAAVDSVHRAAMWVAGLPSR
433635127YP_007268754.1 Class A beta-lactamase BlaC [Mycobacterium canettii CIPT 140070017]MRNRGFGRRELLVAMAMLVSVTGCARHASGARPASTTLPAGPDLADRFAE
LERRYDARLGVYVPATGTTAAIEYRADERFAFCSTFKAPLVAAVLHQNPL
THLDKLITYTSDDIRSISPVAQQHVQTGMTIGQLCDAAIRYSDGTAANLL
LADLGGPGGGTAAFTGYLRSLGDTVSRLDAEEPELNRDPPGDERDTTTPH
AIALVLQQLVLGNALPPDKRALLTDWMARNTTGAKRIRAGFPADWKVIDK
TGTGDYGRANDIAVVWSPTGVPYVVAVMSDRAGGGYDAEPREALLAEAAT
CVAGVLA
433635125YP_007268752.1 Putative cobalamin biosynthesis protein cobIJ [Includes: Precorrin-MSARGTLWGVGLGPGDPELVTVKAARVIGEADVVAYHSAPHGHSIARGIA
EPYLRPGQLEEHLVYPVTTEATHHPGGYAGALEDFYTDATERIAAHLDAG
RNVALLAEGDPLFYSSYMHLHTRLTRRFNAVIVPGVTSVSAASAAVATPL
VAGDQVLSVLPGTLPVGELTRRLADADAAVVVKLGRSYHNVREALSASGL
LGDAFYVERASTAGQRVLPAADVDETSVPYFSLAMLPGGRRRASLTGTVA
VVGLGPGDSDWMTPQSRRELAAATDLVGYHRYLDRVEVRDGQRRHPSDNT
DEPARARLACSLAERGRAVAVVSSGDPGVFAMATAVLEEAEQWPGVRVRV
IPAMTAAQAVASRVGAPLGHDYAVISLSDRLKPWDVIAARLTAAAAADLV
LAIYNPASATRTWQVGAMRELLLAHRDPGTPVVIGRNVSGPVSGPNEDVR
VVKLADLNPAEIDMRCLLIVGSSQTRWYSVDSQDRVFTPRRYPEAGRATA
TKSSRHSD
433635123YP_007268750.1 Putative cobalamin biosynthesis protein CobG [Mycobacterium canettiMAGTRDADACPGALRPHQAADGALARIRLPGGMITAAQLATLASVASDFG
SATLELTARGNVQLRGIRDVAAVADAVAKAGLLPSATHERVRNIVASPLS
GRAGGLADVRAWVGELDAAIRAEPRLADLGGRFWFGLDDGRADVSGLGAD
VGVQVFPDGPRLLLTGRDTGVRVADVAETLIEVALRFVKIRETAWRVTEL
ADIGELQPGVELGPSVRPVTKTPVGWIPQDDSRVTLGAAVPLGVLPARVA
ECLAAIEAPLVITPWRSVLICDLDDATADAALRVLAPLGLVFDENSPWLN
ISACTGSPGCAHSAADVRADAARSLNVESAGHRHFVGCERACGSPPAGEV
LVATGGGYRRLRP
433635121YP_007268748.1 Conserved protein of unknown function- possible antitoxin MazE7 [MyMSTSTTIRVSTQTRDRLAAQARERGISMSALLTELAAQAERQAIFRAERE
ASHAETTTQAVRDEDREWEGTVGDGLG
433635119YP_007268746.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MTPTFSDLAEAQYLLLTTFTKDGRPKPVPIWAALDTDRGDRLLVITEKKS
WKVKRIRNTPRVTLATCTLRGRPTSEAVEATAAILDESQTGAVYDAIGKR
YGIQGKLFGFVSKLRGGMRNNIGLELKVAESETG
433635117YP_007268744.1 ATPase component of an ABC-type transport system [Mycobacterium canMTEQAVALTGARLAFGDRVLWDHLDLSVSPGEFIAVLGPNGTGKTSLLKV
LLGQLPLSAGVALVNGRPITTGGERIGYVPQHRPVDREVMLRGRDLVALG
VDGHRWGAMPLRSAGRARRRQAVRRALHQVNGERLADVRVGLMSGGELQR
VRIAQALASDPTLMLCDEPLLTLDPANAKLVSELIDRRRREAGTAVMVVT
HEVNPILPYVDRVLYLVDGRFLIGTVEQVMTTETLSALYRADMQVVKVVR
GPGVRYVVIGESEGRSP
433635115YP_007268742.1 Protein of unknown function (part1) [Mycobacterium canettii CIPT 14MSIRRAVATPVILVTGHEGTAAVTAELLGLLTDHGTATLRSVAPGSVRRA
DPRPRCHRREQRRHRASMKSAIHPDHHPVVFHGARSSAATNLYWK
433635113YP_007268740.1 30S ribosomal protein S14 RpsN2 + 50S ribosomal subunit protein L33MARTDIRPIVKLRSTAGTGYTYTTRKNRRNDPDRLILRKYDPILRRHVDF
ARNADVAKKSKIVKNQQRADTVARYASRRAALKDIIRSPSSTPEQRNTAQ
QALARQPRDASPVRLRNRDAIDGRPRGHLRKFGLSRVRVRQLAHDGHLPG
VRKASW
433635111YP_007268738.1 Protein of unknown function- PPE family [Mycobacterium canettii CIPMNADVDQDWRPPPAQDVFASTVASDRGAGDLGFAGTARKEAAAEAAGMTT
LASDDFGGGPKMPMVPGTWHPDAVDEGNEY
433635109YP_007268736.1 Prevent-host-death family protein [Mycobacterium canettii CIPT 1400MKTTTSTEAKARLNALLAEVAATGESVTITSHGKPVAILSPATPTPRRFG
QLAGKITVPDDFDSPLNADDLVLWEGGE
433635107YP_007268734.1 Conserved membrane protein of unknown function [Mycobacterium canetMSRLLLSYAVVELAVVFALAATIGFGWTLLVLLATFVLGFGLLAPLGGWQ
LGRRLLWLRSGLAEPRSALSDGALVTVASVSVLVPGLVTTTMGLLLLVPP
IRALARPGLTAIAVRGFLRNVPLTADAAAGMAGPFGESGTDPDFIDGEVI
DVIDVEPLTLQPPPVAAEPPSPGSN
433635105YP_007268732.1 Polyprenol-monophosphomannose synthase Ppm1 [Mycobacterium canettiiMGLGAWVAAQLPTARTAVRPRLTRLVVSIVAGLLLYASFPPRNWWWAAVV
AFALLAWVLTHPATTPVGGLGYGLLFGLVFYVPLLPWIGMLVGPGPWLAL
ATTCALFPGLFGLFAVVVRLLPGWPIWYAVGWAAQEWLKSVFPFGGFPWG
SVAFGQAEGPLLPLVQLGGVALLSTGVVLVGCGLTAIALEIEKWWRAGGQ
GDAPPAVVLPGACICLVLFAAIVVWPQVRHAGSGSGGEPTVSVAVVQGNV
PRLGLDFNAQRRAVLDNHVEETLRLAADVHAGLAQQPQFVIWPENSSDID
PFVNPDAGQRISAAAEAIGVPILIGTLMDVPGRSRENPEWINTAIVWNPG
TGPADRHDKAIVQPFGEYLPMPWLFRHLSGYADRAGHFVPGNGTGVVRIA
GVPVGVATCWEVIFDRAPRKSILGGAQLLTVPSNNATFNKTMSEQQLAFA
KVRAVEHDRYVVVAGTTGISAVIAPDGGELIRTDFFQLAYLDSQVRLKTK
LTPATRWGPILQWILVGAAAAVVLVAMRQNGWFPRPRRSEPKGESDDSDA
PPGRSEASGPPALSESDGELIQPEQGGRHSSGFGRHRATSRSYMTTGQPA
PPAPGNRPSQRVLVIIPTFNERENLPVIHRRLTQACPAVHVLVVDDSSPD
GTGQLADELAQADPGRTHVMHRTAKNGLGAAYLAGFAWGLSREYSVLVEM
DADGSHAPEQLQRLLDAVDAGADLAIGSRYVVGGTVRNWPWRRLVLSKTA
NTYSRLALGIGVHDITAGYRAYRREALEAIDLDGVDSKGYCFQIDLTWRT
VSNGFVVTEVPITFTERELGVSKMSGSNIREALVKVARWGIEGRLSRRVS
RADVTE
433635103YP_007268730.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MLTRGEVRALPADAVVLSADDAADLSDRVYQVRCAAEDVVTALDEGAAAT
ELRDLCDELIRAARAADGWRRAGA
433635101YP_007268728.1 Conserved lipoprotein of unknown function- LppI [Mycobacterium caneMRIAALVAVSLLIAGCSREVGGDVGQSQTIAPPAPAPSAAPSTPPAAGAP
ITAVVSWIEAGHPVDPSAYHVATRDGVTTQLGDDVAFSASSGTVACMTDA
RHTSGTLACLVRLANPPPRPETAYGEWKGGWVDFDGIHLQVGSARADPGP
FVYGNGPELANGDTLSIGDYRCRSDQAGLFCVNYAHQSAVRFASAGIEPF
GCLKPVPPPDGVGVAFGC
433635099YP_007268726.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MHFAFIAYVLAGGFLALRWRRTMWLHVPAVIWGIGIAAKRVDCPLTWVER
WARTKAAMTPLSPDGFVAHYITGVIYPAGWVAAAQLVMFAIVAASWALYL
WLPRR
433635097YP_007268724.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MAPPNRDELLAAVERSPQAAAAHDRAGWVGLFTGDARVEDPVGSRPQVGH
EAIGGFYDTFIGPRDITFHRDLDIVSGTVVLRDLELEVAMGSAVTVFIPA
FLRYDLRPVTGEWQIAALRAYWELPAMMLQFLRTGSGATRPALQLSRALL
GNQGLGGTAGFLTGFRRAGRRHKKLVETFLNAASRADKSAAYHALSRTAT
VTLGEDELLDVVELFEQLRGASWTKVTGAGSTVAVSLASDHRRGIMFADV
PWRGNRISRIRYFPA
433635095YP_007268722.1 Putative sugar-transport integral membrane protein ABC transporter MTQRRGRRAWAGRMFVAPNLAAVVVFMLFPLGFSLYMSFQKWDLFTHATF
VGLDNFRNLFTSDPLFLIAVVNTAVYTVGTVVPTVVVSLVVAAFLNRKIK
GISLFRTVVFLPLAISSVVMAVVWQFVFNTDNGLLNIMLGWLGIGPIPWL
IEPRWAMVSLCLVSVWRSVPFATVVLLAAMQGVPETVYEAARIDGAGEIR
QFVSITVPLIRGALSFVVVISIIHAFQAFDLVYVLTGANGGPETATYVLG
IMLFQHAFSFLEFGYASALAWVMFAILLVLTVLQLRITHRRSWEASRGLG
433635093YP_007268720.1 Putative sugar-transport ATP-binding protein ABC transporter [MycobMASVSLEQATRRYPGTDRPALDRLDLIVGDGEFVVLVGPSGCGKTTSLRM
VAGLETLDCGRIRIGERDVTDVDPKDRDVAMVFQNYALYPHMTVAQNMGF
ALKVAKIGKAEIRERVLAAAKLLDLQSYLDRKPKDLSGGQRQRVAMGRAI
VRRPQVFLMDEPLSNLDAKLRGQTRNQIAALQRQLGTTTVYVTHDQVEAM
TMGDRVAVLSDGVLQQCASPRELYRKPGNVFVAGFIGSPAMNLFRLSIAD
STVSLGDWQILLPRAVVGTAAEVIIGVRPEHLELGGAGIEMDVDMVEELG
ADAYLYGRIVSGGCEMDQSIVARVDGRGPPERGSRVRLCPTPGHLHFFAV
DGRRIPG
433635091YP_007268718.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MIAADDETEMSMMDMARAERGELAAFLTTLTLQQWETPSLCAGWSVKEVV
AHMISYEDLGVFGLLKRFAKGRIVRANEVGVDEFAGLSPQELVDYVGRHL
QPRGLTAGFGGMIALVDGMIHHQDIRRPLGQPRTIPAQRLDRVLRLMPKN
PRLRARPRIKGLRLRATDLDWTIGTGPEVTGPGEALLMAMAGRPAAVSDL
SGPGKPTLAGRLG
433635089YP_007268716.1 Putative ArsR-type repressor protein [Mycobacterium canettii CIPT 1MSTYRSPDRAWQALADGTRRAIVERLAHGPLAVGELARDLPVSRPAVSQH
LKVLKTARLVCDRPAGTRRVYQLDPTGLAALRTDLDRFWTRALTGYAQLI
DSEGDDT
433635087YP_007268714.1 Putative NAD(P)H nitroreductase Acg [Mycobacterium canettii CIPT 14MPDTMVTTDVIKRAVQLACRAPSLHNSQPWRWIAEDHTVALFLDKDRVLY
ATDHSGREALLGCGAVLDHFRVAMAAAGTTANVERFPNPNDPLHLASIDF
SPADFVTEGHRLRADAILLRRTDRLPFAEPPDWDLVESQLRTTVTADTVR
LDVIADDMRPELAAASKLTESLRLYDSSYHAELFWWTGAFETSEGIPHSS
LVSAAESDRVTFGRDFPVVANTDRRPEFGHDRSKVLVLSTYDNERASLLR
CGEMLSAVLLDATMAGLATCTLTHITELHASRDLVAALIGQPATPQALVR
VGLAPEVEEPPPATPRRPIDEVFHVRAKDHR
433635085YP_007268712.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MLMTAAADVTRRSPRRVFRDRREAGRVLAELLAAYRDQPDVIVLGLARGG
LPVAWEVAAALHAPLDAFVVRKLGAPGHDEFAVGALASGGRVVVNDDVVR
GLRITPQQLRDIAEREGRELLRRESAYRGERPPTDITGKTVIVVDDGLAT
GASMFAAVQALRDAQPAQIVIAVPAAPESTCREFAGLVDDVVCATMPTPF
LAVGESFWDFRQVTDEEVRRLLATPTAEPSLRRPAASTAADVLRRVAIDA
PGGVPTHEVLAELVGDARIVLIGESSHGTHEFYQARAAMTQWLIEEKGFG
AVAAEADWPDAYRVNRYVRGLGEDTNADEALSGFERFPAWMWRNTVVRDF
VEWLRTRNQRYESGALRQAGFYGLDLYSLHRSIQEVISYLDKVDPRAAAR
ARARYACFDHACADDGQAYGFAAAFGAGPSCEREAVEQLVDVQRNALAYA
RQDGLLAEDELFYAQQNAQTVRDAEVYYRAMFSGRVTSWNLRDQHMAQTL
GSLLTHLDRHLVAPPARIVVWAHNSHVGDARATEVWADGQLTLGQIVRER
YGDESRSIGFSTYTGTVTAASEWGGVAQRKAVRPALHGSVEELFHQTADS
FLVSARLSRDAEAPLDVVRLGRAIGVVYLPATERQSHYLHVRPADQFDAM
IHIDQTRALEPLEVTSRWIAGENPETYPTGL
433635083YP_007268710.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MNQSHKPPSIVVGIDGSKPAVQAALWAVDEAASRDIPLRLLYAIEPDDPG
YTAHGAAARKLAAAENAVRYAFTAVEAADRPVKVEVEITQERPVTSLIRA
SAAAALVCVGAIGVHHFRPERAGSTAAALALSAQCPVAIVRSHRVPIGRD
AAWIVVEADGSSDIGVLLGAVMAEARLRDSPVRVVTCRQSGVGDTGDDVR
ASLDRWLARWQPRYPDVRVQSAAVHGELLDYLAGLGRSVHMVVVSASDQE
HVEQLVGAPGNAVLQEAGCTLLVVGQQYL
433635081YP_007268708.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MSAATAKYGILVGVDGSAQSNAAVAWAAREGVMRQLPITLLHIVAPVVVG
WPVGQLYANMTEWQKDNAQQVIEQAREALTNSLGESKPPQVHTELVFSNV
VPTLIDASQQAWLMVVGSQGMGALGRLLLGSISTALLHHARCPVAIIHSG
NGATPDFDAPVLVGIDGSPASEAATALAFDEASRRRVDLVALHAWTDLGM
FPVLGMDWREREKREAEVLAERLAGWQEQYPDVRVHRSLVCDKPARWLLE
HSERAQLVVVGSHGRGGFSGMLLGSVSSAVAHSVRIPVIVVRPS
433635079YP_007268706.1 Conserved protein of unknown function (part1) [Mycobacterium canettMGSVHDVIEAFRKAPSNAERGTKFEQLMVRYFELDPTMAQQYDAVWRWID
WPERRGRTDTGIDLVARERDTGNYTAIQCKFYEPTHTLAKGDIDSFFTAS
GKTGFTNRVIISTTDRWGRNAEDALADQLVPVQRIGMAEIAESPIDWDIA
WPAGDLQVNLTPAKRHELRPHQQQAIDAVFRGFAVGNDRGKLIMACGTGK
TFTALKIAERTAAEKGGSARILFLVPSISLLSQTLREWTAQTALEVRAFA
VCSDTKVSRSAEDYHVHDVPIPVTTDPQVLLHEMQHRRRAQGLTVVFSTY
QSLPTVAKAQGLGVDEFDLVMCDEAHRTTGVTLAGEDESNFVRVHDGQYL
KAARRLYMTATPRIFTESIKDKADQHSAELVSMDDERTFGPEFHRLSFGE
AVERGLLTDYKVMVLTVDQGVIAPRLQQELSGVSGELMLDDASKIVGCWN
GLAKRSGTGVAAGEPPMRRAVAFARDIKTSKQVAEMFPKVVEAYRELVDE
GPGLACSVRHVDGTFNALVRNEQLAWLKGVVAEDECRILSNARCLSEGVD
VPALDAVLFLNPRNSIVDVVQSVGRVMRKSPGKDYGYVILPVAVPEGVEP
SAALADNKRFKVVWQVLNALRSHDERFDAMVNSIALNVKPTKTGEGTDKL
LGGHIGPVADEPGPAVAEKLAMFSLSQWQEAIYARIVDKVGTRTYWEQWA
ADVADIAATLTTRIQALLDGADAAVAAAFEQFLAGLRDNLNDSITPDDAI
SMLSQHLITKPVFDALFPGMTSRRTTRCRGPCRRWSTPSGVPAWRPKPLG
WKAFTNRCDGAPARSPAPRASSR
433635077YP_007268704.1 Protein of unknown function [Mycobacterium canettii CIPT 140070017]MLDLIASSRATRVEHTPTCVLGKSVRVSFGGRVFARSGLGFVWASRQHQA
GSAPSLHGKFSVSDRR
433635075YP_007268702.1 Protein of unknown function [Mycobacterium canettii CIPT 140070017]MPERKHSGDWETRQGIPTQYEIDKIEEGKPPGNEPPPVPPPDDGDQGSS
433635073YP_007268700.1 Protein of unknown function [Mycobacterium canettii CIPT 140070017]MANVQEVGRNRQQRAHTSALVIPWVNGEADAWSLAAKPELLGPAVIPWRA
VTWSRGAAAADDRHAAGMDHA
433635071YP_007268698.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MADPSVPSISLGGFVEFASSMSSGRITAVQNVIANEFGGYEPSHDFYRQF
RIAIAEGIANGDDALRVRRAVDECTPKRRSHYEALATGWSRWRRGKNLEV
FSQPLSWHASGLEVRVSPQFTYWVKAEPLLVWPYFKDAELSRDRIQAAIR
LTEMTHPNSGRRPAVLDVRRGTLYQAAKRRRKGFDAWLTSEAAAFISLLE
SIRNVA
433635069YP_007268696.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MADSRLEDLQRQRAQLYDELAATGDFRRGSISENYRRCGKPNCACAQPDH
PGHGPRHLWTRTVAGRGTKGRQLSAEEVDKVRAELANYHRFAAVSEQIVE
VNEAICEARPPNPAASAPPAATTGDEKKGSTSRSRRRSPPR
433635067YP_007268694.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MWAASPPPPCSPPWWPPKPAAAAPITSRQLVVLGDGAPWIWNLATAIAPE
ATPIVDLYHAREHLHTLADRLTGPLGDAHPDWLAARLADLDAGDIETLAT
ETERLLPQLPDDTANDTAKALGYFKTDVHRMRYAYFRAHGLFVGSGVGEA
GCRSLVGQRLKLSGMRWNIPGATGILTLRCQQASNRFDHIWIPAAQPDLT
A
433635065YP_007268692.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MTLAKRLKAMGSAKYQNDGDPRTSGPGFDVRPHPQALDEPYRWRTPRIVF
VNSMSDLFHARVPLSFIHDVFDVCRDTPQHTYQVLTKRSLRLRRVAGKLD
WPSNLWMGVSIENADVLARVDHLRDVPAAVRFLSCEPLLGPLHDINLGGI
HWVIAGGESGPNYRPMEIDWARGIRDECRDADVAFFFKQWGGRTPKSRGR
HLDGKLWDEMPSVPAMDSARIALAQ
433635063YP_007268690.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MAIEFTESAGKHGFTQADAVHAMSNARYYEPEFDEPRGDDQSSIRPSLWI
GPSLSLAAPLLEVMAEVIPPRTVRIFHVMPVREKFLARLDTDLDTDEGTP
433635061YP_007268688.1 Conserved protein of unknown function (C-terminal fragment) [MycobaMADVLGPLRAGATLQAVANDYGVTPDQLRDALDAIAA
433635059YP_007268686.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MVGAHLRLRIKRHHAGDEISTYPTQTAIEFWQQGSQPAFPGLEEVRIAVG
YRWHPDTRDIGAPLLSLRDGKDHVIWVVELDEPAAGVKITWTPIQPTLPS
IDFGDLGDDSGASRQR
433635057YP_007268684.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MSGARRSDIPADRDVSLGRPDYRDDPSPAHQPGSWSRLFTGATFPGASKA
VADLREAAVSETHDTKDVLAALAARKSPVRPF
433635055YP_007268682.1 Conserved protein of unknown function- possible MarR-family regulatMSDEIARLVADVFELAGLLRRSGEVVAAREGHTQARWQLLSVVSDRALTV
PQAARRLGVTRQGVQRVANDLVVCGLAELRHNPDHRTSPLLVLTENGRRV
LQAITERAIVVNNRLADAVDPAALQATRDSLRRMIVALKAERP
433635053YP_007268680.1 Conserved protein of unknown function- possible antitoxin VapB15 [MMYSGVVSRTNIEIDDELVAAAQRMYRLDSKRSAVDLALRRLVGEPLGRDE
ALALQGSGFDFSNDEIESFSDTDRKLADES
433635051YP_007268678.1 Ferredoxin FdxA [Mycobacterium canettii CIPT 140070017]MTYVIGSECVDVMDKSCVQECPVDCIYEGARMLYINPDECVDCGACKPAC
RVEAIYWEGDLPDDQHQHLGDNAAFFHQVLPGRVAPLGSPGGAAAVGPIG
VDTPLVAAIPVECP
433635049YP_007268676.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MSKPRKQHGVVVGVDGSLESDAAVCWGATDAAMRNIPLTVVHVVNADVAT
WPPMPYPETWGVWQEDEGRQIVANAVKLAKEAVGADRKLSVKSELVFSTP
VPTMVEISNEAEMVVLGNSGRGALARGLLGSVSSSLVRRAGCPVAVIHSD
DAVIPDPQHAPVLVGIDGSPVSELATAVAFDEASRRGVELIAVHAWSDVE
VVELPGLDFSAVQQEAELSLAERLAGWQERYPDVPVSRVVVCDRPARKLV
QKSASAQLVVVGSHGRGGLTGMLLGSVSNAVLHAARVPVIVARQS
433635047YP_007268674.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MTPDTRMPASSAAGRDAAAYDAWYDSPTGRPILATEVAALRPLIEVFAQP
RLEIGVGTGRFADLLGVRFGLDPSRDALMFARRRGVLVANAVGEAVPFVS
RHFGAVLMAFTLARYDIEAAHDGIQAGAGFVAISAVDQAHEPKDDHPLES
E
433635045YP_007268672.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MHHNRDVDLALVERPSSGYVYTTGWRLATTDIDEHQQLRLDGVARYIQEV
GAEHLADAQLAEVHPHWIVLRTVIDVINPIELPSDITFHRWCAALSTRWC
SMRVQLQGSAGGRIETEGFWICVNKDTLTPSRLTDDCIARFGSTTDNHRL
KWRPWLTGPNIDGTETPFPLRRTDIDPFEHVNNTIYWHGVHEILCQIPTL
TAPYRAVLEYRSPIKSGEPLTIRYEQHDDVVRMHFVVGDDVRAAALLRRL
433635043YP_007268670.1 Conserved membrane protein of unknown function [Mycobacterium canetMRRPLDPRDIPDELRRRLGLLDAVVIGLGSMIGAGIFAALAPAAYAAGSG
LLLGLAVAAVVAYCNAISSARLAARYPASGGTYVYGRMRLGDFWGYLAGW
GFVVGKTASCAAMALTVGFYVWPAQAHAVAVAAVVALTAVNYAGIQKSAW
LTRSIVAVVLVVLTAVVVAAYGSGAADPARLDIGVDAHVWGMLQAAGLLF
FAFAGYARIATLGEEVRDPARTIPRAIPLALGITLAVYALVAVAVIAVLG
PQRLARAAAPLSEAMRVAGVNWLIPAVQVGAAVAALGSLLALILGVSRTT
LAMARDRHLPRWLAAVHPRFKVPFRAELVVGAVVAALAATADIRGAIGFS
SFGVLVYYAIANASALTLGLDEGRPRRLIPLVGLIGCVVLAFALPLSSVA
AGAAVLGVGVAAYGVRRIITRRARQTDSGDTQRSGHPSAT
433635041YP_007268668.1 Putative metal cation transporter P-type ATPase A CtpF [MycobacteriMSASVSATTAHHGLPAHEVVLLLESDPYHGLSDGEAAQRLERFGPNTLAV
VTRASLLARILRQFHHPLIYVLLVAGTITAGLKEFVDAAVIFGVVVINAI
VGFIQESKAEAALQGLRSMVHTHARVVREGHEHTMPSEELVPGDLVLLAA
GDKVPADLRLVRQTGLSVNESALTGESTPVHKDEVALPEGTPVADRRNIA
YSGTLVTAGHGAGIVVATGAETELGEIHRLVGAAEVVATPLTAKLAWFSK
FLTIAILGLAALTFGVGLLRRQDAVETFTAAIALAVGAIPEGLPAAVTVT
LAIGMARMAKRRAVIRRLPAVETLGSTTVICADKTGTLTENQMTVQSIWT
PHGEIRATGTGYAPDGLLCDTDDAPVPVNANAALRWSLLAGACSNDAALG
RDGTRWQIVGDPTEGAMLVVAAKAGFNPERLATTLPRVAAIPFSSERQYM
ATLHRDGTDHVVLAKGAVERMLDLCGTEMGADGALRPLDRATVLRAAEML
TSRGLRVLATGMGAGAGTPDDFDENVLPGSLALTGLQAMSDPPRAAAASA
VAACHSAGIAVKMITGDHAGTATAIATEVGLLDNTEPAAGSVLTGAELAA
LSADQYPEAVDTASVFARVSPEQKLRLVQALQARGHVVAMTGDGVNDAPA
LRQANIGVAMGRGGTEVAKDAADMVLTDDDFATIEAAVEEGRGVFDNLTK
FITWTLPTNLGEGLVILAAIAVGVALPILPTQILWINMTTAIALGLMLAF
EPKEAGIMTRPPRDPDQPLLTGWLVRRTLLVSTLLVTSAWWLFAWELDNG
AGLHEARTAALNLFVVVEAFYLFSCRSLTRSAWRLGMFANRWIILGVTAQ
AIAQFAITYLPAMNMVFDTAPIDIEVWVRIFAVATAITIVVATDKLLPRI
RAQPP
433635039YP_007268666.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MVASGAATKGVTVMKQTPPAAVGRRHLLEISASAAGVIALSACSVSPPEP
AKGRPDTTAEQEVSVTAPEDLMREHGVLKRILLIYREGIRRLQADDQSPA
PALNESAQIIRRFIEDYHGQLEEQYVFPKLEQAGKLTDITSVLRTQHQRG
RVLTDRVLAATTAAAAFDQPARDALAQDMAAYIRMFEPHEAREDTVVFPA
LRDVMSAVEFRDMAETFEDEEHRRFGEAGFQSVVDKVADIEKSLGIYDLS
QFTPS
433635037YP_007268664.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MVTHELLVKAAGAVLTGLVGVSAYETLRKALGTAPIRRAAVTVTEWGLRG
TRRAEVAAESARLTVADVVAEARGRIGEEAPLPAGARVDE
433635035YP_007268662.1 Conserved protein of unknown function- possible toxin MazE6 [MycobaMKTAISLPDETFDRVSRRASELGMSRSEFFTKAAQRYLHELDAQLLTGQI
DRALESIHGTDEAEALAVANAYRVLETMDDEW
433635033YP_007268660.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MIWRGEVYDVALGQPIGHEPAFRRPAVVVSVDILNNGPGGLVIVVPITTA
SYGLRSHVELEPAAGGLDHTSYARCDQLRVVSIERLSSRQGMIRPDQMRA
IEQALRFVLDL
433635031YP_007268658.1 Putative methyltransferase [Mycobacterium canettii CIPT 140070017]MSALGRSRRAWGWHRLHDEWAARVVSAAAVRPGELVFDIGAGEGALTAHL
VRAGARVVAVELHPRRVGVLRERFPGITVVHADAASIRLPGRPFRVVANP
PYGISSRLLRTLLAPNSGLVAADLVLQRAVVCKFASGNARRFTLTVGLTL
PRRAFLPPPHVDSAVLVVRRRRKCGDWQGR
433635029YP_007268656.1 Conserved membrane protein of unknown function [Mycobacterium canetMNSPLVVGFLACFTLIAAIGAQNAFVLRQGIQREHVLPVVALCTVSDIVL
IAAGIAGFGALIGAHPRALNVVKFGGAAFLIGYGLLAARRAWRPVALIPS
GATPVRLAEVLVTCAAFTFLNPHVYLDTVVLLGALANEHSDQRWLFGLGA
VTASAVWFATLGFGAGRLRGLFTNPGSWRILDGLIAAMMVALGISLTVT
433635027YP_007268654.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MTDSVVVRVKPGSHKGPLVEVGPNGELIIYVREPAIDGKANDAVTRLLAA
HLQLPKSRVKLVSGATSRFKRFRLSR
433635025YP_007268652.1 Conserved protein of unknown function- PE-PGRS family protein [MycoMSFLVVVPEFLTSAAADVENIGSTLRAANAAAAASTTALAAAGADEVSAA
VAALFARFGQEYQAVSAQASAFHQQFVQTLNSASGSYAAAEATIASQLQT
AQHDLLGAVNAPTETLLGRPLIGDGAPGTATSPNGGAGGLLYGNGGNGYS
ATASGVGGGAGGSAGLIGNGGAGGAGGPNAPGGAGGNGGWLLGNGGIGGP
GGASSIPGMSGGAGGTGGAAGLLGWGANGGAGGLGDGVGVDRGTGGAGGR
GGLLYGGYGVSAPGGDGRTVPLEIIHVTEPTVHANVNGGPTSTILVDTGS
AGLVVSPEDVGGILGVLHMGLPTGLSISGYSGGLYYIFATYTTTVDFGNG
IVTAPTAVNVVLLSIPTSPFAISTYFSALLADPTTTPFEAYFGAVGVDGV
LGVGPNAVGPGPSIPTMALPGDLNQGVLIDAPAGELVFGPNPLPAPNVEV
VGSPITTLYVSIDGGTPIPVPSIIDSGGVTGTIPSYVIGSGTLPANTNIE
VYTSPGGDRLYAFNTNDYRPTVISSGLMNTGFLPFAFQPVYIDYSPSGIG
TTVFDHPA
433635023YP_007268650.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MIVDTSAVVALVQGERPHATLVAAALAGAHSPVMSAPTVAECLIVLTARH
GPVARTIFERLRSEIGLSVSSFTAEHAAATQRAFLRYGKGRHRAALNFGD
CMTYATAQLGHQPLLAVGNDFPQTDLEFRGVVGYWPGVA
433635021YP_007268648.1 Conserved exported protein of unknown function- immunogenic proteinMRIKIFMLVTAVVLLCCSGVATAAPKTYCEELKGTDTGQACQIQTSDPAY
NINISLPSYYPDQKSLENYIAQTRDKFLSAATSSTPREAPYELNITSATY
QSAIPPRGTQAVVLKVYQNAGGTHPTTTYKAFDWDQAYRKPITYDTLWQA
DTDPLPVVFPIVQGELSKQTGQQVSIAPNAGLDPVNYQNFAVTNDGVIFF
FNPGELLPEAAGPTQVLVPRSAIDSMLA
433635019YP_007268646.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MGEANIREQAIATMPRGGPDASWLDRRFQTDALEYLDRDDVPDEVKQKII
GVLDRVGTLTNLHEKYARIALKLVSDIPNPRILELGAGHGKLSAKILELH
PTATVTISDLDPTSVANIAAGELGTHPRARTQVIDATAIDGHDHSYDLAV
FALAFHHLPPTVACRAIAEATRVGKRFLIIDLKRQKPLSFTLSSVLLLPL
HLLLLPWSSMRSSMHDGFISALRAYSPSALQTLARAADPGMQVEILPAPT
RLFPPSLAVVFSRSSSAPTESSECSADRQPGE
433635017YP_007268644.1 Protein of unknown function [Mycobacterium canettii CIPT 140070017]MVHRRVKAPLVGEQRALLGAAGDPYDACAGGLGQLAGNRADRTGWCPARC
VRLGVREGESGGFDRP
433635015YP_007268642.1 Conserved exported protein of unknown function [Mycobacterium canetMSGSARLRDSPRSGLIAAALCVLATAAVLITAPAVHSALRSGASGRQPLA
PRLAALSDQELAQLLPKQSEFPASWTVDETTELSDTFGYFKYHVFDEGLG
FDPIECFGVVGVASTGAFDAAQVFGHDPAAQVAVADGKDILLTVGREFDR
SGFDAFVGLVSRCLRFGSAVAGSYTVRILEDSRPTAGPQRFRYSLTTTIS
AEPADETRTDYYSYGRTSGLILTGSAGSGHQQALDALFDITLQRIVER
433635013YP_007268640.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MDSLSHDPAAGDIGSQLVEIGSRGLAAGNAATMPTMTGLVPAGGEEVSAQ
AVMAFATEAASMIASNTAAQEELMRAGTALTDIARMYGDTDDNAAGALTI
GAGLTSRHPLAGGSGASAGAGLMRAGSLPGEAGSAARTPLMAQLLEGASS
PMASTAANAGSSAMSGAAPVGSGMGAGTPAGGSSKAGLVSATGPADEDDK
DPEDRRDQPSGERLA
433635011YP_007268638.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MRWIVDGMNVIGSRPDGWWRDRHRAMVMLVERLEGWAVTKARGDDVTVVF
ERPPSTAIPSSVVEVAHAPKSAANSADDEIVRLVRSGAQPQEIRVVTSDK
ALTDRVRDLGAAVYPAERFRDLIDPRGSNAARRTQ
433635009YP_007268636.1 Conserved membrane protein of unknown function [Mycobacterium canetMQRQSLMPQQTLAAGVFVGALLCGVVTAAVPPHARADVVAYLVNVTVRPG
YNFADADAALSYGHGLCEKVSRGRPYAQIIADVKADFDTRDQYQASYLLS
QAVNELCPALIWQLRNSAVDNRRSG
433635007YP_007268634.1 Conserved MCE-associated membrane protein of unknown function [MycoMSVAVDSDAEDDAVSEIAEAAGVSPAPAKPSMSAPRRMLLFGLVVVVALA
VLLCCWGFRVQRARHAQDQRGHFLQAARQCALNLTTIDWRNAEADVRRIL
DGATGEFYNDFAQRSQPFVEVLRHAKASTVGTITEAGLQTQTADTAQALV
AVSVQTSNAGEADPVPRAWRMRITVQRVGDRVKVSDVGFVP
433635005YP_007268632.1 Conserved lipoprotein of unknown function- MCE family Mce3E- thoughMRIGLTLVMIAAVVASCGWRGLNSLPLPGTQGNGPGSFAVQAQLPDVNNI
QPNSRVRVADVTVGHVTKIERQGWHALVTMRLDGDVDLPANATAKIGTTS
LLGSYHIELAPPKGEARQGKLRDGSLIALSHGSAYPSTEQTLAALSLVLN
GGGLGQVQDITEALSTAFAGREHDLRGLIGQLDTFTAYLNNQSGDIIAAT
DSLNRLVGKFADQQPVFDRALATIPDALAVLADERDTLVEAAEQLSKFSA
LTVDSVNKTTANLVTELRQLGPVLESLANSGPALTRSLSLLATFPFPNET
FQNFQRGDYANLTAIVDLTLSRIDQGLLTGTRWECHLTQLELQWGRTIGQ
FPSPCTAGYRGTPGNPLTIAYRWDQGP
433635003YP_007268630.1 Conserved protein of unknown function- MCE family Mce3C- thought toMKSFAERNRLAIGTVGIVVVAAVALAALQYQRLPFFNQGTRVSAYFADAG
GLRTGNTVEVSGYPVGKVSSISLDGPGVLVEFKVDTDVRLGNRTEVAIKT
KGLLGSKFLDVTPRGDGRLDSPIPIERTTSPYQLPDALGDLAATISGLHT
ERLSESLATLAQTFADTPAHFRNAIHGVARLAQTLDERDNQLRSLLANAA
KATGVLANRTDQIVGLVRDTNVVLAQLRTQSAALDRIWANISAVAEQLRG
FIAENRQQLRPALDKLNGVLAIVENRKERVRQAIPLINTYVMSLGESLSS
GPFFKAYVVNLLPGQFVQPFISAAFSDLGLDPATLLPSQLTDPPTGQPGT
PPLPMPYPRTGQGGEPRLTLPDAITGNPGDPRYPYRPEPPAPPPGGPPPG
PPAQQPGDQP
433635001YP_007268628.1 Conserved protein of unknown function- MCE family Mce3A- thought toMRRGPGRHRLHDAWWTLILFAVIGVAVLVTAVSFTGSLRSTVPVTLTADR
SGLVMDSGAKVMMRGVQVGRVAQIGRIEWAQNGASLRLEIDPDQIRYIPA
NVEAQISATTAFGAKFVDLVMPQNPSRARLSAGAVLHSTNVSTEINTVFE
NVVDLLNMIDPLKLNAVLTAVADAVRGQGERIGQATTNLNEVLEALNARG
DTIGGNWRSLKNFTDTYDAAAQDILTILNAASTTSATVVNHSTQLDALLL
NAIGLSNAGTNLLGSSRDNLVGAADILAPTTSLLFKYNPEYTCFLQGAKW
YLDNGGYAAWGGADGRTLQLDVALLFGNDPYVYPDNLPVVAAKGGPGGRP
GCGPLPDATHNFPVRQLVTNTGWGTGLDIRPNPGIGHPCWANYFPVTRAV
PEPPSIRQCIPGPAIGPNPAAGEQP
433634999YP_007268626.1 Conserved membrane protein of unknown function- YrbE3a [MycobacteriMVIPADKAAGRVADPVLRPVGALGDFFAMTLDTFVCMFKPPFAWREYLLQ
CWFVARVSTLPGVLMTIPWAVISGFLFNVLLTDIGAADFSGTGCAIFTVN
QSAPIVTVLVVAGAGATAMCADLGARTIREELDALRVMGINPIQALAAPR
VLAATTVSLALNSVVTATGLIGAFFCSVFLMHVSAGAWVTGLTTLTHTVD
VVISMIKATLFGLMAGLIACYKGMSVGGGPAGVGRAVNETVVFAFIVLFV
INIVVTAVGIPFMVS
433634997YP_007268624.1 Conserved protein of unknown function- possible antitoxin [MycobactMNEVSIRTLNQETSKVLARVKRGEEINLTERGKVIARIIPASGGPLDSPI
NTGRVQPATVRGPAPRPTIPMRGGLDAGTLLERLRAEERY
433634995YP_007268622.1 Conserved protein of unknown function- possible phage protein [MycoMRSDPFEEIAAALDAYHASLSRVLDLKCDALTTPELLACLQRLEVERRRQ
GAAEHALINQLAGQACEEELGGTLRTALANRLHITPGEASRRIAEAEDLG
KRRALTGEPLPAQLTATAAAQREGKIGREHIKEIQAFFKELPAAVDLGIR
DAAEAQLAELATSRRPDHLHGLATQLMDWLHPDGNFSDQERARKRGITMG
KQEFDGMSRISGLLTPELRATIEAVLAKLAAPGACNPDDHTPVVDDTPDA
DAVRRDTRSQAQRHHDGLLAALRGLLASGELGQHTGLPVTIVVSTTLKEL
EAAAGKGVTGGGSRVPMSDLIRMASKAHHYLALFDGAKPLALYHTKRLAS
PAQRIMLYAKDRGCSRPGCDAPAYHSEVHHVTPWTTTHRTDINDLTLACG
PDNRLVEKGWKTRKNAKGDTEWLPPAHLDHGQPRINRYHHPEKILCEPDD
DEPH
433634993YP_007268620.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MKTARLQVTLRCAVDLINSSSIQCFARIEHVASDQADPRPGVWHSSGMNR
IRLSTTVDAALLTSARDMRAGITDAALIDEALAALLARHRSAEVDASYAA
YDKHPVDEPDEWGDLASWRRAAGDS
433634991YP_007268618.1 Putative short-chain type dehydrogenase/reductase [Mycobacterium caMNHPDLAGKAAIVTGAGAGIGLAVARRLADEGCHVLCADIDGDAADAAAT
EIGCGAAACQVDVSDEQQVIAMVDACVAAFGGVDKLVANAGVVHLASLID
TTVEDFDRVIAINLRGAWLCTKHAAPRMIERGGGAIVNLSSLAGQVAVGG
TGAYGMSKAGIIQLSRITAAELRSSGIRSNALLPAFVDTPMQQTAMAMFD
EALGAGGARSMIARLQGRMAAPEEVAGIVAFLLSDDASMITGTTQIADGG
TIAALW
433634989YP_007268616.1 Putative dimerase [Mycobacterium canettii CIPT 140070017]MSCTFDMVPETVDHLDEVELRRAFGCFPCGVIAVCAMVDDQPVGMAASSF
TSVSVDPPLVSICVQNSSTTWPKLRDRPRLGVSVLAEGHDAACMSLSRKE
GNRFAGVFWSELSSGGVVIAGAGAWLDCRPYAEIPAGDHLIALLEICAVR
ADPETPPLVFHGSRFRRLESR
433634987YP_007268614.1 Putative oxygenase [Mycobacterium canettii CIPT 140070017]MAVRQVTVGYSDGTHKTMPVRCDQTVLDAAEEHGVAIVNECQSGICGTCV
ATCTAGRYQMGRTEGLSDVERAARKILTCQTFVTSDCRIELQYPVDDNAA
LLVTGDGVVTAVELVSPSTAILRVDTSGMAGALRYRAGQFAQLQVPGTNV
WRNYSYAHPADGRGECEFIIRLLPDGVMSNYLRDRAQPGDHIALRCSKGS
FYLRPIVRPVILVAGGTGLSAILAMAQSLDADVAHPVYLLYGVERTEDLC
KLDELTELRRRVGRLEVHVVVARPDPDWDGRTGLVTDLLDERMLASGDAD
VYLCGPVAMVDAARTWLDHNGFHRVGLYYEKFVASGAARRRTPARLDYAG
VDIAEVCRRGRGTAVVIGGSIAGIAAAKMLSETFDRVIVLEKDGPHRRRE
GRPGAAQGWHLHHLLTAGQIELERIFPGIVDDMVREGAFKVDMAAQYRIR
LGGTWKKPGTSDIEIVCAGRPLLEWCVRRRLDDEPRIDFRYESEVADLAF
DRANNAIVGVAVDNGDADGGDGLQVVPAEFVVDASGKNTRVPEFLERLGV
GAPEAEQDIINCFYSTMQHRVPPERRWQDKVMVICYAYRPFEDTYAAQYY
TDSSRTILSTSLVAYNCYSPPRTAREFRAFADLMPSPVIGENIDGLEPAS
PIYNFRYPNMLRLRYEKKRNLPRALLAVGDAYTSADPVSGLGMSLALKEV
REMQALLAKYGAGHRDLPRRYYRAIAKMADTAWFVIREQNLRFDWMKDVD
KKRPFYFGVLTWYMDRVLELVHDDLDAYREFLAVVHLVKPPSALMRPRIA
SRVLGKWARTRLSGQKTLIARNYENHPIPAEPADQLVNA
433634985YP_007268612.1 Putative enoyl-CoA hydratase EchA13 (enoyl hydrase) (unsaturated acMFVGRVGPVDRRSDGERSRRPREFEYIRYETIDDGRIAAITLDRPKQRNA
QTRGMLVELGAAFELAEADDTVRVVILRAAGPAFSAGHDLGSADDIRERS
PGPDQHPSYRCNGATFGGVESRNRQEWHYYFENTKRWRNLRKITIAQVHG
AVLSAGLMLAWCCDLIVASEDTVFADVVGTRLGMCGVEYFGHPWEFGPRK
TKELLLTGDCIDADEAHALGMVSKVFPVDELATSTIEFARRIAKVPTMAA
LLIKESVNQTVDAMGFSAALDGCFKIHQLNHAHWGEVTGGKLSYGTVEYG
LEDWRATPQIRPAIKQRP
433634983YP_007268610.1 Putative acyl-CoA dehydrogenase FadE18 [Mycobacterium canettii CIPTMDFRYSTEQDDFRASLRGFLGRGAPVREMAAADGSDRRLWQRLCTELELP
ALHVPPEHGGLGATLVETAIAFAELGRALTPIPFAATVFAIEAILRMGDD
EQRKRLLAGLLTGARIGTIAVSGHDVTSATTVRAVRRDGRPALTGECTPV
LHGHVADLFVVPAVADGSIVLHVVAADAPGVTVTPLPSFDITRPVATLRL
AGSPAEPLTAGTPDDMERVLDVARVLLAAEMLGGAEACLDLAVQYARSRK
QFDRPIGSFQAVKHACADMMIEIDATRATVMFAAMSAANGDELQTVAPLA
KAQTAETFVLCAGSALQIHGAIAFTWEHDLHLYYRRAKTSEALFGSSARN
RALLAERAGLVKA
433634981YP_007268608.1 Putative transcriptional regulatory protein [Mycobacterium canettiiMARRVVIVGFPGVQPLDVVGPYEVFTGASLLTSGGYEVAVGSIDGQPITT
ATGLGIVSVLLPSPGDPVDTVILPGGAGVDAARSEPALIDWVKAVSGTAR
RVVTVCTGAFLAAEAGLLDGHRATTHWAFAERFAREFPAVRVDADPIFIR
SSQKVWTAARVTAGIDLALALVEDDHGTEIAQTVARWLVLYLRRPGGQTQ
FAAPVWMPRAKRTSIRRVQEAIEAEPGGAHRIGELAQRAAMSPRHFTRVF
SDEVGEAPGRYVERIRTEAARRQLEETHDTVVAIAARCGFGTAETTRRSF
IRRVGISPDQYRKAFA
433634979YP_007268606.1 Conserved protein of unknown function (part2) [Mycobacterium canettMLGLGDLGGGRSLRGRRATSHWLTLPALKAFGAIPVADERIVHQDNIVTS
AGVSAGLDLALWLAGQLGGEARAKAIQLAIEYDPQPPFDSGHMSKASPTT
KAAATALLSKDSAKPANLTAATLLAWERALAAVRSRRRKRQHVGARARRP
433634977YP_007268604.1 Putative short-chain type dehydrogenase/reductase [Mycobacterium caMSVLDLFDLHGKRALITGASTGIGKRVALAYVEAGAQVAIAARHLDALEK
LADEIGTSGGKVVPVCCDVSQHQQVTSMLDQVTAELGGIDIAVCNAGIIK
VTPMLDMPLEEFQRLQNTNVTGVFLTAQAAAKAMVKQGQGGVIINTASMS
GHIINVPQQVSHYCASKAAVIHLTKAMAVELAPHKIRVNSVSPGYILTEL
VEPYTEYQPLWEPKIPLGRLGRPEELAGLYLYLASEASSYMTGSDIVIDG
GYTCL
433634975YP_007268602.1 Conserved secreted protein of unknown function- immunogenic proteinMKLTTMIKTAVAVVAMATIATFAAPVAFAAYPITGKLGSELTMTDTVGQV
VLGWKVSDLKSSTAVIPGYPVAGQVWEATATVNAIRGSVTPAISQFNART
ADGINYRVLWQAAGPDTISGATIPQGEQSTGKIYFDVTGPSPTIVAMNNG
MEDLLIWEP
433634973YP_007268600.1 Conserved membrane protein of unknown function [Mycobacterium canetMDPADVINPTSTRDAALARVLAYRQRVRARPLLIRATLAVVGGGLFVVSL
PMIVLLPELGIPALLVAFRLLAVEAQWAVRAYAWTDWRFTQLREWFHRQV
LVTRAAILVGLFLAAVAVVWLLVYEF
433634971YP_007268598.1 Conserved lipoprotein of unknown function (part1) [Mycobacterium caMDSTVTASIRRMLGLLAAMLLLGGCTGQHTTRTAASTTYTPHIKASSQDV
LDGAINADEPGCSAAVGVEGKVIWSGVRGIADLASGAKITTDTVFDIASV
SKQFTATAILLLVEAGKLTLDDPISQYVPELPDWAQTVTVEQLMHQTSGI
PDYVALLAARGYQVSDRTIEAEARQALAAAPELQFKPGTRFDYSNSNYLL
LGEIVHRASGQPLPEFLSAEIFQPLGLAMVVDPVGKVPNKAVSYEKGTGG
NRSEYRVGNPAWEQIGDGGIQTTPSQLARWADNYRTGSVGGLKLLEAQLA
GAVETEPGGGDRYGAGIVSRADGTLDHAGAWAGFVTAFHISSDRRTSVAI
SCNTDKPDPVAMADALGRLWM
433634969YP_007268596.1 Conserved membrane protein of unknown function [Mycobacterium canetMFPRWPQQAHNHEVSRADTVSVPRAPTQAEVAAVLRIMTPLRKVIKPKVY
GIENVPTERALLVGNHNTLGLVDAPLLAAELWERGRIVRSLGDHAHFKIP
GWRDALTRTGVVEGTREITSELMRRGELVMVFPGGAREVNKRKNERYKLV
WKNRLGFARLAIQHGYPIVPFASVGAEHGIDIVLDNESPLLAPVQFLAEK
LLGTKDGPALVRGVGLTPVPRPERQYYWFGEPIDTTEFMGQQADDNAARR
VRERAAAAIEHGIELMLAERAADPNRSLVGRLLRSDA
433634967YP_007268594.1 Conserved protein of unknown function- PPE family [Mycobacterium caMHYSVLPPEINSALIFAGAGSGPMLAAASAWDGLATELASAAASFGSVTA
GLVGGSWQGRSSVAMAAAAAPYAGWLAAAATQAERAATQAQVMVAEFEAV
RLAMVQPALVAANRSGLISLVISNLFGQNAPAIAAAEAAYEEMWALDVSA
MAAYHSGASAVAVALPAFALPLRLPAGLAAGPAAVVTALTTAVGMPTFAG
RTIAASLGLANVGGGNLGNANNGLGNIGNANLGNNNLGSANFGSFNIGSA
NLGGNNIGIGNAGASNFGLANLGNLNTGFANAGIGNVGIANTGNNNIGIG
LTGNNQIGIGGLNSGNGNFGLFNSGSANIGFFNSGNGNFGIGNSGNFSTG
LFNPGHGNTGFLNAGSFNTGMFDVGNANTGSFNVGHYNFGAFNPGSSNTG
TFNTGGANTGWFNTGSINTGAFNIGDMNNGLFNTGDMNNGVFYRGVGQGS
LQFAITSPDLTLPSLEIPGISVPAFSLPAITLPSLTIPAVTTPANVTVGA
FDLPGLTVPSLTIPAAMTPANITVGAFDMPGLTVPSLTIPATTTPANITV
GAFNLPQLSIPSVTVPPITIPAGTALGAFNLPTLSIPSVTVPPITIPAGT
TVGGFTLPTIHTPLISTPQISIGGFSTPGIATQANSGVINLPTFSLNGIT
ITNLVVFIPNNITALQTNMPGVFPQIGGFANTPPAFINTGTITVGGGQIN
GVGFSIGAINVTPFTLPNVVIQPWSLGGISVDGFTLPEISTQEFTTPALT
ISPIGVGALSLPDITTQQFTTPELTIDPITLGGFTLPQLSIPAITTPAFT
IDPIALGSFTLPQIMTPEITTPPFTIDPIGLSGFTLPQLNIPEITTPEFT
IQPVGLAAFTTPALTIASIHLPSTTMGGFAIPAGPGYFNSSATPSSGFFN
AGIGGNSGFGNSGSGLSGWFNTSPVGLLAGSGYQNYGGLFSGFSNLGSGI
SGFANTGTLPFAVTSLVSGLANIGNNLSGLFFQSTTP
433634965YP_007268592.1 Isocitrate lyase [Mycobacterium canettii CIPT 140070017]MAIAETDTEVHTPFEQDFEKDVAATQRYFDSSRFAGIIRLYTARQVVEQR
GTIPVDHIVAREAAGAFYERLRELFAARKSITTFGPYSPGQAVSMKRMGI
EAIYLGGWATSAKGSSTEDPGPDLASYPLSQVPDDAAVLVRALLTADRNQ
HYLRLQMSERQRAATPAYDFRPFIIADADTGHGGDPHVRNLIRRFVEVGV
PGYHIEDQRPGTKKCGHQGGKVLVPSDEQIKRLNAARFQLDIMRVPGIIV
ARTDAEAANLIDSRADERDQPFLLGATKLDVPSYKSCFLAMVRRFYELGV
KELNGHLLYALGDGEYAAAGGWLERQGIFGLVSDAVNAWREDGQQSIDGI
FDQVESRFVAAWEDDAGLMTYGEAVADVLEFGQSEGEPIGMAPEEWRAFA
ARASLHAARVKAKELGADPPWDCELAKTPEGYYQIRGGIPYAIAKSLAAA
PFADILWMETKTADLADARQFAEAIHAEFPDQMLAYNLSPSFNWDTTGMT
DEEMRRFPEELGKMGFVFNFITYGGHQIDGVAAEEFATALRQDGMLALAR
LQRKMRLVESPYRTPQTLVGGPRSDAALAASSGRTATTKAMGKGSTQHQH
LVQTEVPRKLLEEWLAMWSGHYQLKDKLRVQLRPQRAGSEVLELGIHGES
DDKLANVIFQPIQDRRGRTILLVRDQNTFGAELRQKRLMTLIHLWLVHRF
KAQAVHYVTPTDDNLYQTSKMKSHGIFTEVNQEVGEIIVAEVNHPRIAEL
LTPDRVALRKLITKEA
433634963YP_007268590.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MVPTQLRFDRWFLPLAVPLGLGPKNSELWVGAGSLHVKMGWAFAADIPLT
SITKAEATNARVYAAGVHFGFGRWLVNGSRKGLVALTIDPPEQAKMWKKS
MTVRELWVSVTDPDALVTACTAK
433634961YP_007268588.1 Putative oxidoreductase FadB5 [Mycobacterium canettii CIPT 14007001MRAVVITKHGDPSVLQVRQRPDPPPPGPGQLRVAVRAAGVNFADHLARVG
LYPDAPKLPAVVGYEVAGTVEAVGDGVDPNRVGERVLAGTRFGGYCEIVN
VAATDSVVLPDALSFEQGAAVPVNYATAWAALHGYGSLRAGERVLIHAAA
GGVGIAAVQFAKAAKAEVHGTASPQKHQKLAEFGVDRAIDYRRDGWWQGL
GPYDVVLDALGGTSLRRSYTLLRPGGRLVGYGISNMQHGEKRSMRRVAPH
ALSMLRGFNLMKQLEESKTVIGLNMLRLWDDRRTLEPWIAPLTKALNDGT
ILPIVHAIVPFAEAPEAHRILAARENVGKVVLVP
433634959YP_007268586.1 Conserved exported protein of unknown function [Mycobacterium canetMAHAFHRFALAILGLALPVALVAYGGNGDSRKAAPLAPKAAALGRSMPET
PTGDVLTISSPAFADGAPIPEQYTCKGANIAPPLTWSAPFGGALVVDDPD
APREPYVHWIVIGIAPGAGSTADGETPGGGISLPNSSGQPAYTGPCPPAG
TGTHHYRFTLYHLPAVPPLAGLAGTQAARVIAQAATMQARLIGTYEG
433634957YP_007268584.1 Catalase-peroxidase-peroxynitritase T KatG [Mycobacterium canettii MPEQHPPITETTTGAASNGCPVVGHMKYPVEGGGNQDWWPNRLNLKVLHQ
NPAVADPMGAAFDYAAEVATIDVDALTRDIEEVMTTSQPWWPADYGHYGP
LFIRMAWHAAGTYRIHDGRGGAGGGMQRFAPLNSWPDNASLDKARRLLWP
VKKKYGKKLSWADLIVFAGNCALESMGFKTFGFGFGRVDQWEPDEVYWGK
EATWLGDERYSGKRDLENPLAAVQMGLIYVNPEGPNGNPDPMAAAVDIRE
TFRRMAMNDVETAALIVGGHTFGKTHGAGPADLVGPEPEAAPLEQMGLGW
KSSYGTGAGKDAITSGIEVVWTNTPTKWDNSFLEILYGYEWELTKSPAGA
WQYTAKDGAGAGTIPDPFGGPGRSPTMLATDLSLRVDPIYERITRRWLEH
PEELADEFAKAWYKLIHRDMGPVARYLGPLVPKQTLLWQDPVPSVSHDLV
GEAEIASLKSQILASGLTVSQLVSTAWAAASSFRGSDKRGGANGGRIRLQ
PQVGWEVNDPDGDLRKVIRTLEEIQESFNSAAPGNIKVSFADLVVLGGCA
AIEKAAKAAGHNITVPFTPGRTDASQEQTDVESFAVLEPKADGFRNYLGK
GNPLPAEYMLLDKANLLTLSAPEMTVLVGGLRVLGANYKRSPLGVFTEAS
ESLTNDFFVNLLDMGITWEPSPADDGTYQGKDGSGTVKWTGSRVDLVFGS
NSELRALAEVYGADDAQPKFVQDFVAAWDKVMNLDRFDVR
433634955YP_007268582.1 Putative D-amino acid oxidase Aao [Mycobacterium canettii CIPT 1400MAIGEQQVIVIGAGVSGLTSAICLAEAGWPVRVWAAALPQQTTSAVAGAV
WGPRPKEPVAKVRGWIEQSLHVFRDLAKDPATGVRMTPALSVGDRIETGA
LPPGLELIPDVRPADPADVPGGFRAGFHATLPMIDMPQYLDCLTQRLAAT
GCEIETRPLRSLAEAAEAAPIVINCAGLGARELAGDATVWPRFGQHVVLT
NPGLEQLFIERTDGSEWICYFAHPQRVVCGGISIPGRWDTTPEPEITERI
LQRCRRIQPRLAEAAVIETITGLRPDRPSVRVEAEPIGRALCIHNYGHGG
DGVTLSWGCAREVVNLVSGG
433634953YP_007268580.1 Conserved membrane protein of unknown function [Mycobacterium canetMVPFLMRAAVTGFALWVVTLFVPGMRFAGGDTTLQRVAIIFVVAVIFGLV
NAFIKPIVQILSIPLYILTLGLFHVVVNASMLWLTAWITEHTTGWGLQID
HFWWTAIWAAILLSIVSWILSLLARDFRRVTRAH
433634951YP_007268578.1 Putative CinA-like protein CinA [Mycobacterium canettii CIPT 140070MAVSARAGIVITGTEVLTGRVQDRNGPWIADRLLELGVELAHITICGDRP
ADIEAQLRFMAEQGVDLIVTSGGLGPTADDMTVEVVARYCGRELVLDDEL
ENRIANILKKLMGRNPAIEPANFDSIRAANRKQAMIPAGSQVIDPVGTAP
GLVVPGRPAVMVLPGPPRELQPMWSKAIQTAPVQDAIAGRTTYRQETIRI
FGLPESSLADTLRDAEAAIPGFDLVEITTCLRRGEIEMVTRFEPNAAQVY
TQLARLLRDRHGHQVYSEDGASVDELVAKLLTGRRIATAESCTAGLLAAR
LTDRPGSSKYVAGAVVAYSNEAKAQLLGVDPALIEAHGAVSEPVAQAMAA
GALQRFGADTATAITGIAGPSGGTPEKPVGTVCFTVLLDDGRTTTRTVRL
PGNRSDIRERSTTVAMHLLRRTLCGIPGSP
433634949YP_007268576.1 Conserved exported protein of unknown function- lipoprotein LppD (pMAAMRAHARRRHPHALMSRAAGLPRLSWFAGLTWFAGGSTGAGCAAHPAL
AGLTAGARCPAYAAISASTARPAATAGTTPATGASGSARPTDAAGMADLA
RPGVVATHAVRTLGTTGSRAIGVSPCQPLDCPRSPQATPNLGSMGRSLDG
PESRWAGVSMGRSGAGRGFDCVGDGGDGPTQ
433634947YP_007268574.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MSVLVAFSVTPLGVGEGVGEIVTEAIRVVRDSGLPNQTDAMFTVIEGDTW
AEVMAVVQRAVEAVAARAPRVSTVIKVDWRPGVTDAMTQKVATVERYLLR
PE
433634945YP_007268572.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MTTPEYGSLRSDDDHWDIVSNVGYTALLVAGWRALHTTGPKPLVQDEYAK
HFITASADPYLDALLANPRTSEDGTAFPRLYGVQTRFFDDFFNCADEAGI
RQAVIVAAGLDCRAYRLDWQPGTTVFEIDVPKVLEFKARVLTERGAVPKA
HRVEVPADLRTDWPTPLKAAGFDPQRPSAWSVEGLLPYLTGDAQYALFAR
IDELCAPGSRVAFGALGSRLDHEQLAALETAHPGVNMSGDVNFSALTYDD
KTDPVEWLVEHGWVVDPVRSTLELQVGYGLTPPDVDVKIDSFMRSQYITA
IRA
433634943YP_007268570.1 Putative integrase fragment [Mycobacterium canettii CIPT 140070017]MANSPGSGRVSARTPAKLTRRSKVTFTRTRPASNNDGCPTEQKNWAMVCT
AVATTATTPPQKRVAKVRACAKVSDNHDQATTLFHHAIDHPTMTVQQTYS
LINPQSARGDGP
433634941YP_007268568.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MSFNPKDAVDAVRDIAANAVEKASDIVENAGHVIRGDIAGGASGIVKDSI
DIATHAVDRTKEVFTGKPDDEG
433634939YP_007268566.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MIRELVTTAAITGAAIGGAPVAGADPQRYDGDVPGMNYDASLGAPCSSWE
RFIFGRGPSGQAEACHFPPPNQFPPAETGYWVISYPLYGVQQVGAPCPKP
QAAAQSPDGLPMLCLGARGWQPGWFTGAGFFPPEP
433634937YP_007268564.1 Putative S-adenosyl-L-methionine-dependent methyltransferase [MycobMPRTNNDAWDLATSVGATATMVAAARAVATRADNPLIDDPFAEPLVRAVG
IEFFTRWAAGNIKATDVDDPDGTWGLQRLADLLAARTRYFDAFFRDATSA
GIRQAVILASGLDARAYRLTWPSGTTVFEIDQPQVIEFKMTTLADLDATA
TADLRVVPVDLRRDWPTPLRQAGFDPNQPSAWLAEGLLAFLPPEAQDRLL
DNITALSAPGSRLAAEIFGNSVDDDGGPASDLLDTASQRWSVHGFDIEIT
HLLYSDGERNDVATYLDSHGWQSVPTPLSKLLADNGLPVPPSSPEQLPTA
QGYYCTSIRCP
433634935YP_007268562.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MDTVLGLSITPTTLGWVLAEGHGADGAILDRNELELHSGPNAQAIHTAEQ
LAAEVLLAHEVAAAGDHRLRVIGVTWNAEASAQAALLVESLTGAGFDNVV
PVRRLHAIETLAQAIAPVIGYEQTAVCVLEHESATVVMVDTHDGKTQTAV
KHVCRGLSGLTSWLTGMFSRDAWRPAGVVVVGSDSEVSEFSWQLERVLPV
PVFAQTMAQVTVARGAALAAAQSTEFTDAQLVADSASQPTVAPRRSRHYA
GAAAALAAAAVTFVASLSLAVGIQLAPHNDTGTAKHGAHKLTPRIAKAVA
PAVPPPPTVTPPVPARAPRPAAQHEPPARVTSGEGLTEPNPPEEQPNASA
PQQDRNDSQPITRVLEHIPGTYGDSAPPAE
433634933YP_007268560.1 Conserved exported protein of unknown function [Mycobacterium canetMLTRPREIYLATAVSIGILLSLIAPQGPPLARADGTSQLTELVDAAAERL
EVADPVAAFKWRAQLPIEDSGRVEQQLAKLGEDARSQHIDPDYVTRVFGD
QIRATEAIEYSRFSDWKLNPASAPPEPPDLSASRSAIDSLNNRMLSQIWS
HWSLLCAPSCAAQLDRAKRDIVRARHLDSLYQRALTTATQSYCQALPPA
433634931YP_007268558.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MEGSATVHMAAPPDKIWKLIADVRNTGRFSPETFEAEWLDGAAGPALGAR
FRGHVRRNGIGPVYWTVCEVTACEPGREFGFAVLLGDRPVNNWHYCLTPT
ADGTEVTESFRLPPSVLTTVYYRVFGGWLRQRRNIRDMTKTLQRIKDVVE
AG
433634929YP_007268556.1 Conserved lipoprotein of unknown function- LppE [Mycobacterium caneMCNRLVTVTGVAMVVAAGLSACGQAQTVPQKAARLTIDGVTHTTRPATCS
QEHSYRTIDIRNHDSNVQAVVLLSGDRVIPQWVKIRNVDGFNGSFWHGGV
GNARADRARNTYTVAGSAYGISSKKPNTVVSTDFNILAEC
433634927YP_007268554.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MADSAGSDLTRHTAEVPLIDQHVHGCWLTEGNRRRFENALNEANTEPLAD
FDSGFDSQLGFAVRNHCAPILGLSRHVDPQTYWDRRSQFSEAELARRFLQ
AAGVTDWLVETGIGYGVSAMASVAGLGELSGGHAHEVVRLEQVAEQAAQA
SGDYASAFNEILRRRAATAVATKSILAYRGGFDGDLTEPPAAQVAEAAKR
WRDRGGVRLQDRVLLRFGLHQALRLGKPLQFHVGFGDRDADLHKANPLYL
LDFLRQSGNTPIVLLHCYPYEREAGYLAQAFNNVYLDGGLSVHYLGARSP
AFIGRLLELAPFRKIVYSSDGFGPAELHFLGATLWRSGIQRVLRGFVERD
DWSETDALRVVDLIAHGTAARIYRLGDR
433634925YP_007268552.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MAGPTAPTTAPTAIRADGTLLSPVRRNIIFTALVFGVLVAATGQTIVVPA
LPTIVAELGSTVDQSWAVTSYLLGGTVVVVVAGKLGDLLGRNRVLLGSVV
VFVVGSVLCGLSQTMTMLAISRALQGVGAGAISVTAYALVAELVPLRDRG
RYQGVLGAVFGVNTVTGPLLGGWLTDYLSWRWAFWINVPVSIAVLTVAAT
AVPALARPPKPVIDYLGILVIAVATTALIMATSWGGTTYAWGSATIVGLL
IGAAVALGFFVWLEGRAAAAILPPRLFGSPVFAVCCVLSFVVGFAMLGAL
TFVPIYLGYVDGASATASGLRTLPMVIGLLIASTGTGVLVGRTGRYKIFP
VAGMALMAVAFLLMSQMDEWTPPLLQSLYLVVLGAGIGLSMQVLVLIVQN
TSSFEDLGVATSGVTFFRVVGASFGTATFGALFVNFLDRRLGSALTSGAV
PVPAVPSPAVLHQLPQSMAAPIVRAYAESLTQVFLCAVSVTVVGFILALL
LREVPLTDIHDDADDLGDGFGVPRAESPEDVLEIAVRRMLPDGVRLRDIA
TQPGCGLGVAELWALLRIYQYQRLFEAVRLTDIGRHLHVPYQVFEPVFDR
LVQTGYAARDGDILTLTPSGHRKVDSLAVLIRQWLLDHLVVAPGLRRQPD
HQFEAALQHITDAVLVQRDWYEDLGDLSESRQLAATR
433634923YP_007268550.1 Exported protein of unknown function [Mycobacterium canettii CIPT 1MPRLNLVQRVRVGAGFVAASARLAGAKSKPRVIVRLDSTNQLRLDSTNMR
LDRSPTQHLLGVC
433634921YP_007268548.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MLMRPEPDDDWCARQRAQVADALLGLGVAGLSINVRDSTVRDSVMTLTTL
YPPVAAVVSLWTQQCYGEQVAAAFRLLAQECDELGAYLVTESVPLTFPSL
VESGSRTPGLANIALLRRPDGLDQATWLTRWQRDHTQVAIEAQATSGYTQ
NWVVRALTPEAPGIAGIVEELFPMAATTDLKAFFGAADDNDLRNRISRMV
ASTSAFGANQNIDTVPTSRYVFRTPFKD
433634919YP_007268546.1 L-lactate dehydrogenase (cytochrome) LldD2 [Mycobacterium canettii MAVNRRVPRVRDLAPLLQFNRPQFDTTKRRLGSALTIQDLRRIAKRRTPR
AAFDYADGAAEDELSIERARQGFRDIEFHPTILRDVTTVCAGWNVLGQPT
VLPFGIAPTGFTRLMHTEGEIAGARAAAAAGIPFSLSTLATCAIEDLVIA
VPQGRKWFQLYMWRDRDRSMALVRRAAAAGFDTMLVTVDVPVAGARLRDV
RNGMSIPPALTLRTVLDAMGHPRWWFDFLTTEPLAFASLDRWPGTVGEYL
NTVFDPSLTFDDLAWIKSQWPGKLVVKGIQTLDDARAVVDRGVDGIVLSN
HGGRQLDRAPVPFHLLPHVASELGKHTEILVDTGIMSGADIVAAIALGAR
CTLIGRAYLYGLMAGGEAGVNRAIEILQTGVIRTMRLLGVTCLEELSPRH
VTQLRRLGPIGAPT
433634917YP_007268544.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MIKPEPLARRLLKLAGTTYAAEAGIRIRDKPMPLFQLLVLCMLASKPIGA
ATAVRAARELFSSGLRTPKAVLSAERQTMISAFGRAHYVRYDESSATRLT
AIAHRVRDEYSGDLRELARRTRPDVSAAKRMLKTFNGIGDTGADIFLREV
QDVWIWVRPYFDDRATAAAKQLGLPTDPKKLASVAPSSNALLAAALVRVA
LDDELRRQVTG
433634915YP_007268542.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MQILVTDATGAVGRSVTRQLIAAGHTVSGIAQHPHDALDPRVDYVCASLR
HPVLQELAGEADAVIHLAPVDTRAPGGVGITGLAHVANAAARAGARLLFV
SQAAGRPELYRQAETLVSTGWAPSLVIRIAPPVGRQLDWMVCRTVATLLR
SKVSARPIRVLHLDDLVRFLVLALNTDRNGVVDLATPDTTNVVTAWRLLR
SVDPHLRTHRVRSWEQLIPEVDIAAVQEDWNFEFGWQATEAIVDTGRGLV
GRRLHPAGATNGSGQLALPVEAPPRSVPSHGEPLGSAAPEGLEGEFDDRI
DERFPVFSSASLAEALPGPLTPMTLDVQLSGLRAAGRAMGRVLALGGVVA
DEWGSRAIAVFGHRPYVGVSANIVAAAQLPGWDAQAVARRALGEQPQVTE
LLPFGRPQLAGGPLGSVAKVVVTARSLALLRHLRSDTHHYVAAADAEHLA
AGQLASLPDAGLEVRIRLLRDRIHQGWILTVLWVIDTGVTAATLEHTRAG
SAVSGVGMIMESGRIGAEIAPLAAVLRADPPLCALANDGNLASVRALSAP
AAAAVDAAIARIGHRGLGEAELANLTFADDPALLLKTAAEIAARPAGPAH
PATLIQRLAAGARSARELAHDTTIRFTHELRMTLRELGSRRVAADVIDVV
DDVFYLTCDELITTPVDARLRIKRRRAERERLQAQRPPDVIDHAWVPVE
433634913YP_007268540.1 Putative acyl-CoA transferase [Mycobacterium canettii CIPT 14007001MVTRLLADLGADVLKVEPPGGSPGRHARPTLAGTSIGFAVHNANKRSAVL
NPLDESDRRRFFDLAAGADIVVDCGIPGQAAAYGASCAELADRYRHLVAL
SITDFGAAGPRSSWRATDPVLYAMSGALSRSGPTAGTPVLPPDGIASATA
AVQAAWAVLVAYFNRLRCGTGDYIDFSRFDAVVMALDPPFGAHGQVAAGI
RSTGRWRGRPKNQDAYPIYPCRDGYVRFCVMAPRQWRGLRRWLGEPEDFQ
DPKYDVIGARLAAWPQISVLVAELCAEKTMKELVAAGQALGVPITAVLTP
SRILASEHFQAVGAITDAELVPGVRTGVPTGYFVVDGKRAGFRTPAPAAG
QDEPRWLADPAPVPPPSGRVGGYPFEGLRILDLGIIVAGGELSRLFGDLG
AEVIKVESADHPDGLRQTRVGDAMSESFAWTHRNHLALGLDLRNSEGKAI
FGRLVAESDAVFANFKPGTLTSLGFSYDVLHAFNPRIVLAGSSAFGNRGP
WSTRMGYGPLVRAATGVTRVWTSDEAQPDNSRHPFYDATTIFPDHVVGRV
GALLALAALIHRDRTGGGAHVHISQAEVVVNQLDTMFVAEAARATDVAEI
HPDTSVHAVYPCAGDDEWCVISIRSDDEWRRATSVFGQPELANDPRFGAS
RSRVANRSGLVAAVSAWTSTRTPVQAAGALQAAGVAAGPMNRPSDILEDP
QLIERNLFRDMVHPLIARPLPAETGPAPFRHIPQAAQRPAPLPGQDSVSI
CRKLLGMTADETARLINERVVFGPAVSA
433634911YP_007268538.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MTVAPRRLACTNARQSYPVRVAHVLSVNLARVRANPDPRAQSKLTGIDKV
AASEAVMVRAPGSMHAGVGSGLVGDTVGNPKLHGGDDQAVYAYAREDLDA
WETQLHRTLHNGMFGENLTTSGIDVTYARIGERWRIGSDGLVLEVSAPRI
PCRTFAAFLDLRHWIKTFTRAAKPGAYLRVIAPGTVRAGDTITVDYRPEH
NVTVGLVFRARTSESELLPQLLAADALAAELKAYARERTPSPPPVDSADD
V
433634909YP_007268536.1 Putative alcohol dehydrogenase AdhA [Mycobacterium canettii CIPT 14MVSPATMATMSAWQVRRPGPMDTGPLERVTTRVPRPAPSELLVAVHACGV
CRTDLHVTEGDLPVHRERVIPGHEVVGEVIEVGSAVGAAAGGEFDLGDRV
GIAWLRHTCGVCKYCRRGSENLCPESRYTGWDADGGYAEFTTVPAAFAHH
LPSGYSDSELAPLLCAGIIGYRSLLRTELPPGGRLGLYGFGGSAHITAQV
ALAQGAEIHVMTRGARARKLALELGAASAQDAADRPPVPLDAAILFAPVG
DLVLPALEALDRGGILAIAGIHLTDIPDLNYQRHLFQERQIRSVTSNTRA
DARAFFDFAAQHHIEVTTPEYPLGQADRALGDLSAGRIAGAAVLLI
433634907YP_007268534.1 Alanine and proline rich secreted protein Apa (fibronectin attachmeMHQVDPNLTRRKGRLAALAIAAMASASLVTVAVPATANADPEPAPPVPTT
AASPPSTAAAPPAPATPVAPPPPAAANTPNAQPGDPNAAPPPADPNAPPP
PVIAPNAPQPVRIDNPVGGFSFALPAGWVESDAAHLDYGSALLSKTTGDP
PFPGQPPPVANDTRIVLGRLDQKLYASAEATDSKAAARLGSDMGEFYMPY
PGTRINQETVSLDANGVSGSASYYEVKFSDPSKPNGQIWTGVIGSPAANA
PDAGPPQRWFVVWLGTANNPVDKGAAKALAESIRPLAPPPPAPAPAPGPA
EPAPAPAPPPAPAPAGEVTPTPTTPPQRTLPA
433634905YP_007268532.1 Putative molbdenum-transport integral membrane protein ABC transporMHSPTDLPRWVYLPAIAGIVFVAMPLVAIAIRVDWPHFWGLITSPSSQTA
LLLSVKTAAASTVLCVLLGVPMALVLARSRGRLVRSLRPLILLPLVLPPV
VGGIALLYAFGRIGLIGRYLEAAGISIAFSTAAVVLAQTFVSLPYLVISL
EGAARTAGADYEVVAATLGARPGTVWWRVTLPLLLPGVVSGSVLAFARSL
GEFGATLTFAGSRQGVTRTLPLEIYLQRVSDPDAAVALSLLLVVVAALVV
LGVGARTPIGTDTR
433634903YP_007268530.1 Putative short chain dehydrogenase [Mycobacterium canettii CIPT 140MAVEVLVTGGDTDLGRTMAEGFRNDGHKVTLVGARRGDLEVAAKELDVDA
VVCDTTDPTSLTEARGLFPRHLDTIVNVPAPSWDAGDPRAYSVSDTANAW
RNALDATVLSVVLTVQSVGDHLRSGGSIVSVVAENPPAGGAESAIKAALS
NWIAGQAAVFGTRGITINTVACGRSVQTGYEGLSRTPAPVAAEIARLALF
LTTPAARHITGQTLHVSHGALAHFG
433634901YP_007268528.1 Putative NADH dehydrogenase Ndh [Mycobacterium canettii CIPT 140070MSPQQEPTAQSPRRHRVVIIGSGFGGLNAAKKLKRADVDIKLIARTTHHL
FQPLLYQVATGIISEGEIAPPTRVVLRKQRNVQVLLGNVTHIDLAGQCVV
SELLGHTYQTPYDSLIVAAGAGQSYFGNDHFAEFAPGMKSIDDALELRGR
ILSAFEQAERSSDPERRAKLLTFTVVGAGPTGVEMAGQIAELAEHTLKGA
FRHIDSTKARVILLDAAPAVLPPMGEKLGQRAAARLQKLGVEIQLGAMVT
DVDRNGITVKDSDGTVRRIESACKVWSAGVSASRLGRDLAEQSRVELDRA
GRVQVLPDLSIPGYPNVFVVGDMAAVEGVPGVAQGAIQGAKYVASTIKAE
LAGANPAEREPFQYFDKGSMATVSRFSAVAKIGPVEFSGFIAWLIWLVLH
LAYLIGFKTKITTLLSWTVTFLSTRRGQLTITDQQAFARTRLEQLAELAA
EAQGSGASAKVAS
433634899YP_007268526.1 Urease accessory protein ureG [Mycobacterium canettii CIPT 14007001MATHSHSHSHTVSARPRRVRKPGEPLRIGVGGPVGSGKTALVAALCRQLR
GELSLAVLTNDIYTTEDADFLRTHAVLPDDRIAAVQTGGCPHTAIRDDIT
ANLDAIDELMAAHEGLDLILVESGGDNLTATFSSGLVDVQIFVIDVAGGD
KVPRKGGPGVTYSDLLVVNKTDLAPLVGADLAVMARDADAVRDGRPTVLQ
SLTEDPAASDVVAWVRSQLAADGV
433634897YP_007268524.1 Urease subunit alpha [Mycobacterium canettii CIPT 140070017]MARLSRERYAQLYGPTTGDRIRLADTNLLVEVTEDRCGGPGLAGDEAVFG
GGKVLRESMGQGRASRADGAPDTVITGAVIIDYWGIIKADIGIRDGRIVG
IGKAGNPDIMTGVHRDLVVGPSTEIISGNRRIVTAGTVDCHVHLICPQII
VEALAAGTTTIIGGGTGPAEGTKATTVTPGEWHLARMLESLDGWPVNFAL
LGKGNTVNPDALWEQLRGGASGFKLHEDWGSTPAAIDTCLAVADVAGVQV
ALHSDTLNETGFVEDTIGAIAGRSIHAYHTEGAGGGHAPDIITVAAQPNV
LPSSTNPTRPHTVNTLDEHLDMLMVCHHLNPRIPEDLAFAESRIRPSTIA
AEDVLHDMGAISMIGSDSQAMGRVGEVVLRTWQTAHVMKARRGALEGDPS
GSQAADNNRVRRYIAKYTICPAIAHGMDHLIGSVEVGKLADLVLWEPAFF
GVRPHVVLKGGAIAWAAMGDANASIPTPQPVLPRPMFGAAAATAAATSVH
FVAPQSIDARLADRLAVNRRLAPVADVRAVGKTDLPLNDALPSIEVDPDT
FTVRIDGQVWQPQPAAELPMTQRYFLF
433634895YP_007268522.1 Urease gamma subunit ureA (Urea amidohydrolase) [Mycobacterium caneMRLTPHEQERLLLSYAAELARRRRARGLRLNHPEAVAVIADHILEGARDG
HTVAELMTSGREVLGRDDVMEGVPEMLAEVQVEATFPDGTKLVTVHQPIA
433634893YP_007268520.1 Transcriptional repressor BlaI [Mycobacterium canettii CIPT 1400700MAKLTRLGDLERAVMDHLWSMTEPQTVRQVHEALSARRDLAYTTVMTVLQ
RLAKKNLVLQIRDDRAHRYAPVHGRDELVAGLMVDALAQAEDSGSRQAAL
VHFVERVGADEADALRRALAELEAGHRNRPPAGAATET
433634891YP_007268518.1 Putative 6-phosphogluconate dehydrogenase Gnd1 [Mycobacterium canetMSSSESPAGSAQIGVTGLAVMGSNIARNFARHGYTVAVHNRSVAKTDALL
KEHGSDGKFVRSETIPELLAALEKPRRVLIMVKAGEATDAVINELADAME
PGDIIIDGGNALYTDTMRREKAMRERGLHFVGAGISGGEEGALNGPSIMP
GGPAESYQSLGPLLEEISAHVDGVPCCTHIGPDGSGHFVKMVHNGIEYSD
MQLIGEAYQLLRDGLGLTAPAIADVFTEWNNGDLDSYLVEITAEVLRQTD
AKTGKPLVDVIADRAEQKGTGRWTVKSALDLGVPVTGIAEAVFARALSGS
VGQRSAASGLASGKLGEKPADPDTFTEDIRQALYASKIVAYAQGFNQIQA
GSAEFGWDITPGDLATIWRGGCIIRAKFLNRIKEAFDDNPSLASLIVAPY
FRSAIELAIDSWRRVVSTAAQLGIPTPGFSSALAYYDALRTVRLPAALIQ
AQRDFFGAHTYGRIDEPGKFHTLWSSDRAEVPA
433634889YP_007268516.1 Conserved membrane protein of unknown function [Mycobacterium canetMNLTDTVATILAILALTAGTGVFVAAEFSLTALDRSTVEANARGGTSRDR
FIQRAHHRLSFQLSGAQLGISITTLATGYLTEPLVAELPHPGLVAVGMPD
RVADGLITFFALVIVTSLSMVFGELVPKYLAVARPLRTARSVVVAQVLFS
LLLTPAIRLTNGAANWIVRRLGIEPAEELRSARTPQELVSLVRSSARSGA
LDDATAWLMRRSLQFGALTAEELMTPRSKIVALQTDDTIADLVAAAAASG
FSRFPVVEGDLDATVGIVHVKQVFEVPPGDRAHTLLTTVAEPVAVVPSTL
DGDAVMAQVRASALQTAMVVDEYGGTAGMVTLEDLIEEIVGDVRDEHDDA
TPDVVAAGNGWRVSGLLRIDEVASATGYRAPDGPYETIGGLVLRELGHIP
VAGETVELTALDQDGLPDDSMRWLATVIQMDGRRIDLLELIKMGGHAEPG
SGRGR
433634887YP_007268514.1 Conserved protein of unknown function- PE-PGRS family protein PE_PGMSFVVAVPEVVVAAASDLAGIGSAIGAANAAAAVPTMGVLAAGADEVSAA
VADLFGAHAQAYQALSAQAALFHEQFVHAMTAGAGAYAGAEAADAAALDV
LNGPFQALFGRPLIGDGANGAPGQPGGPGGLLYGNGGNGGNGGIGQPGGA
GGDAGLIGNGGNGGIGGPGATGLAGGAGGVGGLLFGDGGNGGAGGLGTGP
VGATGGIGGPGGAAVGLFGHGGAGGAGGLGKAGFAGGAGGTGGTGGLLYG
NGGNGGNVPSGAADGGAGGDARLIGNGGDGGSVGAAPTGIGNGGNGGNGG
WLYGDGGSGGSTLQGFSDGGTGGNAGMFGDGGNGGFSFFDGNGGDGGTGG
TLIGNGGDGGNSVQTDGFLRGHGGDGGNAVGLIGNGGAGGAGSAGTGVFA
PGGGSGGNGGNGALLVGNGGAGGSGGPTQIPSVAVPVTGAGGTGGNGGTA
GLIGNGGNGGAAGVSGDGTPGTGGNGGNAQLIGDGGDGGPGDSGGPGGSG
GTSGTLAGQNGSPGG
433634885YP_007268512.1 Conserved protein of unknown function with PIN domain- possible toxMILVDSNIPMYLVGASHPHKLDAQRLLESALSGGERLVTDAEVLQEICHR
YVAIKRREAIQPAFDAIIGVVDEVLPIERTDVEHARDALLRYQTLSARDA
LHIAVMAHHDITRLMSFNHGFDSYPGIKRLA
433634883YP_007268510.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MGRHSKPDPEDSADDLSDGHAAEQQHWEDTSGSYDYPGVDQPDDGPLSSE
GHYSAVGGYSASGSEDYPDIPPRPDWEPTGAEPIAAAPPPLFRFGHRGPG
DWQAGHRSADGRRGVSIGVIVALVAVVVMVAGVILWRFFGDALSNRSHTA
AARCVGGKDTVAVIADPSIADQVKESADSYNASAGPVGDRCVAVAVTSAG
SDAVINGFIGKWPTELGGQPGLWIPSSSISAVRLTGAAGSQAISDSRSLV
ISPVLLAVRPELQQALANQNWAALPGLQTNPNSLSGLDLPAWGSLRLAMP
ISGNGDATYLAGEAVAAASAPAGAPATAGIGAVRTLMGARPKLADDSLTA
AMDTLLKSGDVATAPVHAVVTTEQQLFQRGQSLSDAENTLGSWLPPGPAA
VADYPTVLLSGAWLSQEQTSAASAFARYMHKPEQLAKLAKAGFRVSDVKP
PSSPVTSFPALSSTLSVGDDSMRATLADTMVTASTGVAATIMLDQSMPND
EGGNSRLSNVVAALENRIKAMPPSSVVGLWTFDGREGRTEVPAGPLADPV
NGQPRPAALTAALGKQYSSGGGAVSFTTLRLIYQEMLANYRVGQANSVLV
ITTGPHTDQTLDGPGLQDFIRKSADPAKPIAVNIIDFGADPDRATWEAVA
QLSGGSYQNLETSASPDLATAVNIFLS
433634881YP_007268508.1 Putative hydrolase [Mycobacterium canettii CIPT 140070017]MTSPSVREWRDGGRWLPTAVGKVFVRSGPGDTPTMLLLHGYPSSSFDFRA
VIPYLTGQAWVTMDFLGFGLSDKPRPHRYSLLEQADLVETVVAHTVTGAV
VVLAHDMGTSVTTELLARDLDGRLPFDLRRAVLSNGSVILERASLRPIQK
VLRSPLGPVAARLVSRGGFTRGFGRIFSPAHPLSAQEAQAQWELLCYNEG
NRIPHLLISYLDERIRHAQRWHGAVRDWPKPLGFVWGLDDPVATTNVLNG
LRELRPSAAVVELPGLGHYPQVEAPKAYAEAVLSLLVD
433634879YP_007268506.1 Glycine decarboxylase- PLP-dependent- subunit (protein P) of glycinMSDHSTFADRHIGLDARAVETMLAVIGVNSLDDLAIKAVPAGILDTLTDT
GAAPGLDSLPPAASEAEALAELRALADANTVAVSMIGQGYYDTHTPPVLL
RNIIENPAWYTAYTPYQPEISQGRLEALLNFQTLVTDLTGLEIANASMLD
EGTAAAEAMTLMHRAARGPVKRVVVDADVFTQTAAVLATRAKQLGIEIVT
ADLRAGLPDGEFFGVIAQLPGASGRITDWSALVQQAHDRGALVAVGADLL
ALTLIAPPGEIGADVAFGTTQRFGVPMGFGGPHAGYLAVHAKHARQLPGR
LVGVSVDSDGTPAYRLALQTREQHIRRDKATSNICTAQVLLAVLAAMYAS
YHGAGGLTAIARRVHAHAEAIAGALGDALVHDKYFDTVLARVPGRADEVL
ARAKANGVNLWRVDADHVSVACDEATTDAHVAVVLDAFGVAAAAPAHADI
ATRTSEFLTHPAFTQYRTETSMMRYLRALADKDIALDRSMIPLGSCTMKL
NAAAEMESITWPEFGRQHPFAPASDTAGLRQLIADLQSWLVLITGYDAVS
LQPNAGSQGEYAGLLAIHEYHASRGEPHRDICLIPSSAHGTNAASAALAG
MRVVVVGCHDNGDVDLDDLRAKVGEHAERLSALMITYPSTHGVYEHDIAE
ICAAVHDAGGQVYVDGANLNALVGLARPGKFGGDVSHLNLHKTFCIPHGG
GGPGVGPVAVRAHLAPFLPGHPFAPELPKGYPVSSAPYGSASILPITWAY
IRMMGAEGLRAASLTAITSANYIARRLDEYYPVLYTGENGMVAHECILDL
RGITKLTGITVDDVAKRLADYGFHAPTMSFPVAGTLMVEPTESESLAEVD
AFCEAMIGIRAEIDKVGAGEWPVDDNPLRGAPHTAQCLLASDWDHPYTRE
QAAYPLGTAFRPKVWPAVRRIDGAYGDRNLVCSCPPVEAFA
433634877YP_007268504.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MGEVRVVGIRVEQPQNQPVLLLREANGDRYLPIWIGQSEAAAIALEQQGV
EPPRPLTHDLIRDLIAALGHSLKEVRIVDLQEGTFYADLIFDRNIKVSAR
PSDSVAIALRVGVPIYVEEAVLAQAGLLIPDESDEEATTAVREDEVEKFK
EFLDSVSPDDFKAT
433634875YP_007268502.1 Conserved protein of unknown function with Fha domain [MycobacteriuMTDMNPDIEKDQTSDEVTVETTSVFRADFLSELDAPAQAGTESAVSGVEG
LPPGSALLVVKRGPNAGSRFLLDQAITSAGRHPDSDIFLDDVTVSRRHAE
FRLENNEFNVVDVGSLNGTYVNREPVDSAVLANGDEVQIGKFRLVFLTGP
KQGEDDGSTGGP
433634873YP_007268500.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MSENRPEPVAAETSAATTPRHSQADAGAHEAVRRGRHELPADHPRPKVGP
LRRTRLTEILRGGRSRLVFGTLALLLCLVLGVAIVTQVRQTDSGDSLETA
RPADLLVLLDSLRQREATLNAEVIELQNTLNALQASGNTDQAALESAQAR
LATLSILVGAVGATGPGVMITIDDPGPGVAPEVMIDVINELRAAGAEAIQ
INDAHRSVRVGVDTWVVGVPGSLTVDTKVLSPPYSILAIGDPPTLAAAMN
IPGGAQDGVKRVGGRMVVQQADRVDVTALRQPKQHQYAQPVK
433634871YP_007268498.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MAESDRLLGGYDPNAGYSAHAGAQPQRIPVPSLLRALLSEHLDAGYAAVA
AERERAAAPRCWQARAVSWMWQALAATLVAAVFAAAVAQARSVAPGVRAA
QQLLVASVRSTQAAATTLAQRRSALSAKVDDVRRIVLADDAEGQRLLARL
DVLSLAAASTPVVGPGLTVTVTDPGASPNLSDVSKQRVSGSQQIILDRDL
QLVVNSLWESGAEAISIDGVRIGPNVTIRQAGGAILVDNNPTSSPYTILA
VGPPHAMQDVFDRSPGLYRLRLLETSYGVGVSVNVGDGLALPAGATRDVK
FAKQIGP
433634869YP_007268496.1 Putative preprotein translocase ATPase SecA2 [Mycobacterium canettiMNVHGCTRIAACRCTDTHPRGRPAFAYRWFVPKTTRAQPGRLSSRFWRLL
GASTEKNRSRSLADVTASAEYDKEAADLSDEKLRKAAGLLNLDDLAESAD
IPQFLAIAREAAERRTGLRPFDVQLLGALRMLAGDVIEMATGEGKTLAGA
IAAAGYALAGRHVHVVTINDYLARRDAEWMGPLLDAMGLTVGWITAESTS
ADRRAAYGCDVTYASVNEIGFDVLRDQLVTDVNDLVSPNPDVALIDEADS
VLVDEALVPLVLAGTTHRETPRLEIIRLVAELVGDKDADEYFATDSDNRN
VHLTEHGARRVEKALGGIDLYSEEHVGTTLTEVNVALHAHVLLQRDVHYI
VRDDAVHLINASRGRIAQLQRWPDGLQAAVEAKEGIETTETGEVLDTITV
QALINRYATVCGMTGTALAAGEQLRQFYQLGVSPIPPNKPNIREDEADRV
YITAAAKNDAIVEHITEVHQTGQPVLVGTRDVAESEELHERLVRRGVPAV
VLNAKNDAEEARVIAEAGKYGAVTVSTQMAGRGTDIRLGGSDEADHNRVA
ELGGLHVVGTGRHHTERLDNQLRGRAGRQGDPGSSVFFSSWEDDVVAANL
DHNKLPMATDENGRIVSPRTGGLLDHAQRVAEGRLLDVHANTWRYNQLIA
QQRAIIVERRNTLLRTATAREELAELAPKRYEELSDKVSEERLETICRQI
MLYHLDRGWADHLAYLADIRESIHLRALGRQNPLDEFHRMAVDAFASLAA
DAIEAAQQTFETANVLDHEPGLDLSKLARPTSTWTYMVNDNPLSDDTLSA
LSLPGVFR
433634867YP_007268494.1 Putative drugs-transport transmembrane ATP-binding protein ABC tranMGPKLFKPSIDWSRAFPDSVYWVGKAWTISAICVLAILVLLRYLTPWGRQ
FWRITRAYFVGPNSVRVWLMLGVLLLSVVLAVRLNVLFSYQGNDMYTALQ
KAFEGIASGDGTVKRSGVRGFWMSIGVFSVMAVLHVARVMADIYLTQRFI
IAWRVWLTHHLTQDWLDGRAYYRDLFIDETIDNPDQRIQQDVDIFTAGAG
GTPNAPSNGTASTLLFGAVQSIISVISFTAILWNLSGTLNIFGVSIPRAM
FWTVLVYVFVATVISFIIGRPLIWLSFRNEKLNAAFRYALVRLRDAAEAV
GFYRGERVEGTQLRRRFTPVIDNYRRYVRRSIAFNGWNLSVSQTIVPLPW
VIQAPRLFAGQIDFGDVGQTATSFGNIHDSLSFFRNNYDAFASFRAAIIR
LHGLVDANEKGRALPAVLTRPSDDESVELNDIEVRTPAGDRLIDPLDVRL
DRGGSLVITGRSGAGKTTLLRSLAELWPYASGTLRRPGGENETMFLSQLP
YVPLGTLRDVVCYPNSAAAIPDATLRDTLTKVALAPLCDRLDEERDWAKV
LSPGEQQRVAFARILLTKPKAVFLDESTSALDTGLEFALYQLLRSELPDC
IVVSVSHRPALERLHENQLELLGGGQWRLAPVENEPVRV
433634865YP_007268492.1 Putative transcriptional regulatory protein [Mycobacterium canettiiMCQTCRVGKRRDAREQIEAKIVELGRRQLLDHGAAGLSLRAIARDLGMVS
SAVYRYVSSRDELLTLLLVDAYSDLADTVDRARDDTVADSWSDDVIAIAR
AVRGWAVTNPARWALLYGSPVPGYHAPPDRTAGVATRVVGAFFDAIAAGI
ATGDIRLTDDVAPQPMSSDFEKIRQEFGFPGDDRVVTKCFLLWAGVVGAI
SLEVFGQYGADMLTDPGVVFDAQTRLLVAVLAEH
433634863YP_007268490.1 C-5 sterol desaturase [Mycobacterium canettii CIPT 140070017]MRDPVLFAIPFFLLLLILEWTAARKLESIETAATGQPRPASGAYLTRDSV
ASISMGLVSIATTASWKSLALLGYAAIYAYLAPWQLSAHWWYTWVIAIVG
VDLLYYSYHRIAHRVRLIWATHQAHHSSEYFNFATALRQKWNNSGEILMW
VPLPLMGLPPWMVFCSWSLNLIYQFWVHTERIDRLPRWFEFVFNTPSHHR
VHHGMDPVYLDKNYGGILIIWDRLFGSFQPELFRPHYGLTKRVDTFNIWK
LQTREYVAIARDWRSATRLRDRLGYVFGPPGWEPRTIDKSNAAASLVTSR
433634861YP_007268488.1 Conserved membrane protein of unknown function [Mycobacterium canetMQTLTVADFALRLAVGVGCGAIVGLERQWRARLAGLRTNALVATGATLFV
LYAAATEDSSPTRMASYVVSGIGFLGGGVILREGFNVRGLNTAATLWCSA
AVGVLAASGHLVFTVIGTGTVVAIHLLGRPLGRLIDRDNAAEEDEGLQPY
QVRVICRPKSEKYVRAHIVQHTSSNDITLRGIRTGPAGDDNITLTAHLLM
AGHAPAKLERLVAELSLQPGVYAVHWYAGEHAQAE
433634859YP_007268486.1 Conserved protein of unknown function- PPE family protein PPE33 [MyMDFGLQPPEITSGEMYLGPGAGPMLAAAVAWDGLAAELQSMAASYASIVE
GMASESWLGPSSAAMAAAAAPYVAWMSGTSAQAKAAADQARAAVVAYETA
FAAVVPPPQIAANRSQLMSLVATNIFGQNTAAIAATEAEYGEMWAQDAIA
MFGYASSSATASRLTPFTAPPQTTNPSGLAGQAAAMGQATALASGTNAVT
TALSSAAAQFPFDIIPTLLQGLANLSTQYTQLMGQLINAIFGPTGATTYQ
NLVVTAANVTKFSTWANDAMSAPNLGMTEFKVFWQPPPAPEIPKSSLGAG
LGLRSGLSAGLAHAASAGLGQANLVGDLSVPPSWASATPAVRLVANTLPA
TSLAAAPATQIPANLLGQMALGSMTGGALGAAAPAIYTGSGARARANGGT
PSAEPVKLEAVIAQLQKQPDAVRHWNVDKADLDGLLDRLSKQPGIHAVHV
SNGDKPKVALPDTQLGSHST
433634857YP_007268484.1 Conserved protein of unknown function- PPE family protein PPE22 [MyMTAALDFATLPPEINSARMYSGAGSAPMLAAASAWHGLSAELRASALSYS
SVLSTLTGEEWHGPASASMTAAAAPYVAWMSVTAVRAEQAGAQAEAAAAA
YEAAFAATVPPPAIEANRAQLMALIATNVLGQNAPAIAATEAQYAEMWSQ
DAMAMYGYAGASAAATQLTPFTEPVQTTNASGLAAQSAAIAQATGASAGA
QQTTLSQLIAAIPSVLQGLSSSTTATSTSGPSGLLGILGSGSSWLDKLWA
LLDPNSNFWNTIASSGLFLPSNTIAPFLGLLGGVAAADAAGDVLGEATSG
GLGGALAAPLGSAGGLGGTVAAGLGNAATVGTLSVPPSWTAAAPLASPLG
SPSAGTPMVAPPPAVAAGMPGMPFGTMGGQGFGRAVPQYGFRPNFVARPP
AAG
433634855YP_007268482.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MRKRRRGRIGTKRSSISDTDYRRDSFRSHLLTARAHGDADTQHKGMTAQQ
STELGTPLVRALAPHGVSGRSSRKPLGLNP
433634853YP_007268480.1 Conserved protein of unknown function- PE-PGRS family [MycobacteriuMWTSQMIVAPAFVDAAAKDLATIGSAISRANAEALVPITALLPAGADDVS
AAIAALFATHGRAYQELSAHAVAFHEQFVQLMSAGAAQYASAEAANSSPL
QIVGQTALDAINSPVQTLTGRPLIGNGANGLAGTGQNGGDGGWLYGNGGN
GGSGGTGQNGGNGGSAGLWGSGGNGGQGGAGANGAAGQPGNAGGSGGNGG
AGGWIYGHGGHGGVGGNGGNATAPGGASAGFDGGAGGNGGSGGRGGLLFG
NGGNGSVGGMGGQGTNDTAGDSAGSGGLGGNGGNGAQGGWLIGNGGQGGD
SGAGGGTDSTQTGVMNGASGGSAGIAGNGGDAGLVGNGGAGGNGGNGAAG
SALGTTVFGGSGGVGGVGGEGGNGGWLFGSGASGGNGGQGGDAGTNGFAG
FGGIGGDGGWVGALNVGPISVQGFGLFGHGGDGGNAGDVGAGSLSIQFGA
SGGDGGQGGVLYGNGGNGGNAGNGGSTDFEGMAGQGGAAVLIGNGGAGGN
GATGGTGVGNFAQEAGGDGSDGGAGGSGGLLFGSGGAGGNGGAGGVGGSG
NDGGNGGDGGQGGPSGLGIGNGGAGGNGGSGGAGGTGGSAGTGGAGGDGG
SAALLIGTGGDGGAGVPPAPGGQGGRGGLIGSPGQNGQP
433634851YP_007268478.1 Conserved protein of unknown function- PPE family [Mycobacterium caMDFGLLPPEINSGRMYTGPGPGPMLAAATAWDGLAVELHATAAGYASELS
ALTGAWSGPSSTSMASAAAPYVAWMSATAVHAELAAAQARLAVAAYEAAF
AATVPPPVIAANRAQLMVLIATNIFGQNTPAIMMTEAQYMEMWAQDAAAM
YGYAGSSATASRMTAFTEPPQTTNHGQLGAQSSAVAQTVATAAGGNLQSA
FPQLLSAVPCALQGLALPTASQSASATPQWVTDLGNLSTFLGGAVTGPYT
FPGVLPPSGVPYLLGIQSVLVTQNGQGVSALLGKIGGKPITGALAPLAEF
ALHTPILGSEGLGGGSVSAGIGRAGLVGKLSVPQGWTVAAPEIPSPAAAL
QATRLAAAPMAATDGAGALLGGMALSGLAGRAAAGSTGHPIGSAAAPAVG
AAAAAVEDLATEANIFVIPAMDD
433634849YP_007268476.1 Conserved lipoprotein of unknown function- LppT [Mycobacterium caneMSVKSKNGRLAARVLVALAALFAMIALTGSACLAEGPPLGRNPQGAPAPV
GGTVIVAPMHSGV
433634847YP_007268474.1 ESX conserved component EccE5 [Mycobacterium canettii CIPT 14007001MKAQRSLGLALSWPRVTAVFLVDVLILVVASHCPDSWQADHHVAWWVGVG
VAAVVTLLSVVSYHGITVISGLATWVRDWSADPGTTLGAGCTPAIDHQRR
FGRDTVGVREYNGRLVSVIEVTCGESGPSGRHWHRKSPVPMLPVVAVADG
LRQFDIHLDGIDIVSVLVRGGVDAAKASASLQEWEPQGWKSEERAGDRTV
ADRRRTWLVLRMNPQRNVAAVVCRDSLASTLVAATERLVQDLDGQSCAAR
PVTADELAEVDSAVLADLEPTWSRPGWRHLKHFNGYATSFWVTPSDITSE
TLDELCLPDSPEVGTTVVTVRVTTRVGSPALSAWVRYHSDTRLPKEVAAG
LNRLTGRQLAAVRASLPAPTHRPLLVIPSRNLRDHDELVLPVGQELEHAT
SSFVGQ
433634845YP_007268472.1 ESX conserved component EccD5 [Mycobacterium canettii CIPT 14007001MTAVADAPQADIEGVASPQAVVVGVMAGEGVQIGVLLDANAPVSVMTDPL
LKVVNSRLRELGEAPLEATGRGRWALCLVDGAPLRATQSLTEQDVYDGDR
LWIRFIADTERRSQVIEHISTAVASDLSKRFARIDPIVAVQVGASMVATG
VVLATGVLGWWRWHHNTWLTTIYTAVIGVLVLAVAMLLLMRAKTDADRRV
ADIMLMSAIMPVTVAAAAAPPGPVGSPQAVLGFGVLTVAAALALRFTGRR
LGIYTTIVIIGALTMLAALARMVAATSAVTLLSSLLLICVVAYHAAPALS
RRLAGIRLPVFPSATSRWVFEARPDLPTTVVVSGGSAPVLEGPSSVRDVL
LQAERARSFLSGLLTGLGVMVVVCMTSLCDPHTGQRWLPLILAGFTSGFL
LLRGRSYVDRWQSITLAGTAVIIAAAVCVRYALELSSPLAVSIVAAVLVL
LPAAGMAAAAHVPHTIYSPLFRKFVEWIEYLCLMPIFPLALWLMNVYAAI
RYR
433634843YP_007268470.1 Esat-6 like protein EsxN [Mycobacterium canettii CIPT 140070017]MTINYQFGDVDAHGATIRAQAASLEAEHQAIVRDVLAAGDFWGGAGSVAC
QEFITQLGRNFQVIYEQANAHGQKVQAAGNNMAQTDSAVGSSWA
433634841YP_007268468.1 Conserved exported protein of unknown function- PE family- PE19 [MyMSFVTTQPEALAAAAANLQGIGTTMNAQNAAAAAPTTGVVPAAADEVSAL
TAAQFAAHAQMYQTVSAQAAAIHEMFVNTLVASSGSYAATEAANAAAAG
433634839YP_007268466.1 Putative ferredoxin [Mycobacterium canettii CIPT 140070017]MKVRLDPSRCVGHAQCYAVDPDLFPIDDSGNSILAEHEVRPEDMQLTRDG
VAACPEMALILEEDDAD
433634837YP_007268464.1 ESX conserved component EccC5 (corresponds to EccCa and EccCb de M.MKRGFARPTPEKPPVIKPENIVLPTPLSIPPPEGKPWWLIVVGVVVVGLL
GGMVAMVFASGSHVFGGIGSIFPLFMMVGIMMMMFRGMGGGQQQMSRPKL
DAMRAQFMLMLDMLRETAQESADSMDANYRWFHPAPNTLAAAVGSPRMWE
RKPDGKDLNFGVVRVGVGMTRPEVTWGEPQNMPTDIELEPVTGKALQEFG
RYQSVVYNLPKMVSLLVEPWYALVGEREQVLGLMRAIICQLAFSHGPDHV
QMIVVSSDLDQWDWVKWLPHFGDSRRHDAAGNARMVYTSVREFAAEQAEL
FAGRGSFTPRHASSSAQTPTPHTVIIADVDDPQWEYVISAEGVDGVTFFD
LTGSSMWTDIPERKLQFDKTGVIEALPRDRDTWMVIDDKAWFFALTDQVS
IAEAEEFAQKLAQWRLAEAYEEIGQRVAHIGARDILSYYGIDDPGNIDFD
SLWASRTDTMGRSRLRAPFGNRSDNGELLFLDMKSLDEGGDGPHGVMSGT
TGSGKSTLVRTVIESLMLSHPPEELQFVLADLKGGSAVKPFAGVPHVSRI
ITDLEEDQALMERFLDALWGEIARRKAICDSAGVDDAKEYNSVRARMRAR
GQDMAPLPMLVVVIDEFYEWFRIMPTAVDVLDSIGRQGRAYWIHLMMASQ
TIESRAEKLMENMGYRLVLKARTAGAAQAAGVPNAVNLPAQAGLGYFRKS
LEDIIRFQAEFLWRDYFQPGVSIDGEEAPALVHSIDYIRPQLFTNSFTPL
EVSVGGPDIEPVVAQPNGEVLDSDDIEGGEDEDEEGVRTPKVGTVIIDQL
RKIKFEPYRLWQPPLTQPVAIDDLVNRFLGRPWHKEYGSACNLVFPIGII
DRPYKHDQPPWTVDTSGPGANVLILGAGGSGKTTALQTLICSAALTHTPQ
QVQFYCLAYSSTALTTVSRIPHVGEVAGPTDPYGVRRTVAELLALVRERK
RSFLECGIASMEMFRRRKFGGESGPVPGDGFGDVYLVIDNYRALAEENEV
LIEQVNMIINQGPSFGVHVVVTADRESELRPPVRSGFGSRIELRLAAVED
AKLVRSRFAKDVPVKPGRGMVAVNYVRLDSDPQAGLHTLVARPALGSTPD
NVFECDSVVAAVSRLTSAQAPPVRRLPARFGVEQVRELAARDTRQGVGAG
GIAWAISELDLAPVYLNFAENSHLMVTGRRECGRTTTLATIMSEIGRLYA
PGASSAPPPAPGRPSAQVWLVDPRRQLLTTLGSDYVERFAYNLDGVVAMM
GELAAALAGREPPPGLSAEELLSRSWWSGPEIFLIVDDIQQLPPGFDSPL
HKAVPFVNRAADVGLHVIVTRTFGGWSSAGSDPMLRALHQANAPLLVMDA
DPDEGFIRGKMKGGPLPRGRGLLMAEDTGVFVQVAATEVRR
433634835YP_007268462.1 Putative 4-alpha-glucanotransferase MalQ (Amylomaltase) (DisproportMTELAPSLVELARRFGIATEYTDWTGRQVLVSEATLVAALAALGVPAQTE
QQRNDALAAQLRSYWARPLPATIVMRAGEQTQFRVHVTDGAPADVWLQLE
DGTTRAEVVQVDNFTPPFDLDGRRIGEASFVLPADLPLGYHRVNLRSGDS
QASAAVVVTPDWLGLPDKLGARRVWGLAVQLYSVRSRQSWGVGDLTDLAD
LALWSASAHGAGYVLVNPLHAATLPGPAGRSKPIEPSPYLPTSRRFVNPL
YLRVEAIAELVDLPKRGRVQRLRTNVQQHADQLDTIDRDSAWAAKRAALK
LVHQVPRSAGRELAYAAFRTREGRALDDFATWCALAEKYGEDWHRWPKSL
RHPDASGVADFVGKHADAVDFHRWLQWQLDEQLATAQSQALRAGMSLGIM
ADLAVGVHPNGADAWALQDVLAQGVTAGAPPDEFNQLGQNWSQPPWRPDR
LAEQEYRPFRALIQAALRHAGAVRIDHIIGLFRLWWIPDGAPPTQGTYVR
YNHDAMIGIVALEAHRAGAVVVGEDLGTVEPWVRDYLLLRGLLGTSILWF
EQDRDGGPAGTPLPAERWREYCLSSVTTHDLPPTAGYLAGDQVRLRESLG
LLTNPVEAELESARADRAAWMAELRRVGLLADGAEPDSEEAVLALYRYLG
RTPSRLLAVALTDAVGDRRTQNQPGTTDEYPNWRVPLTGPDGQPMLLEDI
FTDRRAATLAEAVRAATISPMSCW
433634833YP_007268460.1 Conserved membrane integral protein of unknown function [MycobacterMCAHEYAEQRSAVSGIEGLLTWLGGGHWRELGERHERSTHAVAGVIVVVG
AALAGLLASLAVSEAAQGPISSPIGAASLALVLGLLVGAVTRGTASGPAR
GRAGVTGRSAVAVAVGFVVGELAALVMFSGAIDRRLDEQAMHSADAAPAA
VQASASLQQARNARTALDSAVEQARGRLDDALVVARCEYNPTPACPQTRI
TGVPGRGPETRTANQLLADAQRELDNALVARDRQAPALDAKMAHDEQALA
EVRQAVVADAGRGLGSRWVAMNDLTLASAGALTARMLAIAFFALLYLLPL
ILRLWRGDTTHDRHAAARAERERAELEADTAIAIKRAEVRRAAEIMWAEH
QLTQTRLAIEAQAEIDREQQRRRVVEALEGPVRASSERTLQPVEDEVYLP
IAAEAETASRTVAQLPAGAAHHRPDIAKNLPAQVQPEGAVEPREKRATPV
IPSIPDATKAAARWIRPLVPPFVARMLDNTTAPLRTARQVFEEVEEIAFS
FKRTHKVTVDAESSGTGGQPPLESPSPAAPAESNPIASSDSARCSRLATN
DDHPPLAQVPPRDLASLSVGSTGELTQREGRHELRSPDGPRQLPPPK
433634831YP_007268458.1 Putative cytochrome P450 144 cyp144 [Mycobacterium canettii CIPT 14MRRAPKGFPGAVLNLQRRVDLAISADHAELMTIAKDASTFFGAESVQDPY
PLYERMRAAGPVHRIANSDFYAVCGWDAVNEAIGRPEDFSSNLTATMTCT
AEGTVKPFEMDPLGGPTHVLATADDPAHAVHRKLVLRHLAAKRIRVMEQF
TVQAADRLWVDGWQDGCIEWMGAMANRLPMMVVAELIGLPDPDIAQLVKW
GYAATQLLEGLVENDQLVAAGVALMELSGYIFEQFDRAAADPRDNLLGEL
ATACASGELDTLTAQVMMVTLFAAGGESTAALLGSAVWILATRPDIQQQV
RANPELLGAFIEETLRYEPPFRGHYRHVRNATTLDGTELPADSHLLLLWG
AANRDPAQFEAPGDFRLDRAGGKGHISFGKGAHFCVGAALARLEARIVLR
LLLDRTSVIEAADIGGWLPSILVRRIERLELAVQ
433634829YP_007268456.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MASDLYLGYRNDDANTPFGTFFKPEMAPLPQHVVVALQHGPQAGPTLLAF
DEAASIADQGYQQTENGYGILDDGSMQVSVRTDMPGVTPAMWAWWFGWHG
SDTRRYKLWHPRAHLSARWKDGDQDSGAGLRGAQRYVGRWSMISEYIGST
KLGAAIQFVEPAAMGLPDDSDEAVSICARLGSADAPVDAGWFVHQVRSTP
GGSEMRSRFWMGGGHIAVRKAPDVASKAVRPIASKLIGVSESTARNLLVH
CAQEMNHLAGFLPQLWESFRDE
433634827YP_007268454.1 Putative transcriptional regulatory protein [Mycobacterium canettiiMPPTEGKSTTNRDEGIQVLRRAVAALDEIAAEPGHLRLVDLCERLGLAKS
TTRRLLVGLVEVGLVSVDSHGRFALGERLLGFGSVTGAHIAAAFRPTVER
VARATDGETVDLSVLRGQRMWFVDQIESSHRLRAVSAVGVRFPLNGTANG
KAALAALDDADAEAALCHLDLMVAEGLRREIAEIRRTGIAFDRNEHTPGI
SAAAIARRALGDNVIAISVPAPTERFLEKEQRIIAALRAAADSPDWTR
433634825YP_007268452.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MDEAHLAHPADAGRPGGPIQGARRGAAMTPITALPTELAAMREVVETLAP
IERAAGEPGEHKAAEWIVERLRTAGAQDARIEEEQYLDGYPRLHLKLSVI
GVAAGVAGLLSRRLRIPAALAGVGAGLAIADDCANGPRIVRKRTETPRTT
WNAVAEAGDPAGQLTVVVCAHHDAAHSGKFFEAHIEEVMVELFPGIVERI
DTQLPNWWGPILAPALAGVGALRGSRPMMIAGTVGSALAAALFADIARSP
VVPGANDNLSAVALLVALAERLRERPVKGVRVLLVSLGAEETLQGGIYGF
LARHKPELDRDRTYFLNFDTIGSPELIMLEGEGPTVMEDYFYRPFRDLVI
RAAERADAPLRRGIRSRNSTDAVLMSRAGYPTACFVSINRHKSVANYHLM
SDTPENLCYETVSHAVTVAESVIRELAR
433634823YP_007268450.1 Conserved protein of unknown function- PE-PGRS family- PE_PGRS24 [MMSYLVVVPELVAAAATDLANIASSISAANAAAAAPTTALVAAGGDEVSAA
IAALFGAHARAYQTLSAQAAMFHEQFVRALAAGGNSYAVAEAATAQSVQQ
DLLNLINAPTQALLGRPLIGNGANGLPGTGQNGGDGGILYGNGGNGGSGG
VNQAGGNGGNAGLWGNGGSGGAGGNATTAGRNGFNGGAGGSGGLLWGNGG
AGGAGGNGGPAPLVGGVGTTGGAGGNGGGAGLFYGFGGAGGNGGMGGVAP
STGPSMGILPAGGVGGPGGSGGASALAFGSGGVGGAGGLGGPTDGTVQGV
GGFGGQGGNGGQSGLLFGNAGAGGAGAAGGAGTGDTESFGGHGGAGGDGG
AVGLIGNGGGGGNGGAGGTGSPGAVVGGNGGVGGLGGAGSPGGLLYGTGG
AGGNGGPGGDGGTGATVGFAGSGGFGGAGGIAQLFGTGGMGGSGGGIGAG
TTTVVPPDVAPVGGTGGNGGRAGLLLGVGGMGGNGGATSVGGTLYAAGGN
GGDGGLVWGNGGTGGSGGAGGAGSVGNGGAGGNAALLFGNGGAGGAGGAG
GIGAGGAGGFGAVLFGNGGAGGSGAPGGIGAGGNGGNALLVGNGGNGGAG
TGGAAGGAGGSGGLLFGQNGMPGP
433634821YP_007268448.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MIGDQDSIAAVLNRLRRAQGQLAGVISMIEQGRDCRDVVTQLAAVSRALD
RAGFKIVAAGLKECVSGATASGAAPLSAAELEKLFLALA
433634819YP_007268446.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MSSTATSGAAVVSPAERVEVLFEELAELAGQRNAIDGRIVEIVSELDRDG
LWGGTGARSVPALVAWKTGCSPANAHTIATVARRLPEFPRCAQGMREGRL
SLDQVGVIAARAGEGSDAHYAQLAGVATVNQLRTALKLEPRPEPEPDFRP
DPRPSISKSSDEQFSCWRIKLPHVEAAKFDAALQSHLDALIAEYKRDHDN
TDGVSDQRPPLPTTAEAFMRLVEAGWDAEVTRRPHGQHTTVVMHLDVQGR
AAALHLGPLLSESERRYLLCDATYEAWFERDGQVIGCGRATRQINRRLRR
ALEHRDRTCAVPGCGATRGLHAHHIRHWEDGGATELANLVLVCPYHHRAH
HRGLITITGPADDLTVADSAGRPLSAGSLARASTKPPPAVAPCPGPTGER
ADWWWYEPFQPQPPPTNN
433634817YP_007268444.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MQSSSLDPVASERLSHAEKSFTSDLSINEFALLHGAGFEPIELVMGVSVY
HVGFQFSGMRQQQELGVLTEATYRARWNAMARMQAEADALKADGIVGVRL
NWRHHGEGGEHLEFMAVGTAVRYTAKPGAFRRPNGQAFSSHLSGQDMVTL
LRSGFAPVAFVMGNCVFHIAVQGFMQTLRQIGRNMEMPQWTQGNYQAREL
AMSRMQSEAERDGATGVVGVHFAISNYAWGVHTVEFYTAGTAVRRTGSGE
TITPSFVLPMDS
433634815YP_007268442.1 Conserved protein of unknown function- possible triacylglycerol synMPRGCAGARFACNACLNFLAGLGISEPISPGWAAMERLSGLDAFFLYMET
PSQPLNVCCVLELDTSTMPGGYTYGRFHAALEKYVKAAPEFRMKLADTQL
NLDHPVWVDDDNFQIRHHLRRVAMPAPGGRRELAEICGYIAGLPLDRDRP
LWEMWVIEGGARSDTLAVMLKVHHAVVDGVAGANLLAHLCSLQPDAPAPQ
PVRGTGGGNVLQIAASGLVGFASRPLRLATVVPATVLTLVRTLLRAREGR
TMAAPFSAPPTPFNGPLGRLRNIAYTQLDMRDVKRVKDRFGVTINDVVVA
LCAGALRRFLLEHGVLPEAPLVATVPVSVHDKSDRPGRNQATWMFCRVPS
QISDPAQRIRTIAAGNTVAKDHAAAIGPTLLHDWIQFGGSTMFGAAMRIL
PHISITHSPAYNLILSNVPGPQAQLYFLGCRMDSMFPLGPLLGNAGLNIT
VMSLNGELGVGIVSCPDLLPDLWGVADGFPEALKELLECSDDQPEGSNQQ
DS
433634813YP_007268440.1 Putative cutinase Cut1 [Mycobacterium canettii CIPT 140070017]MSAFNICRFVGAPMVTTWALLFAPVPAASADPPGPTVSDGACPDVEVVFA
RGTGEPPGVGGIGEDFVDALRSKIGEKSMGVYGVDYPATTDFPTAMAGIY
DAGTHVEQTAANCPESKLVLGGFSQGAAVMGFVTAAAIPDGAPLDAPKPM
PPEVADHVAAVTLFGMPSVAFMHSIGAPPIVIGPLYAEKTIQLCAPGDPV
CSSGGNWAAHNGYADDGMVEQAAVFAAGRLG
433634811YP_007268438.1 Putative oxidoreductase [Mycobacterium canettii CIPT 140070017]MLETAGLWGKRADMIVRGCLPYNAEPPPAVLAGSDITPINAFYVRNHGPV
PDIAPQHWRLTVGGLVDNPLTVTYERLTTEFDQHCVVATLACAGNRRAEL
LRVRQIPGKEPWAHGAISTAQWCGVRLADILQAADVHIDEGLHVAFDAPD
VAEEARPIQPYGSSIPLSKALSPEVLLAWQMNSEPLPRAHGGPVRVVVPG
FIGARSVKWVTAITVQPGASQNYFQALDYRILPADADADIVGPGEGISLS
SLALNCDILDPTDGDDVPAGALTIRGYGMAGDGRSVERVDVSVDDGLTWQ
QADLHAAPGQWSWRPWSLTVDVEPGPLGITARAWDDTGALQPESAVSLWN
PRGYGNNAWARVALRVS
433634809YP_007268436.1 Phospholipase C 4 (MTP40 antigen) [Mycobacterium canettii CIPT 1400MRLEVRQENTAVSQSHIGGVSRREFLAKVAAGGAGALMSFAGPVIEKAYG
AGPCSGHLTDIEHFVFFMQENRSFDHYFGTLSGTDGFNTVSPLFQQKGWN
PMTQALDATGVTLPYRFDTTRGPFLDGACVNDPDHSWVAMHESWNGGVND
NWLPAQAKTRSAAHTPTVMGYYTRQDIPIHYLLADAFTVCDRYFCSVLGP
TLPNRLYWLSATIDPDGQNGGPELQSPTFQPVRRFGWRIMPQNLSDAGVS
WKVYRNKTLGPISSVLTYGSLVTSFKQSADPRSDLVRFGVAPSYPASFAA
DVLANRLPRVSWVIPNVLESEHPAVPAAAGAFAIVNILRILLANPAVWEK
TALIVSYDENGGFFDHVVPATAPAGTPGEYVTVPDIDQVPGSGGIRGPIG
LGFRVPCFVISPYSRGPQMVHDTFDHTSQLRLLETRFGVPVPNLTAWRRS
VTGDMTSTFNFAVPPNSSWPNLDYPGLHALSTVPQCVPNAALGTINRGIP
YRVPDPQIMPTQETTPTRGIPSGPC
433634807YP_007268434.1 Conserved protein of unknown function- probable ancestor of PPE famMNFSVLPPEINSALIFVGAGPEPMAAAAAAWDGLAMELASAAASFGSVTS
GLVGGVWQGASSSAMAAAAAPYAAWLAAAAVQAEQTAAQAAAMMAEFEAV
KTAVVQPMLVAANRADLVSLVMSNLFGQNAPAIAAVEATYEQMWAADVSA
MSAYHAGASAIASALSPFSKPLQNLAGLPAWLASGAPAAAMTAAAGIPAL
AGGPTAINLGIANVGGGNVGNANNGVANIGNANLGNYNFGSGNFGNSNIG
SASLGNNNIGFGNLGSNNVGAGNLGNLNTGFANTGLGNFGFGNTGNNNIG
IGLTGNNQIGIGGLNSGTGNFGLFNSGSGNVGFFNSGNGNFGIGNAGNFN
TGGWNSGHGNTGFFNAGSFNTGMLDVGNANTGSLNTGSYNMGDFNPGSSN
TGAFNTGSVNTGFLNAGNINTGVFNIGHMNNGLFNTGDMNNGVFYRGVGQ
GSLQFSITTPDLTLPPLQIPGISVPAFSLPAITLPSLSIPAATTPANITV
GAFSLPGLTLPPLTIPAATTPANITVGAFSLPGLTLPPLTIPAATTPANI
TVGAFSLPGLTLPSLTIPAATTPANITVGAFSLPGLTLPSLTIPAATTPA
NITVGAFSLPGLTLPSLTIPAATTPANITVGAFSLPGLTLPSLTIPAATT
PANITVGAFSLPGLTLPSLTIPAATTPANITVGAFSLPGLTLPSLTIPAA
TTPANITVGAFSLPGLTLPSLTIPAATTPANISSGAFSLPGINLPSLTIP
AAITFFL
433634805YP_007268432.1 Putative oxidoreductase [Mycobacterium canettii CIPT 140070017]MGETTTCAIIGGGPAGMVLGLLLARAGVQVTLLEKHGDFLRDFRGDTVHP
TTMRLLDELGLWERFAALPYSEVRTATLHSNGRAVTYIDFERLHQPYPYV
AMVPQWDLLNLLAEAAQAEPSFTLRMKTEVTGLLREGGKVTGVRYQGAEG
PGELRAELTVACDGRWSIARHEAGLKAREFPVNFDVWWFKLPREGDAEFS
FLPRFSPGKGLGVIPREGYFQIAYLGPKGTDAQLRERGIEEFRRDVSELL
PEATASVAALASMDEVKHLNVKVNRLRRWHIDGLLCIGDAAHAMSPVAGV
GINLAVQDAVAAATILAEPLREHRVSSRYLAAVRRRRAFPTAVTQAVQRV
LHRRLLGPLLQGRDPTPPAALLGLVERLPWLSAVPAYFVGVGVRPEHAPA
FARRGPGNRKGP
433634803YP_007268430.1 Conserved membrane protein of unknown function [Mycobacterium canetMLRAVNEIRQHDGTLKLGKGVGMFTIVGVIVALIGAFVQSRRHRHRPAAD
IHMLWWMVLIVGVVSIIGAGYHVFDGERTAELIGYTRGDGGFQWENAMGD
LAIGVVGLMAYRFRGHFWLATIVVLTIQYVGDAAGHIYYWVVENNTNPYN
IGVPLWTDILLPIVMWALYAWSWHSNGDAVPKGQP
433634801YP_007268428.1 Putative conserved transmembrane ATP-binding protein ABC transporteMPMSQPAAPPVLTVRYEGSERTFAAGHDVVVGRDLRADVRVAHPLISRAH
LLLRFDQGRWVAIDNGSLNGLYLNNRRVPVVDIYDAQRVHIGNPDGPALD
FEVGRHRGSAGRPPQTTSIRLPNLSAGAWPTDGPPQTGTLGSGQLQQLPP
ATTRIPAAPPSGPQPRYPTGEQQLRPPSGPQRAPQIYRPPTAAPPPAGAR
GGTEAGNLATSMMKILRPGRLTGELPPGAVRIGRANDNDIVIPEVLASRH
HATLVPTPGGTEIRDNRSINGTFVNGARVDAALLHDGDVVTIGNIDLVFA
DGTLARREENLLETRVGGLDVRGVTWTIDGDKTLLDGISLTARPGMLTAV
IGPSGAGKSTLARLVAGYTHPTDGTVTFEGHNVHAEYASLRSRIGMVPQD
DVVHGQLTVKHALMYAAELRLPPDTTKDDRTQVVARVLEELEMSKHIDTR
VDKLSGGQRKRASVALELLTGPSLLILDEPTSGLDPALDRQVMTMLRQLA
DAGRVVLVVTHSLTYLDVCDQVLLLAPGGKTAFCGPPTQIGPVMGTTNWA
DIFSTVADDPDAAKARYLARTGPTPPPPPVEQPAELGDPAHTSLFRQFST
IARRQLRLIVSDRGYFVFLALLPFIMGALSMSVPGDVGFGFPNPMGDAPN
EPGQILVLLNVGAVFMGTALTIRDLIGERAIFRREQAVGLSTTAYLIAKV
CVYTVLAVVQSAIVTVIVLVGKGGPTQGAVALSKPDLELFVDVAVTCVAS
AMLGLALSAIAKSNEQIMPLLVVAVMSQLVFSGGMIPVTGRVPLDQMSWV
TPARWGFAASAATVDLIKLVPGPLTPKDSHWHHTASAWWFDMAMLVALSI
FYVGFVRWKIRLKAY
433634799YP_007268426.1 Putative isopentenyl-diphosphate delta-isomerase Idi (IPP isomeraseMTRSCRPAPPIERVVLLNDRGDATGVADKATVHTGDTPLHLAFSSYVFDL
HDQLLITRRAATKRTWPAVWTNSCCGHPLPGESLPGAIRRRLAAELGLTP
DRVDLILPGFRYRAAMADGTVENEICPVYRVQVDQQPRPNSDEVDAIRWL
SWEQFVRDVTAGVIAPVSPWCRSQLGYLTKLGPCPAQWPVADDCRLPKAA
HGN
433634797YP_007268424.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MSALLDEVLDAHGGLQRWRAAETVHGRVRTGGLLLRTRVPGNRFADYRIT
VHVQQARTVLDPFPRDGHRGVFESGQVRIESHDGAVISSRTHPRAAFFGR
SGLRRNIRWDPLDSVYFAGYAMWNYLTTPYLLTREGVAVEEGAPWQQEGE
TWRRLIVSFPPDIDTHSPRQTFYVDASGLLRRHDYVPEVVGHWARAAHYC
ADPVDVDGFVFPTRRWVHPIGPGNRSLPFPTLVSILLTDMRVETG
433634795YP_007268422.1 Putative sulphate-transport transmembrane protein ABC transporter [MIPTMTSAGWAPGVVQFREYQRRWLRGDVLAGLTVAAYLIPQAMAYATVA
GLPPAAGLWASIAPLAIYALLGSSRQLSIGPESATALMTAAVLAPMAAGD
LRRYAVLAATLGLLVGLICLLAGTARLGFLASLLSRPVLVGYMAGIALVM
ISSQLGTITGTSVEGNEFFSEVHSFATSVTRVHWPTFVLAMSVLALLTML
TRWAPRAPGPIIAVLAATMLVAAMSLDDKGIAIVGRIPSGLPAPGVPPVS
VEDLRALIIPAAGIAIVTFTDGVLTARAFAARRGQEVNANAELRAVGACN
IAAGLTHGFPVSSSSSRTALADVVGGRTQLYSLIALGLVVIVMVFASGLL
AMFPIAALGALVVYAALRLIDLSEFRRLARFRRSELMLALATTAAVLGLG
VFYGVLAAVALSILELLRRVAHPHDSVLGFVPGIAGMHDIDDYPQAERVP
GLVVYRYDAPLCFANAEDFRRRALTVVDQDPGQVEWFVLNAESNVEVDLT
ALDALDQLRTELLRRGIVFAMARVKQDLRESLRAASLLDKIGEDHIFMTL
PTAVEAFRRR
433634793YP_007268420.1 Nitrate/nitrite transporter NarK2 [Mycobacterium canettii CIPT 1400MRGQAANLVLATWISVVNFWAWNLIGPLSTSYARDMSLSSAEASLLVATP
ILVGALGRIVTGPLTDRFGGRAMLIAVTLASILPVLAVGVAGTMGSYPLL
VFFGLFLGVAGTIFAVGIPFANNWYQPARRGFATGVFGMGMVGTALSAFF
TPRLVRWFGLFATHAIVAAALASTAVVAMAVLRDAPYFRPNADPVLPRLK
AAARLPVTWEMSFLYAIVFGGFVAFSNYLPTYITTIYGFSTVDAGARTAG
FALAAVLARPVGGWLSDRIAPRHVVLASLAGTALLAFAAALQPPPDVWSA
ATFITLAVCLGVGTGGVFAWVARRAPAASVGSVTGIVAAAGGLGGYFPPL
VMGATYDPVDNDYTVGLLLLVATALVACAYTALRLHAQEPARKEASR
433634791YP_007268418.1 Nitrate reductase beta chain [Mycobacterium canettii CIPT 140070017MKVMAQLAMVMNLDKCIGCHTCSVTCKQAWTNRAGTEYVWFNNVETRPGQ
GYPRTYEDQDRWRGGWLRDRRGRLRLRDGGRLAKLVRIFANPKLPSIADY
YEPWTYDYENLTAAPLGEHMPVAPPRSLISGQPMKVTWSANWDDDLGGSP
QIVPEDPVLKKVGTRVQLELEQAFMFYLPRICEHCLNPSCVASCPSGAMY
KRTEDGIVLVDQDRCRGWRMCVSGCPYKKVYFNHKTGKAEKCTLCYPRIE
VGLPTVCSETCVGRLRYLGLVLYDVDQVLQAASVESDTDLYEAQRRILLD
PHDPRVIAAARAEGISDEWIEAAQRSPVYALINTYRVALPLHPEYRTMPM
VWYIPPLSPVVDAVSHDGHDGEDLGNLFGAIEALRIPIAYLAGLFTAGDT
AVVDGVLRRLAAMRCYMRDITLGRETQPHIPHAVGMTEEQIYQMYRLLAL
AKYEERYVIPTTYPTEPRMIEEPGCALSFEGGPGMFESGPFGEASGGPVP
VAVETFHALHHRQTQEGMAANATRPSRVNLLNWDGRGAPAGIFPDRSAR
433634789YP_007268416.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MTNVGDQGVDAVFGVIYPPQVALVGFGKPAQ
433634787YP_007268414.1 Conserved exported protein of unknown function [Mycobacterium canetMAVESSMLALGTPAPSFTLPQPATGATVSLDELTGPALVVTFICNHCPYV
QHVAAGLATLGRDLVDQGVPMVGISSNDVVTYPQDGPDQMVAEARRHGWT
FPYLYDETQDVARAFSAACTPDTFVFDGQRRLVYRGQLDDSRPGNGRPVT
AADVRAAVDALLAGRPVNPDQRPSIGCGIKWR
433634785YP_007268412.1 Conserved protein of unknown function- possible penicillin-binding MCPLIISSSATPTGTRCGTRHGRAVVTEYVRALDRLPHEIATAVVKVNCA
DPGTAFDELDAKINAGMKAYAIPGVAVAVWAGGQEYVKGYGVTNVDHPMP
VDGDTVFRIGSTTKTFTGTVMMRLVERDKVDLDSPVRRYIPDFAVADESA
SATVTVRQLLNHTAGWDGRNGQDFGRGDDAVALYVKAMTRLPQLTPPGTA
FAYNNSGLVVAGRIIELVAGTTYESTVQRLLLDPLQLARTRYFSDQIIGL
NVAASHSVVDGKPIAVTDFWTFPRSCNPTGGLMSTARDQLRYAQFHLGDG
RAPNGEQILSRQSLKAMRSNPGAGGTLWVELTGMGVTWMLRPSAENVTIV
EHGGTWKGQRSGFVMVPDRNFAMTVLTNSDGGFHMINDLFASDWALQRFA
GLSNLPATPQRLGAVDLAPYEGRYIARQVAQNGDLETTVIDFRARDGQLA
GSMSTDDANPDGQNSAELGLAFYRPDYGLDLGPDNKPTGSRSNFVRGPDG
NIAWFCSQHGRLFRRQ
433634783YP_007268410.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MSVNGLPGAHNAGLQPSDSKGCHTRRTRHTKVLFVGKGVLANGRGRWLAI
AASLVVSAAILYAQGAEHPCCRETPAAIPTGPDSAPANAPRIASPTEADL
LAASAPVAAQQFQFALPAGVAPEEGLQVKTIWVARAVSVLFPQITNIFGY
RQDPLKWHPNGLAIDVMIPNHHSGEGIQLGNQVAGLALANAKRWGVLHVI
WRQGYYPGIGAPSWTADYGSETLNHYDHVHIATDGGGYPTGQETYYVGSM
SPTPPE
433634781YP_007268408.1 Putative oxidoreductase [Mycobacterium canettii CIPT 140070017]MTATLTETLGSLDDFKGTLCVPGDPDYPRVRAIWNGQVAREPALIATCHD
ACDVRTVLRRAVDAGMVTAVRGGGHNVAGTALCDGGVVIDLSAMRAVSLD
PATGRVRVQGGATLADLDHATVPFARVAPAGIVTTTGVGGLTLGGGVGWT
TRRFGLSCDNLVAVRLVTAAGDYLSVDDERDPELMWGLRGGGGNFGIVTE
FEFATHPFGPVAVAGFVVYRLDDGPAVLRGYRQFAAAAPEEVTTIVVLRH
APPAPWIPVEQRGKPVVMIGAVHTGSVQAGIEALRPVKSLARPVADTLWP
TPFLAHQAVLDASNPAGDRYYWKSDHLAELNDEAIDLLVEQAAGLSSPDS
LIGIFQLGGAAARGGERSCFPSRHARFMVNYATHWTEAGEDDLHRQWTRD
AIEALAPYGLGTAYVNFTADDAPMHVETLYGTTEFSRVVTLKNRLDPDNV
FRNNHNIRPSA
433634779YP_007268406.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MVGNEENELQDLRNLRRPCFSRAEAPIGVYNGEQAIIVYDLRPVPHWPKY
WIQALAKHFQRQLKPSPKIDISLLDDRIRFSVFVSTDVSAKDLCKLDDAV
YNAVRNAGRAIENEQAALDHKLAEVRKRRMDTWDESYFR
433634777YP_007268404.1 Putative carboxylase [Mycobacterium canettii CIPT 140070017]MIVPAREPEPQPRRVLNGLSDVRAFFHNNTVPLYFISPTPFNLLGIYRWI
RNFFYLTYYDSFEGEHSRVFVPRRRDRRDFDGMGDVCNHLLRDPETLEFI
KNRGPGGKACFVMLDEETQALARQAGLEVMHPPAELRHRLESKIVMTRLA
DEAGVPSVPHVIGRVSSYDELSALAHGAGLGDDLVVEAAYGNAGSATFFV
RGLRDWDQCAGGIVGQPEIKVMKRIRNVEVCIEATVTRHGTVIGPAMTSL
VGYPELTPYRGAWCGNDVWRGALPPAQTRAAREMVAKLGDVLSREGYRGY
FEVDLLHDLDADELYLGEVNPRLSGASPMTNLTTEAYADMPLFLFHLLEY
MDVDYELDIEAINSRWERGYGEDEVWGQLIMSETSPDLELFTATPRTGMW
RLNHDGRVSFARQGNDWATMLDESEAFYMRVAAPGDLRCEGAQLGVLVTR
GHLQTDDYQLTERGRRWIDGLKAQFASTPLTPAAPIVSRLVARA
433634775YP_007268402.1 Conserved protein of unknown function with PIN domain- possible toxMIVLDASAAVELMLATPAGAAVAQRLRGETVHAPAHFDVEVIGAIRRAVV
RQLISDHEGLVVVVDFLSLPVRRWPLKPFTQRAYQLRSTHTVADGVYVAL
AEGLGVPLITCDGRLALSHGHNAEIELVA
433634773YP_007268400.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MTSLDDLRRRRPGNRVRIDAIKDEMDREVAQYRLRELREDAGYTQTSLAA
AIGVGQNRVSQMEHGNLGTSRVDTLRKYVEATGGELEVAVKRPDGSRVLL
SL
433634771YP_007268398.1 Putative transcriptional regulatory protein [Mycobacterium canettiiMSVEEQDTRSGGIQVIARAAELLRVLQAHPGGLSQAEIGERVGMARSTVS
RILNALEDEGLVASRGARGPYRLGPEFARMAATVRLGVVTEMHPFLTELS
RELDETVDLSILDGDRADFVDQVVPPRRLRAVSAVGESFPLYCCANGKAL
LAALAPDQQARALPSRLAPLTANTITDRAALREELNCIRVDGVAYDREEQ
TEGICAVGAVLRGVSVELVAVSVPVPAQRFYGREAELAGALLAWVSKVEV
WFNSTEDRK
433634769YP_007268396.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MRLTRASQAPTYMAPAHHEVSTMRLQGHEAGRTERFWVGLSVYQPGGTAE
PAPTREETVYVVLDGELVVTVDGAETVLGWLDSVHLAKGELRSIHNRTDR
QALLLVTVAHPVAEVA
433634767YP_007268394.1 Putative 3-hydroxybutyryl-CoA dehydrogenase FadB3 (beta-hydroxybutyMLTSHGFSRAAVVGAGLMGRRIAGVLASAGLDVAITDTNAEILHAAAVEA
ARVAGAGRGSVAAAADLAAVIPDADLVIEAVVENLAVKQELFERLATLAP
DAVLATNTSVLPIGAVTERVEDGSRVIGTHFWNPPDLIPVVEVVPSARTA
PDTADRVVALLTQVGKLPVRVGRDVPGFIGNRLQHALWREAIALVAEGVC
DPKTVDLVVRNTIGLRLATLGPLENADYIGLDLTLAIHDAVIPSLNHDPH
PSPLLRELVAAGQLGARTGHGFLDWPAGAREATTARLAQHIAAQLQANEK
GRGT
433634765YP_007268392.1 Putative GTP-binding protein EngA [Mycobacterium canettii CIPT 1400MTQDGTWVDESDWQLDDSEIAESGAAPVVAVVGRPNVGKSTLVNRILGRR
EAVVQDIPGVTRDRVCYDALWTGRRFVVQDTGGWEPNAKGLQRLVAEQAS
VAMRTADAVILVVDAGVGATAADEAAARILLRSGKPVFLAANKVDSEKGE
SDAAALWSLGLGEPHAISAMHGRGVADLLDGVLAALPEVGESASASGGPR
RVALVGKPNVGKSSLLNKLAGDQRSVVHEAAGTTVDPVDSLIELGGDVWR
FVDTAGLRRKVGQASGHEFYASVRTHAAIDSAEVAIVLIDASQPLTEQDL
RVISMVIEAGRALVLAYNKWDLVDEDRRELLQREIDRELVQVRWAQRVNI
SAKTGRAVHKLVPAMEDALASWDTRIATGPLNTWLTEVTAATPPPVRGGK
QPRILFATQATARPPTFVLFTTGFLEAGYRRFLERRLRETFGFDGSPIRV
NVRVREKRAGKRR
433634763YP_007268390.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MMAEPEESREPRGIRLQKVLSQAGIASRRAAEKMIVNGRVEVDGHVVTEL
GTRVDPQVAVVRVDGARVVLDDSLVYLALNKPRGMHSTMSDDRGRPCIGD
LIERKVRGTKKLFHVGRLDADTEGLMLLTNDGELAHRLMHPSHEVPKTYL
ATVTGSVPRGLGRTLRAGIELDDGPAFVDDFAVVDAIPGKTLVRVTLHEG
RNRIVRRLLAAAGFPVEALVRTDIGAVSLGKQRPGSVRALRSNEIGQLYQ
AVGL
433634761YP_007268388.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MNGLQNSLANGGAAPENSYSAGFRVRLTNFEGPFDLLLQLIFAHQLDVTE
VALHQVTDDFIAYTKAIGARLELEETTAFLVIAATLLDLKAARLLPAGQV
DDEEDLALLEVRDLLFARLLQYRAFKHVAEMFAELEATALRSYPRAVSLE
DGFVGLLPEVMLGVDAHRFAEIAAIALTPRPAPTVATEHLHELMVSVPEQ
AEHLLAMLKARGSGQWASFSELVADCTAPIEIVGRFLALLELYRTRAVAF
EQSEPLGALQVSWTGDDAERSDEKERRL
433634759YP_007268386.1 Sulfate transporter [Mycobacterium canettii CIPT 140070017]MLQRIARELLSGVAVAIVALPLAIAFGITATGTSQGALIGLYGAIFAGFF
AAVFGGTPGQVTGPTGPITVVATATIAEHGLEGAFFAFILAGVFQILFGA
CRLGSLIRYVPHPVISGFMGGIAILIIMTQLDQVRSSSLLVLVTVVLLLA
SGRFIKAIPPSLLVLVLVSSVLPLAAPWLRDLRAGPVSINRTVDYIGEIP
QAMPSFDFPQVANSTMLQVLLSAVAIALLGSLDSLLTSLVMDNIRGTRHR
SNKELIGQGIGNIAAGLFGGLAGAGATVRSVVNVRNGGQTALSAATHSVV
LFVFVAGLGAVVQYIPLAVLSGILILVAVGMFDWHAMRKAHVSPRGDVIV
MFTTMIITVVVDLTIAVMVGIALSLLVHRLRSRQRKAKVTQDDTGTYRID
GPLSFLSVDGVFGSLRDGREDVSLDLQHVTYLDTSGARALLYFIDHSEKD
GVAVSIKRIPPRLESQLTALADNEQRDKLRTVLESA
433634757YP_007268384.1 Conserved protein of unknown function- PPE family [Mycobacterium caMTLDVPANQGHVPPGSVACCLVGVTAVADGIAPHSLSNFGALPPEINSGR
MYSGPGSGPLMAAAAAWDGLAAELSSAATGYGAAISELTNMRWWSGPASD
SMVAAVLPFVGWLSTTATLTEQAAMQARAAAAAFEAAFAMTVPPPAIAAN
RTLLMTLIDTNWFGQNTPAIATTEFQYAEMWAQDAAAMYGYASAAAPATV
LTPFAPPPQTTNAAGLVGHATAVAALRGQHSWAAAIPWSDIQKYWMMFLG
ALATAEGFIYDSGGLTLNALQFVGGMLWSTALAEAGAAEAAAGAGGAAGW
SAWSQLGAGPVAASATLAAKIGPMSVPPGWSAPPATTQAQTVARSIPGIR
SAAEAAETSVLLRGAPTPGRSRAAHMGRRYGRRLTVMADRPNVG
433634755YP_007268382.1 Putative d-Serine/Alanine/Glycine transporter protein CycA [MycobacMPDDIAAADPTDTQPHLRRDLANRHIQLIAIGGAIGTGLFMGSGRTISLA
GPAVMVVYGIIGFFVFFVLRAMGELLLSNLNYKSFVDFAADLLGPAAGFF
VGWSYWFAWVVTGIADLVAITGYARFWWPGLPIWVPALVTVALILAVNLF
SVRHFGELEFWFALIKVAAIVCLIAVGAILVATNFVSPHGVHATIENLWN
DNGFFPTGFLGVVSGFQIAFFAYIGVELVGTAAAETADPRRTLPRAINAV
PLRVAVFYIGALLAILAVVPWRQFASGESPFVTMFSLAGLAAAASVVNFV
VVTAAASSANSGFFSTGRMLFGLADEGHAPAAFHQLNRGGVPAPALLLTA
PLLLTSIPLLYAGRSVIGAFTLVTTVSSLLFMFVWAMIIVSYLVYRRRHP
QRHTDSVYKMPGGVVMCWAVLVFFAFVIWTLTTETETATALAWFPLWFVL
LAMGWLVTQRRQSRRSFGFHCQVVGVRQQLGRGMARLAMKIHARPKLRSA
VVVEPVSAGEPGTRRSAKSVRKLASDDSQSAHCPVAVVGLADGGRDPQNH
HDGPDR
433634753YP_007268380.1 Conserved protein of unknown function- possibly SNF2-related [MycobMRSLMYPSIDLDDAESQLGTDTYDRGLDYAREGRVVRCLWNPDDDSLIGD
VRGNRGRIYTTTVQLSTDLADTWNLEIGMCTCPMQVDCKHVAALLIAAAG
TAKTRGQRPPAAAPARQAPPAWRTSLDALFAASPPSNAAGTPLAVELNLS
ANGLDARLVRPGKRGGWVAGDLSWSRLVTLRHHGYPDAHVHLLQQFYAAY
RASAPYPIGYYGYSYADEKAISLLKFESPQLWPLLDEARRIGVRLVQAHT
QHDVPPYGTARFSLDVTGDRSEDLAVTPLLQVDGVLARAVGFIGSSGHGV
VYADDGGLRLARLDKPIPAALQRMALGDRTLTIPADEAARFAAEYYPRLR
HIAAITSSDQSFTPPAITGPTLVLHAHYRDAHQVELTLGWAYRVGDCDFH
IAVDAPTDGGYRNLDAEIGLALSIDAPLERFGLRAADGTLIAATQLSGLQ
TMRFTTELQPLLAGLPDVVLEVTGDPVDYRETGGSLVIGVTTDPVTGETD
WFDLGITISVEGKQIPFVTVFTALASGQSHLLLADGAYFALDKPELVKLR
QLIEEARALTDVEDGPPRISRFQAGLFDELAELGVVTRQAEEWRRQVDGL
RALQGVEPVAVPSGLRTNLRPYQADGFSWLAMLYTHGLGGILADDMGLGK
TVQSLALICHVQQQNSSQAPFLVVAPSSVVTNWAAEAARFAPALSVVAIS
DTLRRAGADLDQLAVGADIVVTSYTLFRLDFEAYAAQTWSGLILDEAQYV
KNRHAKTYQCARQLPAPVKLAITGTPMENNLMELWSLLSITAPGLFPSPT
KFAEYYAKPIEKSGDEELLARLRRRIKPLVKRRTKELVAAELPAKQEQCL
DIELPSRHRTLYDKRLQRERQKVLGLLDDMQRNRFTILKSLTVLRQMALH
PGLVDPAHETLACAKIDVLAEHLADIADGGHRALVFSQFTRFLGRVRDRL
DADNIDYCYLDGRTRNRPKVIQRFKEGNAPVFLISLKAGGFGLNLTEADY
CFLLDPWWNPATETQAVDRTHRIGQTRNVMVYRLIASDTIEEKVVALNAR
KAKLFASVLDDGDAFGSVLTADDIRGLLA
433634751YP_007268378.1 Putative integrase/recombinase [Mycobacterium canettii CIPT 1400700MKTLALQLQGYLDHLTIERGVAANTLSSYRRDLRRYSKHLEERGITDLAK
VGEHDVSEFLVALRRGDPDSGTAALSAVSAARALIAVRGLHRFAAAEGLA
ELDVARAVRPPTPSRRLPKSLTIDEVLSLLEGAGGDKPSDGPLTLRNRAV
LELLYSTGARISEAVGLDLDDIDTHARSVLLRGKGGKQRLVPVGRPAVHA
LDAYLVRGRPDLARRGHATAAIFLNARGGRLSRQSAWQVLQDAAERAGIT
AGVSPHMLRHSFATHLLEGGADVRVVQELLGHASVTTTQIYTLVTVHALR
EVWAGAHPRAR
433634749YP_007268376.1 Putative CTP synthase PyrG [Mycobacterium canettii CIPT 140070017]MRKHPQTATKHLFVSGGVASSLGKGLTASSLGQLLTARGLHVTMQKLDPY
LNVDPGTMNPFQHGEVFVTEDGAETDLDVGHYERFLDRNLPGSANVTTGQ
VYSTVIAKERRGEYLGDTVQVIPHITDEIKRRILAMAQPDADGNRPDVVI
TEIGGTVGDIESQPFLEAARQVRHYLGRADVFFLHVSLVPYLAPSGELKT
KPTQHSVAALRSIGITPDALILRCDRDVPEALKNKIALMCDVDIDGVIST
PDAPSIYDIPKVLHREELDAFVVRRLNLPFRDVDWTEWDDLLRRVHEPHE
TVRIALVGKYVELSDAYLSVAEALRAGGFKHRAKVEICWVASDGCETTSG
AAAALGDVHGVLIPGGFGIRGIEGKIGAIAYARARGLPVLGLCLGLQCIV
IEAARSVGLTNANSAEFDPDTPDPVIATMPDQEDIVAGEADLGGTMRLGS
YPAVLEPDSVVAQAYQTTQVSERHRHRYEVNNAYRDKIAESGLRFSGTSP
DGHLVEFVEYPPDRHPFVVGTQAHPELKSRPTRPHPLFVAFVGAAIDYKA
GELLPVEIPEIPEHTPNGSSHRDGVGQPLPEPASRG
433634747YP_007268374.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MRMSALLSRNTSRPGLIGIARVDRNIDRLLRRVCPGDIVVLDVLDLDRIT
ADALVEAEIAAVVNASSSVSGRYPNLGPEVLVTNGVTLIDETGPEIFKKV
KDGAKVRLYEGGVYAGDRRLIRGTERTDHDIADLMREAKSGLVAHLEAFA
GNTIEFIRSESPLLIDGIGIPDVDVDLRRRHVVIVADEPSGPDDLKSLKP
FIKEYQPVLVGVGAGADVLRKAGYRPQLIVGDPDQISTEVLKCGAQVVLP
ADADGHAPGLERIQDLGVGAMTFPAAGSATDLALLLADHHGAALLVTAGH
AANIETFFDRTRVQSNPSTFLTRLRVGEKLVDAKAVATLYRNHISGGAIA
LLALTMLIAIIVALWVSRTDGVVLHWIIDYWNRFSLWVQHLVS
433634745YP_007268372.1 Inorganic polyphosphate/ATP-NAD kinase PpnK (Poly(P)/ATP NAD kinaseMTAHRSVLLVVHTGRDEATETARRVEKVLGDNKIALRVLSAEAVDRGSLH
LAPDDMRAMGVEIEVVDADQHAADGCELVLVLGGDGTFLRAAELARNASI
PVLGVNLGRIGFLAEAEAEAIDAVLEHVVAQDYRVEDRLTLDVVVRQGGR
IVNRGWALNEVSLEKGPRLGVLGVVVEIDGRPVSAFGCDGVLVSTPTGST
AYAFSAGGPVLWPDLEAILVVPNNAHALFGRPMVTSPEATIAIEIEADGH
DALVFCDGRREMLIPAGSRLEVTRCVTSVKWARLDSAPFTDRLVRKFRLP
VTGWRGK
433634743YP_007268370.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MTIDPGQIRAEIDALLASLPDPADAENGPSLAELESIARRLSEAHEVLLA
ALESAEKG
433634741YP_007268368.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MVDDRQGRRGGRRPRSAAADNRPAFRDGPAIPPGIHARQLAPEIRRELST
LDRATADAVACHLVAAGELIDDDPEAALRHARAARFRASRIAAVREAVGI
AAYRCGDWAQALAELRAARRMGSKSPLLALIADCERGLGRPQRAIELARG
SEAVELSGDAADELRIVAAGARADLGQLEQALTVLSTPQLDPGRTGSTAA
RLFYAYAEILLALGRGDEALQWFLRSAAADIDGVTDAEDRVDELGAREQK
433634739YP_007268366.1 Putative tyrosyl-tRNA synthase TyrS (TYRRS) [Mycobacterium canettiiMSGMILDELSWRGLIAQSTDLDTLAAEAQRGPMTVYAGFDPTAPSLHAGH
LVPLLTLRRFQRAGHRPIVLAGGATGMIGDPRDVGERSLNEADTVAEWTE
RIRGQLERFVDFDDSPMGAIVENNLEWTGSLSAIEFLRDIGKHFSVNVML
ARDTIRRRLAGEGISYTEFSYLLLQANDYVELHRRHGCTLQIGGADQWGN
IIAGVRLVRQKLGATVHALTVPLVTAADGTKFGKSTGGGSLWLDPQMTSP
YAWYQYFVNTADADVIRYLRWFTFLSADELAELEQATAQRPQQRAAQRRL
ASELTVLVHGEAATAAVEHASRALFGRGELARLDEATLAAALRETTVAEL
KPGSPDGIVDLLVASGLSASKGAARRTIHEGGVSVNNIRVDNEEWVPQNS
DFLHGRWLVLRRGKRSIAGVERIG
433634737YP_007268364.1 Putative multidrug resistance ABC transporter ATP-binding protein [MMISSSDELLRDGADPAVIIDQLRVIRGKRLALQDVSVRVACGTITGLLG
PSGSGKTTLIRCIVGSQIIASGSVSVLGQPAGSAELRHRVGYMPQDPTIY
NDLRVIDNIRYFAELCGVDRQAADEVIEAVDLRDHRTARCANLSGGQRAR
VSLACALVGRPDLLVLDEPTIGLDPVLRVELWDRFTALARRGTTLLVSSH
VMDEADRCGDLLLLRQGQLLAHTTPHRLRKETGCTSLEEAFLSIVRRTTT
VPAAG
433634735YP_007268362.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MAAPDNSRRRPGRPAGSSDTRERILSSARELFAHNGIDRTSIRAVAAKAG
VDAALVHHYFGTKQQLFAAAIHIPIDPMVIIGPIREAPVEELGYQLPSLL
LPIWDSELGAGLIATLRSLISGSDVGLARSFLEEVVTVELGSRVDNPPGT
GKIRTQFVASQLMGVVMARYIVRIEPFASLPAEQIVQTIAPNLQRYLTGE
LPDGLAP
433634733YP_007268360.1 Putative long-chain acyl-CoA synthase [Mycobacterium canettii CIPT MVDLNFSMVTRPIERLVATAQNGLEVLRLGGLETGSVPSPSQIVESVPMY
KLRRYFPPDNRPGQPPVGPPVLMVHPMMMSADMWDVTREDGAVGILHASG
LDPWVIDFGSPDEVEGGMRRNLADHIVALSEAVDTVKDATGHDVHFVGYS
QGGMFCYQAAAYRRSKDIASVVAFGSPVDTLAALPMGIPANMGAAVADFM
ADHVFNRLDIPSWMARMGFQMMDPLKTAKARVDFVRQLHDREALLPREQQ
RRFLESEGWIAWSGPAISELLKQFIAHNRMMTGGFAISGQMVTLTDITCP
ILAFVGEVDDIGQPASVRGIRRAAPNSEVYECLIRAGHFGLVVGSRAAQQ
SWPTVADWVRWISGDGTKPENIHLMADQPAEHTDSGVAFSSRVAHGIGEV
SEAALALARGAADAVVAANRSVRTLAVETVRTLPRLARLGQLNDHTRISL
GRIIDEQAHDAPKGEFLLFDGRVHTYEAVNRRINNVVRGLIAVGVRQGDR
VGVLMETRPSALVAIAALSRLGAVAVVMRPDTDLSASVRLGRVTEILTDP
TNLDAARQLPGQVLVLGGGESRDLDLPADALEQGQVIDMEKIDPDAVELP
AWYRPNPGLARDLAFIAFSSADGDLVAKQITNYRWAVSAFGTASTAALGR
RDTVYCLTPLHHESALLVSLGGAVVGGTRIALSRGLRPDRFVAEVRQYGV
TVVSYTWAMLRDVVDDPAFVLHGNHPVRLFIGSGMPTGLWERVVEAFAPA
HVVEFFATTDGQAVLANVAGAKIGSKGRPLPGAGRVELGAYDAEHDLILE
NDRGFVQVAGVNQVGVLLAQSRGPIDPTASVKRGVFAPADTWISTDYLFW
RDDDGDYWLAGGRGSVVRTARGMVYTEPVTNALGLITGVDLAVTYGVLVR
GRHVAVSAVTLLPGATITAADLTEAVASMPVGLGPDIVHVVPQLTLSGTY
RPTVSALRANGIPKAGRQAWYFNSGGNEYRRLTPAVRSELTGQHRRGNA
433634731YP_007268358.1 Putative molybdopterin biosynthesis protein MoeX [Mycobacterium canMIIELMRRVVGLAQGATAEVAVYSDRDRDLAERWCANTGNTLVRADVDQT
GVGTLVVRRGHPPDPASVLGPDRLPGVRLWLYTNFHCNLCCDYCCVSSSP
STPHRELGAERIGRIVGEAARWGVRELFLTGGEPFLLPDIDTIIATCVKQ
LPTTVLTNGMVFKGRGRRALESLPRGLALQISLDSATPELHDAHRGAGTW
VKAVAGIRLALSLGFRVRVAATVASPAPGELTAFHDFLDGLGIAPGDQLV
RPIALEGAASQGVALTRESLVPEVTVTADGVYWHPVAATDERALVTRTVE
PLTPALDMVSRLFAEQWTRAAEEAALFPCA
433634729YP_007268356.1 Putative acyl-CoA dehydrogenase FadE16 [Mycobacterium canettii CIPTMATPGVVQEVVSVAAEHAERVDTDCAFPAEAVDALRKTGLLGLVLPREIG
GMGSGPVEFTEVVAQLSAACGSTAMIYLMHMAAAVTVAASPPPGLPDLLA
DMASGKQLGTLAFSEPGSRSHFWAPVSTASADGDGIAVRADKSWVTSAGF
ADVYVVSVGSADGAAGDVDLYAVPADTPGLRVAGTFTGMGLRGNASAPMA
VDIRIPDSYRLGEAGGGFGIMMQTVLPWFNLGNAAVSLGLATAATGAAVK
HVGAARLEHLGGSLAELPTIRAQIARMGTTLAAQKAYLEVAANSVSSPDD
TTLTHVLGVKASVNDAALTITESAMRVCGGAAFSKHLPIERAFRDARAGS
VMAPTADALYDFYGRAVTGLPLF
433634727YP_007268354.1 Conserved lipoprotein of unknown function- DsbF [Mycobacterium caneMTHSRLIGALTVVAIIVTACGSQPKSQPAVAPTGDAAAASQVPAGQTVPA
QLQFSAKTLDGQDFHGESLLGKPAVLWFWAPWCPTCQGEAPVVGQVAASH
PEVTFVGVAGLDQVPAMQEFVNKYPVKTFTQLADTDGSVWANFGVTQQPA
YAFVDPHGNVDVVKGRMSQDELTRRVTALTSR
433634725YP_007268352.1 Putative transcriptional regulatory protein [Mycobacterium canettiiMADQSVRPLRHLVHAVTGGQPPSEAQVRQAAWIARCVGRGRSAPLHRDDV
SALAETLQAKEFAPGAVVFHADQTADGVWIVRHGLIELAVGSRRRRAVVN
ILHPGDVDGDIPLLLEMPMVYTGRALTQATCLFLDRQAFERLLATHPAIA
RRWLSSVAQRVSTAQIRLMGMLGRPLPAQVAQLLLDEAIDARIELAQRTL
AAMLGAQRPSINKILKEFERDRLITVGYAVIEITDQDGLRARAQ
433634723YP_007268350.1 Putative transcriptional regulatory protein [Mycobacterium canettiiMSGAKKLIFEQFALVGQALSSGHRLELLDLLVQGERSVDALARASGLTFA
NASQHLLQLRRAGLVTSRRDGKRVIYALSDPQVWDVMRAVRGVAERNLAS
VGSLVRQYYTDRDSLEPITRDELQARVAAGSVLVLDVRPAVEYAAGHLPG
AVSIPLNELAERLDELPSGIDIVACCRGPYCVYSYDALELLRPNGFSARR
LDGGFSEWLAADLPVVRT
433634721YP_007268348.1 Putative conserved integral membrane transport protein [MycobacteriMATIAASPTHNALGKAARRLLPLLFVLYVINFVDRANISVAALAMNADLR
LSATAYGTAAGVFFLGYVLFQVPANAALARFGAGRTLTAVVLAWGVCSAA
TAFVTSAHTLYLARFALGVAEAGFFPGVIAYLTVWFPCAQRARAVATFLL
AIPVANTVGLPLSGLIVGHVHMAGLPGWRAMFVIEALPALLLAPLLRRLL
PDNPQRASWLTPEERAELSARLDEETPAPTGRSGGAGWDLVLFAVVYGGL
YFALYALQFFLPQLVASLAHGTATLTAATLAALPYGVAALAMFAWSHRSI
DRSGAQAGHITLPTTAAGSAALGAALSPMSPIVTLSWLTIAVAGILAAMP
AFWSRCTAALAGPRVAVAIAAVNAVASLASFAGPYATGHLKDATGTYHLT
LLTVAAVLAAAAACSLLLRHAGRTVCANDSEIMLHPSPATPFV
433634719YP_007268346.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MIRAVWNGTVLAEAPRTVRVEGNHYFPPESLHREHLIESPTTSICPWKGL
AHYYNVVVDGPYGPVNPDAAWYYRRPSPLARRIKNHVAFWHGVTVEGESE
GRHGLARRVVAWLGK
433634717YP_007268344.1 Putative cytochrome P450 139 [Mycobacterium canettii CIPT 140070017MRYPLGEALLALYRWRGPLINAGVGGHGYTYLLGAEANRFVFANADAFSW
SQTFESLVPVDGPTALIVSDGADHRRRRSVVAPGLRHHHVQRYVATMVSN
IDTVIDGWQPGQRLDIYQELRSAVRRSTAESLFGQRLAVHSDFLGEQLQP
LLDLTRRPPQVMRLQQRVNSPGWRRAMAARKRIDDLIDAQIADARTAPRP
DDHMLTTLISGCSEEGTTLSDNEIRDSIVSLITAGYETTSGALAWAIYAL
LTVPGAWESAASEVARVLGGRAPAADDLSALTYLNGVVHETLRLYSPGVI
SARRVLRDLWFDGHRIRAGRLLIFSAYVTHRLPEIWPEPTEFRPLRWDPN
AADYRKPAPHEFIPFSGGLHRCIGAVMATTEMTVMLARLVARATLQLPAQ
RAHRVRAANFAALRPWPGLTVEIRKSAPAQ
433634715YP_007268342.1 Putative polyketide synthase Pks9 [Mycobacterium canettii CIPT 1400MQPTDIAIIGLACRFPTVVSPGDLWDLLRDGREATGSIDNVADFDADFFN
LSPREASAMDPRQRLALELTWELLEDAFVVPETLRGQPIAVYLGAMNDDY
AVLTLAADRVDHHAFAGTSRAIIANRVSFAFGLRGPSVTIDSGQSSSLVA
VHLACESVRTGEAPLAIAGGVHLNLARETAMLEQEFGAVSPSGHTYAFDE
RADGYVPGDGGGLVLLKPVQAALDDGDRIHAIIRGSAVGNAGHSATGLTV
PSVAGQVDVIRRAMSGAGVDCHQVHYVEAHGTGTKIGDPIEARALGEIFA
ARQRRPVSVGSVKTNIGHTGGAAGIAGLLKAVLAIENAVIPPSLNYVGAP
IDLDSLGLRVDTALTPWPVADEPRRAGVSSFGMGGTNAHVILEQGPTQSP
EIVESVAAAGSNAPVAVPWVLAARSPQALTNQAGRLLAHLTADDGLTALD
VGWSLVSTRSVFDHRAVVVGADRGRLMAGLAGLAAGEPGAGVVVGRARSV
GKTVFVFPGQGSQWLGMGRQLYGRYSVFARAFDEVVAVLDGQLRLSVRQV
MWGADAGLLESTEFAQPALFVVQVALAALLQDWGVLPDLVMGHSVGEIAA
AYVAGALSLVDAARVVAARGRLMQALPVGGVMVAVAASEDEVAPLLTEGV
CIAAVNAPESVVISGEQAAVGVVVDRLVGLGRRVRRLAVSHAFHSVLMDP
MVEEFSKVLADVCVRAPRIGLVSNVTGQLAGAGYGSPAYWVEHVRKPVRF
FDGVGLAESLGARVFVEVGPGAGLEASVALLARDRPEVESVLAGVGRLFT
EGVAVDWSSVFAGLGGRRVELPTYGFARQRFWLGDNGELSVDQTGKDAGA
IARLQSLAPPELQRQLVELVCFHAAIVLGRKSSHDIDPECAFQDLGFDSM
SGVELRNRLQMAIGLPGLSLPRTLIFDYPTASALAECLGQLLGGQHESSD
DESIWQLLKNIPIHQLRRTGLLDKLLLLAGQPEESLAGRTVSDEVIDSLS
PEALIGLALDEDENDIR
433634713YP_007268340.1 Putative polyketide synthase Pks7 [Mycobacterium canettii CIPT 1400MNSTPEDLVKALRRSLKHNERLKRENRDLLARATEPVAVVGMGCRYPGGV
DSPETLWELVAHGRDAVSEFPADRGWDVAGLFDPDPDAVGKSYTRCGGFL
TDVAGFDAEFFGIAPSEALAMDPQQRLLLEVSWEALERAGIDPITLRGSQ
TGVFAGVFHGSYGGQGRVPGDLERYGLRGSTLSVASGRVAYVLGLQGPAV
SVDTACSSSLVALHLAVQSLRLGECDLALVGGVTVMATPAMFIEFSRQRA
LSADGRCKAYAGAADGTAFAEGAGVLVLARLADARRWGHPVLALVRGSAV
NQDGASNGLATPNGPAQQRVITAALASARLGVADVDVVEGHGTGTVLGDP
IEAQAILATYGQRPADRPLWLGSIKSNIGHTSAAAGVAGVIKMVQAMRHG
VLPKTLHVDVPTPHVDWSAGAVSLLTEPRPWHVPGRPRRAGVSSFGISGT
NAHVILEQAPAVEPVGAAHGNDPVAVPWVLSARSAQALTNQARRLLAWVG
ADENVRPLDVGWSLVNTRSLFDHRAVVVGADRTQLMEGLTGLAAGVPGAD
VVAGRAQALGKTAFVFPGQGAQWLGMGAQLCDTAPVFAEHIHRCERALRE
HVEWSLLDVLRATPGAPGLDRVDVVQPALWAVMVSLAELWRSVGVVPDAV
IGHSQGEIAAAYVAGALSLRDAAAVVALRSRLLVRLAGAGGMVSLACGQP
QAEKLASQWGDRLNIAAVNGVSSVVLAGETDAVTELMQRCEAEGIRARRI
DVDYASHSAQVDAIREELIAALRGIEPRTSTVAFFSTVTGELMDTAGVNA
EYWYRSIRAPVQFERAVRNAFDRGYRVFVESSPHPVLVAGIEETLVDCDR
GATGEPIVIPTLGRDDGGVGRFWLSAGQAHVAGVGVDWRAAFADLGGRRV
ELPTYGFARQRFWLDGLGAAGGDLGGVGLVGAEHGLLAAVVQRPDSGGVV
LTGRISVVAAPWLADHAVGPVVLFPGTGFVELALRAGDEVGCSVLQELTL
QAPLVLPAGGVRIQVVVGGVEQSGTRNVWVYSAAGQADSSPGWTLHAQGV
LRVGSVQPAAELSVWPPVGARAMDVADGYQVLAARGYGYGPAFRGLQALW
RRGAEVFADVTLPEGVPIRGFGIHPAVLDAALHAWGIVEGGQQTMLPFSW
QGVCLHASGASRVRVRLAPVGRGAVSVELADPQGLPVLSVRQLMVRPVCA
AALSTAAAGDRGLLEVVWTPVPLAGGDIGDDAVVWELPPRAGAQAGGDLL
AAVYRGVHEVLEVLQSWLASDATGLGVVVTRGAVGPVDDDVTDLAGAAVW
GLVRSAQAEHPGRVVLVDTDGSVAVEDAVGSGARSGEPQLVVRRGGVYAA
RLAPVAAGLTLPSASAGGWRLVAGGGGTLADVVVAPVAPVKLATGQVRVA
VGAVGVNFRDVLVALGMYPGGGELGVDGAGVVVEVGPGVTGLAVGDRVMG
LLGVVGSEAVVDARLVTMVPAGWSLVEAAAVPVAFLTAFYGLSVLAEVAA
GQKVLVHAGTGGVGMAAVSLARYWGAEVFVTASRAKWDTLRVMGFDDIHI
SDSRSLEFEETFLRATEGSGVDVVLNSLAGEFTDASLRLLPRGGRFIELG
KTDLRDGQTVAERHRGVRYRAFDLVEAGPDRIAAMLSEVVGLLAAGVLAR
LPVKTFDARYAPAAYRFVSQARHIGKVVLTIPDGPGGQSGLAGGTVVVTG
GTGMAGSAVATHLVRRHGVANLVLVSRSGEQADRAAEVAALLREGGAQVA
VVSCDVADRDALAALLAGLDPRYPLKGVFHAAGVLDDAVITGLTPDRVDT
VLRAKVDGAWNLHELTQDMDLSAFVVFSSMAGIVGTPGQGNYAAANAFLD
GLVAYRRSRGLAGLSVAWGLWEQASAMTRHLGERDRARMTQAGLAPLTTE
QALGLLDTALLADRAVVVAARLDRAALAGAGAALPALFSQLAAGPTRRRI
DASDTVSMSGLVSRLHALTPERRQRELTDLVISNAATVLGRSSSVDINAH
KAFQDLGFDSLTAVELRNRLKTATGLTLSPTLIFDYPTPATLAEHLDSRL
VTASGSHQQSLSDRVDDITRELVVLLDQPDLSADVKAHLRTRLQTMLTSL
TTEDDDIAAATESQLFAILDEELGF
433634711YP_007268338.1 Putative argininosuccinate lyase ArgH [Mycobacterium canettii CIPT MSTNEGSLWGGRFAGGPADALAALSKSTHFDWVLAPYDITASRAHTMVLF
RAGLLTEEQRDGLLAGLDSLAQDVADGSFGPLVTDEDVHAALERGLIDRV
GPDLGGRLRAGRSRNDQVAALFRMWLRDAVRRVATGVLDVVGALAEQAAA
HPSAIMPGKTHLQSAQPILLAHHLLAHAHPLLRDLDRIVDFDKRAAVSPY
GSGALAGSSLGLDPDAIAADLGFSAAADNSVDATAARDFAAEAAFVFAMI
AVDLSRLAEDIIVWSSTEFGYVTLHDSWSTGSSIMPQKKNPDIAELARGK
SGRLIGNLAGLLATLKAQPLAYNRDLQEDKEPVFDSVAQLELLLPAMAGL
VASLTFNVARMAELAPAGYTLATDLAEWLVRQGVPFRSAHEAAGAAVRAA
EQRGVGLQELTDDELTAISPELTPRVREVLTIEGSVSARDCRGGTAPGRV
AEQLNAVGEAAERLRRQLVR
433634709YP_007268336.1 Putative arginine repressor ArgR (AHRC) [Mycobacterium canettii CIPMSRAKAAAVAGPEVAANRAGRQARIVAILSSAQVRSQSELAALLAAEGIE
VTQATLSRDLEELGAVKLRGADGGTGIYVVPEDGSPVRGVSGGTDRMSRL
LAELLVSTDASGNLAVLRTPPGAAHYLASAIDRAALPQVVGTIAGDDTIL
VVAREPMTGAQLAGMFENIR
433634707YP_007268334.1 Putative acetylornithine aminotransferase ArgD [Mycobacterium canetMRQRWQAVMMNNYGTPPIALASGDGAVVTDVDGKTYIDLLGGIAVNVLGH
RHPAVIEAVTRQMSTLGHTSNLYATEPGIALAEELVALLVADQRTRVFFC
NSGAEANEAAFKLSRLTGRTKLVAAHDAFHGRTMGSLALTGQPAKQTPFA
PLPGDVTHVGYGDVDALAAAVDDHTAAVFLEPIMGESGVVVPPAGYLAAA
RDITARRGALLVLDEVQTGMGRTGAFFAHQHDGITPDVVTLAKGLGGGLP
IGACLAVGPAAELLTPGLHGSTFGGNPVCAAAALAVLRVLASDGLVRRAE
VLGKSLRHGIEALGHPLIDHVRGRGLLLGIALTAPHAKDAEATARDAGYL
VNAAAPDVIRLAPPLIIAEAQLDGFVAALPAILDRAVGAP
433634705YP_007268332.1 Arginine biosynthesis bifunctional protein ArgJ [Includes: GlutamatMTDLAGTTRLLRAQGVTAPAGFRAAGVAAGIKASGALDLALVFNEGPDYA
AAGVFTRNKVKAAPVLWTQQVLTTGRLRAVILNSGGANACTGPAGFADTH
ATAEAVAAALSDWGTETGAIEVAVCSTGLIGDRLPMDKLLAGVAHVVHEM
HGGLVGGDEAAHAIMTTDTVPKQAALHHQDNWTVGGMAKGAGMLAPSLAT
MLCVLTTDAVAEPAALERALRRAAAVTFDRLDIDGSCSTNDTVLLLSSGA
SEIAAAQADLDEAVLRVCDDLCAQLQADAEGVTKRVTVTVTGAATEDDAL
VAARQIARDSLVKTALFGSDPNWGRVLAAVGMAPITLDPDRISVSFNGAA
VCVHGVGAPGAREVDLSDADIDITVDLAVGDGRARIRTTDLSHAYVEENS
AYSS
433634703YP_007268330.1 Conserved protein of unknown function- PE-PGRS family protein [MycoMSFLLVEPDLVTAAAANLAGIRSALSEAAAAASTPTTALASAGADEVSAA
VSRLFGAYGQQFQALNARAATFHAEFVSLLNGGAAAYTGAEAASVSSMQA
LLDAVNAPTQTLLGRPLIGNGADGVAGTGSNAGGNGGPGGILCGNGGNGG
AGGPDGGAGGNGGAAGLIGNGGAGGAGGAGGAGGAGGAGGTGGLWYGNGG
TGGNGGSATAAGGAGGNALLFGNGGNGGSGASGGTAGHAGTVYGNGGNAG
AGSGLAGADGGLFGNGGTGGSSTSKAGGAGGNALFGNGGDGGSSTAAAGG
AGGNTLVGNGGAGGAGGTSGLTGSGVAGGAGGSVGLWGSGGAGGDGGAAT
SLLGVGMNAGAGGAGGNAGLLYGNGGAGGAGGNGGDTTVPLFDSGVGGAG
GAGGNASLFGNGGTGGVGGKGGTSSDLASATSGAGGAGGTGGVGGLLYGN
GGNGGAGGIGGAAINIVANAGAGGAGGAAGSSFIGNGGNGGAGGDGGAAA
LFSSGVGGAGGSGGTALLLGSGGAGGLGGTGGANSGSLFASPGGTGGAGG
HGGAGGLIWGNGGAGGDGGNGGTTADGSLDGGTGGIGGTGGSAIAFGNGG
HGGAGGTGGDHSGGNGIGGKGGASGNGGNAGQVLGDGGTGGTGGAGGAGS
GTKAGGIGSDGGHGGNATLIGNGGDGGAGGAGGAGSPAGAPGNGGTGGTG
GVLFGQSGSSGPPGAAALAFPSLSSSVPILGPYEDLIANTVANLASIGNT
WLADPAPFLQQYLANQFGYGQLTLTALTDATRDFAIGLAGIPPSLQSALQ
ALAAGDVSGAVTDVLGAVVKVFVSGVDASDLSNILLLGPVGDLFPILSIP
GAMSQNFTNVVMTVTDTTIAFSIDTTNLTGVMTFGLPLAMTLNAVGSPIT
TAIAFAESTTAFVSAVQAGNLQAAAAALVGAPANVANGFLNGEARLPLAL
PTSATGGIPVTVEVPVGGILAPLQPFQATAVIPVIGPVTVTLEGTPAGGI
VPALVNYAPTQLAQAIAP
433634701YP_007268328.1 Putative Phenylalanyl-tRNA synthetase- alpha chain PheS [MycobacterMLSPEALTTAVDAAQQAIALADTLDVLARVKTEHLGDRSPLALARQALAV
LPKEQRAEAGKRVNAARNAAQRSYDERLATLRAERDAAVLVAEGIDVTLP
STRVPAGARHPIIMLAEHVADTFIAMGWELAEGPEVETEQFNFDALNFPA
DHPARGEQDTFYIAPEDSRQLLRTHTSPVQIRTLLARELPVYIISIGRTF
RTDELDATHTPIFHQVEGLAVDRGLSMAHLRGTLDAFARAEFGPSARTRI
RPHFFPFTEPSAEVDVWFANKKGGADWVEWGGCGMVHPNVLRATGIDPDL
YSGFAFGMGLERTLQFRNGIPDMRDMVEGDVRFSLPFGVGA
433634699YP_007268326.1 Adenylate cyclase [Mycobacterium canettii CIPT 140070017]MPGSARTTYPCHVEVGPQDSESGAPDETATAMASPVPRQRSALRWLRTVN
RSPGLVSFIHRARRLLPGDPEFGDPLSTAGEGGPRAAARAADRLLRDRDA
ASREVGLSVLQVWQALTEAVSRRPANPEVTLVFTDLVGFSTWSLHAGDDA
TLTLLRQVARAVESPLLDAGGHIVKRLGDGIMAVFRNPTVALRAVLVAQD
AVKSLEVQGYTPRMRIGIHTGRPQRLAADWLGVDVNIAARVMERATKGGI
MISQPTLDLIPQSELDALGVVARRVRKPVFASKPTGIPPDLAIYRIKTVS
ESTAADNFDEMSPDAQ
433634697YP_007268324.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MTVASRTSADPLGPDSLTWKYFGDLRTGMMGVWIGAIQNMYPELGAGVEE
HSILLREPLQRVARSVYPIMGVVYDGDRAAQTGQQIKGYHRTIKGVDAEG
RRYHALNPDTFYWAHATFFMLVIKVAEYFCGGLTEAEKHQLFEEHVRWYR
MYGMSMRPVPKSWEDFQDYWDRVCRDKLEINQATVDILQMRIPKPRFVLM
PTPIWDQLFKPLIAGQRWIAAGLFDPAVREKAGMHWTPGDEVLLRVFGKV
VELAFLAVPDEIRLHPRALAAYRRAAGRTRHDAPLVQAPGFMAPPRDRQG
LPMHYFPPRSHRFTRSALDPAKALMERAGALVHSTLSLAGVRPARGPSRA
A
433634695YP_007268322.1 50S ribosomal subunit protein L20 [Mycobacterium canettii CIPT 1400MARVKRAVNAHKKRRSILKASRGYRGQRSRLYRKAKEQQLHSLNYAYRDR
RARKGEFRKLWIARINAAARLNDITYNRLIQGLKAAGVEVDRKNLADIAI
SDPAAFTALVGVARAALPEDVNAPSGEAA
433634693YP_007268320.1 Translation initiation factor IF-3 [Mycobacterium canettii CIPT 140MRIEDALRVAADADLDLVEVAPNARPPVCKIMDYGKYKYEAAQKARESRR
NQQQTVVKEQKLRPKIDDHDYETKKGHVVRFLEAGSKVKVTIMFRGREQS
RPELGYRLLQRLGADVADYGFIETSAKQDGRNMTMVLAPHRGAKTRARAR
HPGEPAGGPPPKPTAGDSKAAPN
433634691YP_007268318.1 Conserved membrane protein of unknown function [Mycobacterium canetMAQNELVTASTPPAATQPLAVGHTSLMHGWVPLTVQVVTAVVLVLAAGWR
SRHWQRRWLPTAAAIGATLAWGTRWYVTGNGLANERPPSTLWIWVALTGA
AATVLILGWRSARWWRRGASLLAVPLCLLSATLTLNLWVGYFPTVQTAWN
QLTSGPLPDQADQAAVAALAHSGVRPSHGTLLPVVIPSDASHFKHRGELV
YLPPAWFDREHRSENPPPPQLPTVMMIGGQFNTPADWARAGNAVKTLDDF
AAAHSGNAPVVVFVDSGGAFNNDTECVNGRRGNAADHLTKDVVPYMVSKF
GVSPEQTSWGIVGWSMGGTCAVDLTVMHPTLFSAFVDIAGDFYPNAGNKT
QTIVRLFGGNEDAWSAFDPTTVITRHGSYTGLSGWFAISSPGPPSPDNAV
ADTTTMRLAGRDAAANPGNQAAAANALCALGRANGIYCAVVPQPGKHDWP
FADRVFAAALPWLAGQLATPGVPKIPLPGTTQQIAGTGR
433634689YP_007268316.1 Putative excinuclease ABC (subunit A-DNA-binding ATPase) UvrA [MycoMADRLIVKGAREHNLRSVDLDLPRDALIVFTGLSGSGKSSLAFDTIFAEG
QRRYVESLSAYARQFLGQMDKPDVDFIEGLSPAVSIDQKSTNRNPRSTVG
TITEVYDYLRLLYARAGTPHCPTCGERIARQTPQQIVDQVLAMPEGTRFL
VLAPVVRTRKGEFADLFDKLNAQGYSRVRVDGVVHPLTDPPKLKKQEKHD
IEVVVDRLTVKAAAKRRLTDSVETALNLADGIVVLEFVDHELGAPHREQR
FSEKLACPNGHALAVDDLEPRSFSFNSPYGACPECSGLGIRKEVDPELVV
PDPDRTLAQGAVAPWSNGHTAEYFTRMMAGLGEALGFDVDTPWRKLPAKA
RKAILEGADEQVHVRYRNRYGRTRSYYADFEGVLAFLQRKMSQTESEQMK
ERYEGFMRDVPCPVCAGTRLKPEILAVTLAGESKGEHGAKSIAEVCELSI
ADCADFLNALTLGPREQAIAGQVLKEIRSRLGFLLDVGLEYLSLSRAAAT
LSGGEAQRIRLATQIGSGLVGVLYVLDEPSIGLHQRDNRRLIETLTRLRD
LGNTLIVVEHDEDTIEHADWIVDIGPGAGEHGGRIVHSGPYDELLRNKDS
ITGAYLSGRESIEIPAIRRPVDPRRQLTVVGAREHNLRGIDVSFPLGVLT
SVTGVSGSGKSTLVNDILAAVLANRLNGARQVPGRHTRVTGLDYLDKLVR
VDQSPIGRTPRSNPATYTGVFDKIRTLFAATTEAKVRGYQPGRFSFNVKG
GRCEACTGDGTIKIEMNFLPDVYVPCEVCQGARYNRETLEVHYKGKTVSE
VLDMSIEEAAEFFEPIAGIHRYLRTLVDVGLGYVRLGQPAPTLSGGEAQR
VKLASELQKRSTGRTVYILDEPTTGLHFDDIRKLLNVINGLVDKGNTVIV
IEHNLDVIKTSDWIIDLGPEGGAGGGTVVAQGTPEDVAAVPASYTGKFLA
EVVGGGASAATSRSNRRRKVSA
433634687YP_007268314.1 Conserved protein of unknown function- iron-regulated TB15.3 [MycobMSAYKTVVVGTDGSDSSMRAVDRAAQIAGADAKLIIASAYLPQHEDARAA
DILKDESYKVTGTAPIYEILHDAKERAHNAGAKNVEERPIVGAPVDALVN
LADEEKADLLVVGNVGLSTIAGRLLGSVPANVSRRAKVDVLIVHTT
433634685YP_007268312.1 Putative drug efflux membrane protein [Mycobacterium canettii CIPT MTETASETGSWRELLSRYLGTSIVLAGGVALYATNEFLTISLLPSTIADI
GGSRLYAWVTTLYLVGSVVAATTVNTMLLRVGARSSYLMGLAVFGLASLV
CAAAPSMQILVAGRTLQGIAGGLLAGLGYALINSTLPKSLWTRGSALVSA
MWGVATLIGPATGGLFAQLGLWRWAFGVMTLLTALMAMLVPVALGAGRVG
PGGETPVGSTHKVPVWSLLLMGAAALAISVAALPNYLVQTAGLLAAAALL
VAVFVVVDWRIHAAVLPPSVFGSGPLKWIYLTMSVQMIAAMVDTYVPLFG
QRLGHLTPVAAGFLGAALAVGWTVGEVASASLNSARVIGHVVAAAPLVMA
SGLALGAVTQRADAPVGIIALWALALLIIGTGIGIAWPHLTVRAMDSVAD
PAESSAAAAAINVVQLISGAFGAGLAGVVVNTAKGGEVAAARGLYMAFTV
LAAAGVIASYQATHRDRRLPR
433634683YP_007268310.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MRAVDEYTVHPWGLYLARPTPGRAQFHYLESWLLPSLGLRATVFHFNPSH
KRDHDYYLDVGEYTPGPSVWRSEDHYLDIEVRTGGGAELADVDELLDAVR
HGLLTPTVAEQAVRHAVDAVEGLARNGYDLTRWLATKGMELTWRSGS
433634681YP_007268308.1 Putative ribosomal protein S1 RpsA [Mycobacterium canettii CIPT 140MPSPAVTSPQVAVNDIGSSEDFLAAIDKTIKYFNDGDIVEGTIVKVDRDE
VLLDIGYKTEGVIPARELSIKHDVDPNEVVSVGDEVEALVLTKEDKEGRL
ILSKKRAQYERAWGTIEALKEKDEAVKGTVIEVVKGGLILDIGLRGFLPA
SLVEMRRVRDLQPYIGKEIEAKIIELDKNRNNVVLSRRAWLEQTQSEVRS
EFLNNLQKGTIRKGVVSSIVNFGAFVDLGGVDGLVHVSELSWKHIDHPSE
VVQVGDEVTVEVLDVDMDRERVSLSLKATQEDPWRHFARTHAIGQIVPGK
VTKLVPFGAFVRVEEGIEGLVHISELAERHVEVPDQVVAVGDDAMVKVID
IDLERRRISLSLKQANEDYTEEFDPAKYGMADSYDEQGNYIFPEGFDAET
NEWLEGFEKQRAEWEARYAEAERRHKMHTAQMEKFAAAEAAGRGADDQSS
ASSAPSEKSAGGSLASDAQLAALREKLAGSA
433634679YP_007268306.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MREATMQEPAVDGWFATDEAGNPHLIGSKCPQCGTYVFPPRKNNCPNPAC
ESHTLESVALSRRGKLWSYTENRYAPPPPYPSPDPFEPFAVAAVELATEG
LIVLGKVVEGTLATDLKIGMEMELTTMPLFTDADGVERIVYGWRRA
433634677YP_007268304.1 Putative two-component system transcriptional regulator [MycobacterMTGPTTDADAAVPRRVLIAEDEALIRMDLAEMLREEGYEIVGEAGDGQEA
VELAELHKPDLVIMDVKMPRRDGIDAASEIASKRIAPIVVLTAFSQRDLV
ERARDAGAMAYLVKPFSISDLIPAIELAVSRFREITALEGEVATLSERLE
TRKLVERAKGLLQTKHGMTEPDAFKWIQRAAMDRRTTMKRVAEVVLETLD
TPAE
433634675YP_007268302.1 Conserved membrane protein of unknown function [Mycobacterium canetMCHTAPMEPSPVVSPLPRLLPHLWKSTLASGILSLILGVLVLAWPGISIL
VAAMAFGVYLLITGVAQVAFAFSLHVSAGGRILLFISGAASLILAVLAFR
HFGDAVLLLAIWIGIGFIFRGVATTVSAISDPMLPGRGWSIFVGVISLIA
GIVVMASPFESIWILALVVGIWLVVIGACEIASSFAIRKASQTLG
433634673YP_007268300.1 Putative integral membrane cytochrome D ubiquinol oxidase (Subunit MVLQELWFGVIAALFLGFFILEGFDFGVGMLMAPFAHVGMGDPETHRRTA
LNTIGPVWDGNEVWLITAGAAIFAAFPGWYATVFSALYLPLLAILFGMIL
RAVAIEWRGKIDDPKWRTGADFGIAAGSWLPALLWGVAFAILVRGLPVDA
NGHVALSIPDVLNAYTLLGGLATAGLFSLYGAVFIALKTSGPIRDDAYRF
AVWLSLPVTGLVAGFGLWTQLAYGKDWTWLVLAVAGCAQAAATVLVWRRL
SDGWAFTCTLIVVAAVVVLLFGALYPNLVPSTLNPQWSLTIHNASSTPYT
LKIMTWVTAFFAPLTVAYQTWTYWVFRQRISAERIPPPTGLARRAP
433634671YP_007268298.1 Putative component linked with the assembly of cytochrome transportMNRPSAVSRRQRDLLAASGLLRPRLPRILAAVALGVLSLGSALALAGVSA
WLITRAWQMPPVLDLSVAVVAVRAFAISRGVLHYCERLATHDTALRAAGR
ARTLIYHRLAHGPAAAAVGLHSGDLAARVGADVDELANMLVRALVPIAVA
AVLAVAASAVVAAVSVPAAVVLAVCLLVAGVVAPWLAGRTAAAQEAIARQ
HRGMRDTSAMIALEHAPELRVAGALRNVIADSQRRQHAWADALDAAARTG
AIAEAMPTAAIGASLLGAVVAGIGMAPTVAPTTLAILMLLPLSAFEATVA
LPAAAVQLTRSRIAAARLLDLTGSNRVRETESTVSARLPVGTGVLAADVC
CGHQEAQSIRVTIDLPPGARLAVTGASGAGKTTLLMTLAGLLPPVHGRVL
LDGTNLSDFDEDELRSAVSFFAEDAHIFATTVRDNLLTARGDCPDDELIE
ALDRVGLCGWLAGLPEGLSTVLIGGAQAVSAGQRRRLLLARAVLSPARIV
LLDEPVEHLDAPNADLLRDLLAPNSGIMSAMRTVVVATHHLPNDIQCAEL
SIATDQRCRRRGTNSSDNNTNASAKT
433634669YP_007268296.1 Putative acyl-CoA thioesterase II TesB1 [Mycobacterium canettii CIPMSDFDELLAVLDLNAVASDLFTGSHPSKNPLRTFGGQLMAQSFVASSRTL
TRHHLPPSAFSVHFINGGDTAKDIEFHVIRLRDERRFANRRVDAVQDGTL
LSSAMVSYMAGGRGLEHALDPPQVAEPHTRPPIGELLRGYEETVPHFVNA
LQPIEWRYANDPAWIMRDKGDRLAYNRVWVKALGEMPDDPVLHTATLLYS
SDTTVLDSVITTHGLSWGFDRIFAASANHSVWFHRQVNFDDWVLYSTSSP
VAADSRGLGSGHFFDRSGKLIATVVQEGVLKYFPATPDSAAGRSSDSGSA
RL
433634667YP_007268294.1 Conserved membrane protein of unknown function [Mycobacterium canetMEASGRQRRYAAAGSVVLLAGALGYIGLVDPHNSNSLYPPCPFKLLTGWN
CPACGGLRMIHDLLHGELAASINDNVFLLVGVPVLASWVLLRRRHGDLAL
PIPVMIAVAVAVIAWTVLRNLPGFPLVPTISG
433634665YP_007268292.1 Putative prolipoprotein diacylglyceryl transferases Lgt [MycobacterMRMLPSYIPSPPRGVWYLGPLPVRAYAVCVITGIIVALLIGDRRLTARGG
ERGMTYDIALWAVPFGLIGGRLYHLATDWRTYFGDGGAGLAAALRIWDGG
LGIWGAVTLGVMGAWIGCRRCGIPLPVLLDAVAPGVVLAQAIGRLGNYFN
QELYGRETTMPWGLEIFYRRDPSGFDVPNSLDGVSTGQVAFVVQPTFLYE
LIWNVLVFVALIYIDRRFIIGHGRLFGFYVAFYCAGRFCVELLRDDPATL
IAGIRINSFTSTFVFIGAVVYIILAPKGREAPGALRGSEYVVDEALEREP
AELAAAAVASAASAVGPVGPGEPNQPDDVAEAVKAEVAEVTDEVAAESVV
QVADRDGESTPAVEETSEADIEREQPGDLAGQAPAAHQVDAEAASAAPEE
PAALASEAHDETEPEVPEKAAPIPDPAKPDELAVAGPGDDPAEPDGIRRQ
DDFSSRRRRWWRLRRRRQ
433634663YP_007268290.1 Tryptophan synthase- beta subunit TrpB [Mycobacterium canettii CIPTMSAAIAEPTSHDPDSGGHFGGPSGWGGRYVPEALMAVIEEVTAAYQKERV
SQDFLDDLDRLQANYAGRPSPLYEATRLSQHAGLARIFLKREDLNHTGSH
KINNVLGQALLARRMGKTRVIAETGAGQHGVATATACALLGLDCVIYMGG
IDTARQALNVARMRLLGAEVVAVQTGSKTLKDAINEAFRDWVANADNTYY
CFGTAAGPHPFPTMVRDFQRIIGMEARVQIQGQAGRLPDAVVACVGGGSN
AIGIFHAFLDDPGVRLVGFEAAGDGVETGRHAATFTAGSPGAFHGSFSYL
LQDEDGQTIESHSISAGLDYPGVGPEHAWLKEAGRVDYRPITDSEAMDAF
GLLCRMEGIIPAIESAHAVAGALKLGVELGRGAVIVVNLSGRGDKDVETA
AKWFGLLGND
433634661YP_007268288.1 Conserved membrane protein of unknown function [Mycobacterium canetMAANAGSVRPNRRARPMIGIAQLLLVVAAGALWMAARLPWVVIGSFDELG
PPKEVTLTGASWSTALLPLALLMLAAAVAALAVRGWPLRALAVLLAAASF
AVGYLGISLWVVPDVAARGADLAHVPVVTLVGSARHYWGAVAAVLAAVCA
LLAAVFLMSSAAIRGSAGEDMARYAAPRARRSIARRQHSNAAGRAAPQDD
GPDMGPRMSERMIWEALDEGRDPTDREQESDTEGR
433634659YP_007268286.1 Putative peroxidoxin BcpB [Mycobacterium canettii CIPT 140070017]MKTGDTVADFELPDQTGTPRRLSVLLSDGPVVLFFYPAAMTPGCTKEACH
FRDLAKEFAEVRASRVGISTDPVRKQAKFAEARRFDYPLLSDAQGTVAAQ
FGVKRGLLGKLMPVKRTTFVIDTDRKVLDVISSEFSMDAHADKALATLRA
IRSG
433634657YP_007268284.1 Putative phosphoribosyl-AMP1-6 cyclohydrolase HisI [Mycobacterium cMTLDPKIAARLKRNADGLVTAVVQERGSGDVLMVAWMNDEALARTLQTRE
ATYYSRSRAERWVKGATSGHTQHVHSVRLDCDGDAVLLTVDQVGGACHTG
DHSCFDAAVLLEPDD
433634655YP_007268282.1 Putative inositol-monophosphatase ImpA (IMP) [Mycobacterium canettiMHLDSLVAPLVEQASAILDAATALFLAGHRADSAVRKKGNDFATEVDLAI
ERQVVAALVAATGIEVHGEEFGGPAVDSRWVWVLDPIDGTINYAAGSPLA
AILLGLLHDGVPVAGLTWMPFTDQRYTAVAGGPLIKNGVPQPPLADAELA
NALVGVGTFSADSRGQFPGRYRLAVLEKLSRVSSRLRMHGSTGIDLVFVA
DGILGGAISFGGHVWDHAAGVALVRAAGGVVTDLAGQPWTPASRSALAGP
PRVHAQILEILGSIGEPEDY
433634653YP_007268280.1 Putative imidazole glycerol phosphate synthase subunit HisH [MycobaMTGKSVVVLDYGSGNLRSAQRALQRVGAEVEVTADTDAAMTADGLVVPGV
GAFAACMAGLRKINGERIIAERVAAGRPVLGVCVGMQILFARGVEFGVQT
PGCGHWPGAVIRLEAPVIPHMGWNVVDSAAGSALFKGLDVDARFYFVHSY
AAQRWEGSPDALLTWATHRAPFLAAVEDGALAATQFHPEKSGDAGATVLS
NWVDGL
433634651YP_007268278.1 Putative histidinol-phosphate aminotransferase HisC1 [MycobacteriumMTRSGRRVTLDDLPLRADLRGKAPYGAPQLAVPVRLNTNENPHPPTRALV
DDVVRSVREAAIDLHRYPDRDAVALRADLAGYLTAQTGIQLGVENIWAAN
GSNEILQQLLQAFGGPGRSAIGFVPSYSMHPIISDGTHTEWIEASRANDF
GLDVDVAVAAVVDRKPDVVFVASPNNPSGQSVSLPDLCKLLDVAPGIAIV
DEAYGEFSSQPSAVSLVEEYPSKLVVTRTMSKAFAFAGGRLGYLIATPAV
IDAMLLVRLPYHLSSVTQAAARAALRHSDDTLSSVAALIAERERVTTSLN
DMGFRVIPSDANFVLFGEFADAPAAWRRYLEAGILIRDVGIPGYLRATTG
LAEENDAFLRASARIATDLVPVTRSPVGAP
433634649YP_007268276.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MSAKDHPNNAPGVPMVFPLWLERLQVKYINRALKPIARYLPGTATIEHRG
RKSGKPYQTIVTAYRKDGVLAIALAHGKTDWVKNVLAAGEADVHFARGVV
HVINPRIVPAGSDGQGLPRMARLQLRRIGVFVGDIA
433634647YP_007268274.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MARTFEDLVAEAASASVGGWDFSWLDGRATEERPSWGYQRQLSQRLANAT
AALDLETGGGEVLAGAGNFPPTMVATEAWPPNAAMATRRLHPLGAVVVIT
GDKPPLPFADAAFDLVTSRHPSTRWWTEIARVLRAGGGYFAQHVGPATLW
DLREHFLGPREHNGADQYAQVVRTCITDAGLEIVDLQMERLRVEFFDVGA
VIYFLRKVIWFLPDFTVEGYHDRLRALHERIQAEGPFVTYSTRALIEARK
PS
433634645YP_007268272.1 Putative L-aspartate oxidase NadB [Mycobacterium canettii CIPT 1400MAGPAWRDAADVVVIGTGVAGLAAALAADRAGRSVVVLSKAAQTHVTATH
YAQGGIAVVLPDNDDSVDAHVADTLAAGAGLCDPDAVYSIVADGYRAVTD
LVGAGARLDESVPGRWALTREGGHSRRRIVHAGGDATGAEVQRALQDAAG
MLDIRTGHVALRVLHDGTAVTGILVVRPDGCGIISAPSVILATGGLGHLY
SATTNPAGSTGDGIALGLWAGVAVSDLEFIQFHPTMLFAGRAGGRRPLIT
EAIRGEGAILVDRQGNSITAGVHPMGDLAPRDVVAAAIDARLKATGDPCV
YLDARGIEGFASRFPTVTASCRAAGIDPVRQPIPVVPGAHYSCGGIVTDV
YGQTELLGLYAAGEVARTGLHGANRLASNSLLEGLVVGGRAGKAAAAHAA
AAGRSRATPSATWPEPISYTALDRGDLQRAMSRDASMYRAAAGLHRLCDS
LSGAQVRDVACRRDFEDVALTLVAQSLTAAALARTESRGCHHRAEYPCTV
PEQARSIVVRGADDANAVCVQALVAVC
433634643YP_007268270.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MAHGSTAHEVLAVVFQVRGVGMSRGAAKPQLNVLLWQRAKEPQRGAWSLP
GGRLRNDEDMTSSVRRQLAEKVDLRELAHLEQLAVFSDPHRLPGIRMIAS
TYLGVVPSPATPELPADTRWHPVSSLPPMAFDHGPMVTHARTRLIAKMSY
TNIGFALAPKEFALSTLRDIYGAALGYQVDATNLQRVLARRRVITQTGTI
AQSGRSGGRPAALYRFTDSQLRVTDEFAALRPPGQL
433634641YP_007268268.1 Conserved membrane protein of unknown function [Mycobacterium canetMTEPPGFGGLSEPSGAPRTSRTRAVLFVMLGLSATGVLVGGLWAWIAPPI
HAVVAITRAGERVHEYLGSESQNFFIAPFMLLGLLSVLAVVASALMWQWR
EHRGPQMVAGLSIGLTTAAAIAAGVGALVVRLRYGALDFDTVPLSRGDHA
LTYVTQAPPVFFARRPLQIALTLMWPAGIASLVYALLAAGTARDDLGGYP
AVDPSSNARTEALETPQAPVS
433634639YP_007268266.1 Biotin synthase [Mycobacterium canettii CIPT 140070017]MTQAATRPTNDAGQDGGNNSDILVVARQQVLQRGEGLNQDQVLAVLQLPD
DRLEELLALAHEVRMRWCGPEVEVEGIISLKTGGCPEDCHFCSQSGLFAS
PVRSAWLDIPSLVEAAKQTAKSGATEFCIVAAVRGPDERLMAQVAAGIEA
IRNEVEINIACSLGMLTAEQVDQLAARGVHRYNHNLETARSFFANVVTTH
TWEERWQTLSMVRDAGMEVCCGGILGMGETLQQRAEFAAELAELGPDEVP
LNFLNPRPGTPFADLEVMPAGDALKAVAAFRLALPRTMLRFAGGREITLG
DLGAKRGILGGINAVIVGNYLTTLGRPAEADLELLDELQMPLKALNASL
433634637YP_007268264.1 Transposase (Part 2) [Mycobacterium canettii CIPT 140070017]MADSITWRRFCRIPLDGSVPHPTTLMKLTTRCGSAAIDGLNEALLAKAAE
AKLLRTNRIRADTTVVPANASYPTDSGLLAKAVRRIAATGKRIQAAGGAV
RTRVRDRSRAAGRRAHAAKLRSRAELGRDETRAAVLRFTGELAELAEAAA
QEAQHLLDNAKQVVRRAKAKAAALAARGERDAVAGRRRGRLVRAVNDLTE
LLNATRQIVAQTRQRVAGITPDGASRRVSLHDGDARPITKGRLGKPVEFG
QKAQVVDNDDGIVLDHTVQQGNPPDAPQLAPAVARVKKRAGRTPRTVTAD
RGYGEAAVDQQLTEVASRMW
433634635YP_007268262.1 Protein of unknown function [Mycobacterium canettii CIPT 140070017]MRKRISVSGYTEPPVDRLCVEGADLDQFVGEHAVSGPDPGAFETVDPAAV
PAVAAFEVADPAFASGPPFDGAAERFSVFFGAPILRGFAFARDHHILDAT
SVSCWSTAASP
433634633YP_007268260.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MHSIELVFDSDTEAAIRRIWAELAAAGIPSQAPASRPHVSLAVAERIAPE
VDDPLGAVARRLPLDCLIGAPVLFGRANVVFTRLVVPTSELLALHAEVHR
LCGPHLAPAPMANSLPGQWTAHVTLARRVGGHQLGRALRIAGRPPQIDGR
FAGLRRWDGDKRAEHLLG
433634631YP_007268258.1 8-amino-7-oxononanoate synthase BioF1 (AONS) (8-amino-7-ketopelargoMKAATQARIDDSPLAWLDAVQRQRREAGLRRCLRPRPAVATELDLASNDY
LGLSRHPAVIDGGVQALRIWGAGATGSRLVTGDTELHQQFEAELAEFVGA
AAGLLFSSGYTANMGAVVGLSGPGSLLVSDARSHASLVDACRLSRARVVV
TPHRDVNAVDVALRSRDEQRAVVVTDSVFSADGSLAPVRELLEVCRRHRA
LLLVDEAHGLGVRGGGRGLLYELGLAGAPDVVMTTTLSKALGSQGGVVLG
PTPVRAHLIDAARPFIFDTGLAPAAVGAALAALRVLRAEPWRPDVVLKHA
RELARICGVGAPDSAMVSVILGEPESAVAAAAACLDAGVKVGCFRPPTVP
AGTSRLRLTARASLNAGELELARRVLTDVLAVAHR
433634629YP_007268256.1 Conserved membrane protein of unknown function [Mycobacterium canetMVTMTSWPSRLFAFTDNVCPPDACPLVPFGVNYYIYPVMWGGIGAAIATA
VIGPFVSMLKGWYMSFWPIISIAVITLTSIAGYAIAGFSERYWH
433634627YP_007268254.1 Conserved membrane protein of unknown function [Mycobacterium canetMLTLSPPRPPALTPEPALPPVTMGTRTTGFYRHDLDGLRGVAIALVAVFH
VWFGRVSGGVDVFLALSGFFFGGKILRAALNPDLSLSPIAEVIRLIRRLL
PALVVVLAGCALLTIAIQPQTRWEAFANQSLASLGYYQNWELASTVSNYL
RAGEAVSPLQHIWSMSVQGQFYLAFLLLVAGCAYLLRGLFRGPRAPYLRT
MFVVLLSTLTLASFIYAIVAHHAYQATAYYNTFARAWELLAGALVGAVVP
YVRWPMWLRTAVATAALAAILSCGALIDGVKEFPGPWALVPVGATMLMIL
AGANRQGHPGTRDRLPLPNRLLATAPLVALGAMAYSWYLWHWPLLIFWLS
YTGHRHANFVEGAAVLLVSGLLAYLTTRLVEDPLRYRAPAGVRSPAAVPP
IPWRLRLRRPTIVLGSVVALLGVALTATSFTWREHVIVQRAAGKELSGLS
SRDYPGARALIDHVRVPKLRMRPTVLEVRHDLPTSTKDGCISDFVNPAII
NCTYGDVDAPRTIALAGGSHAEHWLTALDLLGRMHHFKVVTYLKMGCPLS
TEEVPLIMGNNAPYPQCHQWVQAAMAKLVADHPDYVFTTSTRPWNIKPGD
VMPATYVGIWQTFADNNIPVLAMRDTPWLVKDGQPFIPADCLAKGGNPQS
CGIARSKVLVDRNPTLDFVARFPLLKPLDMSDAICRTDTCRAVEGNVLVY
RDSHHLTPTYMRTMTSELGRQIAANTGWW
433634625YP_007268252.1 Maltooligosyltrehalose synthase TreY [Mycobacterium canettii CIPT 1MAFPVISTYRVQMRGPSSGFGFTFADAENLLDYLDDLGVSHLYLSPILTA
VSGSTHGYDVTDPTTVSPELGGSDGLARLSAAARSRGMGLIVDIVPSHVG
VGKPDQNAWWWDVLKFGRSSAYAEFFDIDWELGDGRIILPLLGSDSDVAN
LRVDGDLLRLGDLALPVAPGSGDGTGPAVHDRQHYRLVGWRHGLCGYRRF
FSITSLAGLRQEDRAVFDASHAEVARWFTEGLVDGVRIDHLDGLSDPSGY
LAQLRELLGPNAWIVVEKILAVDEALEPTLPVDGSTGYDVLREIGGVLVD
PQGESPLTALVESAGVDYQEMPAMLADLKVHAAVHTLASELRRLRRCIAA
AAGADHPLLPAALAALVSHIGTYRCDYPGQAAVLPCALAETHSTTPQLAP
GLQLIAAAVARGGEPDVRLQQLCGAVSAKAVEDCMFYRDARLVSLNEVGG
EPRRFGVGAAEFHHRAATRARLWPRSMTTLSTHDTKRGEDVRARIGVLSQ
VPWLWAKFIGHAQAIAPAPDAVTGQFLWQNVFGVWPVSGEVSAALRGRLH
TYAEKAIREAAWHTSWHNPNRAFEDDVHGWLDLVLDGPLASELTGLVAHL
NSHAESDALAAKLLALTVPGVPDVYQGSELWDDSLVDPDNRRPVDYGTRR
VALKALQQPKIRVLAAALRLRRTHPESFLGGAYHPVFAAGPAADHVVAFR
RGDDILVAVTRWTVRLQQTGWDHTVLPLPDGSWTDALTGFTASGHTPAVE
LFADLPVVLLVRDNA
433634623YP_007268250.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MILIDTSAWVEYFRATGSIAAVEVRRLLSEEAARIAMCEPIAMEILSGAL
DDNTHTTLERLVNGLPSLNVDDAIDFRAAAGIYRAARRAGETVRSINDCF
IAALAIRHGARIVHRDADFDVIARITSLQAASFR
433634621YP_007268248.1 Putative threonine dehydratase IlvA [Mycobacterium canettii CIPT 14MSAELSQSPSSSPLFSLSGADIDRAAKRIAPVVTPTPLQPSDRLSAITGA
TVYLKREDLQTVRSYKLRGAYNLLVQLSDEELAAGVVCSSAGNHAQGFAY
ACRCLGVHGRVYVPAKTPKQKRDRIRYHGGEFIDLIVGGSTYDLAAAAAL
EDVERTGATLVPPFDDLRTIAGQGTIAVEVLGQLEDEPDLVVVPVGGGGC
IAGITTYLAERTTNTAVLGVEPAGAAAMMAALAAGEPVTLEHVDQFVDGA
AVNRAGTLTYAALAAAGDMVSLTTVDEGAVCTAMLDLYQNEGIIAEPAGA
LSVAGLLEADIEPGSTVVCLISGGNNDVSRYGEVLERSLVHLGLKHYFLV
DFPQEPGALRRFLDDVLGPNDDITLFEYVKRNNRETGEALVGIELGSAAD
LDGLLARMRATDIHVEALEPGSPAYRYLL
433634619YP_007268246.1 Conserved transmembrane transport protein MmpL2 [Mycobacterium caneMSNHHRPRPWLPHTIRRLSLPILLFWVGVAAITNAAVPQLEVVGEANNVA
QSSPDAPSLQAMKRIGKVFHEFDSDSAAMIVLEGDKPLGNDAHRFYDTLL
RNLSNDTKHVEHVQDFWGDPLTAAGSQSTDGKAAYVQVYLAGNQGEALSI
ESVDAVRDIVAHTPPPAGVKAYVTGAAPLMADQFQVGSKGTAKVTGITLV
VIAVMLLFVYRSVVTMVLVLITVLIELAAARGIVAFLGNAGVIGLSTYST
NLLTLLVIAAGTDYAIFVLGRYHEARYAAQDRETAFYTMYRGTAHVVLGS
GLTVAGAVYCLSFTRLPYFQSLGIPASIGVMIALAAALSLAPSVLILGSR
FGCFEPKRRMRTRGWRRIGTAIVRWPGPILAVACAIAVVGLLALPGYKTS
YDARHYMPATAPANIGYMAAERHFPQARLNPELLMIETDHDMRNPADMLI
LDRIAKAVFHLPGIGLVQAMTRPLGTPIDHSSIPFQISMQSVGQIQNLKY
QRDRAADLLKQAEELGKTIEILQRQYALQQELAAATHEQAESFHQTIATV
NELRDRIANFDDFFRPIRSYFYWEKHCYDIPSCWALRSVFDTIDGIDQLG
EQLASVTVTLDKLAAIQPQLVALLPDQIASQQINRELALANYATMSGIYA
QTAALIENAAAMGQAFDAAKNDDSFYLPPEAFDNPDFQRGLKLFLSADGK
AARMIISHEGDPATPEGISHIDAIKQAAHEAVKGTPMAGAGIYLAGTAAT
FKDIQDGATYDLLIAGIAALSLILLIMMIITRSLVAALVIVGTVALSLGA
SFGLSVLVWQHLLGIQLYWIVLALAVILLLAVGSDYNLLLISRFKEEIGA
GLNTGIIRAMAGTGGVVTAAGLVFAATMSSFVFSDLRVLGQIGTTIGLGL
LFDTLVVRAFMTPSIAVLLGRWFWWPQRVRPRPASRMLRPYGPRPVVREL
LLREGNDDPRTQVATHR
433634617YP_007268244.1 Putative transcriptional regulatory protein [Mycobacterium canettiiMVGAVTQIADRPTDPSPWSPRETELLAVTLRLLQEHGYDRLTVDAVAASA
RASKATVYRRWPSKAELVLAAFIEGIRQVAVPPNTGNLRDDLLRLGELIC
REVGQHASTIRAVLVEVSRNPALNDVLQHQFVDHRKALIQYILQQAVDRG
EISSAAISDELWDLLPGYLIFRSIIPNRPPTHDTVQALVDDVILPSLTRS
TG
433634615YP_007268242.1 Putative fumarate reductase [membrane anchor subunit] FrdC (fumaratMTAYRQPVERYWWARRRSYLLFMLREISCIFVAWFVLYLVLVLRAVGAGG
NSYQRFLDFSANPVVVVLNVVALSSLLLHAVTWFGSAPRAMVIQVRGRRV
PARAVRAGHYAAWLVVSVIVAWMVLS
433634613YP_007268240.1 Putative fumarate reductase [flavoprotein subunit] FrdA (fumarate dMTAQHNIVVIGGGGAGLRAAIAIAETDPHLDVAIVSKVYPMRSHTVSAEG
GAAAVTGDDDSLDEHAHDTVSGGDWLCDQDAVEAFVAEAPKELVQLEHWG
CPWSRKPDGRVAVRPFGGMKKLRTWFAADKTGFHLLHTLFQRLLTYSDVM
RYDEWFATTLLVDDGRVCGLVAIELATGRIETILADAVILCTGGCGRVFP
FTTNANIKTGDGMALAFRAGAPLKDMEFVQYHPTGLPFTGILITEAARAE
GGWLLNKDGYRYLQDYDLGKPTPEPRLRSMELGPRDRLSQAFVHEHNKGR
TVDTPYGPVVYLDLRHLGADLIDAKLPFVRELCRDYQHIDPVVELVPVRP
VVHYMMGGVHTDINGATTLPGLYAAGETACVSINGANRLGSNSLPELLVF
GARAGRAAADYAARHQKSDGGPSSAVRAQARTEALRLERELSRHGQGGER
IADIRADMQATLESAAGIYRDGPTLTKAVEEIRVLQERFATAGIDDHSRT
FNTELTALLELSGMLDVALAIVESGLRREESRGAHQRTDFPNRDDEHFLA
HTLVHRESDGTLRVGYLPVTITRWPPGERVYGR
433634611YP_007268238.1 Putative FadD-like fatty-acid-CoA ligase [Mycobacterium canettii CIMTTTERPTTMCEAFQRTAVMDPDAVALRTPGGNQTMTWRDYAAQVRRVAA
GLAGLGVRRGDTVSLMMANRIEFYPLDVGAQHVGATSFSVYNTLPAEQLT
YVFDNAGTKVVICEQQYVDRVRASGVPIEHIVCVDGAPPGTLSLTDLYAA
ASGDFFDFESTWRAVQPEDIVTLIYTSGTTGNPKGVEMTHANLLFEGYAI
DEVLGIRFGDRVTSFLPSAHIADRMTGLYLQEMFGTQVTAVADARTIAAA
LPDVRPTVWGAVPRVWEKLKAGIEFTVARETDEMKRQALAWAMSVAGKRA
NALLAGEPMSDQLVAEWAKADELVLSKLRERLGFGELRWALSGAAPIPKE
TLAFFAGIGIPIAEIWGMSELSCVATASHPRDGRLGTVGKLLPGLQGKLA
EDGEYLVRGPLVMKGYRKEPAKTAEAIDSDGWLHTGDVFDIDSDGYLRVV
DRKKELIINAAGKNMSPANIENTILAACPMVGVMMAIGDGRPYNTALLVF
DADSLGPYAAQRGLDASPAALAADPEVIARIAAGVAEGNAKLSRVEQIKR
FRILPTLWEPGGDEITLTMKLKRRRIAAKYSAEIEELYASELRPQVYEPA
AVPSTQPA
433634609YP_007268236.1 Putative DNA polymerase III (alpha chain) DnaE1 (DNA nucleotidyltraMSGSSAGSSFVHLHNHTEYSMLDGAAKITPMLAEVERLGMPAVGMTDHGN
MFGASEFYNSATKAGIKPIIGVEAYIAPGSRFDTRRILWGDPSQKADDVS
GSGSYTHLTMMAENATGLRNLFKLSSHASFEGQLSKWSRMDAELIAEHAE
GIIITTGCPSGEVQTRLRLGQDREALEAAAKWREIVGPDNYFLELMDHGL
TIERRVRDGLLEIGRALNIPPLATNDCHYVTRDAAHNHEALLCVQTGKTL
SDPNRFKFDGDGYYLKSAAEMRQIWDDEVPGACDSTLLIAERVQSYADVW
TPRDRMPVFPVPDGHDQASWLRHEVDAGLSRRFPAGPPDGYRERAAYEID
VICSKGFPSYFLIVADLISYARSAGIRVGPGRGSAAGSLVAYALGITDID
PIPHGLLFERFLNPERTSMPDIDIDFDDRRRGEMVRYAADKWGHDRVAQV
ITFGTIKTKAALKDSARIHYGQPGFAIADRITKALPPAIMAKDIPLSGIT
DPSHERYKEAAEVRGLIETDPDVRTIYQTARGLEGLIRNAGVHACAVIMS
SEPLTEAIPLWKRPQDGAIITGWDYPACEAIGLLKMDFLGLRNLTIIGDA
IDNVRANRGIDLDLESVPLDDKATYELLGRGDTLGVFQLDGGPMRDLLRR
MQPTGFEDVVAVIALYRPGPMGMNAHNDYADRKNNRQAIKPIHPELEEPL
REILAETYGLIVYQEQIMRIAQKVASYSLARADILRKAMGKKKREVLEKE
FEGFSDGMQANGFSPAAIKALWDTILPFADYAFNKSHAAGYGMVSYWTAY
LKANYPAEYMAGLLTSVGDDKDKAAVYLADCRKLGITVLPPDVNESGLNF
ASVGQDIRYGLGAVRNVGATVVGSLLQTRSDKGKFTGFSDYLNKIDISAC
TKKVTESLIKAGAFDSLGHARKGLFLVHSDAVDSVLGTKKAEAMGQFDLF
GGNDEGTGTPDPVFTIRVPDDEWEAKHKLALEREMLGLYVSGHPLNGVAH
LLASQVDTAIPAILDGDVPNDAQVRVGGILASVNRRVNKNGIPWASAQLE
DLTGGIEVMFFPHTYSSYGAEIIDDAVVLVNAKVAVRDDRIALIANDLIV
PDLSTAQVDRPLAVSLPTRQCTFDKVSALKQVLVRHPGTSQVHLRLISGD
RITTLALDQSLRVTPSPALMGDLKELLGPGCLGS
433634607YP_007268234.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MYGLQLAHESPCCQMHNLPSSARQVTVACREEVGITTILAGRDECGVCDK
TAGLDGAAP
433634605YP_007268232.1 Putative fatty acyl-CoA reductase [Mycobacterium canettii CIPT 1400MNLGDLTNFVEKPLAAVSNIVNTPNSAGRYRPFYLRNLLDAVQGRNLNDA
VKGKVVLITGGSSGIGAAAAKKIAEAGGTVVLVARTLENLENVANDIRAI
RGNGGTAHVYPCDLSDMDAIAVMADQVLGDLGGVDILINNAGRSIRRSLE
LSYDRIHDYQRTMQLNYLGAVQLILKFIPGMRERHFGHIVNVSSVGVQTR
APRFGAYIASKAALDSLCDALQAETVHDNVRFTTVHMALVRTPMISPTTI
YDKFPTLTPDQAAGVITDAIVHRPRRASSPFGQFAAVADAVNPAVMDRVR
NRAFNMFGDSSAAKGSESQTDTSELDKRSETFVRATRGIHW
433634603YP_007268230.1 Conserved lipoprotein of unknown function- LprI [Mycobacterium caneMRWIGVLVTALVLSACAANPPANTTSPTAGQSLDCTKPATIVQQLVCHDR
QLTSLDHRLSTAYQQALAHRRSAALEAAQSSWTMLRDACAQDTDPRTCVQ
EAYQTRLVQLAIADPATATPPVLTYRCPTQDGPLTAQFYNQFDPKTAVLN
WKGDQVIVFVELSGSGARYGRQGIEYWEHQGEVRLDFHGAKFVCRTS
433634601YP_007268228.1 Putative lipoprotein signal peptidase LspA [Mycobacterium canettii MPDEPTGSADPLTSTEEAGGAGEPNAPAPPRRLRMLLSVAVVVLTLDIVT
KVVAVQLLPPGQPVSIIGDTVTWTLVRNSGAAFSMATGYTWVLTLIATGV
VVGIFWMGRRLVSPWWALGLGMILGGAMGNLVDRFFRAPGPLRGHVVDFL
SVGWWPVFNVADPSVVGGAILLVILSIFGFDFDTVGRRHADGDNVGRRHA
DGDTVGRRKADG
433634599YP_007268226.1 DNA polymerase IV DinX (POL IV 1) (DNA nucleotidyltransferase (DNA-MESRWVLHLDMDAFFASVEQLTRPTLRGRPVLVGGLGGRGVVAGASYEAR
AYGARSAMPMHQARRLIGVTAVVLPPRGVVYGIASRRVFDTVRGLVPLVE
QLSFDEAFAEPPQLAGAVAEDVETFCERLRRRVRDETGLIASVGAGSGKQ
IAKIASGLAKPDGIRVVRHAEEQALLSGLPVRRLWGIGPVAEEKLHRLGI
ETIGQLAALSDAEAANILGATIGPALHRLARGIDDRPVVERAEAKQISAE
STFAVDLTTMEQLQEAIDSIAEHAHQRLLRDGRGARTITVKLKKSDMSTL
TRSATMPYPTTDAGALFTVARRLLPDPLQIGPIRLLGVGFSGLSDIRQES
LFADSDLTQETAAAHYVETPGAVVPAAHDATMWRVGDDVAHPKLGHGWVQ
GAGHGVVTVRFETRGSGPGPARTFPVDTGDISNASPLDSLDWPDYIGQLS
VEGAAGASAPTVDDVGDR
433634597YP_007268224.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MTAALHNDVVTVASAPKLRVVRDVPPAPASKKVARRLDAQPFGTGGDPLV
DGAARLLSIPLRHLYAALWRVGLLEVQA
433634595YP_007268222.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MRTRVAELLGAEFPICAFSHCRDVVAAVSNAGGFGILGAVAHSPKRLESE
LTWIEEHTGGKPYGVDVLLPPKYIGAEQGGIDAQQARELLPEGHRTFVDD
LLVRYGIPAVTDRQRSSSAGGLHISPKGYQPLLDVAFAHDIRLIASALGP
PPPDLVERAHNHDVLVAALAGTAQHARRHAAAGVDLIVAQGTEAGGHTGE
VATMVLVPEVVDAVSPTPVLAAGGIARGRQIAAALALGAEGVWCGSVWLT
TEEAETPPVVKDKFLAATSSDTVRSRSLTGKPARMLRTAWTDEWDRPDSP
DPLGMPLQSALVSDPQLRINQAAGQPGAKARELATYFVGQVVGSLDRVRP
ARSVVLDMVEEFIDTVGQLQALVQR
433634593YP_007268220.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MTTSRVPLLPVDEAKAAADEAGVPDYMAELSIFQVLLNHPRLARTFNDLL
ATMLWHGTLDSRLRELVIMRIGWLTDCDYEWTQHWRVASGLGVSADDLLG
VRDWQGYNGFGPAEQAVLAATDDVVREGAVSAQSWSACERELHCDKVVLI
ELVTVISAWRMVASILHSLEVPLEDGVSSWPPDGLSPR
433634591YP_007268218.1 Putative fatty-acid-CoA ligase FadD24 (fatty-acid-CoA synthetase) (MVASSIPTALRERASVHPNGAAITYIDYEQDWAGVAETLTWSQLYRRMLN
VAEPLRHVGATGDRAVILAPQGIEYVVGFLGALQAGRIAVPLPVPHAGAH
DERTISVLSDTSPAVILTTSGAVDDVRECAQPQPGQSAPSIVELDLLDLD
SRQRSRSPGARPTGRDTPETAYLQYTSGSTRTPAGVMVSNKNVFANFEQI
VADFFAPEGGVVPPDLTVVSWLPLYHDMGLLLGAIMPILAGVPTVLTSPV
GFLQRPARWIQLLARNGRTISAGPNFAFELAVRKTSDDDMDGLDLAGVHT
ILNGSERVHPATLKRFAERFGRFNFAAEALRPAYGMAEATVYIATRNVNE
PPEIVDFESEKLPAGQAIRCPSGSGTPLVSYGVPQSQLVRIVDPDTCIEC
PQGSVGEIWVQGGNVASGYWHKPEESKRTFGARIVTPSEGTPEAPWLRTG
DSGFVSGGELFIIGRIKDLLIVYGRNHAPDDIEATIQEITAGRCAAIAVP
DNGTEKLVAIIELKKRGDSDEDVADRLRIVKRDVAGAIFDSHGLSVADLV
LVSPGSIPITTSGKIRRAQCVQLYRRREFTRLDA
433634589YP_007268216.1 Putative glycosyltransferase [Mycobacterium canettii CIPT 140070017MKFVLAVHGTRGDVEPCAAVGVELRRRGHAVHMAVPPNLIEFVESAGLTG
VAYGPDSDEQINTVAAFVRNLTKAQNPLNLARAVKELFVEGWAEMGTTLT
TLADGADLVMTGQTYHGVAANVAEYYDIPAAALHHFPMQVNGQIAIPSIP
TPATLVRATMKVSWRLYAYVSKDADRAQRRELGLPPAPAPAVRRLVERGA
PEIQAYDPVFFPGLAAEWSDRRPFVGPLTMELHSEPNEELESWIAAGTPP
IYFGFGSTPVQTPVQTLAMISDVCAQLGERALIYSPAANSTRIRHADHVK
RVGLVNYSTILPKCRAVVHHGGAGTTAAGLRAGMPTLILWDVADQPIWAG
AVQRLKVGSAKRFTNITRRSLLKELRSILAPECAARAREISTRMTRPAAA
VTAAADLLEATARQTPGSTPSSSPGR
433634587YP_007268214.1 Putative glycosyltransferase [Mycobacterium canettii CIPT 140070017MKFVVASYGTRGDIEPCAAVGLELQRRGHDVCLAVPPNLIGFVETAGLSA
VAYGNRDSQEQLDEQFLHNAWKLQNPIKLLREAMAPVTEGWAELSAMLTP
VAAGADLLLTGQIYQEVVANVAEHHGIPLAALHFYPVRANGEIAFPARLP
APLVRSTITAIDWLYWRMTKGVEDAQRRELGLPKASTPAPRRMAARGSLE
IQAYDALCFPGLAAEWGGRRPFVGALTMESATDADDEVASWIAAGTPPIY
FGFGSMPIGSLADRVAMISAACAELGERALICSGPSDATGIPQFDHVKVV
RVVSHAAVFPTCRAVVHHGGAGTTAAGLRAGIPTLILWVTSDQPIWAAQI
KQLKVGRGRRFSSATKESLVADLRTILAPDYAARAREIASRMTQPAASVT
ATADLLEDAAHGGR
433634585YP_007268212.1 Putative conserved transmembrane transport protein MmpL12 [MycobactMARHDEAKAGGFFDRIGNFVVRWPLIVIGCWIAVAAALTLLLPTLQAQAA
KREQAPLPPGAPSMVLQKEMGAAFQEKIEASALLLVLLTNENGLGPADEA
VYRKLIENLRADTQDKISVQDFLAVPEMKELLASKDNKAWNLPITFAGDA
ASPETQAAFKRVAAIVKQTVAGTSLTVHLSGPIATVADLTELGEKDVRII
EIGTAVSVLIILILVYRNVVTMLVPLVTIGASVVTAQGTLSGLAEFGLAV
NMQAIVFMSAVMIGAGTDYAVFLISRYHDYVRHGEKSDVAVKKALMSIGK
VITASAATVAVTFLAMVFTKLEVFSAVGPAIAVAITVSLLGAITLLPAIL
TLTGRRGWIKPRRDLTSRMWRRSGVRIVRRPTIHLVGSLIVLIALAGCTL
LIRFNYDDLKTVPQHVESVKGYEAMNRHFPMNAMTPMVLFIKSPRDLRTP
GALADIEMMSREIAELPNIVMVRGLTRPNGEPLKETKVSFQAGEVGGKLD
EATTLLEEHGGELDQLTGGAHQLADALAQIRNEINGAVASSSGIVNTLQA
MMDLMGGDKTIRQLENASQYVGRMRALGDNLSGTVTDAEQIATWASPMVN
ALNSSPVCNSDPACRTSRAQLAAIVQAQDDGLLRSMRALAVTLQQTQEYQ
TLARTVSTLDGQLKQVVSTLKAVDGLPTKLAQMQQGANALADGSAALAAG
VQELVDQVKKMGSGLNEAADFLLGIKRDADKPSMAGFNIPPQIFSRDEFK
KGAQIFLSADGHAARYFVQSALNPATTEAMDQVNDILRVADSARPNTELE
DATIGLAGVPTALRDIRDYYNSDMKFIVIATIVIVFLILVILLRALVAPI
YLIGSVLISYLSALGIGTLVFQLILGQEMHWSLPGLSFILLVAIGADYNM
LLISRIRDESPHGIRIGVIRTVGSTGGVITSAGLIFAASMFGLVGASINT
MAQAGFTIGIGIVLDTFLVRTVTVPALTTMIGRANWWPSELGRDPSMPPT
KADRWLRRMKGHRRKAPIPAPNPPHTKVVRNTNGHASKVATKPVPNGKPA
DLAEGNSDYLIDHLRRHSLPLFGYAAMPAYDVVDGVSKPNGDGAHIGKEP
VDHLLGHSLPLFGLAGLPSYDRWDDTSIGEPAVGHAGSKPDAKLST
433634583YP_007268210.1 Putative sugar transferase [Mycobacterium canettii CIPT 140070017]MSIVSISYNQEEYIREALDGFAAQRTEFPVEVIIADDASTDATPRIIGEY
ADRYPQLFRPILRQTNIGVHANFKDVLSAARGEYLALCEGDDYWTDPLKL
SKQVEYLDRHPETTVCFHPVRVIYEDGAKDSEFPPLSWRRDLSVDALLAR
NFIQTNSVVYRRQPSYDDIPANVMPIDWYLHVRHAVGGEIAMLPETMAVY
RRHAHGIWHSAYTDRRKFWETRGHGMAATLEAMLDLVHGHREREAIVGEV
SAWVLREIGKTPGRQGRALLLKSIADHPRMTMLSLQHRWAQTPWRRFKRR
LSTELSSLAALAYAYSARFKRHMGSATR
433634581YP_007268208.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MPGDASSVVSVNPAKPPISVCVPMYNNGATIERCLRSILEQQGVEFEIVV
VDDDSSDDCAAIAATMLRPGDRLLRNEPRLGLNRNHNKCLEVARGGLIQF
VHGDDRLLPGALQTLSRCFEDPSVGMAFAPRRVESDDIKWQQRYGRVHTR
FRKLRDRNHGPSLVLQMVLHGAKDNWIGEPTAVMFRRQLALDAGGFRTDI
YQLVDVDFWLRLMLRSAVCFVPHELSVRGHTPATETTRVMATRRNVLDRQ
RILTWLIVDPASPNSVRSAAALWWIPAWLAMIVEVAVFGPRRRMHLKALA
PAPFREFAHARRQLPMAD
433634579YP_007268206.1 Putative sugar transferase [Mycobacterium canettii CIPT 140070017]MSPKACPKVSIVSTTHNQAGYARQAFDSFLAQQTDFPVEIIVADDASTDA
TPAIIREYAERYPHVFRPIFRTENLGLNGNLTGALSAARGEYVALCEADD
YWIDPLKLSKQVAFLDRHPKTAVCFHPVRVIWEDGHAKDSTFPPVRVRGN
LSLDALILMNFIQTNSAVYRRLERYDDIPADVMPLDWYLHVRHAVHGDIA
MLPDTMAVYRRHAQGMWHNQVVDPPKFWLTQGPGHAATFDAMLDLFPGDP
AREELIAVMADWILRQIANVPGPEGRAALQDTIARHPRIAMLALQHRAAT
PARRLRTQWRKLAAATPSRRGLVDVWPSRLRRGRRA
433634577YP_007268204.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MTSAPTVSVITISFNDLDGLQRTVKSVRAQRYRGRIEHIVIDGGSGDDVV
AYLSGCEPGFAYWQSEPDGGRYDAMNQGIAHASGDLLWFLHSADRFSGPD
VVAQAVEALSGKGPVSELWGFGMDRLVGLDRVRGPIPFSLRKFLAGKQVV
PHQASFFGSSLVAKIGGYDLDFGIAADQEFILRAALVREPVTIRCVLCEF
DTTGVGSHREPSAVFGDLRRMGDLHRRYPFGGRRISHAYLRGREFYAYNS
RFWENVFTRMSK
433634575YP_007268202.1 Putative nucleotide-sugar epimerase EpiA [Mycobacterium canettii CIMNAHTSVGPLDRAAGVYIAGHRGLVGSALLRTFAGAGFTNLLVRSRAELD
LTDRAATFDFVLESRPQVVIDAAARVGGILANDTYPADFLSENLQIQVNL
LDAAVAARVPRLLFLGSSCIYPKLAPQPIPESALLTGPLEPTNDAYAIAK
IAGILAVQAVRRQHGLPWISAMPTNLYGPGDNFSPSGSHLLPALIRRYDE
AKASGAPNVTNWGTGTPRRELLHVDDLASACLYLLEHFDGPTHVNVGTGI
DHTIGEIAEMVASAVGYSGETRWDPSKPDGTPRKLLDVSVLREAGWRPSI
ALRDGIEATVAWYREHAGTVRQ
433634573YP_007268200.1 Conserved membrane protein of unknown function [Mycobacterium canetMYERRHGRGMCDRAVEMTDVGATAAPTGPIARGSVARVGAATALAVACVY
TVIYLAARDLPPACFSIFAVFWGALGIATGATHGLLQETTREVRWVRSTE
MVAGHRTHPLRVAGMIGTVAAVAIAGSSPLWSRQLFVEGRWLSVGLLSVG
VAGFCAQATLLGALAGVDRWTQYGALMVTDAVIRLAVAAAAVVIGWGLAG
YLWAATAGAVAWLLMLMASPTARSAASLLTPGGIATFVRGAAHSITAAGA
SAILVMGFPVLLKVTSDQLGAKGGAVILAVTLTRAPLLVPLSAMQGNLIA
HFVDRRTQRLRALIAPALVVGGIGAVGMLAAGLTGPWLLRVGFGPDYQTG
GALLAWLTAAAVAIAMLTLTGAAAVAAALHRAYLLGWVSATVASTLLLLL
PMLLETRTVIALLFGPTVGIAIHVAALAQRPD
433634571YP_007268198.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MKRALITGITGPDGSYLAKLPLKGYVAAGSAAEVYFCWATRNYRELYGLL
AVNSIWFNHESPCHGETFMTRNPAPHRGRQRGADRCADADAPAHPDRYQY
WGVPASERGVIDRAMGVCVE
433634569YP_007268196.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MQSDQNILAKVCNLIEQSRLSSTRCLQFRITNIRITNTSRPRQLRWSEFK
RFWDIFNMVLGKARMGRDPGRPVRDERRIVSYEIIASDHIGLAAARLLAK
RYRGRSVSGLVLMIKSASVHEIDSWSSPSVAISIGVALCSYPHYAAASIS
PPNRDWGENTTRSRPVTGLLAG
433634567YP_007268194.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MRIVNAADPFSINDLGCGYGALLDYLDARGFKTDYTGIDVSPEMVRAAAL
RFEGRANADFICAARIDREADYSVASGIFNVRLKSLDTEWCAHIEATLDM
LNAASRRGFSFNCLTSYSDASKMRDDLYYADPCALFDLCKRRYSKSVALL
HDYGLYEFTILVRKAS
433634565YP_007268192.1 Lipopolysaccharide biosynthesis protein RffA [Mycobacterium canettiMSDHKVPFNRPYMTGRELAYIAEAHSCGHLAGDGPFTRRSHAWLEQQTGC
RKALLTPSCTAALEMMALLLDIEEGDEVILPSYTFVSTANAFVLRGGVPV
FVDIRPDTLNIDETRIVDAITPRTKAIVPVHYAGVACEMDAIMKIATHHN
LAVVEDAAQGAMASYRGRALGSIGDLGALSFHETKNVISGEGGALLVNSE
DFLLRAEILREKGTNRSRFLRNEVDKYTWQDKGSSYLPSELVAAFLWAQF
EEAERITRIRLDLWNRYHESFESLEQRGLLRRPIIPQGCSHNAHMYYVLL
APSADREEVLARLTSEGIGAVFHYVPLHDSPAGRRYGRTNGNLTVTNDVA
SRLIRLPMWVGLQEVDQSRVVEALTRILTLRA
433634563YP_007268190.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MIPAKVENNTSLEQVQDALNCVGYAVVEDVLDEASLVATRDRMYRVQERI
LTEIGKERLARAGELGVLRLMMKYDPHFFTFLEIPEVLSIVDRVLSETAI
LHLQNGFILPSFPPFSTPDVFQNAFHQDFPRVLSGYIASVNIMFAIDPFT
RDTGATLVVPGSHQRIEKPDHTYLARNAVPVECAAGSLFVFDSTLWHAAG
RNTSGKDRLAINHQFTRSFFKQQIDYVRALGDAVVLEQPARTQQLLGWYS
RVVTNLDEYYQPPDKRLYRKGQG
433634561YP_007268188.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MSNHTYRVIEIVGTSPDGVDAAIQGGLARAAQTMRALDWFEVQSIRGHLV
DGAVAHFQVTMKVGFRLEDS
433634559YP_007268186.1 Esterase LipL [Mycobacterium canettii CIPT 140070017]MMVDTGVHHRAVSSHDGPDAGRRVFGAADPRFACVVRAFASMFPGRRFGG
GALAVYLDGRPVVDVWKGWADRAGWVPWSADSAPMVFSATKGMTATVIHR
LADRGLIDYEAPVAEYWPAFGANGKATLTVRDVMRHQAGLSGLRGATQQD
LLDHVVMEERLAAAAPGRLLGKSAYHALTFGWLMSGLARAVTGKDMRLLF
REELAEPLDTDGLHLGRPPADAPTRVAEIIMPQDIAANAVLTCAMRRLAH
RFSGGFRSMYFPGAIAAVQGEAPLLDAEIPAANGVATARALARMYGAIAN
GGEIDGIRFLSRELVAGLTRNRRQVLPDRNLLVPLNFHLGYHGMPIGNVM
PGFGHVGLGGSIGWTDPETGVAFALVHNRLLSPLVMTDHAGFVGIYHLIR
QAAAQARKRGYQPVTPFGAPYSEPGAAAG
433634557YP_007268184.1 Conserved protein of unknown function- putative toxin MazF4 [MycobaMNAPLRGQVYRCDLGHGAKPWLIVSNNARNRHTADVVAVRLTTTRRTIPT
WVAMGPSDPLTGYVNADNIETLGKDELGDYLGAVTPATMSKINTALATAL
GLPWP
433634555YP_007268182.1 Putative methylmalonyl-CoA mutase large subunit MutB (mcm) [MycobacMTTKTPVIGSFADVPLHGERAAQSPTEATVQQHVAAAAAAHGYTPEQLVW
HTPEGIDVKPVYIAADRAAAEAEGYPLHSFPGEPPFVRGPYPTMYVNQPW
TIRQYAGFSTAADSNAFYRRNLAAGQKGLSVAFDLATHRGYDSDHPRVQG
DVGMAGVAIDSILDMRQLFDGIDLSTVSVSMTMNGAVLPILALYVVAAEE
QGVAPEQLAGTIQNDILKEFMVRNTYIYPPQPSMRIISDIFAYTSAKMPK
FNSISISGYHIQEAGATADLELAYTLADGVDYIRAGLNAGLDIDSFAPRL
SFFWGIGMNFFMEVAKLRAGRLLWSELVAQFAPKSAKSLSLRTHSQTSGW
SLTAQDVFNNVARTCIEAMAATQGHTQSLHTNALDEALALPTDFSARIAR
NTQLVLQQESGTTRPIDPWGGSYYVEWLTHRLAQRARAHIAEVAEHGGMA
QAISDGIPKLRIEEAAARTQARIDSGQQPVVGVNKYQVPEDHEIEVLKVE
NSRVRAEQLAKLQRLRAGRDEPAVRAALAELTRAAAEQGRAGGQADPAGL
GNNLLALAIDAARAQATVGEISDALEKVYGRHRAEIRTISGVYRDEVGKA
PNIAAATELVEKFAEADGRRPRILIAKMGQDGHDRGQKVIATAFADIGFD
VDVGSLFSTPEEVARQAADNDVHVIGVSSLAAGHLTLVPALRDALAQVGR
PDIMIVVGGVIPPGDFDELYAAGATAIFPPGTVIADAAIDLLHRLAERLG
YTLD
433634553YP_007268180.1 Conserved membrane protein of unknown function [Mycobacterium canetMTAPAICNTTETVRGIATSLGAAARQASLPRIVGTVVAITVLVAVALLVP
VPTAVELRDWAKSLGAWFPLAFLLVHTVVTVPPFPRTAFTLAAGLLFGSV
VGVFIAVVGSTASAVIAMLLVRATGWQLNSLVRRRAIDRLDERLRERGWL
AILSLRLIPVVPFAAINYAAGASGVRILPFAWATLAGLLPGTAAVVILGD
AFAGSGSPLLILVSVCTGALGLAGLVYEIRHYRRQHRRMPGYPDPVREPA
LI
433634551YP_007268178.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MSVGEVEVLKVENSRVRAEQLAKLYELRSSRDRVRVDAALAELSRAAAAR
GCAGTSGLGNNLMAPGPHSRLGRDR
433634549YP_007268176.1 Conserved exported protein of unknown function [Mycobacterium canetMQGAVAGLVFLAVLVIFAIIVVAKSVALIPQAEAAVIERLGRYSRTVSGQ
LTLLVPFIDRVRARVDLRERVVSFPPQPVITEDNLTLNIDTVVYFQVTVP
QAAVYEISNYIVGVEQLTTTTLRNVVGGMTLEQTLTSRDQINAQLRGVLD
EATGRWGLRVARVELRSIDPPPSIQASMEKQMKADREKRAMILTAEGTRE
AAIKQAEGQKQAQILAAEGAKQAAILAAEADRQSRMLRAQGERAAAYLQA
QGQAKAIEKTFAAIKAGRPTPEMLAYQYLQTLPEMARGDANKVWVVPSDF
NAALQGFTRLLGKPGEDGVFRFEPSPVEDQPKHAADGDDAEVAGWFSTDT
DPSIARAVATAEAIARKPVEGPLGTAPRLTQ
433634547YP_007268174.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MWCPSVSLSIWANAWLAGKAAPDDVLDALSLWAPTQSVAAYDAVAAGHTG
LPWPDVHDAGTVSLLQTLRAAVGRRRLRGTINVVLPVPGDVRGLAAGTQF
EHDALAAGEAVIVANPDDLGSAVGLVPEFSYGDVDEAAQSEPLTPELCAL
SWMVYSLPGAPVLEHYELGDAEYALRSAVRSAAEALSTIGLGSSDVANPR
GLVEQLLESSRQHRVPDHAPSRALRVLENAAHVDAIIAVSAGLSRLPIGT
QSLSDAQRATDALRPLTAVVRSARMSAVTAILHSAWPD
433634545YP_007268172.1 NADH-dependent enoyl-[acyl-carrier-protein] reductase InhA (NADH-deMTGLLDGKRILVSGIITDSSIAFHIARVAQEQGAQLVLTGFDRLRLIQRI
TDRLPAKAPLLELDVQNEEHLASLAGRVSEAIGAGNKLDGVVHSIGFMPQ
SGMGINPFFDAPYEDVSKGIHISAYSYASMAKALLPIMNRGGSIVGMDFD
PSRAMPAYNWMTVAKSALESVNRFVAREAGKYGVRSNLVAAGPIRTLAMS
AIVGGALGEEAGAQIQLLEEGWDQRAPVGWNMKDATPVAKTVCALLSDWL
PATTGDIIYADGGAHTQLL
433634543YP_007268170.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MTDPFLGSEALAAGVLTPYELRSRYVALHKDVYVPRGLELTAQLRAKALW
LRSRRRGVLAGYSASALHGAKWIDADLPAAIINTNRRRAPGLQVWEERIE
PDEICVIEGMRVSTPERTALDLTSRFPLDPAVAAVDALIQATDLKVADVE
PLIERYRGRRGIKAARAALDLVDGGAQSPKETWLRLLLIRAGFPRPQTQI
AVRNEWGWAEAHLDMGWQDIKVAAEYDGDHHLTSRYHYRKDILRHEKVQH
RYGWIVVRVVAEDHPADIIRRVGEARAFRA
433634541YP_007268168.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MTESKAPAVVHPPSMLRGDIDDPKLAAALRTLELTVKQKLDGVLHGDHLG
LIPGPGSEPGESRLYQPGDDVRRMDWAVTARTTHPHVRQMIADRELETWL
VVDMSASLDFGTACCEKRDLAVAAAAAITFLNSGGGNRLGALIANGAAMT
RVPARTGRQHQHTMLRTIATMPQAPAGVRGDLAVAIDALRRPERRRGMAV
IISDFLGPINWMRPLRAIAARHEVLAIEVLDPRDVELPDVGDVVLQDAES
GVVREFTIDPALRDDFARAAAAHRADVARTIRGCGAPLLSLRTDRDWLAD
IVRFVASRRRGALAGHQ
433634539YP_007268166.1 Conserved protein of unknown function- probable invasion protein [MMRHTRFHPIKLAWITAVVAGLMVGVATPADAEPGQWDPTLPALVSAGAPG
DPLAVANASLQATAQATQTTLDLGRQFLGGLGINLGGPAASAPSAATTGA
SRIPRANARQAVEYVIRRAGSQMGVPYSWGGGSLQGPSKGVDSGANTVGF
DCSGLVRYAFAGVGVLIPRFSGDQYNAGRHVPPAEAKRGDLIFYGPGGGQ
HVTLYLGNGQMLEASGSAGKVTVSPVRKAGMTPFVTRIIEY
433634537YP_007268164.1 Conserved membrane protein of unknown function [Mycobacterium canetMTGPYFPQTIPFLPSYIPQDVDMTAVKAEVAALGVSAPPAATPGLLEVVQ
HARDEGIDLKIVLLDHNPPNDTPLRDIATVVGADYSDATVLVLSPNYVGS
YSTQYPRVTLEAGEDHSKTGNPVQSAQNFVHELSTPEFPWSALTIVLLIG
VLAAAVGARLMQLRGRRSATSTDAAPGAGDDLNQGV
433634535YP_007268162.1 Putative transcriptional regulatory protein [Mycobacterium canettiiMPKVSEDHLAARRRQILDGARRCFAEYGYDKATVRRLEQAIGMSRGAIFH
HFRDKDALFFALAREDAERMAAVASREGLIGVMRDMLAAPDQFDWLATRL
EIARKLRNDPDFSRGWAERSAELAAATTDRLRRQKQANRVRDDVPSDVLR
CYLDLVLDGLLARLASGEDPQRLAAVLDLVENSVRRS
433634533YP_007268160.1 Putative macrolide-transport ATP-binding protein ABC transporter [MMITATDLEVRAGARILLAPDGPDLRVQPGDRIGLVGRNGAGKTTTLRILA
GEVEPYAGSVTRAGEIGYLPQDPKVGDLDVLARDRVLSARGLDVLLTDLE
KQQALMAEVADEDERDRAIRRYGQLEERFVALGGYGAESEAGRICASLGL
PERVLTQQLRTLSGGQRRRVELARILFAASESGAGNSTTLLLDEPTNHLD
ADSLGWLRDFLRSHTGGLVVISHNVDLVADVVNKVWFLDAVRGQVDVYNM
GWQRYVDARATDEQRRIRERANAERKAAALRAQAAKLGAKATKAVAAQNM
LRRADRMMAALDEERVADKVARIKFPTPAACGRTPLVANGLGKTYGSLEV
FTGVDLAIDRGSRVVILGLNGAGKTTLLRLLAGVEQPDTGVLEPGYGLRI
GYFAQEHDTLDNDATVWENVRHAAPDAGEQDLRGLLGAFMFTGPQLEQPA
GTLSGGEKTRLALAGLVASTANVLLLDEPTNNLDPASREQVLDALRSYRG
AVVLVTHDPGAAAALGPQRVVLLPDGTEDYWSDEYRDLIELA
433634531YP_007268158.1 Thioredoxin TrxB1 [Mycobacterium canettii CIPT 140070017]MTTRDLTAAQFNETIQSNDMVLVDYWASWCGPCRAFAPTFAESSEKHPDV
VHAKVDTEAERELAAAAQIRSIPTIMAFKNGKLLFNQAGALPPAALESLV
QQLKAYEVEAGEATTQNGRAQQA
433634529YP_007268156.1 Putative CtpD-like P-type cation transporter (ATPase) [MycobacteriuMTLTACEVTAAEAPFDRVSKTIPHPLSWGAALWSVVSVRWATVALLLFLA
GLVAQLNGAPEAMWWTLYLACYLAGGWGSAWAGAQALRNKALDVDLLMIA
AAIGAVAIGQIFDGALLIVIFATSGALDDIATRHTAESVKGLLDLAPDQA
VVVQGDGSERVVAASELVVGDRVVVRPGDRIPADGAVLSGASDVDQRSIT
GESMPVAKARGDEVFAGTVNGSGVLHLVVTRDPSQTVVARIVELVADASA
TKAKTQLFIEKIEQRYSLGMVAATLALIVIPLMFGADLRPVLLRAMTFMI
VASPCAVVLATMPPLLSAIANAGRHGVLVKSAVVVERLADTSIVALDKTG
TLTRGIPRLATVAPLDPNVVDARRLLQLAAAAEQSSEHPLGRAIVAEARR
RGIAIPPAEDFRAVPGCGVHALVGNDFVEIASPQSYRGAPLAELALLLSA
GATAAIVLLDGVAIGVLGLTDQLRPDAVESVAAMAALTAAPPVLLTGDNG
RAAWRVARNAGITDVRAALLPEQKVEVVRGLQAGGHHVLLVGDGVNDAPA
MAAARAAVAMGAGADLTLQTADGVTIRDELHTIPTIIGLARQARRVVTVN
LAIAATFIAVLVLWDLFGQLPLPLGVAGHEGSTVLVALNGMRLLTNRSWR
AAASAAR
433634527YP_007268154.1 Putative acyl-coa dehydrogenase FadE15 [Mycobacterium canettii CIPTMGHYIANVRDLEFNLFEVLDVGAVLGTGRYSDLDADTVHTILAEAARLAE
GPIAESFGYADRNPPVFDPNTHTISVPDELAKTVQAIKEAGWWRLGLAEE
IGGMPAPPPLAWAVNEMIYCANPSACFFNLGPVLAQSLYIEGNEEQRRWA
AEGVQRGWQATMVLTEPDAGSDVGAGRTKAFEQPDGTWHIEGVKRFISGG
DVGNTAENIFHLVLARPEGAGPGTKGLSLFYVPNYLFDPNTFELGARNGV
YVTGLEHKMGLKSSPTCELTFGGTDVPAVGYLVGGVHNGIAQMFTVIEHA
RMTIGVKSAGTLSTGYLNALAYAKERVQGADLTQMTDKTAPRVTIMRHPD
VRRSLMTQKAYAEGLRALYLYAAAHQDDAVAQRVSGADHDMAHRVDDLLL
PIVKGVGSERAYEILTESLQTLGGSGFLTDYPIEQYIRDAKIDSLYEGTT
AIQALDFFFRKIVRDHGKALQFVLAQITHTVENIDPSLKPQAELLRTALD
DITAMTGALTGYLMSAAQHSSDIYKVGLGSVRYLLAVGDLLIGWRLLVQA
GVAHAALATGPSRNDEAFYRGKIAVAAFFAKNMLPKLTGVRSVIESIDDD
IMRVPEDAF
433634525YP_007268152.1 Nitrogen fixation protein NifU-related protein [Mycobacterium canetMTLRLEQIYQDVILDHYKHPQHRGLREPFGAQVYHVNPICGDEVTLRVAL
SEDGTRVTDVSYDGQGCSISQAATSVLTEQVIGQRVPRALNIVDAFTEMV
SSRGTVPGDEDVLGDGVAFAGVAKYPARVKCALLGWMAFKDALAQASEAF
EEVTDERNQRTG
433634523YP_007268150.1 Putative conserved ATP-binding protein ABC transporter [MycobacteriMTILEIKDLHVSVENPADGDHEIPILRGVDLTVKSGETHALMGPNGSGKS
TLSYAIAGHPKYHVTSGTITLDGADVLAMSADERARAGLFLAMQYPVEVP
GVSMSNFLRSAATAIRGEPPKLRHWVKEVKAAMAALDIDPAFAERSVNEG
FSGGEKKRHEILQLELLKPKIAILDETDSGLDVDALRVVSEGVNRYAESQ
HGGILLITHYTRILRYIHPEYVHVFVGGRIVESGGSELADELDQNGYVRF
SPASGRYPHQPAPTGA
433634521YP_007268148.1 Putative enzyme [Mycobacterium canettii CIPT 140070017]MTLTPEASKSVAQPPTQAPLTQEEAIASLGRYGYGWADSDVAGANAQRGL
SEAVVRDISAKKNEPDWMLQSRLKALRIFDRKPIPKWGSNLEGIDFDNIK
YFVRSTEKQAASWDDLPEDIRNTYDRLGIPEAEKQRLVAGVAAQYESEVV
YHQIRADLEAQGVIFLDTDTGLREHPDIFKEYFGTVIPAGDNKFSALNTA
VWSGGSFIYVPPGVHVDIPLQAYFRINTENMGQFERTLIIADEGSYVHYV
EGCLPAGELITTADGDLRPIESIRVGDFVTGHDGRPHRVTAVQVRDLDGE
LFTFTPMSPANAFSVTAEHPLLAIPRDEVRVMRKERNGWKAEVNSTKLRS
AEPRWIAAKDVAEGDFLIYPKPKPIPHRTVLPLEFARLAGYYLAEGHACL
TNGCESLIFSFHSDEFEYVEDVRQACKSLYEKSGSVLIEEHKHSARVTVY
TKAGYAAMRDNVGIGSSNKKLSDLLMRQDETFLRELVDAYVNGDGNATRR
SGALWKRVHTTSRLWAFQLQSILARLGHYATVELRKDIYQVQWTEGGRGP
KQARDCGDYFAVPIKKRAVREAHEPVYNLDVENPDSYLAYGFAVHNCTAP
IYKSDSLHSAVVEIIVKPHARVRYTTIQNWSTNVYNLVTKRARAEAGATM
EWIDGNIGSKVTMKYPAVWMTGEHAKGEVLSVAFAGEDQHQDTGAKMLHL
APNTSSNIVSKSVARGGGRTSYRGLVQVNKGAHGSRSSVKCDALLVDTVS
RSDTYPYVDIREDDVTMGHEATVSKVSENQLFYLMSRGLTEDEAMAMVVR
GFVEPIAKELPMEYALELNRLIELQMEGAVG
433634519YP_007268146.1 Conserved membrane protein of unknown function [Mycobacterium canetMAARHHTLSWSIASLHGDEQAVGAPLTATELTALARTRLFGATGTVLMAI
GALGAGARPVVQDPTFGVRLLNLPSRIQTVSLTMTTTGAVMMALAWLMLG
RFTLGRRRMSRGELDRTLLLWMLPLLIAPPMYSKDVYSYLAQSQISREGL
DPYRVGPASGLGLGHVFTLSVPSLWRETPAPYGPLFLWIGRGISSLTGEN
IVAAVLCHRLVVLIGVTLIVWATPRLAQRCGVAEVSALWLGAANPLLIMH
LVAGIHNEALMLGLMLTGVEFALRGLDMANAPRPSPESRRLGPATMWASR
RSEPGASPRAGASRAIKPCPEWGPLAMLLAGSILITLSSQVKLPSLLAMG
FITTVLAYRWGGNLRALLLAAAVMASLTLAIMAILGWASGLGFGWINTLG
TANVVRSWMSPPTLLALGTGHVGILLGLGDHTTAVLSLTRAIGVLIITVM
VCWLLLAVLRGRLHPIGGLGVALAVTVLLFPVVQPWYLLWAIIPLAAWAT
RPGFRVAAILATLIVGIFGPTANGDRFALFQIVDATAASAIIVILLIALT
YTRLPWRPLAAEQVVTAAESASKTPATRRPTAAPDAYADST
433634517YP_007268144.1 Putative unidentified antibiotic-transport integral membrane ABC trMTQTNRPAFPAGTFSPDPGPNAVPLMLAAQFSLELKLLLRNGEQLLLTMF
IPITLLVGLTLLPMGSFGHNRAATFVPVIMALAVISTAFTGQAIAVAFDR
RYGALKRLGATPLPVWGIIAGKSLAVVAVVFLQAIILGAIGFALGWRPAL
AALTLGAGIIALGTAGFAALGLLLGGTLRAEIVLAVANLMWFVFAGFGAL
TLESNVIPTAFKWVARVTPSGALTEALSQAMTVSVDWFGVVVLAVWGALA
ALAALRWFRFT
433634515YP_007268142.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MKLARPDVFHPRVVLAGWPQQPAGDGDDAGLVAALRHRGLHAGWLSWDDP
EIVHADLVILRATRDYPARLDEFLAWTTRVANLLNSRPVVAWNVERRYLR
DLTDRGVPTVPGEVYVPGEPVRLPRKGQVFVGPTIGTGTRRCSARFAAEF
VAQLHAAGQAVLVQPGGSGDETVLIFLGGEPSHAFTKQADTWRQTEPDFE
IWDVGAAAVAGAAAQVGVDPGELLYARAHITGGSRDPRLLELQLVDPSLG
WQWLDPDIRNLAQRDFALCVQSALERLGLGPFSHRRP
433634513YP_007268140.1 Putative transcriptional activator protein [Mycobacterium canettii MALRETSPRIHELIREAARIALNPTQEWLDEFDRAILAANPSIAADPALA
TVVKRSNRAHLIHFAAANLRNPGAPVPPNLGPEPLRMARDLVRVGLDALA
LDIYRIGQNVAWRRWTDIAFGLTSDPDELHELLDVPFRTANEFVDTTLAG
ITTEMQLERDKLTRDVPAERRKIVQLLIDGAPISREHAEARLGYPLDRSH
TAAVIWGDQAQGDHSQLDRVADAFGHAGGCPHPLVVVAGAATRWVWVKDA
PGFDIDLIHEVLHGIPDARIAIGATAPGIEGFRRSHRDALTTARMIIRLE
SPHRVAFFTDIEMVALLTENAEGADDFIKRTLGNLESASPALKTTLLTFI
NQQCNASRAARLLFTHRNTLMNRLETAQRLLPRPLADTTIHVAVALEAQQ
WREKQTSDPPAKKESNGTTMH
433634511YP_007268138.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MHDATGGAGFVRPDLTAFCRLDELGVEVTGQYLDSDRAVLACRITDEDRW
CRRCGEQGQVRDTVTRRLAHEPFGWRPTTLVLTVRRYRCAGCAHVWRQDS
SAAAEPRAKLSRHGLRWALEAVVCQHLTMARVAEGLGVSWNTANDAVLAE
GKRVLIDDAGRFDEVTVIGVDEHVWRHTRRGDKYVTVIIDLTGIREGTGP
ARLLDMVEGRSKQAFKTWLAEREESWRQAVEVVAMDGFTGFKTATSEELP
DAVAVMDPFHVVRLGGEALDKCRRRVQLDTCGHRGRKTDPLYAARRTLQT
GADLLTDKQKDRPTKLFAVDTHIEVETTWGIYQRMISAYRHPDRRRGREL
MSTLIESISDAVPAALTQVITLGRTLKKRAADVLAYFDRPGTSNGPTEAI
NGRLEHLRGSALGFRNLTHYIARSLLEAGGFKPRLHPRS
433634509YP_007268136.1 Transketolase Tkt (TK) [Mycobacterium canettii CIPT 140070017]MTTLEEISALTQPRHPDDWTEIDSAAVDTARVLAADAVQKVGNGHPGTAM
SLAPLAYTLFQRTMRHDPSDTHWLGRDRFVLSAGHSSLTLYIQLYLGGFG
LELSDIASLRTWGSKTPGHPEFRHTPGVEITTGPLGQGLASAVGMAMASR
YERGLFDPDAEPGASPFDHYIYVIASDGDIEEGVTSEASSLAAVQQLGNL
IVFYDHNQISIEDDTNIALCEDTTARYRAYGWHVHEVEGGENVVAIEEAI
ANAKAVPDRPSFIALRTVIGYPAPNLMNTGKAHGAALGDDEVAAVKKILG
FDPDKAFEVREDVLTHTRGLVARGKQAHERWQLEFDAWARREPERKALLD
RLLAHRLPDGWDADLPHWEPGSKALATRAASGSVLAAIGPKLPELWGGSA
DLAGSNNTTIKGADSFGPPSISTKEYTAHWYGRTLHFGVREHAMGAILSG
IVLHGPTRAYGGTFLQFSDYMRPAVRLASLMDIDTIYVWTHDSIGLGEDG
PTHQPIEHLSALRAIPRLSVVRPADANETAYAWRTILARGNGSGPVGLIL
TRQGVPVLDGTDAEGVARGGYVLSDAGGLQPGEEPDVILIATGSEVQLAV
AAQTLLADNDILARVVSMPCLEWFEAQPYEYRDAVLPPTVSARVAVEAGV
AQCWHKLVGDTGEIVSIEHYGESADHKTLFREYGFTAEAVAAAAERALDN
433634507YP_007268134.1 Glucose-6-phosphate dehydrogenase [Mycobacterium canettii CIPT 1400MKPAHAAASWRNPLRDKRDKRLPRIAGPCGMVIFGVTGDLARKKVMPAIY
DLANRGLLPPTFSLVGFARRDWDTEDFGEVVYNAVQEHCRTPFRQQNWDR
LAEGFRFVPGTFDDDDAFAQLAETLEKLDTDRATGGNHAFYLAIPPKSFP
VVCEQLHKSGLARPREDRWARVVIEKPFGHDLASARELNKAVNAVFPEEA
VFRIDHYLGKETVQNILALRFANQLFDPIWNAHYVDHVQITMAEDIGLGG
RAGYYDGIGAARDVIQNHLMQLLALTAMEEPVSFNPAALQAEKIKVLSAT
RLAEPLEQTTSRGQYAGGWQGGEKVVGLLDEEGFAEDSTTETFAAITLEV
DTRRWAGVPFYLRTGKRLGRRVTEIALVFKRAPHLPFDATMTDELGTNAM
VIRVQPDEGVTLRFGSKVPGTAMEVRDVNMDFSYGSAFAEDSPEAYERLI
LDVLLGEPSLFPVNAEVELAWEILDPALEHWAAHGTPDAYEAGTWGPESS
LEMLRRTGREWRRP
433634505YP_007268132.1 Putative 6-phosphogluconolactonase DevB (6PGL) [Mycobacterium canetMSSNIEIFPDSGLLIGAAGKRLVGAIATAVAARGQALIVLTGGGNGIALL
RYLATHGARVDWSKVHLFWGDDRYVPEDDDERNLKQARQALLNHVDIPSN
QVHPMAASDGDFGADLHAAALAYEQVLAASAAPGDPAPNFDVHLLGMGPE
GHINSLFPHSPAVLETTRMVVAVDDSPKPPPRRITLTLPAIQRSREVWLL
VSGPGKADAVAAAIGGADPVSVPAAGAVGRQNTLWLLDRDAAAKLPS
433634503YP_007268130.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MVGYAEPVLIERQSVVAAPAEQVWQRVVTPEGINDELRPWMTMSVPRGAK
GITIDTVPIGAPIGRAWLRLFGVLPFDYDRLSIAELEPGRRFREDSTMLS
MRQWQHERTVTPEGDTKTIVRDRITFQTRAGLRFAAPLIAAGLRALFGHR
HRRLQRHFAQG
433634501YP_007268128.1 Conserved protein of unknown function- PE-PGRS family protein [MycoMSNVMVVPGMLSAAAADVAGIGAALSAANGAAAPTTAGVLAAGADEVSAA
IASLFSGYARDYQALSAQMAGFHQQFVQALTASVGSYAAAEAANASPLQA
LEQQVLAAINAPTQTLLGRPLIGNGADGLPGQNGGAGGLLWGNGGNGGAG
DAAHPNGGNGGDAGMFGNGGAGGAGYSPAAGTGAAGGAGGAGGAGGWLSG
NGGAGGNGGLFANGADGGGGFPPVPASPGGNGGGGGAGGAAGMFGTGGAG
GTGGDGGAGGAGDSPNSGANGARGGDGGNGAAGGAGGRLFGNGGAGGTGG
TAGQGGDGGTALGAGGIGGDGGTGGAGGTGGTAGIGGSSAGAGGAGGDGG
AGGTGGGSSMIGGKGGTGGNGGVGGTGGASALTIGNGSSAGAGGAGGAGG
TGGTGGYIESPDGKGQAGNGGNGGNGAAGGAGGGGTGAGGNGGAGGNGGD
GGPSQGGGNPGFGGDGGTGGPGGVGVPDGIGGANGAQGKHG
433634499YP_007268126.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MQMSASNAFVEGFADFWKAPSPDRLTDHLHPDVVLVQPLSPPRHGLAAAQ
REFTRILGLLPDLHGEVDRWSQAGDVVFIEFRLIARLGSEVVEWPVVDRF
LLRGDKAVERVSYFDSLPLLIKVVKHPSTWRGWLSTMRGRA
433634497YP_007268124.1 Putative phosphoglycerate kinase Pgk [Mycobacterium canettii CIPT 1MSVPNLKDLLAEGVSGRGVLVRSDLNVPLDEDGTITDAGRIIASAPTLKA
LLDADAKVVVAAHLGRPKDGPDPTLSLAPVAVALGEQLGRHVQLAGDVVG
ADALARAEGLTGGDILLLENIRFDKRETSKNDDDRRALAKQLVELVGTGG
VFVSDGFGVVHRKQASVYEIATLLPHYAGTLVADEMRILEQLTSSTQRPY
AVVLGGSKVSDKLGVIESLATKADSIVIGGGMCFTFLAAQGFSVGTSLLE
DDMIEVCRGLLDTYHDVLRLPVDLVVTEKFAADSPPQTVDVGAVPNGVMG
LDIGPGSIKRFSTLLSNAGTIFWNGPMGVFEFPAYAAGTRGVAEAIVAAT
GKGAFSVVGGGDSAAAVRAMNIPEGAFSHISTGGGASLEYLEGKTLPGIE
VLSREQPTGGVL
433634495YP_007268122.1 Conserved exported protein of unknown function- proline- glycine- vMTLMAIVNRFNIKVIAGAGLFAAAIALSPDAAADPLMTGGYACIQGMAGD
APVAAGDPVAAGGPAAAGACSAALTDMAGVPFVAPGPVPAAAPVPIGAPV
PIPGAPVPIPGGPVPIPGAPVPIPGGPVPIPGGPVPVPAVPAPVIPVGTP
LIALGPVLAGAPGDGVVSAPIIGMSGVKDALTDPAPAGGPVPGQPVLPGP
SASAPAGAR
433634493YP_007268120.1 Putative dehydrogenase [Mycobacterium canettii CIPT 140070017]MTTAVVVGAGPNGLAAAIHLARHGVDVQVLEARDTIGGGARSGELTVPGV
IHDHCSAFHPLGVGSPFWAAIDLQRYGLTWKWPDVDCAHPLDDGTAGVLY
RSIEATAAGLGADGKRWRRAVGDLAAGFDELAEDLLRPVLNMPRHPIRLA
RFGPRAALPATAMARRFRTERARALFGGAAAHVYTRLDRPLTASLGLMIL
ASGHRHGWPVAQGGSGSITKALAAALDAYGGTVATGLTVTSRRDIPDADI
VMLDLSPAAVLGIYGDVMPTRINRSYRRYRAGSSAFKVDFAVEGDVGWTN
PDCRRAGTVHLGGTFAEIADTERRRAQGTMVQRPFVLVGQQYLADPSRSV
GNINPIWAYAHVPFGYTGDATAAVIDQIERFAPGFRDRIVATVSTSTTEL
QTYNRNFIGGDIIGGANDRLQVIFRPRVAVDPYAIGVPGVYLCSQSAPPG
AGIHGLCGYHAAESALRWLRKRR
433634491YP_007268118.1 Conserved protein of unknown function- PE family protein [MycobacteMSFVFAVPEMVAATASDLASLGTALSEAIAAAAIPTTQVLAAAADEVSAA
IAELFGAHGQEFQALSAQASAFHDRFVRALSAAAGWYVDAEAANAALVDT
AATGASALGSGGRTALILGSTGTPRPPFDFMQQVYDRYIAPHYSGYAFSG
LYTPAQFQPWTGIPSLTYDQSVAEGAGYLHTAIMQQVAAGNDVVVLGFSQ
GASVATLEMRHLASLPAGVAPSPDQLSFVLLGNPNNPNGGILARFPGLYL
QSLGLTFNGATPDTEYATTIYTTQYDGFADFPKYPLNILADVNALLGIYY
SHSLYYGLTPEQVASGIVLPVSSPDTNTTYILLPNEDLPLLQPLRGIVPE
PLLDLIEPDLRAIIELGYDRTGYADVLTPAALFPVRIDPIAVPPQIGAAI
GGPLTALDGLLDTVINDQLNPVVTSGIYQAGAELSVAAAGYGAPAGVTNA
IFIGQQVLPILVEGPGALVTADTHYLVDAIQDLAAGDLSGFNQNLQLIPA
TNIALMVFAAGIPAVAAVAILTGQDFPV
433634489YP_007268116.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MSETDSPGNGDDAGIGDIGKFDPGLTQRLITVLRPVLKTYHRSQVHGLDS
FPPGGALVVANHSGGMFPMDVPVFSVDFYDKFGYDRPVYTLSHDILFMGL
TGDLFRRTGYIRATRENAAQALRSGGVVVVFPGGDYDAYRPTFAENVIDF
NGRKGYVSTAVEAGVPIVPAVSIGGQESQLYLSRGTWLARRLGLKRLLRS
DILPISFGFPFGFSAAIPPNLPLPAKIVMQVLDPINLTKQFGEDPDVDAV
DEHVRSVMQQALNDLAAKRRFPILG
433634487YP_007268114.1 Putative esterase LipO [Mycobacterium canettii CIPT 140070017]MRLRRMARPRPLARAAVELLNAANGLRPLSGSGYSTVLAFWLGWPTSEVP
GVYLGASVLDALRRGHRGDFGGPKGKAALALTAAAWVILVVIRYRGATTP
GPVLEAGLTEQLGPDYAKELATLPTEPMRSRGRNLPLHTAMARRRYVETT
NVVCYGPYGRANLADIWRRRDLPRDAKAPVLVQVPGGAWVLGWRRPQAYP
LMSHLAARGWVCVSLNYRVSPRHTWPDHIVDVKRALAWVKENIAAYGGDP
NFVAISGGSAGGHLCALAALTPNDPRFQPGFEQADTSVAAAVPVYGRYDW
FTTEAPGRREFVGLLETFVVKRKFSTHRDIFVDASPIHHVRADAPPFFVL
HGRHDSLIPVAEAHAFVEELRAVSKSPVAYADLPHAQHAFDVFGSPRAHH
TAEAVARFLSWVYATNPPAT
433634485YP_007268112.1 Conserved membrane protein of unknown function [Mycobacterium canetMTVVPGAPSRPASAVSRPSYRQCVQASAQTSARRYSFPSYRRAPAEKLVF
PVLLGILTLLLSACQTASASGYNEPRGYDRATLKLVFSMDLGKCLNRFTY
DSKLAPSRPQVVACDSREARIRNDGFHANAPSCMRIDYELITQNHRAYYC
LKYLVRVGYCYPAVMTPGKPPSVLLYAPSACDESLPSPRVATALVPGTRS
ANREFSRFVVTEIKSPGAGGRCDSASVSLHPPEEIEGPGIPPADSQLVCV
APK
433634483YP_007268110.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MTDGIVALGGGHGLYATLSAARRLTPYVTAVVTVADDGGSSGRLRSELDV
VPPGDLRMALAALASDSPHGRLWATILQHRFGGSGALAGHPIGNLMLAGL
SEVLADPVAALDELGRILGVKGRVLPMCPVALQIEADVSGLEADPRMFRL
IRGQVAIATTPGKVRRVRLLPTDPPATRQAVDAIMAADLVVLGPGSWFTS
VIPHVLVPGLAAALRATSARRALVLNLVAEPGETAGFSVERHLHVLAQHA
PGFTVHDIIIDAERVPSEREREQLRRTATMLQAEVHFADVARPGTPLHDP
GKLAAVLDGVCARDVGASEPPVAATQEIPIDGGRPRGDDAWR
433634481YP_007268108.1 Putative excinuclease ABC (subunit C-nuclease) UvrC [Mycobacterium MPDPATYRPAPGSIPVEPGVYRFRDQHGRVIYVGKAKSLRSRLTSYFADV
ASLAPRTRQLVTTAAKVEWTVVGTEVEALQLEYTWIKEFDPRFNVRYRDD
KSYPVLAVTLGEEFPRLMVYRGPRRKGVRYFGPYSHAWAIRETLDLLTRV
FPARTCSAGVFKRHRQIDRPCLLGYIDKCSAPCIGRVDAAQHRQIVADFC
DFLSGKTDRFARALEQQMNAAAEQLDFERAARLRDDLSALKRAMEKQAVV
LGDGTDADVVAFADDELEAAVQVFHVRGGRVRGQRGWIVEKPGEPGDSGI
QLVEQFLTQFYGDQAALDDAADESANPVPREVLVPCLPSNAEELASWLSG
LRGSRVMLRVPRRGDKRALAETVHRNAEDALQQHKLKRASDFNARSAALQ
SIQDSLGLADAPLRIECVDVSHVQGTDVVGSLVVFEDGLPRKSDYRHFGI
REAAGQGRSDDVACIAEVTRRRFLRHLRDQSDPDLLSPERKSRRFAYPPN
LYVVDGGAPQVNAASAVIDELGVTDVAVIGLAKRLEEVWVPSEPDPIIMP
RNSEGLYLLQRVRDEAHRFAITYHRSKRSTRMTASALDSVPGLGEHRRKA
LVTHFGSIARLKEATVDEITAVPGIGVATATAVHDALRPGSSGAAR
433634479YP_007268106.1 Conserved lipoprotein of unknown function- LprH [Mycobacterium caneMACLGRPGCRGWAAASLVLVVVLALAACTESVAGRAMRATDRSSGVPTSA
KPARARDLLLQDGDRAPFGQVTQSRVGDSYFTSAVPPECSAALLFKGSPL
RPDGSSDHAEAAYNVTGPLPYAESVDVYTNVLNVHDVVWNGFRDVSHCRG
DAVGVSPAGRSTPMRLRYFATLSDGVLVWTMSNPRWTCDYGLAVVPHAVL
VLSACGFKPGFPMAEWASKRRAQLDSQV
433634477YP_007268104.1 Riboflavin synthase beta chain RibH (6- 7-dimethyl-8-ribityllumazinMPDLPSLDASGVRLAIVASSWHGKICDALLDGARKVAAGCGLDDPTVVRV
LGAIEIPVVAQELARNHDAVVALGVVIRGQTPHFDYVCDAVTQGLTRVSL
DSSTPIANGVLTTNTEEQALDRAGLPTSAEDKGAQATVAALATALTLREL
RAQS
433634475YP_007268102.1 Conserved protein of unknown function- possible alanine racemase- NMSCIPDEIDTPDVLIDRDILDRNIGRMSSAVAAKGIALRPHVKTHKLPEI
AHMQLRAGARGLTVATIGEAEVFVDHGADDVFIAYPLWIGTRQADRLRRL
ADRARIAVGVDTAEGASNTGARLADAAGAIDVLIEIDSGHHRSGVRAEQV
LDVAHAVGEAGLHLVGVFTFPGHSYAPGKPGQAAEQERRALNDAANTLVA
AGFPISCRSGGSTPTALLTAADGASEVRPGVYVFGDAQQLELGRCAPADI
ALTVAATVVSRQDCRSGLRRIVLDCGSKILGSDRPAWATGFGRLIDHADA
RITALSEHHATVVWPDDAPLPPVGTRLRVIPNHVCLTTNLVDDVAVVSEA
TLIDRWKVAARGKNH
433634473YP_007268100.1 Conserved lipoprotein of unknown function LprG [Mycobacterium canetMRTPRRHCRRIAVLAALSIAATVVAGCSSGSKPSGGPLPDAKPLVEEATA
QTKALKSAHMVLTVNGKIPGLSLKTLSGDLTTNPTAATGNVKLTLGGSDI
DADFVVFDGILYATLTPNQWSDFGPAADIYDPAQVLNPDTGLANVLANFA
DAKAEGRDTINGQNTIRISGKVSAQAVNQIAPPFNATQPVPATVWIQETG
DHQLAQAQLDRGSGNSVQMTLSKWGEKVQVTKPPVS
433634471YP_007268098.1 Putative bifunctional riboflavin biosynthesis protein RibG : diaminMNVEQVKSIDEAMGLAIEHSYQVKGTTYPNPPVGAVIVDPNGRIVGAGGT
EPAGGDHAEVVALRRAGGLATGAIVVVTMEPCNHYGKTPPCVNALIEARV
GTVVYAVADPNGIAGGGAGRLSAAGLQVRSGVLADQVAAGPLREWLHKQR
TGLPHVTWKYATSIDGRSAAADGSSQWISSEAARLDLHRRRAIADAILVG
TGTVLADDPALTARLADGSLAPQQPLRVVVGKRDIPPEARVLNDEARTMM
IRTHEPMEVLRALSDRTDVLLEGGPTLAGAFLRAGAINRILAYVAPILLG
GPVTAVDDVGVSNITNALRWQFDSVEKVGPDLLLSLVAR
433634469YP_007268096.1 Putative Fmu protein (Sun protein) [Mycobacterium canettii CIPT 140MTPRSRGPRRRPLDPARRAAFETLRAVSARDAYANLVLPALLAQRGIGGR
DAAFATELTYGTCRARGLLDAVIGAAAERSPQAIDPVLLDLLRLGAYQLL
RTRVDAHAAVSTTVEQAGIEFDSARAGFVNGVLRTIAGRDERSWVGELAP
DAQNDPIGHAAFVHAHPRWIAQAFADALGAAVGELEAVLASDDERPAVHL
AARPGVLTAGELARAVRGTVGRYSPFAVYLPRGDPGRLAPVRDGQALVQD
EGSQLVARALTLAPVDGDTGRWLDLCAGPGGKTALLAGLGLQCAARVTAV
EPSPHRADLVAQNTRGLPVELLRVDGRHTDLDPGFDRVLVDAPCTGLGAL
RRRPEARWRRQPADVAALAKLQRELLSAAIALTRPGGVVLYATCSPHLAE
TVGAVADALRRHPVHALDTRPLFEPVLAGLGEGPHVQLWPHRHGTDAMFA
AALRRLT
433634467YP_007268094.1 Putative methyltransferase [Mycobacterium canettii CIPT 140070017]MTIDTPAREDQTLAATHRAMWALGDYALMAEEVMAPLGPILVAAAGIGPG
VRVLDVAAGSGNISLPAAKTGATVISTDLTPELLQRSQARAAQQGLTLQY
QEANAQALPFADNEFDTVISAIGVMFAPDHQAAADELVRVCRPGGTIGVI
SWTCEGFFGRMLATIRPYRPSVSADLPPSALWGREAYVTGLLGDGVTGLK
TARGLLEVKRFDTAQAVHDYFKNNYGPTIEAYAHIGDNAVLAAELDRQLV
ELAAQYLSDGVMEWEYLLLTAEKR
433634465YP_007268092.1 Putative methyltransferase [Mycobacterium canettii CIPT 140070017]MTVYTPTSERQAPATTHRQMWALGDYAAIAEELLAPLGPILVSTSGIRRG
DRVLDVAAGSGNVSIPAAMAGAHVTASDLTPELLRRAQARAAAAGLELGW
REANAEALPFSAGEFDAVLSTIGVMFAPRHQRTADELARVCRRGGKISTL
NWTPEGFYGKLLSTIRPYRPTLPAGAPHEVWWGSEDYVSGLFRDHVSDIR
TRRGSLTVDRFGCPDECRDYFKNFYGPAINAYRSIADSPECVATLDAEIT
ELCREYLCDGVMQWEYLIFTARKC
433634463YP_007268090.1 Conserved membrane protein of unknown function [Mycobacterium canetMLQPAFKASMAVLLAAAAVAHPIGRERRWLVPALLLSATGDWLLAIPWWT
RAFVFGLGAFLLAHLCFIGALLPLARQAAPSRGQVAAVVAMCVASAGLLV
WFWPHLGKDNLTIPVTVYIVALSAMVCTALLARLPTIWTAVGAVCFAASD
SMIGIGRFILGNEALAVPIWWSYAAAEILITAGFFFGRQVPDNAAAPTDS
433634461YP_007268088.1 Putative lipase LipH [Mycobacterium canettii CIPT 140070017]MLKMLLDTFPVTFTAADGVEVARARLRQLATPGVAAGATDRGTDRWLRRA
HRHSGPRLLAAGRSRQPARGCLLPQWRLVPR
433634459YP_007268086.1 Conserved protein of unknown function with PIN domain [MycobacteriuMILVDSDVLIAHLRGVVAARDWLVNARKDGPLAISVVSTAELIGGMRTAE
RREVWRLLASFRVQPATEVIARRAGDMMRRYRRSHNRIGLGDYLVAATAD
VQGLQLATLNVRHFPMFGQLQPPFAVPGHRPRA
433634457YP_007268084.1 Transcriptional regulatory protein [Mycobacterium canettii CIPT 140MGHLPSPAEVRHPVYATRVLCEVANERGVPTRDVLAGTAIEPADLDDPDA
VVGALDEITAVRRLLARLPDDAGIGIDVGSRFALTHFGLFGFAVMSCGTL
RELLTIAMRYFALTTMHVDITLFETADDCLVELDASHLPADVRGFFIERD
IAGIIATTTSFALPLAEKYADQVSAELAVDAELLRPLLELVPVHDVAFGR
AHNRVHFPRAMFDEPLPQADRHTLEMCIAQCDVLMQRNERRRGITALVRS
KLFRDSGHFPTFTDVAGELDMHPRTLRRRLAEEGTSFRALLGEARSTVAV
DLLRNVGLTVQQVSTRLGYTEISTFSHAFKRWYGVAPSEYSRRG
433634455YP_007268082.1 Putative monoxygenase [Mycobacterium canettii CIPT 140070017]MMPDYHTLIVGAGFSGIGAAIKLDRAAFSDYLVVEAGDGVGGTWHWNTYP
GIAVDIPSFSYQFSFEQSRHWSRTYAPGHELKAYAEHCVDKYGIRSRIRL
NTKVLAAEFDDEHSLWRVQTDPGGEITARFLISACGILTVPKLPDIDGVD
TFEGVTMHTARWDHTQDLTGKRVGIIGTGASAVQIIPEIAPIVAHLTVFQ
RTPIWCFPKFDVPLPTAVRWAMRLPGGKAVHRLLSQAFVEATFPIAAHYF
AVFPLAKHMESAGRRYLRQQVHDPVVRKQLTPRYAVGCKRPGFHNTYLST
FNRDNVRLVTEPIDQITPTAVATTDGASHEIDVLVLATGFKVLDTDSIPT
YAVTGSGGESLSRFWDEHRLQAYEGVSVPGYPNFFTVFGPYGYVGSSYFA
LIETQAHHIIRCLKRARRTGATRIEVTEEANARYFAEVMRRRHRQVFWQD
SCRLANSYYFDKNGDVPLRPTTTVEAYWRSRRFDLGDYRISS
433634453YP_007268080.1 Putative DNA/pantothenate metabolism flavoprotein homolog Dfp [MycoMVDHKRIPKQVIVGVSGGIAAYKACTVVRQLTEASHRVRVIPTESALRFV
GAATFEALSGEPVCTDVFADVPAVPHVHLGQQADLVVVAPATADLLARAV
AGRADDLLTATLLTARCPVLFAPAMHTEMWLHPATVDNVATLRRRGAVVL
EPATGRLTGADSGAGRLPEAEEITTLAQLLLERHDALPYDLAGRKLLVTA
GGTREPIDPVRFIGNRSSGKQGYAVARVAAQRGADVTLIAGHTAGLVDPA
GVEVVHVSSAQQLADAVSKHAPTADVLVMAAAVADFRPAQVATAKIKKGV
EGPPTIELLRNDDVLAGVVRARAHGQLPNMRAIVGFAAETGDANGDVLFH
ARAKLRRKGCDLLVVNAVGEGRAFEVDSNDGWLLASDGTESALQHGSKTL
MASRIVDAIVTFLAGCSS
433634451YP_007268078.1 Putative guanylate kinase Gmk [Mycobacterium canettii CIPT 14007001MSVGEGPDTKPTACGQPAAVGRVVVLSGPSAVGKSTVVRCLRERIPNLHF
SVSATTRAPRPGEVDGVDYHFIDPTRFQQLIDQGELLEWAEIHGGLHRSG
TLAQPVRAAAATGVPVLIEVDLAGARAIKKTMPEAVTVFLAPPSWQDLQA
RLIGRGTETADVIQRRLDTARIELAAQGDFDKVVVNRRLESACAELVSLL
VGTAPGSP
433634449YP_007268076.1 Conserved protein of unknown function- PPE family [Mycobacterium caMTEPWIAFPPEVHSAMLNYGAGVGPMLISATQNGELSAQYAEAASEVEEL
LGVVASEGWQGQAAEAFVAAYMPFLAWLIKASADCVEMAAQQHVVIEAYI
AAVELMPTQVELAANQIKLAVLVATNFFGINTIPIAINEAEYVEMWVRAA
TTMATYSTVSRSALSAMPHTSPPPLILKSDELLPDTGEDSDEDGHNHGGH
SHGGHARMIDNFFAEILRGVSAGRIVWDPVNGTLNGLDYDDYVYPGHAIW
WLARGLEFFQDGEQFGELLFTNPTGAFQFLLYVVVVDLPTHIAQIATWLG
QYPQLLSAALTGVIAHLGAITGLAGLSGLSAIPSAAIPAVVPELTPIAAA
PPMLAVAGVGPAVAAPGSVAVSAATPATAASAAAAPPATGFGGFPPYLVG
GGGPGIGFGSGQSAHAKAAASDSAAAESAAQASARAQARAARRGRSAAKA
RGHRDEFVTMDMGFDAAAPTPEHQPGARASDCGAGPIGFAGTVRKEAVVK
AAGLTTLAGDDFGGGPTMPMMPGTWTHDQGAFDEHR
433634447YP_007268074.1 Putative orotidine 5'-phosphate decarboxylase PyrF (OMP decarboxylaMTGFGLRLAEAKARRGPLCLGIDPHPELLRGWDLPTTADGLVAFCDICVR
AFADFAVVKPQVAFFESYGAAGFAVLERTIAELRAADVLVLADAKRGDIG
STMSAYATAWVGDSPLAADAVTATPYLGFGSLRPLLEVAAAHGRGVFVLA
ATSNPEGAAVQRADANGRTVAQLIVDQAGAANEAHGSEPGSIGVVVGATV
PQAPDLSAFTGPVLVPGVGVQGGRPEALGGLGGAASSQLLPAVAREVLRA
GPGVPELRAAGERMRDAVAYLAAG
433634445YP_007268072.1 Putative carbamoyl-phosphate synthase small chain CarA (carbamoyl-pMSKAVLVLEDGRVFTGRPFGATGQALGEAVFSTGMSGYQETLTDPSYHRQ
IVVATAPQIGNTGWNGEDSESRGERIWVAGYAVRDPSPRASNWRATGTLE
DELIRQRIVGIAGIDTRAVVRHLRSRGSMKAGVFSDAALAEPADLIARVR
AQQSMLGADLAGEVSTAEPYIIEPDGPPGVSRFTVAALDLGIKTNTPRNF
ARRGIRCLVLPAWTTFGQLGAIKPHGVFLSNGPGDPATADHVVALTRDVL
GAGIPLFGICFGNQILGRALGLSTYKMVFGHRGINIPVIDHATGRVAVTA
QNHGFALQGEAGQSFDTPFGPAVVSHTCANDGVVEGVKLKDGRAFSVQYH
PEAAAGPHDAEYLFDQFVELMAGEGP
433634443YP_007268070.1 Putative dihydroorotase PyrC (DHOase) [Mycobacterium canettii CIPT MSVLIRGVRPYGEGERVDVLVDDGQIAQIGPDLAIPDTADVIDATGHVLL
PGFVDLHTHLREPGREYAEDIETGSAAAALGGYTAVFAMANTNPVADSPV
VTDHVWHRGQQVGLVDVHPVGAVTVGLAGAELTEMGMMNAGAAQVRMFSD
DGVCVHDPLIMRRALEYATGLGVLIAQHAEEPRLTVGAVAHEGPMAARLG
LAGWPRAAEESIVARDALLARDAGARVHICHASAAGTVEILKWAKDQGIS
ITAEVTPHHLLLDDARLASYDGVNRVNPPLREASDAVALRQALADGIIDC
VATDHAPHAEHEKCVEFAAARPGMLGLQTALSVVVQTMVAPGLLSWRDVA
RVMSENPACIARLPDQGRPLEVGEPANLTVVDPDATWTVTGADLASRSAN
TPFESMSLPATVTATLLRGKVTARDGKIRA
433634441YP_007268068.1 Putative pyrimidine operon regulatory protein PyrR [Mycobacterium cMGAAGDAAIGRESRELMSAADVGRTISRIAHQIIEKTALDDPVGPDAPRV
VLLGIPTRGVTLANRLAANITEYSGIQVGHGALDITLYRDDLMIKPPRPL
ASTSIPSGGIDDALVILVDDVLYSGRSVRSALDALRDVGRPRAVQLAVLV
DRGHRELPLRADYVGKNVPTSRSESVHVRLREHDGRDGVVISR
433634439YP_007268066.1 Putative transferase [Mycobacterium canettii CIPT 140070017]MPGIDFDALYRGESPGEGLPPITTPPWDTKAPKDNVIGWHTGGWVHGDVL
DIGCGLGDNAIYLARNGYQVTGLDISPTALTTAKRRASDAGVDVKFAVGD
ATKLTGYTGAFDTVIDCGMFHCLDDDGKRSYAASVHRATRPGATLLLSCF
SDAMPPDEEWPRSTISEQTLRDVLGGAGWDIESLEPATVRRELDGTEVEM
AFWNVRAQRRGS
433634437YP_007268064.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MTGRRLARFPAFRAGVAQDDDVGSTLSQGSTTGVLSGPNWSYWPSRVLGS
ADPTTITHRHGTHRITSPDETWQALQPFLAPAGITRVADVTWLDCLGIPT
VQAVRPASLTLSVSQGKAATYRAAQVSAVMESLEGWHAENVTADLWSATA
RDLEADLTYDPAQLRHRPGSLYHAGVKLDWMVATTLLTGRRTWVPWTAVL
VNVATRDCWEPPMFEMDTTGLASGNCYDEATLHALYEVMERHSVAAAVAG
ETMFEVPTDDVAGSDSAHLVEMIRDAGDDVDLARIDVWDGYYCFAAELTS
ATLEVTFGGFGLHHDPNVALSRAITEAAQSRITAISGAREDLPSAIYHRF
GRVHTYAKARKTSLRLNRARPTPWRVPDVDSLPELVASAATAVANRSGTE
PLAVVCDFADACVPVVKVLAPGLMLSSASPMRTPLQEAE
433634435YP_007268062.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MNVSAESGAPRRAGQRHEVGLAQLPPAPPTTVAVIEGLSTGTPRRVVNQS
DAADRVAELFLDPGQRERIPRVYQKSRITTRRMAVDPLDAKFDVFRREPA
TIRDRMYLFYEHAVPLAVDVTKRALAGLPYRAAEIGLLVLATSTGFIAPG
VDVAIVKELGLSPSISRVVVNFMGCAAAMNALGTATNYVRAHPAMKALVV
CIELCSVNAVFADDINDVVIHSLFGDGCAALVIGASQVQEKLEPGKVVVR
SSFSQLLDNTEDGIVLGVNHNGITCELSENLPGYIYSGVAPVVTEMLWDN
GLQISDIDLWAIHPGGPKIIEQSVHSLGISAELAAQSWDVLARFGNMLSV
SLIFVLETMLQQAESAKAISTGVAFAFGPGVTVEGMLFDIIRR
433634433YP_007268060.1 Conserved lipoprotein of unknown function LprF [Mycobacterium canetMNGLISQARGSHRPRRPSSLGAVAILIAATLFATVVAGCGKKPTTASSPS
PGSPSPEAQQILQDSSKATKGLHSVHVVVTVNNLSTLPFESVDADVTNQP
QGNGQAVGNAKVRMKPNTPVVATEFLVTNKTMYTKRGGDYVSVGPAEKIY
DPGIILDKDRGLGAVVGQVQNPTIQGREAIDGLATVKVSGTIDAAVIDPI
VPQLGKGGGTLPITLWIVDTNASTPAPAANLVRMVIDKDQGNVDITLSNW
GAPVTIPNPAG
433634431YP_007268058.1 Transposase [Mycobacterium canettii CIPT 140070017]MKNIAVGSRVKVSADGYGVVSHAGMAMVRELADRSGLSAQVTAALADTYR
GPWVYAPGEVFADLAVAVADGADCIDAVGQLCGDREHVLGAKASTTTMWR
LIDERIDAGHLPRVRAARAAARAAAWAAGAAPEAGQWLHIDIDATLVIDH
SDNKEKAGATWKKSFGHHPLLAFLDRPEIAGGEALAGLLRPGGAGSNTAA
DHVSVLAQALAGLPARWRPDPDHRDDPDKPAVLVRCDTAGATHDFADACR
AAGVGFSFGYPVDWRGQDAVDTLNIGQCWYPAIDTDGGIRDGAWVAEATN
LVNLSAWPAGTRLILRKERPHPGAQLRFTDADGMRVTAFITDTPPGVVAG
QVAGLELRHRQHARIEDRIRELKATGLRNLPCHAFDANAAWLEIVLAAAD
LVTWCRLIGFTGHPGLTRAEINTFRYRVLHVAARITRGARRTRLRIDATW
RWAAAIATAWQRVRTAFG
433634429YP_007268056.1 Anti-anti-Sigma factor RsfA (anti-sigma factor antagonist) (regulatMNPTQAGSFTTPVSNALKATIQHHDSAVIIHARGEIDAANEHTWQDLVTK
AAAATTAPEPLVVNLNGLDFMGCCAVAVLAHEAERCRRRGVDVRLVSRDR
AVARIIHACGYGDVLPVHPTTESALSAT
433634427YP_007268054.1 Conserved membrane protein of unknown function [Mycobacterium canetMAETTEPASDAGTSQADAMALAAEAEAAEAEALAAAARARARAARLKREA
LAMAPAGDEDVPEDYADWEDAEDYDDYEAADQEAARPASWRRRLRVRLPR
LSTIAMAAAVVIICGFTGLSGYIVWQHHEATERQQRAAAFAAGAKQGVIN
MTSLDFNKAKEDVARVIDSSTGEFRDDFQQRAADFTKVVEQSKVVTEGTV
NATAVESMNEHSAVVLVAATSRVTNSAGAKDEPRAWRLKVTVTEEGGQYK
MSKVEFVP
433634425YP_007268052.1 Conserved protein of unknown function- PPE family [Mycobacterium caMDFGALPPEINSARMYAGPGSASLVAAAQMWDSVASDLFSAASAFQSVVW
GLTVGSWIGSSAGLMVAAASPYVAWMSVTAGQAELTAAQVRVAAAAYETA
HGLTVPPPVIAENRAELMILIATNLLGQNTPAIAVNEAEYGEMWAQDAAA
MFGYAATAATATATLLPFEEAPEMTSAGGLLEQAVAVEEAIDTAAANQLM
NNVPQALQQLAQPTKSIWPFDQLSELWKAISPHLSPLSNIVSMLNNHVSM
TNSGVSMASTLHSMLKGFAPAAAQAVQTAAQNGVQAMSSLGSQLGSSLGS
SGLGAGVAANLGRAASVGSLSVPQAWAAANQAVTPAARALPLTSLTSAAQ
TAPGHMLGGLPLGQLTNSGGGFGGVSSALRMPPRAFVMPRVPAAG
433634423YP_007268050.1 Putative transcriptional regulatory protein [Mycobacterium canettiiMFMALCAPMLERMNGLHTDDAPVNWLERRGGRLTSRRRVTLLHAGVEHPM
RLWGVQSEAITVAMVLSRKVSAIIAGHCGVRLVDQGVGDGFVAAFAHASD
AVACALELHQAPLSPIVLRIGIHTGEAQLVDERIYAGATMNLAAELRDLA
HGGQTVMSGATEDAVLGRLPIRAWLIGLRPMEGSPEGHNFPQSQRIAQLC
HPNLRNTFPPLRMRIADASGIPYVGRILVNVQVVPHWEGGCAAAGMVLAG
433634421YP_007268048.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MDRCCQRATAFACALRPTKLIDYEEMFRGAMQARAMVANPDQWADSDRDQ
VNTRHCLSTSMRVALDRGEFFLVYQPIIRLADNRIIGAEALLRWEHPTLG
TLLPGRFIDRAEDNGLMVPLTAFVLEQACRHVRSWRDHSTDPQPFVSVNV
SASTICDPGFLVLVEGVLGETGLPAHALQLELAEDARLSGDEKAVTRLQE
LSALGVGIAIDDFGIGFSSLAYLPRLPVDVVKLGGKFIECLDGDIQARLA
NEQITRAMIDLGDKLGITVTAKLVETPSQAARLRAFGCKAAQGWHFAKAL
PVDFFRE
433634419YP_007268046.1 Putative molybdopterin biosynthesis protein MoeY [Mycobacterium canMTIPHEGGSTGILVLRDDDHDDGLVLDRLRSDPSIEFVDRFAEQLAGVRR
LLPQPDPDLLEEAKRWAYYPWRRMVVAILGPRGFRAVRLDRNRHLITTEE
QRALHALRVGVVGLSAGHAIAYTLAAEGACGTLRLADFDKIELSNLNRVP
VGVFDIGLNKAMIAARRIAELDPYLAVDLVTSGLSPESVDEFLDGLDVVI
EECDSLDIKVILRQAACARGVPVLMATSDRGLVDVERYDVEPGRPIFHGL
LGDIDADKLCGLTTKDKVPHVLNILDCQELSARCAASMIEVDQTLWGWPQ
LAGDIWVGAATVAEAVRRIGLGEPLESGRVRVDVSAALDRLDQPPMPSRG
NGWLLESVPPTAPAEPQPTSEIVAQAAIRAPSGGNVQPWHVVAKQHSLTI
RLAPEHTSAMDIAFRGSAVAVGAAMFNARVAAAAHRVLGSVEFDESQPDS
PLQATMHFGRGDDPSLAALYRPMLLRTTNRHHGMPGHVHPATVELLTNTA
AAEGARLQLLLSRNEIDRAATILAAADRIRYLTPRLHEEMMSELRWPGDP
SLDAGIDVRSLELDSGELRVLDILRRSDVVARLAQWDCGTALEDNTNERV
SASSALAIVYVDGATLTDFARGGSAMQAVWIVAQQHGLAVQPMSPIFLYA
RGRHDLDQASPHFAAQLHRLQLDFRELVKPGKEGHEVLIFRLFHAPPPSV
CSRRRVRHAIPEPHR
433634417YP_007268044.1 Putative transcriptional regulatory protein [Mycobacterium canettiiMQTTPGNRQRRQRGSINPEDIISGAFELAQQVSIDNLSMPLLGKHLGVGV
TSIYWYFRKKDDLLNAMTDRALSKYVFATPYIEAGDWRETLRNHARSMRK
TFADNPVLCDLILIRAALSPKTARLGAQEMEKAIANLVTAGLSLEDAFDI
YSAVSVHVRGSVVLDRLSRKSQSADSGPSAIEHPVAIDPATTPLLAHATG
RGHRIGAPDETNFEYGLECILDHAGRLIEQSSKAAGEVAVRHPTATADAP
TPGARAKAVAR
433634415YP_007268042.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MTPRSLPRYGNSSRRKSFPMHRPSNVATATRKKSSIGWVLLACSVAGCKG
IDTTEFILGRAGAFELAVRAAQHRHTYLTMVNVGRAPPRRCRTVCMAATD
TPRNIRLNG
433634413YP_007268040.1 Putative drugs-transport transmembrane ATP-binding protein ABC tranMIRTWIALVPNDHRARLVGFALLAFGSVVARAVGTVLLVPLVAALFGEAP
QRAWLWLGWLSAATVAGWVLDAVTARIGIELGFAVLNHTQHDVADRLPVV
RLDWFTAENTATARQAIAATGPELIGLVVNLVTPLTSAILLPAVIALALL
PISWQLGVAALAGVPLLLGALWASAAFARRADTAADKANTALTERIIEFA
RTQQALRAARRVEPARSLVGNALASQHTATMRLLGMQIPGQLLFSIASQL
ALIVLAGTTAALTITGALTVPEAIALIVVMVRYLEPFTAVSELAPALEST
RATLGRIGSVLTAPVMVAGSGTWRDGAVVGRIEFDDVAFGYDGGSGPVLD
GVSFCLQPGTTTAIVGPSGCGKSTILALIAGLHQPTRGRVLIDGTDVATL
DARTQQAVCSVVFQHPYLFHGTIRDNVLAADPGASDDQFAQAVRLARVDE
LIARLPDGANTIVGEAGSALSGGERQRVSIARALLKAAPVLLVDEATSAL
DAENEAAVVDALAADPRSRTRVIVAHRLASIRHADRVLFVDDGRVVEDGS
IAELLTAGGRFSQFWRQQHEAAEWQILAE
433634411YP_007268038.1 Gcn5-related N-acetyltransferase [Mycobacterium canettii CIPT 14007MTKPTSAGQADDALVRLARERFDLPDQVRRLARPPVPSLEPPYGLRVAQL
TDAEMLAEWMNRPHLAAAWEYDWPASRWRQHLNAQLEGTYSLPLIGSWHG
ADGGYLELYWAAKDLISHYYDADPYDLGLHAAIADLSKVNRGFGPLLLPR
IVANVFAAEPRCRRIMFDPDHRNTATRRLCEWAGCKFLGEHDTTNRRMAL
YALEAPTTAA
433634409YP_007268036.1 Putative polyketide synthase FadD33 [Mycobacterium canettii CIPT 14MSELAAVLTRSMQASAGDLMVLDRETSLWCRHPWPEVHGLAESVAAWLLD
HDRPAAVGLVGEPTVELVAAIQGAWLAGAAVSILPGPVRGANDQRWADAT
LTRFIRIGVRTVLSQGSYLARLQSVDTAGVTIGDLSTAAYTNRSATPVAS
EGPAVLQGTAGSTGAPRTAILSPGAVLSNLRGLNQRVGTDAATDVGCSWL
PLYHDMGLAFVLSAALAGAPLWLAPTAAFTASPFRWLSWLSDSGATMTAA
PNFAYNLIGKYARRVSEVDLGALRVALNGGEPVDCDGLTRFAEVMAPFGF
DAGAVLPSYGLAESTCAVTVPVPGIGLLADRVIDGSGAHKHAVLGNPIPG
MEVRISCGDQAAGNASREIGEIEIRGASMMAGYLGQQPINPDDWFATGDL
GYLGAGGLVVCGRAKEVISIAGRNIFPTEVELVAAQVRGVREGAVVALGT
GDRSTRPGLVVAAEFRGPDEANARAELIQRVASECGVVPSDVVFVSPGSL
PRTSSGKLRRLAVRRSLEMAD
433634407YP_007268034.1 Conserved membrane lipoprotein of unknown function- LprD [MycobacteMSPTRRRRPALIALVIIATCGCLALGWWQWTRFQSTSGTFQNLGYALQWP
LFAWFCVYAYRNFVRYEETPPQPPTGGAAAEIPAGLLPERPKPAQQPPDD
PALREYNAYLAELAKDDAKKQNRTTA
433634405YP_007268032.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MALVTKLLVASRNRKKLAELRRVLDGAGLSGLTLLSLGDVSPLPETPETG
ATFEDNALAKARDAFSATGLASVADDSGLEVAALGGMPGVLSARWSGRYG
DDAANTALLLAQLCDVPDERRGAAFVSACALVSGSGEVVVRGEWPGTIAR
EPRGDGGFGYDPVFVPYGDDRTAAQLSPAEKDAVSHRGRALALLLPALRS
LATG
433634403YP_007268030.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MRRCIPHRCIGHGTVVSVRITVLGCSGSVVGPDSPASGYLLRAPHTPPLV
IDFGGGVLGALQRHADPASVHVLLSHLHADHCLDLPGLFVWRRYHPSRPS
GKALLYGPSDTWSRLGAASSPYGGEIDDCSDIFDVHHWADSEPVTLGALT
IVPRLVAHPTESFGLRITDPSGASLAYSGDTGICDQLVELARGVDVFLCE
ASWTHSPKHPPDLHLSGTEAGMVAAQAGVRELLLTHIPPWTSREDVISEA
KAEFDGPVHAVVCDETFEVRRAG
433634401YP_007268028.1 Conserved membrane protein of unknown function [Mycobacterium canetMGMTPRRKRRGGAVQITRPTGHPRTPTTQTTKRPRWVVGGTTILTFVALL
YLVELIDQLSGSRLDVNGIRPLKTDGLWGVIFAPLLHANWHHLMANTIPL
LVLGFLMTLAGLSRFVWATAIIWILGGLGTWLIGNVGSSCGPTDHIGASG
LIFGWLAFLLVFGLFVRKGWDIVIGLVVLFVYGGILLGAMPVLGQCGGVS
WQGHLSGAVAGVVAAYLLSAPERKARALKRAGARSGHPKL
433634399YP_007268026.1 Conserved protein of unknown function- 9.5 kDa culture filtrate antMNVTVSIPTILRPHTGGQKSVSASGDTLGAVISDLEANYSGISERLMDPS
CPGKLHRFVNIYVNDEDVRFSGGLATAIADGDSVTILPAVAGG
433634397YP_007268024.1 Putative hydrolase [Mycobacterium canettii CIPT 140070017]MNSITDVGGIRVGHYQRLDPDASLGAGWACGVTVVLPPPGTVGAVDCRGG
APGTRETDLLDPANSVRFVDALLLAGGSAYGLAAADGVMRWLEEHRRGVA
MGSGVVPIVPGAVIFDLPVGGWNCRPTADFGYSACAAAGVDVAVGTVGVG
VGARAGALKGGVGTASATLQSGVTVGVLAVVNAAGNVVDPATGLPWMADL
VGEFALRAPPAEQIAALAQLSSPLAAFNTPFNTTIGVIACDAALSPAACR
RIAIAAHDGLARTIRPAHTPLDGDTVFALATGAVAVPPEAGVPAALSPET
QLVTAVGAAAADCLARAVLAGVLNAQPVAGIPTYRDTFPGAFGA
433634395YP_007268022.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MAVVSAPAKPGTTWQRESAPVDVTDRAWVTIVWDDPVNLMSYVTYVFQKL
FGYSEPHATKLMLQVHNEGKAVVSAGSRESMEVDVSKLHAAGLWATMQQD
R
433634393YP_007268020.1 ATP-dependent helicase DinG [Mycobacterium canettii CIPT 140070017]MSKSVSMSVPELLAIAVSALGGARRRGQQEMAAAVAHAFETGEHLVVQAG
TGTGKSLAYLVPAIIRALCDDAPVVVSTATIALQRQLVDRDLPRLVDSLT
DALPRRPKFALLKGRRNYLCLNKIHNSVTASDHDDERPQEELFDPVAVTA
LGRDVQRLTAWASTTVSGDRDDLKPGVGDRSWSQVSVSARECLGVARCPF
GSECFSERARGAAGRADVVVTNHALLAIDAVAESAVLPEHRLLVVDEAHE
LADRVTSVAAAELTSGTLGMAARRITRLVDPKVTQRLQAASATFTSAIHD
ARPGRIDYLDDEMATYLSALRDAASAARSAIDTGSDTKTASVRAEAGAVL
TEISDTASRILASFAPAIPDRTDVVWLEHDDNHESARVVLRVAPLSVAEL
LATQVFARATTVLTSATLTIGGSFDAMATAWGLTADTPWRGLDVGSPFQH
AKSGILYVAAHLPPPGRDGSGSAEQLTEIAELITAAGGRTLGLFSSMRAA
RAATEAMRERLSTPVLCQGDDSTSTLVEKFTADAATSLFGTLSLWQGVDV
PGPSLSLVLIDRIPFPRPNDPLLSARQRAVAARGGNGFMTVAASHAALLL
AQGSGRLLRRVTDRGVVAVLDSRMATARYGEFLRASLPPFWQTTNATQVR
AALRRLARADAKAH
433634391YP_007268018.1 Putative glucanase GlgE [Mycobacterium canettii CIPT 140070017]MSGRAIGTETEWWVPGRVEIDDVAPVVSCGVYPAKAVVGEVVPVSAAVWR
EGHEAVAATLVVRYLGVRYPHLTDGPRARVVPTPSEPQQRVKPLLIPMMS
GQEPFVFHGQFTPDRVGLWTFRVDGWGDPIHTWRHGLIAKLDAGQGETEL
SNDLLVGAVLLERAATGVPRGLRDPLLAAAAALRTPGDPVTRTALALTPE
IEELLADHPLRDLVTRGEQFGVWVDRPLARFGAWYEMFPRSTGGWDDDGN
PVHGTFATAAAELPRIAGMGFDVVYLPPIHPIGKVHRKGRNNSPTAAPTD
VGSPWAIGSDEGGHDTVHPSLGTIDDFDDFVSAACDLGMEVALDLALQCA
PDHPWAREHRQWFTELPDGSIAYAENPPKKYQDIYPLNFDNDPEGLYDEV
LRVVQHWVNHGVKFFRVDNPHTKPPNFWAWLIAQVKTVDPDVLFLSEAFT
PPARQYGLAKLGFTQSYSYFTWRTTKWELTEFGNQIAELADYRRPNLFVN
TPDILHAVLQHNGPGMFAIRAVLAATMSPAWGMYCGYELFEHRAVREGSE
EYLDSEKYELRPRDFASALDQGRSLQPFITRLNTIRRLHPAFQQLRTIHF
HHVDNDALLAYSKFDPATGDCVLVVVTLNAFGPEEATLWLDMAVLGMEDY
DRFWVRDEITGEEYQWGQANYIRIDPARAVAHIINMPAVPYESRNTLLRR
R
433634389YP_007268016.1 Conserved protein of unknown function PE-PGRS family protein PE_PGRMANIRTALEAANAAALAPTTELLAAGADEVSAAVASLFAAHGNGYQALSA
QMTAFHAQFVHTLTSGAGAYAAADAASAAPLEGLLNVVNTPTQLLLGRPL
IGNGASGAPGTGQAGGAGGLLYGNGGAGGSGAPGQPGGPGGVAGLFGNGG
TGGAGGDGLGNGAAGGAGGAGGILFGSGGAGGPGGVGNTGTGGLGGDGGA
AGFFGAGGIGGAGGPGFNGGAGGTGGRSGLFEVLAAGGAGGTGGLSVNGG
TGGTGGTGGGGGLFSNGGTGGAGGFGISGSAGGSGGTGGDGGTFAGNGGA
GGTGGTGTGNQLVGGEGGAGGAGGNAGILFGAGGVGGAGGTGLGAPDPGG
TGGKGGVGGIGGAGALFGPGGAGGTGGFGDSSADGLAGGIGGAGGNGGAA
KLIGDGGAGGTGGDSLRGAAGKGGTGGASGLLGDGGAGGAGGTGIEIGSV
GGAGGAGGNAAGLSGAGGAGGAGGFGETAGDGGAGGNAGLFIGDGGDGGV
GGLGIAGDGGNGGKGGKAGLVGSGGDGGTGGASVVANGGAGGSGGNATLL
GNGGNGGNGGLGAAPGAGGAGGAAGLFGLNGSPGLS
433634387YP_007268014.1 Putative Acetyl-CoA acetyltransferase FadA4 (Acetoacetyl-CoA ThiolaMIVAGARTPIGKLMGSLKDFSASELGAIAIKGALEKANVPASLVEYVIMG
QVLTAGAGQMPARQAAVAAGIGWDVPALTINKMCLSGIDAIALADQLIRA
REFDVVVAGGQESMTKAPHLLMNSRSGYKYGDVTVLDHMAYDGLHDVFTD
QPMGALTEQRNDVDMFTRSEQDEYAAASHQKAAAAWKDGVFADEVIPVNI
PQRTGDPLQFTEDEGIRANTTAAALAGLKPAFRNDGTITAGSASQISDGA
AAVVVMNQEKAQELGLTWLAEIGAHGVVAGPDSTLQSQPANAINKALDRE
GISVDQLDVVEINEAFAAVALASIRELGLNPQIVNVNGGAIAVGHPLGMS
GARITLHVALQLARRGSGVGVAALCGAGGQGDALILRAG
433634385YP_007268012.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MARRRKPLHQQRPELPSWALRRVEVGPDGHTYEVRPVAAARAVKTYRCPG
CDHEIRSGTAHVVVWPTDLAQAGVDDRRHWHTPCWANRATRGPTRKWT
433634383YP_007268010.1 Putative adenylate cyclase (ATP pyrophosphate-lyase) (adenylyl cyclMPSEKSATRHLPGAVETLSPRTGPRPETPAYGSWLLGRVSESPRMRRIRI
QGMLTVAILVTNVIGLIVGAVLLTVAFPKPSVILDAPHWVSFGIVPGYCV
LAFALGTYWLTRQTARALRWAIEERTPSHDEARNAFLVPMRVALAVLFLW
GAAAALWTIIYGLANRLFIPRFLFSMGVIGVVAATSCYLLTEFALRPMAA
QALEVGATPRSLVRGIVGRTMLVWLLCSGVPNVGVALTAIFDDTFWELSN
DQFMITVLILWAPLLIFGFILMWILAWLTATPVRVVREALNRVEQGDLSG
DLVVFDGTELGELQRGFNRMVEGLRERERVRDLFGRHVGREVAAAAERER
PKLGGEERHVAVVFVDIVGSTQLVTSRPAAEVVMLLNRFFTVIVDEVNHH
RGLVNKFQGDASLAVFGAPNRLSHPEDAALATARAIADRLASEMPECQAG
IGVAAGQVVAGNVGAHERFEYTVIGEPVNEAARLCELAKSYPSRLLASSQ
ALRGASENECARWSLGETVTLRGHDQPIRLASPVQRLQMPAQSADIVGGA
LGDHQTHTIYRGAHPTD
433634381YP_007268008.1 Putative adenylate cyclase (ATP pyrophosphate-lyase) (adenylyl cyclMSAKKSTAQRLGRVLETVTRQSGRLPETPAYGSWLLGRVSESQRRRRVRI
QVMLTALVVTANLLGIGVALLLVTIAIPEPSIVRDAPRWLTFGVVPGYVL
LALALGSYALTRQTVQALRWAIEGRKPTREEERRTFLAPWRVAVGHLMFW
GVGTALLTTLYGLINNAFIPRFLFAVSFCGVLVATATYLHTEFALRPFAA
QALEAGPPPRRLAPGILGRTMVVWLLGSGVPVVGIALMAMFEMVLLNLTR
MQFATGVLIISMITLVFGFILMWILAWLTATPVRVVRAALRRVERGELRT
NLVVFDGTELGELQRGFNAMVAGLRERERVRDLFGRHVGREVAAAAERER
SKLGGEERHVAVVFIDIVGSTQLVTSRPPADVVKLLNKFFAIVVDEVDRH
HGLVNKFEGDASLTIFGAPNRLPCPEDKALAAARAIADRLVNEMPECQAG
IGVAAGQVIAGNVGARERFEYTVIGEPVNEAARLCELAKSRPGKLLASAQ
AVDAASEEERARWSLGRHVKLRGHDQPVRLAKPVGLTKPRR
433634379YP_007268006.1 Methylated-DNA--protein-cysteine methyltransferase [Mycobacterium cMIHYRTIDSPIGPLTLAGHGSVLTNLRMLEQTYEPSRTHWTPDPGAFSGA
VDQLNAYFAGELTEFDVELDLRGTDFQQRVWKALLTIPYGETRSYGEIAD
QIGAPGAARAVGLANGHNPIAIIVPCHRVIGASGKLTGYGGGINRKRALL
ELEKSRAPADLTLFD
433634377YP_007268004.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MAVHLTRIYTRTGDDGTTGLSDMSRVAKTDARLVAYADCDEANAAIGAAL
ALGHPDTQITDVLRQIQNDLFDAGADLSTPIVENPKHPPLRITQSYIDRL
EGWCDAYNAGLPALKSFVLPGGSPLSALLHVARTVVRRAERSAWAAVDAH
PEGVSVLPAKYLNRLSDLLFILSRVANPDGDVLWRPGGDRTAS
433634375YP_007268002.1 Putative ATP synthase Epsilon chain AtpC [Mycobacterium canettii CIMAELNVEIVAVDRNIWSGTAKFLFTRTTVGEIGILPRHIPLVAQLVDDAM
VRVEREGEKDLRIAVDGGFLSVTEEGVSILAESAEFESEIDEVAAKQDSE
SDDPRIAARGRARLRAVGAID
433634373YP_007268000.1 Putative ATP synthase gamma chain AtpG [Mycobacterium canettii CIPTMAATLRELRGRIRSAGSIKKITKAQELIATSRIARAQARLESARPYAFEI
TRMLTTLAAEAALDHPLLVERPEPKRAGVLVVSSDRGLCGAYNANIFRRS
EELFSLLREAGKQPVLYVVGRKAQNYYSFRNWNITESWMGFSEQPTYENA
AEIASTLVDAFLLGTDNGEDQRSDSGEGVDELHIVYTEFKSMLSQSAEAH
RIAPMVVEYVEEDIGPRTLYSFEPDATMLFESLLPRYLTTRVYAALLESA
ASELASRQRAMKSATDNADDLIKALTLMANRERQAQITQEISEIVGGANA
LAEAR
433634371YP_007267998.1 Putative ATP synthase Delta chain AtpH [Mycobacterium canettii CIPTMSTFIGQLFGFAVIVYLVWRFIVPLVGRLMSARQDTVRQQLADAAAAADR
LAEASQAHTKALADAKSEAHRVVEEARTDAERIAEQLEAQADVEAERIKM
QGARQVDLIRAQLTRQLRLELGHESVRQARELVRNHVADQAQQSATVDRF
LDQLDAMAPATADVDYPLLAKMRSASRRALTSLVDWFGTMAQDLDHQGLT
TLAGELVSVARLLDREAVVTRYLTVPAEDATPRIRLIERLVSGKVGAPTL
KVLRTAVSKRWSANSDLIDAIEHVSRQALLELAERAGQVDEVEDQLFRFS
RILDVQPRLAILLGDCAVPAEGRVRLLRKVLERADSTVNPVVVALLSHTV
ELLRGQAVEEAVLFLAEVAVARRGEIVAQVGAAAELSDAQRTRLTEVLSR
IYGHPVTVQLHIDAALLGGLSIAVGDEVIDGTLSSRLAAAEARLPD
433634369YP_007267996.1 Putative ATP synthase C chain AtpE (lipid-binding protein) (dicycloMDPTIAAGALIGGGLIMAGGAIGAGIGDGVAGNALISGVARQPEAQGRLF
TPFFITVGLVEAAYFINLAFMALFVFATPVK
433634367YP_007267994.1 Conserved membrane protein of unknown function [Mycobacterium canetMTTPAQDAPLVFPSVAFRPVRLFFINVGLAAVAMLVAGVFGHLTVGMFLG
LGLLLGLLNALLVRRSAESITAKEHPLKRSMALNSASRLAIITILGLIIA
YIFGPAGLGVVFGLAFFQVLLVATTALPVLKKLRTATEEPVATYSSNGQS
GGSEGRSASDD
433634365YP_007267992.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MTETFDCADPEQRSRGIVSAVGAIKAGQLVVMPTDTVYGIGADAFDSSAV
AALLSAKGRGRDMPVGVLVGSWHTIEGLVYSMPDGARELIRAFWPGALSL
VVVHAPSLQWDLGDAHGTVMLRMPLHPVAIELLREVGPMAVSSANISGHP
PPVDAEQARSQLGDHVAVYLDAGPSEQQAGSTIVDLTGATPRVLRQGPVS
TERIAEVLGVDAASLFG
433634363YP_007267990.1 Peptide chain release factor RF-1 [Mycobacterium canettii CIPT 1400MTQPVQTIDVLLAEHAELELALADPALHSNPAEARRVGRRFARLAPIVAT
HRKLTSARDDLETARELVASDESFAAEVAALEARVGELDAQLTDMLAPRD
PHDADDIVLEVKSGEGGEESALFAADLARMYIRYAERHGWAVTVLDETTS
DLGGYKDATLAIASKADTPDGVWSRMKFEGGVHRVQRIPVTESQGRVHTS
AAGVLVYPEPEEVGEVQIDESDLRIDVFRSSGKGGQGVNTTDSAVRITHL
PTGIVVTCQNERSQLQNKTRALQVLAARLQAMAEEQALADASADRASQIR
TVDRSERIRTYNFPENRITDHRIGYKSHNLDQVLDGDLDALFDALAAADK
QSRLRQS
433634361YP_007267988.1 Putative transcription termination factor Rho homolog [MycobacteriuMTDTDLITAGESTDGKPSDAAATDPPDLNADEPAGSLATMVLPELRALAN
RAGVKGTSGMRKNELIAAIEEIRRQANGALAVDRSAQEHDKGDRPPSSEA
PATQGEQTPTEQIDSQGQQVRPERRSATREAGPSGSGERAGTAADDTDNR
QGGQQDAKTEERGTDAGGDQGGDQQASGGQQARGDEDGEARQGRRGRRFR
DRRRRGERSGDGAEAELREDDVVQPVAGILDVLDNYAFVRTSGYLPGPHD
VYVSMNMVRKNGMRRGDAVTGAVRVPKEGEQPNQRQKFNPLVRLDSINGG
SVEDAKKRPEFGKLTPLYPNQRLRLETSTERLTTRVIDLIMPIGKGQRAL
IVSPPKAGKTTILQDIANAITRNNPECHLMVVLVDERPEEVTDMQRSVKG
EVIASTFDRPPSDHTSVAELAIERAKRLVEQGKDVVVLLDSITRLGRAYN
NASPASGRILSGGVDSTALYPPKRFLGAARNIEEGGSLTIIATAMVETGS
TGDTVIFEEFKGTGNAELKLDRKIAERRVFPAVDVNPSGTRKDELLLSPD
EFAIVHKLRRVLSGLDSHQAIDLLMSQLRKTKNNYEFLVQVSKTTPGSMD
SD
433634359YP_007267986.1 Homoserine kinase ThrB [Mycobacterium canettii CIPT 140070017]MVTQALLPSGLVASAVVAASSANLGPGFDSVGLALSLYDEIIVETTDSGL
TVTVDGEGGDQVPLGPEHLVVRAVQHGLQAAGVSAAGLAVRCRNAIPHSR
GLGSSAAAVVGGLAAVNGLVVQTDSSPSSDAELIQLASEFEGHPDNAAAA
VLGGAVVSWTDHSGDRPNYSAVSLRLHPDIRLFTAIPEQRSSTAETRVLL
PAQVSHDDARFNVSRAALLVVALTERPDLLMAATEDLLHQPQRAAAMTAS
AEYLRLLRRHNVAAALSGAGPSLIALSTDSELPTDAVEFGAAKGFAVTEL
TVGEAVRWSPTVRVPG
433634357YP_007267984.1 Putative homoserine dehydrogenase ThrA [Mycobacterium canettii CIPTMPGDEKPVGVAVLGLGNVGSEVVRIIENSAEDLAARVGAPLVLRGIGVRR
VTTDRGVPIELLTDDIEELVAREDVDIVVEVMGPVEPSRKAILGALERGK
SVVTANKALLATSTGELAQAAESAHVDLYFEAAVAGAIPVIRPLTQSLAG
DTVLRVAGIVNGTTNYILSAMDSTGADYASALADASALGYAEADPTADVE
GYDAAAKAAILASIAFHTRVTADDVYREGITKVTPADFGSAHALGCTIKL
LSICERITTDEGSQRVSARVYPALVPLSHPLAAVNGAFNAVVVEAEAAGR
LMFYGQGAGGAPTASAVTGDLVMAARNRVLGSRGPRESKYAQLPVAPMGF
IETRYYVSMNVADKPGVLSAVAAEFAKREVSIAEVRQEGVVDEGGRRVGA
RIVVVTHLATDAALSETVDALDDLDVVQGVSSVIRLEGTGL
433634355YP_007267982.1 Putative arginyl-tRNA synthetase ArgS (ARGRS) (arginine--tRNA ligasMTPADLAELLKATAAAVLAERGLDASALPQMVTVERPRIPEHGDYASNLA
MQLAKKVGTNPRELAGWLAEALTKVDGIASAEVAGPGFINMRLKTAAQAK
VVTNVIDAGHSYGHSLLLAGRKVNLEFVSANPTGPIHIGGTRWAAVGDAL
GRLLTTQGADVVREYYFNDHGAQIDRFANSLIAAAKGEPTPQDGYAGSYI
TNIAEQVLQKAPDALSLPDAELRETFRAIGVDLMFDHIKQSLHEFGTDFD
VYTHEDSMHTGGRVENAIARLRETGNIYEKDGATWLRTSAFGDDKDRVVI
KSDGKPAYIAGDLAYYLDKRQRGFDLCIYMLGADHHGYIARLKAAAAAFG
DDPAIVEVLIGQMVNLVRDGQPVRMSKRAGTVLTLDDLVEAIGVDAARYS
LIRSSVDTAIDIDLALWSSASNENPVYYVQYAHARLSALARNAAELALIP
DTNHLELLNHDKEGTLLRTLGEFPRVLETAASLREPHRVCRYLEDLAGDY
HRFYDSCRVLPQGDEQPTDLHTARLALCQATRQVIANGLAIIGVTAPERM
433634353YP_007267980.1 Conserved membrane protein of unknown function [Mycobacterium canetMTATSMLNRRKAILDYLQGAVWVLPTFGVAIGLGSGAVLSMIPVKSGTLI
DKLMFQGTPGDARGVLIVVSATMITTIGIVFSLTVLSLQIASSQFSVRLL
RTFLRDVPNQVVLAIFACTFAYSTGGLHTVGEHRDGGAFIPKVAVTGSLA
LAFVSIAALIYFLHHLMHSIQIDTIMDKVRLRTLGLVDQLYPESDTADRQ
VETPPSPPADAVPLLAPHSGYLQTVDVDDIAELAAASRYTALLVTFVGDY
VTAGGLLGWCWRRGTAPGAPGSDFPQRCLRHVHIGFERTLQQDIRFGLRQ
MVDIALRALSPALNDPYTAIQVVHHLSAVESVLASRALPDDVRRDRAGEL
LFWLPYPSFATYLHVGCAQIRRYGSREPLVLTALLQLLSAVAQNCVDPSR
RVAVQTQIALVVRAAQREFADESDRAMVLGAAARATEVVERPGTLAPPPS
TFGQVAAAQAAASTIRSADRDG
433634351YP_007267978.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MVRTHTVVAGETLSALALRFYGDAELYRLIAAASGIADPDVVNVGQRLIM
PDFTRYTVVAGDTLSALAARFYGDAELHWLIAAASGIADPDVVNVGQRLI
MPDFTRYTVVAGDTLSALAARFYGDASLYPLIAAVNGIADPGAIDVGQVL
VIFIGRSDGFGLRIVDRNENDPRLWYYRFQTSAIGWNPGVNVLLPDDYRT
SGRTYPVLYLFHGGGTDQDFRTFDFLGIRDLTAGKPIIVVMPDGGHAGWY
SNPVSSFVGPRNWETFHIAQLLPWIEANFRTYAEYDGRAVAGFSMGGFGA
LKYAAKYYGHFASASSHSGPASLRRDFGLVVHWANLSSAVLDLGGGTVYG
APLWDQARVSADNPVERIDSYRNKRIFLVAGTSPDPANWFDSVNETQVLA
GQREFRERLSNAGIPHESHEVPGGHVFRPDMFRLDLDGIVARLRPASIGA
AAERAD
433634349YP_007267976.1 Putative bifunctional enzyme CysN/CysC [Includes: Sulfate adenylyltMTTLLRLATAGSVDDGKSTLIGRLLYDSKAVMEDQWASVEQTSKDRGHDY
TDLALVTDGLRAEREQGITIDVAYRYFATPKRKFIIADTPGHIQYTRNMV
TGASTAQLVIVLVDARHGLLEQSRRHAFLASLLGIRHLVLAVNKMDLLGW
DQKKFDAIRDEFHAFAARLDVQDVTSIPISALHGDNVVTKSDQTPWYEGP
SLLSHLEDVYIAGDRNMVDVRFPVQYVIRPHTLDHQDHRSYAGTVASGVM
RSGDEVVVLPIGKTTRITAIDGPNGPVAEAFPPMAVSVRLADDIDISRGD
MIARTHNQPRITQEFDATVCWMADNAVLEPGRDYVVKHTTRTVRARIAGL
DYRLDVNTLHRDKTATALKLNELGRVSLRTQVPLLLDEYTRNASTGSFIL
IDPDTNGTVAAGMVLRDVSARTPSPNTVRHRSLVTAQDRPPRGKTVWFTG
LSGSGKSSVAMLVERKLLEKGISAYVLDGDNLRHGLNADLGFSMADRAEN
LRRLSHVATLLADCGHLVLVPAISPLAEHRALARKVHADAGIDFFEVFCD
TPLQDCERRDPKGLYAKARAGEITHFTGIDSPYQRPKNPDLRLTPDRSID
EQAQGVIDLLESSS
433634347YP_007267974.1 Putative Beta carbonic anhydrase [Mycobacterium canettii CIPT 14007MTVTDDYLANNVDYASGFKGPLPMPPSKHIAIVACMDARLDVYRMLGIKE
GEAHVIRNAGCVVTDDVIRSLAISQRLLGTREIILLHHTDCGMLTFTDDD
FKRDIQDETGIRPTWSPESYPDAVEDVRQSLRRIEVNPFVTKHTSLRGFV
FDVATGKLNEVTP
433634345YP_007267972.1 Putative oligopeptide-transport integral membrane protein ABC transMTEFASRRTLVVRRFLRNRAAVASLAALLLLFLSAYTLPPLLPYSYDDLD
FNALLQPPGTKHWLGTNALGQDLLAQTLRGMQKSMLIGVCVAVISTCIAA
TVGAISGYFGGWRDRALTWVVDLLLVVPSFILIAIVTPRTKNSANIMFLV
LLLAGFGWMISSRMVRGMTMSLREREFIRAARYMGVSSRRIIVGHVVPNV
ASILIIDAALNVAAAILAETGLSFLGFGIQPPDVSLGTLIADGTASATTF
PWVFLFPASILVLILVCANLTGDGLRDALDPASRSLRRGVR
433634343YP_007267970.1 Putative periplasmic oligopeptide-binding lipoprotein OppA [MycobacMADRGQRRGCAPGFESALRASFHGKSRPWTQTRYWAFALLTPLVVALVLT
GCSASGTQLELAPTADRRAAVGTTSDINPQDPATLQDGGNLRLSLTDFPP
NFNILHIDGNNAEVAAMMKATLPRAFIIGPDGSTTVDTNYFTSIELTRTS
PQVVTYTINPEAVWSDGTPITWRDIASQIHAISGADKAFEIASSSGAERV
ASVTRGVDDRQAVVTFAKPYAEWRGMFAGNGMLLPASMTATPEAFNKGQL
DGPGPSAGPFVVSALDRTAQRIVLTRNPRWWGARPRLDSITYLVLDDAAR
LPALQNNTIDATGVGTLDQLTIAARTKGISIRRAPGPSWYHFTLNGAPGS
ILADKALRLAIAKGIDRYTIAKVAQYGLTSDPVPLNNHVFVAGQEGYRDN
SGVVAYNPEQAKRELDALGWKLTGQFREKDGRQLVVRDLFYDAQSTRQFA
QIAQHTLAQIGVKLELQAKSGSGFFSDYVNVGAFDIAQFGWVGDAFPLSS
LTQIYASDGESNFGKIGSPQIDAAIERTLAELDPGKARALANQVDELIWA
EGFSLPLTQSPGTVAVRSTLANFGATGLADLDYTAIGFMRR
433634341YP_007267968.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MKLHRLALTNYRGIAHRDIEFPDHGVVVVCGANEIGKSSMVEALDLLLEY
KDRSTKKEVKQVKPTNADVGSEVSAEISSGPYRFVYRKRFHKRCETELTV
LAPRREQLTGDEAHERVQTMLAETVDTELWHAQRVLQAASTAAVDLSGCD
ALSRALDLAAGDDAALSGTEPLLIERIEAEYARYFTPTGRPTGEWSAAVS
RLAAAEAAVADCAAAVAEVDDGVRRHAELTEQVAELSQQLLAHQPRLEAA
RVAAEKIAAITDDAREAKLIATAAAATSGASTAAHAGRLGLLTEIDTRTA
AVVAAEAKARQTADEQATARAEAEACDAALTEATQVLTAVRVRAESARRT
LDQLADRQEADRLAARLARIDDIEGDRDRVCVELSAVTLTEELLSRIERA
AAAVDRGGAQLASISAAVEFTAAADIELGVGDQRVSLSAGQSWSVTATGP
TEVKVPGVLTARIVPGATALDLQAKYAAAQQELADALAAGEVADLAAARS
ADLYRRELLSRRDQLTATLAGLCGDEQVEQLRSRLEQLRAGQPAEPDLVS
TDTATARAELDAVEAARIAAEKDCEARRQIAAGAARRLAETSTRATVLQN
AAAAESAELGAAMTRLACERASVGDDELAAKAEADLRVLQTAEQRVIDLA
DELAATAPDAVAAELAEAADAVELLRDRHDEAIRALHEVGVELSVFGTQG
RKGKLDAAETEREHAASHHARVGRRARAARLLRSVMARHRDTTRLRYVEP
YRAELHRLGRPVFGPSFEVEVDTDLRIRSRTLDNRTVPYECLSGGAKEQL
GILARLAGAALVAKEDAVPVLIDDALGFTDPERLAKMGEVFDTIGADGQV
IVLTCSPTRYGGVKAAHRIDLDAIQ
433634339YP_007267966.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MRHAKSAYPDGIADHDRPLAPRGIREAGLAGGWLRANLPAVDAVLCSTAT
RARQTLAHTGIDAPARYAERLYGAAPGTVIEEINRVGDNVTTLLVVGHEP
TTSALAIVLASITGTDAAVAERISEKFPTSGIAVLRVAGHWADVEPGCAA
LVGFHVPR
433634337YP_007267964.1 Conserved lipoprotein of unknown function- LprB [Mycobacterium caneMRRKVRRLTLAVSALVALFPAVAGCSDSGDNKPGATIPSTPANAEGRHGP
FFPQCGGVSDQTVTELTRVTGLVNTAKNSVGCQWLAGGGILGPHFSFSWY
RGSPIGRERKTEELSRASVEDINIDGHSGFIAIGNEPSLGDSLCEVGIQF
SDDFIEWSVSFSQKPFPPPCDIAKELTRQSIANSK
433634335YP_007267962.1 Putative drugs-transport transmembrane ATP-binding protein ABC tranMSAPPGARPRAASPRPNMRSRDFWGSAVRLVKRLAPQRRLSIAVITLGIA
GTTIGVIVPRILGHATDLLFNGVIGRGLPGGITKAQAVASARARGDNTFA
DLLSGMNVVPGQGVDFAAVERTLALALALYLAAALMIWAQARLLNRTVQK
TMVRLRTDVEDKVHRLPLSYFDGQQRGELLSRVTNDIDNLQSSLSMTISQ
LVTSILTMVAVLAMMVSISGLLALITLLTVPLSLLVTRAITRRSQPLFVA
HWTSTGRLNAHLEETYSGFTVVKTFGHQAAARERFHELNDDVYQAGFGAQ
FLSGLVQPATAFIGNLGYVAVAVAGGLQVATGQITLGSIQAFIQYIRQFN
MPLSQLAGMYNALQSGVASAERVFDVLDEPEESPEPEPELPNLTGRVEFE
HVNFAYLPGTPVIRDLSLVAEPGSTVAIVGPTGAGKTTLVNLLMRFYEIG
SGRILIDGVDIASVSRQSLRSRIGMVLQDTWLYDGTIAENIAYGRPEATT
DEIVEAARAAYVDRFVHTLPAGYQTRVSGDGGSISVGEKQLITIARAFLA
RPQLLILDEATSSVDTRTELLIQRAMRELRRDRTSFIIAHRLSTIRDADH
ILVVQTGQIVERGNHAELLARRGVYYQMTRA
433634333YP_007267960.1 Conserved lipoprotein of unknown function- LprA [Mycobacterium caneMKHPPCSVVAAATAILAVVLAIGGCSTEGDAGKASDTAATASNGDAAMLL
KQATDAMRKVTGMHVRLAVTGDVPNLRVTKLEGDISNTPQTVATGSATLL
VGNKSEDAKFVYVDGHLYSDLGQPGTYTDFGNGASIYNVSVLLDPNKGLA
NLLANLKDASVAGSQQADGVATTKITGNSSADDIATLAGSRLTSEDVKTV
PTTVWIASDGSSHLVQIQIAPTKDTSVTLTMSDWGKQVTATKPV
433634331YP_007267958.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MTTSKIATAFKTATFALAAGAVALGLASPADAAAGTMYGDPAAAAKYWRQ
QTYDDCVLMSAADVIGQVTGREPSERAIIKVAQSTPSVVHPGSIYTKPAD
AEHPNSGMGTSVADIPTLLAHYGVDAVITDEDHATATGVATGMAALEQYL
GSGHAVIVSINAEMIWGQPVEETDSAGNPRSDHAVVVTGVDTENGIVHLN
DSGTPTGRDEQIPMETFVEAWATSHDFMAVTT
433634329YP_007267956.1 Conserved transmembrane ATP-binding protein ABC transporter subunitMTDTADMITPNAPRLELRAAGRTWHAVAGREWSIGRASEADIRLDNPRVS
RQHAVLEATPEGWVLVNLSTNGTFVDGQRVERLTVRQPITVFLGSASSGQ
RVQLYPVAQSPAPTPAPHSPAPPRPATPKPAQRQGETTVARPPTAFHAID
QLVVTIGRAPENTVVLNDLLVSRRHAILRRTGNRWELSDNASANGTYVNG
HRISRAVIGPTDIVGIGHQLLHLSGDRLVEYVDTGDISYQASNLRVVTNK
GRVLLADVSFVLPQRSLLAVVGPSGAGKSTLLGALTGFRPAGNGTVRYDE
RDLYDNYAELRHRIGFVPQDDILHTPLTVRRALNYAARLRFPQDVSVDER
NQRIEEVLVELGLSTQADQRIDSLSGGQRKRTSVALELLTKPSLLFLDEP
TSGLDPGYEKSVMQTLRKLADDGRSVVVVTHNIAHLNMCDRLLILAPGGR
LAYFGPPQQALGYFNCTDFADLFTLLEHDTSTDWTGRFNASPLREALIGH
PAMRPARPAAARHARPVAQQSAFAQFAILCRRYLAVIAADRQYAVFLLVL
PLLLSLFAHAVPGQAGLSLAKAIELKSTQPSQLLVLLIIGGALMGCAASI
REIVKERAIYRREHGIGLSRGAYLASKLVVLTALTSLQALILGFLGVALL
PPPDQSVILPWPSVEVAVAVVAVTVVSMMIGLLISAMIGNADRGMPLLVL
VVMAQLVLCGGMFGVSGRPPLEQLSWLSPSRWAYAVAAATVDLNDLRRTA
GGDQDPLWDYNVGSWLMAAGACAVQALVLVILIALQLKRIEPQRKARK
433634327YP_007267954.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MVLARPDAVFAPARNRCHVSLPVNAMSLQMKVCNHVIMKHHHMHGRRYGR
PGGWQQAQQPDASGAAEWFAGRLPEDWFDGDPTVIVDREEITVIGKLPGL
ESPEEESAARASGRVSRFRDETRPERMTIADEAQNRYGRKVSWGVEVGGE
RILFTHIAVPVMTRLKQPERQVLDTLVDAGVARSRSDALAWSVKLVGEHT
EEWLAKLRTAMSAVDDLRAQGPDLPA
433634325YP_007267952.1 Putative amidase AmiB2 (aminohydrolase) [Mycobacterium canettii CIPMDPTDLAFAGAAAQARMLADGALTAPMLLEVYLQRIERLDSHLRAYRVVQ
FDRARAEAEAAQQRLDAGERLPLLGVPIAIKDDVDIAGEVTTYGSAGHGP
VATSDAEVVRRLRAAGAVIIGKTNVPELMIMPFTESLAFGATRNPWCLNR
TPGGSSGGSAAAVAAGLAPVALGSDGGGSIRIPCTWCGLFGLKPQRDRIS
LEPHDGAWQGLSVNGPIARSVMDAALLLDATTTVPGPEGEFVAAAARQPG
RLRIALSTRAPTPLPVRCGKQELAAVHQAGALLRDLGHDVVVRDPDYPAS
TYANYLPRFLRGISDDADAQAHPDRLDARTRAIARLGSFFSDRRMAALRA
AEVVLSSRIQSIFDDVDVVLTPGAATGPSRIGAYQRRGAVSTLLLVVQRV
PYFQVWNLTGQPAAVVPWDFDDDGLPMSVQLVGRPYDEATLLALAAQIES
ARPWAHRRPSVS
433634323YP_007267950.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MDISRWLERHVGVQLLRLHDAIYRGTNGRIGHRIPGAPPSLLLHTTGAKT
GQPRTTSLTYARDGDAYLIVASKGGDPRSPGWYHNLKANPDVEINVGPKR
FGVTAKPVQPHDPDYARLWQIVNENNANRYTNYQSRTSRPIPVVVLTRR
433634321YP_007267948.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MNIAAESSAKPVWGPPNFCAAAARMQDVRVLMHPKTGRAFRSPVEPGSGW
PGDPATPQTPVAADAAQVSALAGGAGSICELNALISVCRACPRLVSWREE
VAVVKRRAFADQPYWGRPVPGWGSKRPRLLILGLAPAAHGANRTGRMFTG
DRSGDQLYAALHRAGLVNSPVSVDAADGLRANRIRITAPVRCAPPGNSPT
PAERLTCSPWLNAEWRLVSDHIRAIVALGGFAWQVALRLAGASGTPKPRF
GHGVVAELGAGVRLLGCYHPSQQNMFTGRLTPTMLDDIFREAKKLAGIE
433634319YP_007267946.1 Putative oxidoreductase [Mycobacterium canettii CIPT 140070017]MNTDVLAGLMAELPEGMVVTDPAVTNGYRQDRAFDPSAGKPLAIIRPRRT
EEVQTVLRWASANQVPVVTRGAGSGLSGGATALDGGIVLSTEMMRDITVD
PVTRTAVCQPGLYNAEVKEAAAEHGLWYPPDPSSFEICSIGGNIATNAGG
LCCVKYGVTGDYVLGLQVVLANGTAVRLGGPRLKDVAGLSLTKLFVGSEG
TLGVITEVTLRLLPAQNASSIVVASFGSVQAAVDAVLGVTGRLRPAMLEF
MDSVAINAVEDTLRMDLDRDAAAMLVAGSDERGRAATEDAAVMAAVFAEN
GAIDVFSTDDPDEGEAFIAARRFAIPAVESKGALLLEDVGVPLPALGELV
TGIARIAEERNLMISVIAHAGDGNTHPLLVYDPADAAMLERAHLAYGEIM
DLAVGLGGTITGEHGVGRLKRPWLAGYLGPDVLALNQRIKQALDPQGILN
PGSAI
433634317YP_007267944.1 Putative cytochrome p450 130 cyp130 (part2) [Mycobacterium canettiiMVVAHYLGVPEEDWTQFDGWTQAIVAANAVDGATTGALDAVGSMMAYFTG
LIERRRTEPADDAISHLVAAGVGADGDTAGTLSILAFTFTMVTGGNDTVT
GMLGGSMPLLQRRPDQRRLLLDDPEGIPDAVEELLRLTSPVQGLARTTTR
DVTIGDTTIPTGRKVLLLYGSANRDERQYGPDAAELDVTRRPRNILTFSH
GAHHCLGAAAARMQSRVTLTELLAHCPDFEVDESRIVWSGGSYVRRPLSV
PFRVTS
433634315YP_007267942.1 Putative integral membrane acyltransferase [Mycobacterium canettii MTLPKERAAQGGLERISHVDRVASLTGIRAVAALLVVGTHAAYTTGKYTH
GYWGLMSSRMEIGVPIFFVLSGFLLFRPWVKSAATGGPPPSLSRYAWHRV
RRIMPAYTVTVLLAYLVYHFRTAGPNPGHTWVGLFRNLTLTQIYTDGYLG
AFLHQGLTQMWSLAVEVAFYLALPALAYLLLVLVCRRRWQPRLLLATMAG
LTMISPAWLILVHNTHWMPDGARLWLPTYLAWFVGGMMLSVLAAMGARCY
AFAAIPLAVVCYFIVSTPIAGAPTTSPTALAEALVKTAFYAVIAALAVAP
LALDNQGWYARLLASRPMVFLGEISYEIFLIHLVTMEIAMVDVLGYRVYT
GSMPNLCLATLVLTIPLAWLLHRFTRVQGDRPA
433634313YP_007267940.1 Conserved lipoprotein of unknown function- LprE [Mycobacterium caneMPGVWSPPCPTTPRVGVVAALVAATLTGCGSGDSTVAKTPDATPSLSTAH
PGPPSSEPSPPSATAAPPSNHSAAPVDPCAVNLASPTIAKVVSELPRDPR
SEQPWNPEPLAGNYNECAQLSAVVIKANTNAGNPTTRAVMFHLGKYIPQG
VPDTYGFTGIDTSQCTGDTVALTYASGIGLNNVVKFRWNGGGVELIGNTT
GG
433634311YP_007267938.1 Putative drug-transport integral membrane protein [Mycobacterium caMTTAIRRAAGSSYFRNPWPALWAMMVGFFMIMLDSTVVAIANPTIMAQLR
IGYATVVWVTSAYLLAYAVPMLVAGRLGDRFGPKNLYLIGLGVFTVASLG
CGLSSGAGMLIAARVVQGVGAGLLTPQTLSTITRIFPAHRRGVALGAWGT
VASVASLVGPLAGGALVDSMGWEWIFFVNVPVGVIGLILAAYLIPVLPHH
PHRFDWFGVGLSGAGMFLIVFGLQEGQSANWQPWIWAVIVGGIGFMSLFV
YWQARNAREPLIPLVVFNDRNFSLSNLGIAIIAFAGTGIMLPVTFYAQAV
CGLSPTHTAVLFAPTAIVGGVLAPFVGMIIDRSHPLCVLGFGFSVLAIAM
TWLLCEMAPGTPIWRLVLPFIALGVAGAFVWSPLTVTATRNLRPHLAGAS
SGVFNAVRQLGAVLGSASMAAFMTSRIAAEMPGGVDALTGPAGQDATVLQ
LPELVREPFAAAMSQSMLLPAFVALFGIVAALFLVDFTGAAVAQEPLPES
DGDADDDDYVEYILRREPEEDCDTQPLQGSRPAAAAASRSGAGGPLAVSW
STSARGMPPGPPGRRAWQADTESTAPSAL
433634309YP_007267936.1 Oxoglutarate dehydrogenase SucA (alpha-ketoglutarate dehydrogenase)MANISSPFGQNEWLVEEMYRKFRDDPSSVDPSWHEFLVDYSPEPTSEPAA
EPTLVTSPPVAERAAAAAPQAPPKPADTAAAGNGVVAALAAKAAVPPPAE
GDEVAVLRGAAAAVVKNMSASLEVPTATSVRAVPAKLLIDNRIVINNQLK
RNRGGKISFTHLLGYALVQAVKKFPNMNRHYTEVDGKPTAVTPAHTNLGL
AIDLQGKDGKRSLVVAGIKRCETMRFAQFVTAYEDIVRRARDGKLTTEDF
AGVTISLTNPGTIGTVHSVPRLMPGQGAIIGVGAMEYPAEFQGASEERIA
ELGIGKLITLTSTYDHRIIQGAESGDFLRTIHELLLSDGFWDEVFRELSI
PYLPVRWSTDNPDSIVDKNARVMNLIAAYRNRGHLMADTDPLRLDKARFR
SHPDLEVLTHGLTLWDLDRVFKVDGFAGAQYKKLRDVLGLLRDAYCRHIG
VEYAHILDPEQKEWLEQRVETKHVKPTVAQQKYILSKLNAAEAFETFLQT
KYVGQKRFSLEGAESVIPMMDAAIDQCAEHGLDEVVIGMPHRGRLNVLAN
IVGKPYSQIFTEFEGNLNPSQAHGSGDVKYHLGATGLYLQMFGDNDIQVS
LTANPSHLEAVDPVLEGLVRAKQDLLDHGSIDSDGQRAFSVVPLMLHGDA
AFAGQGVVAETLNLANLPGYRVGGTIHIIVNNQIGFTTAPEYSRSSEYCT
DVAKMIGAPIFHVNGDDPEACVWVARLAVDFRQRFKKDVVIDMLCYRRRG
HNEGDDPSMTNPYMYDVVDTKRGARKSYTEALIGRGDISMKEAEDALRDY
QGQLERVFNEVRELEKHGVQPSESVESDQMIPAGLATAVDKSLLARIGDA
FLALPNGFTAHPRVQPVLEKRREMAYEGKIDWAFGELLALGSLVAEGKLV
RLSGQDSRRGTFSQRHSVLIDRHTGEEFTPLQLLATNSDGSPTGGKFLVY
DSPLSEYAAVGFEYGYTVGNPDAVVLWEAQFGDFVNGAQSIIDEFISSGE
AKWGQLSNVVLLLPHGHEGQGPDHTSARIERFLQLWAEGSMTIAMPSTPS
NYFHLLRRHALDGIQRPLIVFTPKSMLRHKAAVSEIKDFTEIKFRSVLEE
PTYEDGIGDRNKVSRILLTSGKLYYELAARKAKDNRNDLAIVRLEQLAPL
PRRRLRETLDRYENVKEFFWVQEEPANQGAWPRFGLELPELLPDKLAGIK
RISRRAMSAPSSGSSKVHAVEQQEILDEAFD
433634307YP_007267934.1 Conserved protein of unknown function- putative antitoxin [MycobactMAVVPLGEVRNRLSEYVAEVELTHERITITRHGHPAAVLISADDLASIEE
TLEVLRTPGASEAIREGLADVAAGRFVSNDEIRNRYTAR
433634305YP_007267932.1 Putative short-chain type dehydrogenase/reductase [Mycobacterium caMEGFAGKVAVVTGAGSGIGQALAIELARSGAKVAISDVDTDGLADTEHRL
KAISTPAKTDRLDVTEREAFLAYADAVNEHFGTVNQIYNNAGIAFTGDIE
VSQFKDIERVMDVDFWGVVNGTKAFLPHLIASGDGHVINISSVFGLFSAP
GQAAYNSAKFAVRGFTEALRQEMALAGHPVKVTTVHPGGVQTAIARNATA
AEGLDQAELAETFDKRVAHLSPQRAAQIILTGVAKNKARVLVGVDAKVLD
LVVRLTGSGYQRIFPIITGRLIPRPR
433634303YP_007267930.1 Conserved protein of unknown function- PE-PGRS family protein [MycoMEYLIAAQDVLVAAAADLEGIGSALAAANRAAEAPTTGLLAAGADEVSAA
IASLFSGNAQAYQTLSAQAAAFHQQFVRALSSAAGSYAAAEAANASPMQA
VLDVVNGPTQLLLGRPLIGDGANGGPGQNGGDGGLLYGNGGNGGSSSTPG
QPGGRGGAAGLIGNGGAGGAGGPGANGGAGGNGGWLYGNGGLGGNGGAAT
LVGGNGGNGGDGGNAGLWGNGGAGGAGAAGAAGANGQNPVSHQVTHATDG
ADGTTGPDGNGTDAGSGSNAVNPGVGGGAGGIGGDGTNFGQTEVSGGAGG
DGGDGANFASGGAGGNGGAAQSGFGDAVGGNGGAGGNGGAGGGGGLGGAG
GSANVANAGNSIGGNGGAGGNGGIGAPGGAGGAGGNANQDNPPGGNSTGG
NGGAGGDGGVGASADVGGAGGFGGSGGRGGLLVGAGGAGGDGGVGGDGGI
GAQGGSGGHGGNGGIGADGLANQDGDGGDGGNGGDGGDGGGGGVGGNGGA
GGAGGLFGQSGSPGSGAAGGLGGAGGNGGAGGGGGPERGPRRPRRSRYSR
RYRRQRSARPERLTRRQSGSHYSRNGSVHFRSANRAKSVSLE
433634301YP_007267928.1 Conserved protein of unknown function- putative antitoxin [MycobactMRTTLTLDDDVVRLVEDAVHRERRPMKQVINDALRRALAPQVKRQEQYRL
EPHDSGVRSGLDLAGFNKLADELEDEALLDATRRAW
433634299YP_007267926.1 Putative magnesium and cobalt transport transmembrane protein CorA MFPGFDALPEVLRPVARPQPPNVHPVAQPPAQALVDCGVYVCGRRLPGKY
TYAAALREVREIELTGQEAFVWIGLHEPDENQMQDVADVFGLHPLAVEDA
VHAHQRPKLERYDETLFLVLKTVNYVPHESVVLAREIVETGEIMIFVGKD
FVVTVRHGEHGGLSEVRKRMDADPEHLRLGPYAVMHAIADYVVDHYLEVT
NLMETDIDSIEEVAFAPGRKLDIEPIYLLKREVVELRRCVNPLSTAFQRM
QTESKDLISKEVRRYLRDVADHQTEAADQIASYDDMLNSLVQAALARVGM
QQNMDMRKISAWAGIIAVPTMIAGIYGMNFHFMPELDSRWGYPTVIGGMV
LICLFLYHVFRNRNWL
433634297YP_007267924.1 Putative sugar-transport integral membrane protein ABC transporter MGARRATYWAILDTLVVGYALLPVLWIFSLSLKPTSTVKDGKLIPSTVTF
DNYRGIFRGDLFSSALINSIGIGLITTVIAVVLGAMAAYAVARLEFPGKR
LLIGAALLITMFPSISLVTPLFNIERAIGLFDTWPGLILPYITFALPLAI
YTLSAFFREIPWDLEKAAKMDGATPSQAFRKVIVPLAAPGLVTAAILVFI
FAWNDLLLALSLTATKAAITAPVAIANFTGSSQFEEPTGSIAAGAIVITI
PIIVFVLIFQRRIVAGLTSGAVKG
433634295YP_007267922.1 Conserved lipoprotein of unknown function- sugar-binding lipoproteiMVMSRGRIPRLGAAVLVALTTAAAACGADSQGLVISFYTPATDGATFTAI
AQRCNQQFGGRFTIAQVSLPRSPDEQRLQLARRLTGNDRTLDVMALDVVW
TAEFAEAGWALPLSDDPAGLAENDAVADTLPGPLATAGWNHKLYAAPVTT
NTQLLWYRPDLVNSPPTDWNAMIAEAARLHAAGEPSWIAVQANQGEGLVV
WFNTLLVSAGGSVLSEDGRHVTLTDTPAHRAATVSALQILKSVATTPGAD
PSITRTEEGSARLAFEQGKAALEVNWPFVFASMLENAVKGGVPFLPLNRI
PQLAGSINDIGTFTPSDEQFRIAYDASQQVFGFAPYPAVAPGQPAKVTIG
GLNLAVAKTTRHRAEAFEAVRCLRDQHNQRYVSLEGGLPAVRASLYSDPQ
FQAKYPMHAIIRQQLTDAAVRPATPVYQALSIRLAAVLSPITEIDPESTA
DELAAQAQKAIDGMGLLP
433634293YP_007267920.1 Conserved membrane protein of unknown function [Mycobacterium canetMTAPSGSSGESAHDAAGGPPPVGERPPEQPIADAPWAPPASSPMANHPPP
AYPPSGYPPAYQPGYPTGYPPPMPPGGYAPPGYQPPGTSSAGYGDIPYPP
MPPPYGGSPGGYYPEPDYLGGYGPSQPGMNTMALVSLISALVGVLCCIGS
IVGIVFGAIAINQIKQTREEGYGLAVAGIVIGIATLLVYMIVGIFAIP
433634291YP_007267918.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MSKPFAPRRLYTPRTSRTLAPRLDPEAVGRTTESIARFFGTGRYLLVQTL
LVLTWIVLNLFAVGLRWDPYPFILLNLAFSTQASYAAPLILLAQNRQEKR
DRAVFEEDRRRAAQTKADTEYNARELAALRLAIGEVPTRDYLRHELDSLR
ALLAELRPTDPDAAQPRVADEAEQHAKKSG
433634289YP_007267916.1 Putative MRP-Related ATP-binding protein Mrp [Mycobacterium canettiMPSRLHSAVMSGTRDGDLNAAIRTALGKVIDPELRRPITELGMVKSIDTG
PDGSVHVEIYLTIAGCPKKSEITERVTRAVADVPGTSAVRVSLDVMSDEQ
RTELRKQLRGDTREPVIPFAQPDSLTRVYAVASGKGGVGKSTVTVNLAAA
MAVRGLSIGVLDADIHGHSIPRMMGTTDRPTQVESMILPPIAHQVKVISI
AQFTQGNTPVVWRGPMLHRALQQFLADVYWGDLDVLLLDLPPGTGDVAIS
VAQLIPNAELLVVTTPQLAAAEVAERAGSIALQTRQRIVGVVENMSGLTL
PDGTTMQVFGEGGGRLVAERLSRAVGADVPLLGQIPLDPALVAAGDSGVP
LVLSAPDSAVGKELLGIADGLSTRRRGLAGMSLGLDPTRR
433634287YP_007267914.1 Conserved membrane protein of unknown function [Mycobacterium canetMDHARNVPSATGPQGSHLALAEPAHRPSSQAPVMWALSASLGWVIPVIAQ
LVWWAVHPQPPWPHLAVAALSAVLMVLHIGLVPLWRYRVHRWEISPQAVY
TRTGWLVQERRIAPISRVQTVDTFRGPMDRLFGLANVTVTTASSAGAVHI
EALDTDVADRVVAQLTDIAALGAQDAT
433634285YP_007267912.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MDVAHLMAAAVLFDIDGVLVLSWRAIPGAAETVRQLTHRGIACAYLTNTT
TRTRRQIAEALGAAGIPVAADDVITAGVLTAEYLHGAYPGARCFLVNSGD
ITEDLPGIDVVLSTEIGPGDRPEAPDVVVLGSAGPQFDHRMLSRVYGWML
DGVPVVAMHRNMTWNTTDGLRIDTGMYLTGMEEACGKTATAIGKPAAEGF
LAAADRVGVDPQQMVMIGDDLHNDVLAAQAVGMTGVLVRTGKFRQQTLDR
WLAGASATRPHHVIDSVAGLPPLLGC
433634283YP_007267910.1 Putative serine protease HtrA (DegP protein) [Mycobacterium canettiMDTRVDTDNAMPARFSAQIQNEDEVTSDQGNNGGPNGGGRLAPRPVFRPP
VDPASRQAFGRPSGVQGSFVAERVRPQEYQDQSDFTPNDQLADPVLQEAF
GRPFAGAESLQRHPIDAGALAAEKDGAGPDEPDDPWRDPAAAAALGTPAL
AAPAPHGALAGSGKLGVRDVLFGGKVSYLALGILVAIALVIGGIGGVIGR
KTAEVVDAFTTSKVTLSTTGNAQEPAGRFTKVAAAVADSVVTIESVSDQE
GMQGSGVIVDGRGYIVTNNHVISEAANNPSQFKTTVVFNDGKEVPANLVG
RDPKTDLAVLKVDNVDNLTVARLGDSSKVRVGDEVLAVGAPLGLRSTVTQ
GIVSALHRPVPLSGEGSDTDTVIDAIQTDASINHGNSGGPLIDMDAQVIG
INTAGKSLSDSASGLGFAIPVNEMKLVANSLIKDGKIVHPTLGISTRSVS
NAIASGAQVANVKAGSPAQKGGILENDVIVKVGNRAVADSDEFVVAVRQL
AIGQDAPIEVVREGRHVTLTVKPDPDST
433634281YP_007267908.1 Alternative RNA polymerase Sigma factor SigE [Mycobacterium canettiMELLGGPRVGNTESQLCVADGDDLPTYCSANSEDLNITTITTLSPTSMSH
PQQVRDDQWVEPSDQLQGTAVFDATGDKATMPSWDELVRQHADRVYRLAY
RLSGNQHDAEDLTQETFIRVFRSVQNYQPGTFEGWLHRITTNLFLDMVRR
RARIRMEALPEDYDRVPADEPNPEQIYHDARLGPDLQAALASLPPEFRAA
VVLCDIEGLSYEEIGATLGVKLGTVRSRIHRGRQALRDYLAAHPEHGECA
VHVNPVR
433634279YP_007267906.1 Putative transcriptional regulatory protein [Mycobacterium canettiiMRSADLTAHARIREAAIEQFGQHGFGIGLRTIAEAAGVSAALVIHHFGSK
DGLRKACDDYVAEEIRSSKSAALKSNDPATWLAQLAEIESHARLMAYLVR
SMQSGGELAKMLWQKMIDNAEEYLDEGVRAGTVKPSRDPRARARFLAING
GGGFLLYLQMHENPTDLRAALRDYAHDMVLPSLEVYTEGLLADRTMYEAF
LSEAQQGEAHVG
433634277YP_007267904.1 Putative tetronasin-transport integral membrane protein ABC transpoMSTTVIDRAGPAEHRVPHRGSGFAGTLGLLRLYLRRDRVSLPLWVLLLSV
PLATVYVGSVEAVYPDRAARAAAAAAIMASPAQRALYGPVYNDSLGAVGI
WKAGMFYTLIAVAVILTVIRHTRADEESGRAELIDSTVVGRYANLTAALL
LSFGASIATGSIGVLGLLATDVAPAGSVAFGAALAASGLVFTAVAAVAAQ
LSPGARFTRGVAFAVLGTAFALRAIGDAGSGALSWCSPLGWSLQVRPYAG
ERWWVLLLSLATAAGLTVLAYRLRAGRDVGAGLIAERPGAGTAGPMLSEP
FGLAWRLNRGSLLLWTVGLCLYGLVMGSVVHGIGDQLGDNTAVRDIVTRM
GGTGALEQAFLALAFTMIGMVAAAFAVSLTLRLHQEEAGLRAETLLAGAV
SRTRWLSSHLAMALAGSAVATLISGVAAGLAYGMTVGDVGAKLPTVVGTA
AVQLPAVWLLSAVTVGLFGLAPRFTPVAWGVLVGFIALYLLGSLAGFPQV
LLNLEPFAHVPRVGGGDFTAVPLLWLLAMDAALITLGAMAFRRRDVRC
433634275YP_007267902.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MTRNPTPALDRPWRRPGALRYARERVRGIATPPITVTDPPADVVIERDVE
VPTRDGTLLRINVFRSAEGGARPVILSIHPYGKDDLPTRRRNRWTFSPQY
RMLRQPKPVTFSALTGWEAPDPAWWTAQGFVVVNADSRGCGRSDGTGDLL
SHQEAEDTYDLVGWLADQSWSDGRVVMLGVSYLAISQYAVAALQPPALRA
ICPWEGFTDAYRDLAFPGGIRESGFTRLWSRGVRRRTRQTYAMEQMQQAH
PLRDDFWRSRVPDLSAIKVPMLVCGSFSDNNLHSRGSIRAFTRSGCGHAR
LYTHRGGKWETFYSNTALAEQLKFLRDALAGTSGSRSVRLEVREDRDTIT
TVREETQWPLAGTRWRPMYLAGPGLLATEPPPTAGSIRFQTRSRAAAFNW
TIPEDIELTGPMAARLWVQLDGCDDANLFVGVEKWRDGKFVAFEGSYGWG
RDRVTTGCQRVSLRELDPELSQPWEPVPACVRPRPVTAGEVVAVDVALGP
SATLFRAGEQLRLVVAGRWLSPRNPLTGQFPAAYPRPPRGRVTLHWGPRH
DAHLLIPEVP
433634273YP_007267900.1 Conserved protein of unknown function- probable PE-PGRS family protMVVRRRRSRRERRQPWHPWRHLGHQRLRRRRGNGGNARLIGNGGAGGAGG
TGVPSGPDGRGGAGGQLFGQPGPPRPSRRAPPRRADAESPISARNWAILR
LLAPLTGPRSKHPCPPRPRRRR
433634271YP_007267898.1 Putative glycosyl transferase [Mycobacterium canettii CIPT 14007001MRVAMLTREYPPEVYGGAGVHVTELVAYLRRLCAVDVHCMGAPRPGAFAY
RPDPRLGSANAALSTLSADLVMANAANAATVVHSHTWYTALAGHLAAILY
DIPHVLTAHSLEPLRPWKKEQLGGGYQVSTWVEQTAVLAANAVIAVSSAM
RNDMLRVYPSLDPNLVHVIRNGIDTEMWYPAGPARTGSVLAELGVDPNRP
MAVFVGRITRQKGVVHLVTAAHRFRSDVQLVLCAGAADTPEVADEVRVAV
AELARNRTGVFWIQDQLTIGQLREILSAATVFVCPSVYEPLGIVNLEAMA
CATAVVASDVGGIPEVVADGITGSLVHYDADDATGYQARLAEAVNALVAD
PATAERYGHAGRQRCIQEFSWAYIAEQTLDIYRKVCA
433634269YP_007267896.1 Putative DNA-3-methyladenine glycosylase 1 (TAG I) (3-methyladenineMSGDGLVRCPWAEVRPGPDAQLYRDYHDNEWGRPLYGRVALFERMSLEAF
QSGLSWLIILRKRENFRRAFSGFDIDKIARYTDTDVRRLLADDGIVRNRA
KIEATIANARAAADLGSSEDLSELLWSFAPPPRPRPVDGSEIPSVSTESK
AMARDLKRRGFRFVGPTTAYALMQATGMVDDHIQACWVPTERPFEQPGGP
PAAR
433634267YP_007267894.1 Putative glucosyl-3-phosphoglycerate synthase GpgS [Mycobacterium cMTASELVAGDLAGGRAPGALPLDTTWHRPGWTIGELEAAKAGRTISVVLP
ALNEEATIESVIDSISPLVDGLVDELIVLDSGSTDDTEIRAIASGARVVS
REQALPEVPVRPGKGEALWRSLAATSGDIVVFIDSDLINPHPLFVPWLVG
PLLTGEGIHLVKSFYRRPLQVSDVTSGAGATGGGRVTELVARPLLAALRP
ELGCVLQPLSGEYAASRELLTSLPFAPGYGVEIGLLIDTFDRLGLDAIAQ
VNLGVRAHRNRPLDELGAMSRQVIATLLSRCGIPDSGVGLTQFLPGGPDD
SDYTRHTWPVSLVDRPPMKVMRPR
433634265YP_007267892.1 Putative fatty-acid-CoA ligase FadD6 (fatty-acid-CoA synthetase) (fMSDYYGGAHTTVRLIDLATRMPRVLADTPVIVRGAMTGLLARPNSKASIG
TVFQDRAARYGDRVFLKFGDQQLTYRDANATANRYAAVLAARGVGPGDVV
GIMLRNSPSAVLAMLATVKCGAIAGMLNYHQRGEVLAHSLGLLDAKVLIA
ESDLVSAVAECGASPGRVAGDVLTVEDVERFAATAPATNPASASAVQAKD
TAFYIFTSGTTGFPKASVMTHHRWLRALAVFGGMGLRLKGSDTLYSCLPL
YHNNALTVAVSSVINSGATLALGKSFSASRFWDEVIANRATAFVYIGEIC
RYLLNQPAKPTDRAHQVRVICGNGLRPEIWDEFTTRFGVARVCEFYAASE
GNSAFINIFNVPRTAGVSPMPLAYVEYDLDTGDPLRDASGRVRRVPDGEP
GLLLSRVNRLQPFDGYTDPVASEKKLVRNAFRDGDCWFNTGDVMSPQGMG
HAAFVDRLGDTFRWKGENVATTEVEAALASDQTVEECTVYGVQIPRTGGR
AGMAAITLRAGAEFDGQALARTVYGHLPGYALPLFVRVVGSLAHTTTFKS
RKVELRNQAYGADIEDPLYVLAGPDEGYVPYYAEYPEEVSLGRRPQG
433634263YP_007267890.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MRVWKHVEAAVESPDRCGVVLVGPHGVGKTLLAQLAAEQVMSEDGWSGRA
RWVVGTAPGRAIPFGAFRHLISLPASGADIGRPAALLRAARSSLTGDAGD
LLLVVDDAHNLDPLSATLVYQLARAGAARLVVTVASEAEPPDAIAALWSD
DLLTRVAIEPLDRAQTAAFVESALDATLDVADADEVFRRSLGNPLYLRHL
IDGGGLEHVDGRWRCRDEDRRPLSGVIDEYLCALPEPARAVVDYLAIAEP
LARTDLVALVGGEQLDTLGQAEAAGAVRVGPDSDTSEIFVGHPLYADRAR
AVLTAEHAHALRVSLVAQLAKHPSDHVSDQLRLSSLAIDVPASATPAAVT
DAATAAGQALRLGDVQLAERLARAALDRSDALAARLPLAYALGWQGRGRE
ADAVLAAVNPAELTETELMAWAIPRAANRFWMLNEPERATAFLQTTRSRV
TEPTARSTLDALAATFAMNSGNLPRAITLAIEVLSGPAADDMAVAWAASA
AALSSARMGRFGDVDRLAERASAAEHPGLLRFTVGLAQITSLLLAGDVAP
AQELAKRFTDFAELQQPGRSIGEVLLAYVLITKGEFGAAASMLEPAAATL
ERTGYSWGPLSLMLLATAIAQQGHIAESAKTLQRAEARHGTKSALFAPEL
GLARAWTRAAAQDMTGAIAAAREAARTAERAGQAAVALCAWHNAVRLGDI
RAVDPVTRLAAEIDCTVGNILVKHARGLADGDAAELTAVAEELAGIGIAA
AAADATKAAARLGPQQR
433634261YP_007267888.1 Putative transferase [Mycobacterium canettii CIPT 140070017]MSTVTGAAGIGLATLAADGSVLDTWFPAPELTESGTGATSRLAVSDVPAE
LAALIGRDDDRRTETIAVRTVIGSLDDVAADPYDAYLRLHLLSHRLVAPH
GLNAGGLFGVLTNVVWTNHGPCAIDGFEAVRARLRRRGPVTVYGVDKFPR
MVDYVMPTGVRIADADRVRLGAHLAPGTTVMHEGFVNYNAGTLGASMVEG
RISAGVVVGDGSDVGGGASIMGTLSGGGTQVISIGKRCLLGANSGLGISL
GDDCVVEAGLYVTAGTRVTMPDGNSVKARELSGSSNLLFRRNSVSGAVEV
LARDGQGIALNEDLHAN
433634259YP_007267886.1 Conserved protein of unknown function- putative ESAT-6 like proteinMTINYQFGDVDAHGAMIRAQAASLEAEHQAIVSDVLAAGDFWGGAGSAAC
QEFINQLGRNFQVIYEQANAHGQKVQAAGNNMAQTDSAVGSSWA
433634257YP_007267884.1 Conserved protein of unknown function- PPE family [Mycobacterium caMVDFGALPPEINSARMYAGPGSASLVAAAQMWDSVASDLFSAASAFQSVV
WGLTVGSWIGSSAGLMVAAASPYVAWMSVTAGQAELTAAQVRVAAAAYET
AHGLTVPPPVIAENRAELMILIATNLLGQNTPAIAVNEAEYGEMWAQDAA
AMFGYAATAATATATLLPFEEAPEMTSAGGLLEQAAAVEEATDTAAANQL
MNNVPQALQQLAQPTQGTTPSSKLGGLWKTVSPHLSPLSNMVSMANNHVS
MTNSGVSMTNTLSSMLKGFAPAAAQAVQTAAQNGVQAMSSLGSQLGSSLG
SSGLGGGVAANLGRAASVGSLSVPQAWAAANQAVTPAARALPLTSLASAA
ERGPGQMLGGLPVGQMGARASGGLSGVLRVPPRPYVMPHSPAAG
433634255YP_007267882.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MSQSAICTYRRHRRVNLPNQRPLDVQSAPTAQFTMLFDATTTTSWVTMPG
RRRISQIALRPKLFNTVDASSRPTP
433634253YP_007267880.1 Putative fatty-acid-CoA ligase FadD36 (fatty-acid-CoA synthetase) (MLLASLNPAVVSAADIADAVRIDGDVLSRSDLVGAATSVAERVAGAHRVA
VLATPTASTVLAITGCLIAGVPVVPVPADVGVTERRHMLTDSGVQAWLGP
LPDDPAGLPHIPVRTHARSWHRYPEPSPGAIAMVVYTSGTTGPPKGVQLS
RRAIAADLDALAEAWQWTAEDVLVHGLPLYHVHGLVLGLLGSLRFGNRFV
HTGKPTPAGYAQACYEAHGTLFFGVPTVWSRVVADVAAAEALRPARLLVS
GSAALPVPVFDKLVQLTGHRPVERYGASESLITLSTRADGERRPGWVGLP
LAGVQTRLVDDDGGEVPHDGETVGKLQVRGPTLFDGYLNQPDATAAAFDA
DSWYRTGDVAVVDGSGMHRIVGRESVDLIKSGGYRVGAGEIETVLLGHPD
VAEAAVVGVPDDDLGQRIVAYVVGSANVDADGLINFVAQQLSVHKRPREV
RIIDALPRNALGKVLKKQLLSEG
433634251YP_007267878.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MAVAIARPKLEGNIAVGEDRQIGFAEFGAPQGRAVFWLHGTPGARRQIPT
EARVYAEHHNIRLIGVDRPGIGSSTPHQYETILAFADDLRTIADTLGIDK
MAVVGLSGGGPYTLACAAGLPDRVVAAGVLGGVAPTRGPDAIGGGLMSLG
SAVAPLLQMGGTPLRLSASLLIRAARPVASPALDLYGLLSPQADRHLLAR
PEFKAMFLDDLLNGSRKQLAAPFADVIAFARDWGFRLDEVKVPVRWWHGD
HDHIVPFSHGEHVVSRLPDAKLLHLPGESHLAGLGRGEEILSTLMQIWDR
DLRK
433634249YP_007267876.1 Putative alternative RNA polymerase sigma factor SigI [MycobacteriuMSQHDPVSAAWRAHRAYLVDLAFRMVGDIGVAEDMVQEAFSRLLRAPVGD
IDDERGWLIVVTSRLCLDHIKSASTRRERPQDIAAWHDGDASVSSVDPAD
RVTLDDEVRLALLIMLERLGPAERVVFVLHEIFALPYQQIATTIGSQAST
CRQLAHRARRKINESRIAASVEPAQHRVVTRAFIEACSNGDLDTLLEVLD
PGVAGEIDARKGVVVVGADRVGPTILRHWSHPATVLVAQPVCGQPAVLAF
VNRALAGVLALSIEAGKITKIHVLVQPSTLDPLRAELGGG
433634247YP_007267874.1 Putative pyrroline-5-carboxylate dehydrogenase RocA [Mycobacterium MDAITQVPVPANEPVHDYAPKSPERTRLRTELASLADHPIDLPHVIGGRH
RMGDGERIDVVQPHRHAARLGTLTNATHADAAAAVEAATSAKSDWAALPF
DERATVFLRAADLLAGPWREKIAAATMLGQSKSVYQAEIDAVCELIDFWR
FNVAYARQILEQQPISGPGEWNRIDYRPLDGFVYAITPFNFTSIAGNLPT
APALMGNTVIWKPSITQTLAAYLTMQLLEAAGLPPGVINLVTGDGFAVSD
VALADPRLAGIHFTGSTATFGHLWQRVGTNIGRYQSYPRLVGETGGKDFV
VAHASARPDVLRTALIRGAFDYQGQKCSAVSRAFIAHSVWQRMGDELLAK
AAELRYGDITDLSNYGGALIDQRAFVKNVDAIERAKGAAAVTIAVGGEYD
DSQGYFVRPTVLLSDDPTDESFVIEYFGPLLSVHVYPDERYEQILDVIDT
GSRYALTGAVIADDRQAVLTALDRLRFAAGNFYVNDKPTGAVVGRQPFGG
ARGSGTNDKAGSPLNLLRWTSARSIKETFVAATDHIYPHMAVD
433634245YP_007267872.1 Putative fatty-acid--CoA ligase fadD21 [Mycobacterium canettii CIPTMSDSSVLSLLRERAGLQPDDAAFTYIDYEQDWAGITETLTWSEVFRRTRI
VAHEVRRHCTTGDRAVILAPQGLAYIAAFLGSMQAGAIAVPLSVPQIGSH
DERVSAVLADASPSVILTTSAVAEAVAEHIHRPNTNKLPPIIEIDSLDLT
GNSPSFRVKDLPSAAYLQYTSGSTRAPAGVMISHRNLQANFQQLMSNYFA
DRNGVAPPDITIVSWLPFYHDMGLVLGIIAPILGGYRSELTSPLAFLQRP
ARWLHSLANGSPSWSAAPNFAFELAVRKTTDADIEGLDLGNVLGITSGAE
RVHPNTLSRFCNRFAPYNFREDMIRPSYGLAEATLYVASRNSGDKPEVVY
FEPDKLSTGSANRCEPKTGTPLLSYGMPTSPTVRIVDPDTCIECPAGTIG
EIWVKGDNVAEGYWNKPDETRHTFGAMLVHPSAGTPDGSWLRTGDLGFLS
EDEMFIVGRIKDMLIVYGRNHYPEDIESTVQEITGGRVAAISVPVDHTEK
LVTVIELKLLGDSAGEAMDELDVIKNNVTAAISRSHGLNVADLVLVPPGS
IPTTTSGKIRRAACVEQYRLQQFTRLDG
433634243YP_007267870.1 Putative conserved transmembrane transport protein MmpL10 [MycobactMVGCWVALALVLPMAVPSLAEMAQRHPVAVLPADAPSSVAVRQMAEAFHE
SGSENILVVLLTDEKGLGAADENVYHTLVDRLRNDAKDVVMLQDFLTTPP
LREVLGSKDGKAWILPIGLAGDLGTPKSYHAYTDVERIVKRTVAGTTLTA
NVTGPAATVADLTDAGARDRASIELAIAVMLLVILMVIYRNPVTMLLPLV
TIGASLMTAQALVAGVSLVSGLAVSNQAIVLLSAMIAGAGTDYAVFLISR
YHEYVRLGEHPERAVQRAMMSVGKVIAASAATVGITFLGMRFAKLGVFST
VGPALAIGIAVSFLAAVTLLPAILVLASPRGWVAPRRERMATFWRRAGTR
IVRRPKAYLGASLIGLVALASCASLAHFNYDDRKQLPPSDPSSVGYAAME
HHFSVNQTIPEYLIIHSAHDLRTPRGLADLEQLAQRVSQIPGIAMVRGVT
RPNGETLEQARATYQAGQVGNRLGGASRMIDERTGDLNRLASGANLLADN
LGDVRGQVSRAVAGVRSLVDALAYIQNQYGGNKTFNEIDNAARLVSNIHA
LGDALQVNFDGIANSFDWLDSVVAALDTSPVCDSNPMCGNARVQFHKLQT
ARDNGTLDKVVGLARQLQSTRSPQTVSAVVNDLGRSLNSVVRSLKSLGLD
NPDAARARLISMQNGANDLASAGRQVADGVQMLVDQTKNMGIGLNQASAF
LMAMGNDASQPSMAGFNVPPQVLKSEEFKKVAQAFISPDGHTVRCFIQTD
LNPFSTAVMDQVNTIIDTAKGAQPNTSLADASISMSGYPVMLRDIRDYYE
RDMRLIVAVTVVVVILILMALLRAIVAPLYLVGSVVISYMSAIGLGVVVF
QVFLGQELHWSVPGLAFVVLVAVGADYNMLLASRLRDESALGVRSSVIRT
VRCTGGVITAAGLIFAASMSGLLFSSIGTVVQGGFIIGVGILIDTFVVRT
ITVPAMATLLGRASWWPGHPWQRCAPEEGQMSARMSARTKTVFQAVADGS
KR
433634241YP_007267868.1 Polyketide beta-ketoacyl synthase Pks3/4 [Mycobacterium canettii CIMRTATATSVAVIGMACRLPGGIDSPQRLWEALLRGDDLVGEIPADRWDAN
VYYDPEPGVPGRSVSRWGAFLDDVGGFDCDFFGLTEREATAIDPQHRLLL
EVSWEAIEHAGVDPATLAESQTGVFVGLTHGDYELLSADCGAAEGPYGFT
GTSNSFASGRVAYTLGLHGPAVTVDTACSSGLTAVHQACRSLDDGESDLA
LAGGVVVTLEPRKSVSGSLQGMLSPTGRCHAFDEAADGFVSGEGCVVLLL
KRLPDAVRDGDRVLAIVRGTAANQDGRTVNIAAPSAQAQIAVYQQALAAA
GVEASTVGMVEAHGTGTPVGDPVEYASLAAVYGTEGPCALTSVKTNFGHL
QSASGPLGLMKTILALRHGVVPQNLHFCRLPDQLAEIDTELFVPQANTSW
PDNTGQPRRAAVSSYGMSGTNVHAILEQAPVSEPAASGPELTPEAGGLAL
FPVSATSAEQLHVTAARLADWVDQNGNAGSRVSMRDLGYTLSCRRAHRPV
RTVVTASSFDELSAALRDVAGDQIPYQPAVGHDDRGPVWVFSGQGSQWPG
MGTELLVAEPVFAATVAAMEPVIARESGFSVTEAMSAPQTVSGIDRVQPT
IFAVQVALAAALKSYGVRPGAIIGHSLGEAAAAVVAGALSLHDGLRVICR
RSRLMSRIAGSGAMASVELPGQQVLSELAIRGISDVVLSVVASPTSTVVG
GATQSIRDLVAAWEQQDVLAREVAVDVASHTPQVDPILDELLEVLAELDP
TAPEIPYYSATLWDPRERPSFTGEYWVENLRYTVRFAAAVQAALKDGYRV
FGELAPHPLLTYAVEQNAASLDMPIATLAAMRRGEQLPFGLRGFVADVHN
AGAKVDFSVQYPDGRLVDAPLPSWTHRTLMLSREDSHRSHTGAVQAVHPL
LGAHVHLLEEPERHVWQAGVGTGAHPWLGDHRIHNVAAFPGAAYCEMALA
AARTTLGELSEVRDIKFEQTLLLDEQTVVSSAATIAAPGILQFAVESHQE
GEPARRASAMLHALEEMPQPPGYDTNALTAAHESSMSGEELRKMFNSLGI
QYGPAFSGLVAVHTARGDVTTVLAEVALPGAIRSQQSAYASHPALLDACF
QSVLVHPEVQKATVGGLMLPVGVRRLRNYHSTRSAHYCLARVTSSSRAGE
CEADLDVFDQAGTVLLTVEGLRLAAGISEHERANRVFDERLLTIEWERGE
LPEVPQIDAGSWLLLSASEADPLTAQLADALNAVGAQSTSVASASDVAQL
RSLLGGRLTGVVVVTGPPTGGLTQCGRDYVSQLVGIALELAELPGEPPRL
FVVTRSAASVLPSDLANLEQAGLRGLMRVIDSEHPHLGATAIDVDNDETV
AALVASQLQSGSQEDETAWRNGIWYTARLRPGPLRPAERRTAVVEYRRDG
MRLQIRTPGDLESLEFVTFDRVAPGPGEIEVAVTASSVNFADVLVAFGRY
PTFEGYRQQLGIDFAGVVTAVGPDVTEHRIGDHVGGMSANGCWSTFVRCD
ARLAVTLPPELPVAAAAAVPTASATAWYALHDLARICSDDKVLIHSGTGG
VGQAAIAIARAAGCEIFATAGSAQRRQLLHDMGVEHVYDSRSTEFAEQIR
GDTDGYGVDVVLNSLPGAAQRAGIELLAFGGRFVEIGKRDIYGDTRLGLF
PFRRNLSLYAVDLALLTHSHPHTVRRLLKTVYQHTVEGTLPVPPTTHYPI
HDAAVAIRLVGGAGHTGKVVLDVPRTGEGVAVVPPEQVRTSRPDGAYLVT
GGLGGLGLFLAGELAAAGCGRIVLNSRSTPSPHATRVIERLRAAGADIQV
ECGDIADAATAHRVVAVATASGLPVRGVLHAAAVVEDATLANVTDELIDR
CWAPKVHGAWNIHRATAAQPLEWFCLFSSAAALVGSPGQGAYAAANSWLD
AFAHWRRAQGLPATSIAWGAWAEIGRATALAEGTGAAIAPAEGARAFQTL
LRYGRAYSGYAPIMGTPWLTAFAQRSRFAEAFHATGQNQPATGKFLAELG
SLPREEWPRTVRRLVSDQISLLLRRTIDPDRPLSDYGLDSLGNLELRTRI
ETETGIRVSPTKITTVRGLAEHVCDELAAAQSAPV
433634239YP_007267866.1 Putative aminotransferase [Mycobacterium canettii CIPT 140070017]MSASLPVFPWDTLADAKALAGAHPDGIVDLSVGTPVDPVAPLIQEALAAA
SAAPGYPATAGTARLRESVVAALARRYGITRLTEAAVLPVIGTKELIAWL
PTLLGLGGADLVVVPELAYPTYDVGARLAGTRVLRADALTQLGPQSPALL
YLNSPSNPTGRVLGVDHLRKVVEWARGRGVLVVSDECYLGLGWDAEPASV
LHPSVCDGDHTGLLAVHSLSKSSSLAGYRAGFVVGDLEIVAELLAVRKHA
GMMVPTPVQAAMVAALDDDAHERQQRERYAQRRAALLPALGSAGFAVDYS
DAGLYLWATRGEPCRDSVAWLAQRGILVAPGDFYGPGGAQHVRVALTATD
ERVAAAVGRLTC
433634237YP_007267864.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MALPHAILVSLCEQASSGYELARRFDRSIGYFWTATHQQIYRTLRVMENN
NWVRATTVAQHGRPDKKVYSVSDSGRAELARWIAEPLSPTRPGRGSALTD
SSTRDIAVKLRGAGYGDVAALYTQVTALRAERVKSLDTYRGIEKRTFADP
SALDGAALHQYLVLRGGIRAEESAIDWLDEVAEALKEKR
433634235YP_007267862.1 Conserved exported protein of unknown function- low molecular weighMRLSLTALSAGVGAVAMSLTVGAGVASADPVDAVINTTCNYGQVVAALNA
TDPGAAAQFNASPVAQSYLRNFLAAPPPQRAAMAAQLQAVPGAAQYIGLV
ESVAGSCNNY
433634233YP_007267860.1 Conserved protein of unknown function- PE family [Mycobacterium canMSFVFAAPEALAAAAADMAGIGSTLNAANVVAAVPTTGVLAAAADEVSTQ
VAALLSAHAQGYQQLSRQMMTAFHDQFVQALRASADAYATAEASAAQTMV
NAVNAPARALLGHPLISADASTGGGSNALSRVQSMFLGTGGSSALGGSAA
AHAAAGGALQLQPTGGASGLSAVGALLPHAGTAAAAALPALAAESIGNAI
KNLYNAVEPWVQYGFNLTAWAVGWLPYIGILAPQINFFYYLGEPIVQAVL
FNTIDFVDGTVTFSQALTNIETATAASINQFINTEINWIRGFLPPLPPIS
PPGFPSLP
433634231YP_007267858.1 N-Acetyl-1-D-myo-Inosityl-2-Amino-2-Deoxy-alpha-D-Glucopyranoside DMSETPRLLFVHAHPDDESLSNGATIAHYTSRGAQVHVVTCTLGEEGEVIG
DRWAQLTADHADQLGGYRIGELTAALRALGVSAPIYLGGAGRWRDSGMAG
TDQRSQRRFVDADPRQTVGALVAIIRELRPHVVVTYDPNGGYGHPDHVHT
HTVTTAAVAAAGVGSGTADHPGDPWRVPKFYWTVLGLSALISGARALVPD
DLRPEWVLPWVDEIAFGYSDEGIDAVVEADEQARAAKVAALAAHATQVVV
GPTGRAAALSNNLALPILADEHYVLAGGSAGARDERGWETDLLAGLGFTE
SGT
433634229YP_007267856.1 Conserved protein of unknown function- PPE family protein [MycobactMDFTIFPPEFNSLNIQGSARPFLVAANAWKNLSNELSYAASRFESEINGL
ITSWRGPSSTIMAAAVAPFQAWIVATASLAELVADHISVVAGAYEAAHAA
HVPLPVIETNRLTRLALATTNIFGIHTPAIFALDALYAEYWSQDGEAMNL
YATMAAAAARLTPFSPPAPITHPGALAGRLAALAHAPHAATQPLARLYDL
ISSVSETLRAFAAPATSNLPSKVWTLLTKSSYPLMAARISSIPVEYMLAF
VEGSNMGQIMGQLAVRSLAPAVKGPLELLPNAVGPAVSATLGKADTIGGL
SVPPSWVADKSITPLATTVPTSAAGGPARTPWAQLGLASLAGGAVTAVAA
RTRPSVIPRSPATG
433634227YP_007267854.1 Conserved protein of unknown function- PE-PGRS family [MycobacteriuMAFLTATPEVVSAAAADLAGIGSTITAANTAAAAATTGVIPAALDEVSAR
IAAMFGAHGQAYQAASAQATRFHEQFVQALNAGASAYANAEANVVQTLAS
AVRAPAQAQAANPVGSLFQQLETAQINFNTDLVNSELAFNHALVTNEIAL
EQRIFGTDSALNGAVNRGFNVANLLVGTGEQAINTVVGAPVPTNFTSSLL
LGSSAQVFNGGQIGGPLGAFDQSLAVGADLAGLVLGSAPAQAVLSVLPAP
VQALLTPPLGSYLQQIEAAQINYNTNLINSELAFNDALVTNEIALEQRVF
GTHSALNGVVNRSFNVANLLVGTGQQAVNAFSGAVVPQPAFTSSLLLGSA
AQVFNGGQIGGLVGAFDQSLMVGADFLGLITGQ
433634225YP_007267852.1 Putative GTP-binding translation elongation factor TypA (tyrosine pMPFRNVAIVAHVDHGKTTLVDAMLRQSGALRERGELQERVMDTGDLEREK
GITILAKNTAVHRHHPDGTVTVINVIDTPGHADFGGEVERGLSMVDGVLL
LVDASEGPLPQTRFVLRKALAAHLPVILVVNKTDRPDARIAEVVDASHDL
LLDVASDLDDEAAAAAEHALGLPTLYASGRAGVASTTAPPDGQVPDGTNL
DPLFEVLEKHVPPPKGEPDAPLQALVTNLDASTFLGRLALIRIYNGRIRK
GQQVAWIRQVDGQQTVTTAKITELLATEGVERKPTDAAVAGDIVAVAGLP
EIMIGDTLAASANPVALPRITVDEPAISVTIGTNTSPLAGKVGGHKLTAR
MVRSRLDAELVGNVSIRVVDIGAPDAWEVQGRGELALAVLVEQMRREGFE
LTVGKPQVVTKTIDGTLHEPFESMTVDCPEEYIGAVTQLMAARKGRMVEM
ANHTTGWVRMDFVVPSRGLIGWRTDFLTETRGSGVGHAVFDGYRPWAGEI
RARHTGSLVSDRAGAITPFALLQLADRGQFFVEPGQQTYEGMVVGINPRP
EDLDINVTREKKLTNMRSSTADVIETLAKPLQLDLERAMELCAPDECVEV
TPEIVRIRKVELAAAARARSRARTKARG
433634223YP_007267850.1 Respiratory nitrate reductase subunit delta NarJ [Mycobacterium canMWQSASLLLAYPDDGLAERLHMVDALRAHQTGPAAALLGRTVAELRALAP
MAAAAQYVETFDMRRRSTMYLTYWTAGDTRNRGREMLAFATAYRDAGVEP
PRAEAPDYLPVVLEFAATVDPETGRRLLTEHRVPIDVLRGALADAKSPYE
HTVAAICETLPAATDQEVRRAQRLAQSGPPAEAVGLQPFTLTVPPKRAEG
A
433634221YP_007267848.1 Putative respiratory nitrate reductase (alpha chain) NarG [MycobactMTVTPHVGGPLEELLERSGRFFTPGEFSADLRTVTRRGGREGDVFYRDRW
SHDKVVRSTHGVNCTGSCSWKIYVKDGIITWETQQTDYPSVGPDRPEYEP
RGCPRGASFSWYSYSPTRVRYPYARGVLVEMYREAKTRLGDPVLAWADIQ
ADPERRRRYQQARGKGGLVRVSWAEASEMIAAAHVHTIKTYGPDRVAGFS
PIPAMSMVSHAAGSRFVELIGGVMTSFYDWYADLPVASPQVFGDQTDVPE
SGDWWDASYLVMWGSNVPITRTPDAHWMAEARYRGAKVVVVSPDYADNTK
FADEWVRCAAGTDTALAMAMGHVILSECYVRNQVPFFVDYVRRYTDLPFL
IKLEKRGDLLVPGKFLTAADIDEETENAAFKPALLDELTNTVVVPQGSLG
FRFGEDGVGKWNLDLGSVVPALSVEMDNAVNGDRSAELVTLPSFDTIDGH
GETVSRGVPVRRVGKHLVCTVFDLMLAHYGVARAGLPGEWPTGYHDRTQQ
NTPAWQESITGVPAAQAIRFAKEFARNATESGGRSMIIMGGGICHWFHSD
VMYRSVLALLMLTGSMGRNGGGWAHYVGQEKVRPLTGWQTMAMATDWSRP
PRQVPGASYWYAHTDQWRYDGSGADKLASPVGRGRFAGKHTMDLLTSATA
MGWSPFYPQFDRSSLDVADEARAAGRDIGDYVTEQLAQHKLKLSITDPDN
PVNWPRVLTVWRANLIGSSGKGGEYFLRHLLGTDSNTQSEPAADAVQPRN
VVWDNEIPEGKLDLMMSIDFRMTSTTLVSDVVLPAATWYEKSDLSSTDMH
PYVHSFSPAIDPPWETRSDFDAFAAIARAFSALAKRHLGTRTDVVLTALQ
HDTPDAMAYPDGTERDWLATGEVPVPGRTMSKLTVVERDYTAIYDKWLTL
GPLIDQFGMTTKGYTVHPFREVSELAANFGVMNSGVAVGRPAITTAKRMA
DVILALSGTCNGRLAVEGFLELEKRTGQRLAHLAEGSEERRITYADTQAR
PVPVITSPEWSGSESGGRRYAPFTINIEHLKPFHTLTGRMHFYLAHDWVE
ELGEQLPVYRPPLDMARLFNQPELGPTDDGLGLTVRYLTPHSKWSFHSTY
QDNLYMLSLSRGGPTMWMSPGDAAKINVRDNDWVEAVNANGIYVCRAIVS
HRMPEGVVFVYHVQERTVDTPRTETNGKRGGNHNALTRVRIKPSHLAGGY
GQHAFAFNYLGPTGNQRDEVTVVRRRSQEVRY
433634219YP_007267846.1 Conserved protein of unknown function- possible pterin-4-alpha-carbMAVLTDEQVDAALHDLNGWQRAGGVLRRSIKFPTFMAGIDAVRRVAERAE
EVNHHPDIDIRWRTVTFALVTHAVGGITENDIAMAHDIDAMFGA
433634217YP_007267844.1 Conserved protein of unknown function- Alanine and Proline rich- poMPTIWTFVRAAAVLVGSSAALLTGGIAHADPAPAPAPAPNIPQQLISSAA
NAPQILQNLATALGATPPLSAPKVAEPAPAAPGITATFPGLTPAAPAAAA
APAVTPSIPGGNAPIPGITPAAPALPVTAPAAAPTIPGVNAPIPGITAPA
PAAAAVPASVPGVPSAKVDLPQLPYLPLQVPQQLSLPADLPALASGVIPA
APIAPTPPAPGAPALPPGPPSLLAALP
433634215YP_007267842.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MKTHLTCPCGEAITGKDEDELVELTQAHLASVHPGLEYDRDAILFMAY
433634213YP_007267840.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MGESKSQQESSSEGETKRKFREALDRKMAQSSSGSDHKDGGGKQSRAHGP
VASRREFRRKSG
433634211YP_007267838.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MEFPLITANSLSSKTWRAMPRAYVAVASFSGGLVQSGMAKFAAFLRGVNV
GGVNLKMAEVVTALTDAGFCNVRTILASGNVLLESTCGAAEVREKTEATL
RERFGYDAWALIYDVDTVRTIVAAYPFECELEGYQSYVTFVADAAILDEL
SALADTAGPDENISRGPDPLGVLYWQVPKGSTLDSTIGQTMGKKRYKSST
TTRNLRTLAKVLR
433634209YP_007267836.1 Putative transcriptional regulatory protein [Mycobacterium canettiiMELRDWLRVDVKAGKPLFDQLRTQVIDGVRAGALPPGTRLPTVRDLAGQL
GVAANTVARAYRELESAAIVETRGRFGTFISRFDPTDAAMAAAAKEYVGV
ARALGLTKSDAMRYLTNVPDD
433634207YP_007267834.1 Putative IS like-2 transposase [Mycobacterium canettii CIPT 1400700MRIRLTAGQAGDNPQLLPLLDDYRHASTEYALGSTDFRLLADKAYSHPST
RAALRSKKIKHTIPERQDQIDRRKAKGSAGGRPPAFDAALYGLRNTVERG
FHRLKQWRGIATRYDKYALTYLGGVLLACAVIHARVGTPKLGDTPCRDRR
ACIQGEIPPGKPSP
433634205YP_007267832.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MSETFCLTDHSAPMTARFLSVGLRRIRGMRSDTREEIAAALDAYHASLSR
VLDLKCDALTTPELLACLQRLEVERRRQGAAEHALINQLAGQACEEELGG
TLRTALANRLHITPGEASRRIAEAEDLGERRALTGEPLPAQLTATAAAQR
EGKIGREHIKEIQAFFKELPAAVDLGIREAAEAQLAELATSRRPDHLHGL
ATQLMDWLHPDGNFSDQERARKRGITMGKQEFDGMSRISGLLTPELRATI
EAVLAKLAAPGACNPDDQTPVVDDTPDADAVRRDTRRQAQRNHDAFLAAL
RGLLASGELGQHKGLPVTIVVSTTLKELEAAAGKGVTGGGSRVPMSDLIR
MASNAHHYLALFDGAKPLALYHTKRLASPAQRIMLYAKDRGCSRPGCDAP
AYHSEVHHVTPWTTTHRTDINDLTLACGPDNRLVEKGWKTRKNAHGDTEW
LPPPHLDHGQPRINRYHHPAKILCEQDDDEPH
433634203YP_007267830.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MTSGAPASASRVDHPLFARIWPVVAEHEAEAIRALRRENLAGLSGRVLEV
GAGVGTNFAYYPVAVEQVIAMEPEPRLAAKARIAAADAPVPIVVTDKTVE
EFRDTETFDAVVCSLVLCSVSDPGAVLAHLRSLLRRGGELRYLEHVASAG
ARGRVQWFVDATFWPRLAGNCHTHRHTERAILDAGFVVDSSRREWALPAW
VPLPVSELALGRAHRT
433634201YP_007267828.1 Putative short-chain type dehydrogenase/reductase [Mycobacterium caMETKEAVAVVTGGASGLGLATTKRLLDAGAQVVVVDLRGDDVVGGLGDCA
RFAQADVTDEAAVSNALELADSLGPVRIVVNCAGTGNAIRVLSRDGVFPL
AAFRKIVDINLVGTFNVLRLGAERIAKTEPIGEERGVIINTASVAAFDGQ
IGQAAYSASKGGVVGMTLPIARDLASKLIRVVTIAPGLFDTPLLASLPTE
AKASLGQQVPHPSRLGNPDEYGALVLHIIENPMLNGEVIRLDGAIRMAPR
433634199YP_007267826.1 Putative enoyl-CoA hydratase EchA10 (enoyl hydrase) (unsaturated acMSNYRIDTRTIVPGLAVTLADGVLSVTIDRPESLNSLTKPVLAGMADAIE
GAATDPRVKVVRLGGAGRGFSSGGAISVDDVWASGPPTDTVAEANRTVRA
IVALPQPVVAVVQGPTVGCGVSLALACDLVLASDNAFFMLAHTNVGLMPD
GGASALVQAAIGRIRAMQMALLPDRVRAAEALSWGLVSAVYPAADFEAEV
DKLISRLLAGPALAFAKTKNAINAATLTELAPTLLRELDGQALLLRTDDF
AEGATAFQQRRTPTFTGR
433634197YP_007267824.1 Conserved membrane protein of unknown function [Mycobacterium canetMPRDCTAPRWAHAWAGELRPVRWHPANQPAHPGHSNRESPACMSQSTTGY
RSSVLAEFRRAITNVAVPHHEPPGIVRRRRVVVGVTLVIGAVMLGFSLRR
TPGESSFYWLTLALAAVWIAGALMSGPLHLGGICWRGRNQRPVITGTTVG
LLLAGIFVVGAMIVREIPGAAEPIARVLQFAHQGTLLPILLITLINGIAE
EMFFRGALYTALGRRYPVTISTVLYVGATMASANLMLGFAAIFVGTVCAL
ERRASGGVLAPILTHFVWGLIMVFALPPLFAV
433634195YP_007267822.1 Putative oxidoreductase [Mycobacterium canettii CIPT 140070017]MTSYDTDLLVVGGGPGGLATALHARARGLSVIVAEPRENPIDKACGEGLM
PGGLAELTSLGVDPVGLPFHGIAYVGEHRRVQARFRTGPGRGVRRTTLHA
ALAARAKEQDTEWIRSRVATIQQDAHGVTAAGVRAKWLVAADGLHSAVRR
AVGIKATAGTPRRYGVRWHYRLPVWSDFVEVHWSRWGEAYVTPVEPDLVG
VAILSRQRPELAWFPSLAHHLQDASRGHARGCGPLRQVVSRRVAGRVLLV
GDAAGYEDALTGEGISLAVKQAAAAVSAIVDDTPASYEAAWHRITRDYRL
VTRGLVLASTPRAARRAIVPLCALLPTAFRYGVNILAY
433634193YP_007267820.1 Putative enoyl-CoA hydratase [Mycobacterium canettii CIPT 140070017MTATDSRSAAFVEYRDNVMVITINRPEARNAVNGAVSIVVGDALEEAHDN
PDVRAVVITGAGDNSLCADLKAIARRENPYHPHHCEWGSAGYVHHFIDKP
NSAAVSGTALDDGAEPALASDLVVADEHT
433634191YP_007267818.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MAAYQKFGQEHAAAIRGGAVLHPTATATTVRVTGARGGDVVTGDGPYEAA
DLDEQGPFPMETVYLWEDGPNGTTRMTL
433634189YP_007267816.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MGFLQPRLPDIDLAEWSQGSRSQKIRPMAQHWAEVGFGTPVVLHLFYVAK
ILLYILVGWLIVLTTKGIDGFTDAAAWYAEPIVFEKVVLYTMLFEVIGLG
CGFGPLNNRFLPPMGSILYWMRFGTIRLPPWPDRVPWTRGTKRKPVDVAL
YALLVMMLLSALFTDGAGPIPELGTTVGLLPAWQIVLILLLLGVLGLRDK
VIFLAARGEVYATLTVTFLFGGLNGIDMIVAAKLVFLVIWIGAATSKLNR
HFPFVISTMMSNNPLFRPRFIKRMFFKKFPGDLRPGLLSQIVAHVSTVIE
MCVPVVLFVAHGGWPTVVAATIMVCFHLGILTAIPMGVPLEWNVFMIFGV
LSLFVGHARLGLADVKNPVPVAILIAVVAGIVIAGNVFPRKISFLAAMRY
YAGNWDTTLWCIKPSAEDKINRGIVAIASMPAAQLERFYGKDRAQLPMYL
GYAFRAMNSHGRALFTLAHRAMAGHDEDDYVITDGERVCSTAVGWNFGDG
HLHNEQLIAAMQQRCGFQPGEVRVVLLDAQPIHRQTQEYRLVDAATGEFE
RGYVRVADMVTRQPWDDDVPVHVLPG
433634187YP_007267814.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MLMHAVRARRSADDFPRTEHLAYKIAQVAADPVDVDPEVADMVCNRIIDN
AAVSAASMVRRPVTVARHQALAHPVRHGAKVFGVEGSYSADWAAWANGVA
ARELDFHDTFLAADYSHPADNIPPLAAVAQQLGVCGAELIRGLVTAYEIH
IDLTRGICLHEHKIDHVAHLGPAVAAGIGTMLRLDQETIYHAIGQALHLT
TSTRQSRKGAISSWKAFAPAHAGKVGIEAVDRAMRGEGSPAPIWEGEDGV
IAWLLAGPEHTYRVPLPAPGEPKRAILDSYTKQHSAEYQSQAPIDLACRL
RERIGDLEQIASIVLHTSHHTHVVIGTGSGDPQKFDPDASRETLDHSLPY
IFAVALQDGCWHHERSYAPERARRSDTVALWHKISTVEDPEWTRRYHCAD
PAEKAFGARAEVTLHSGEVIVDELAVADAHPLGTRPFERKQYVEKFTELA
DGVVEPVEQQRFLAVVESLADLESGAVGGLNVLVDPRVLDKAPVIPPGIF
R
433634185YP_007267812.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MINVCSTLGSWRRAVSQCSSSARRSGVVNASKVSPSTRDSAVANDAKASV
ISSRVEHMTECYVQAPTTMLAQSLLKPQ
433634183YP_007267810.1 Putative pyruvate- phosphate dikinase PpdK [Mycobacterium canettii MTRITRANGCPDGTLENAVVALDGGANYPREILGNKGHGIDMMRRHHLPV
PPAFCITTEVGVRYLAAPESTIAAIWDDVLDRMSWLETETSCTFGRGPNP
LLVSVRSGATQSMPGMMDTILDVGMTDTVERVLARPGAADFAHDTRRRFT
SMYRRIVGSAGAITDDPYAQLRASIEAVFASWNSPRAVAYRDHYGLDDQG
GTAVVVQAMVFGNLTANSGAGVLSSRNPITGANEPFGEWLPGGQGDDVVS
GLVAVAPITALRDQQPAVYDQLMTAARSLERMAGDVQEIEFTVEDGQLWL
LQTRGAERSAQAAVRLALQLHHEGLIDDTETLRRVTPTHIETLLRPSLQP
ETRLAAPLLAKGLPACPGVVSGTAYTEVDEALDAADRGEPVILVRDHTRP
EDVMGMLAAQGIVTEVGGAASHAAVVSRELGRVAVVGCGPGVAAALAGKE
ITVDGYEGEVRQGVLALSAWSESDTPELRELADIARRISP
433634181YP_007267808.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MAGHRMAAVDAQFYWMSAKVPNDQFLLYAFDGEPTDLERAVAQVYRRAGG
CPDLGMRVQDRGALAYPQWVPTSVQRDQLVCHDLADRSWQGCLAAVVGLA
GKQLDIRRMPWRLHVFTPVHDVPGVSGPGTVAVMQFAHALGDGARASAMA
AWLFGRPAAVPEIARSRAGFLPWRAADAARAHLRLVRDTNAGRVAPGVGS
RPPLSTNARPEGVRAVRTLLRRRSQLAGPTVTVTVLAAVSTGLLDLLGGD
VDTLGAEVPMAKPGVPRSYNHFGNVVVGLYPRLEPDERMRRIATDLANAR
RRFEHPAMLSADRAFAAVPAALLRWGVSQFDAEVRPVRMAGNTVVSSVYR
GAADLSFGDAPVVLTAGYPALSPAMGLTHGVHGIGDTVAISVHAAESAVS
DIDAYMRLLDAALQ
433634179YP_007267806.1 Putative peroxidase BpoB (non-haem peroxidase)- supposedlly involveMSAVSSSPQTVAFSGARGITLVADEWNRGAAAADRPTILMLHGGGQNRFS
WKNTGQILADEGHHVVALDTRGHGDSDRAPGADYAVETLTTDVLHVVEAI
GRRVVVVGASMGGLTGILVAERAGPQTVNGLVLVDVVPRYEKEGSARIRD
FMLGNIDGFGSLEEAADAVAEYLPHRDKPRSPEGLKRNLRLRDGRWHWHW
DPAMMTAPGDDPQLRTENFERAAMGLTIPVLLIRGKLSDVVSSDGARDFL
AKVPNAEFVELSNAGHTAAGDDNDAFTDVVVDFVRRLS
433634177YP_007267804.1 Putative glucose-6-phosphate 1-dehydrogenase Zwf1 (G6PD) [MycobacteMVDGGGGASDLLVIFGITGDLARKMTFRALYRLERHQLLDCPILGVASDD
MSVEQLVERARESIGRTEKIDDAVFDRLASRLSYLHGDVTDSQLYDSLAE
LIGSDCRPLYYLEMPPALFAPIVENLANVRLLERARVAVEKPFGHDLASA
LELNARLRAVLGEDQILRVDHFLGKQPVVELEYLRFANQALAELWDRNSI
SEIHITMAEDFGVEDRGKFYDAVGSLRDVVQNHLLQVLALVTMEPPVGSS
ADDLNDKKAEVFRAMAPLDPDRCVRGQYLGYTEVAGVASDSATETYVALR
TEIDNWRWAGVPIFVRAGKALPAKVTEVQLFLRRVPALAFLPNRRPAEPN
QIVLRIDPDPGMRLQISAHTDDSWRDIHLDSSFAVDLGEPIRPYERLLYA
GLVGDHQLFAREDSIEQTWRIVQPLLDNPGEIHRYDRGSWGPEAAQSLLR
GHRGWQSPWLPRSADA
433634175YP_007267802.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MIFIVVKFETKPEWTERWPDLVASFTAATRAEEGNLWFEWSHSLDDPAEY
FLVEAFRDGEAGGVHVNSDHFRQAMRELPKALASTPKIISQTIDATGWSA
MGEMTVG
433634173YP_007267800.1 Conserved protein of unknown function- PE family protein (fragment)MGATGAVLQAPGNAVNGFLFGQTAISQSIDVSPEYGYESVAVSDPVGGTA
GSARAGHGYVHADLR
433634171YP_007267798.1 Conserved protein of unknown function- with PIN domain [MycobacteriMILVDTSVWIKHLRAADARLVELLGDDEAGCHPLVIEELALGSIKQRDVV
LDLLANLYQFPVLTHDEVLRLVGRRRLWGRGLGAVDANLLGSVALVGGAR
LWTRDKRLKAACAESGVALAEEVP
433634169YP_007267796.1 Conserved protein of unknown function- possible GTP binding proteinMSLSLGIVGLPNVGKSTLFNALTRNNVVAANYPFATIEPNEGVVSLPDPR
LDKLAELFGSQRVVPAPVTFVDIAGLVKGASEGAGLGNKFLAHIRECDAI
CQVVRVFVDDDVTHVTGRVDPQSDIEVVETELILADLQTLERATGRLEKE
ARTNKARKPVYDAALRAQQVLDAGKTLFAAGVDAAALRELNLLTTKPFLY
VFNADEAVLTDPARVGELRALVAPADAVFLDAAIESELTELDDESAAELL
ESIGQSERGLDALARAGFHTLKLQTFLTAGPKEARAWTIHQGDTAPKAAG
VIHSDFEKGFIKAEIVSYDDLVAAGSMAAAKAAGKVRIEGKDYVMADGDV
VEFRFNV
433634167YP_007267794.1 Putative LytB-related protein LytB2 [Mycobacterium canettii CIPT 14MVPTVDMGIPGASVSSRSVADRPNRKRVLLAEPRGYCAGVDRAVETVERA
LQKHGPPVYVRHEIVHNRHVVDTLAKAGAVFVEETEQVPEGAIVVFSAHG
VAPTVHVSASERNLQVIDATCPLVTKVHNEARRFARDDYDILLIGHEGHE
EVVGTAGEAPDHVQLVDGVDAVDQVTVRDEDKVVWLSQTTLSVDETMEIV
GRLRRRFPKLQDPPSDDICYATQNRQVAVKAMAPECELVIVVGSRNSSNS
VRLVEVALGAGARAAHLVDWADDIDSAWLDGVTTVGVTSGASVPEVLVRG
VLERLAECGYDIVQPVTTANETLVFALPRELRSPR
433634165YP_007267792.1 Exodeoxyribonuclease VII large subunit XseA (Exonuclease VII large MTQNSAENPFPVRAVAIRVAGWIDKLGAVWVEGQLAQITMRPDAKTVFMV
LRDPAADMSLTVTCSRDLVLSAPVKLAEGVQVVVCGKPSFYTGRGTFSLR
LSEIRAVGIGELLARIDRLRRLLDAEGLFDPRLKRPIPFLPNMIGLITGR
ASAAERDVTTVASARWPAARFAVRNVAVQGPNAVGQIVEALRELDRDPDV
DVIVLARGGGSVEDLLPFSDETLCRAIAACRTPVVSAVGHEPDNPLCDLV
VDLRAATPTDAAKKVVPDTAAEQRLIDDLRRRSAQALRNWVSREQRAVAQ
LRSRPVLADPMTMVSVRAEEVHRARSTLRRNLTLMVAAETERIGHLAARL
ATLGPAATLARGYAIVQTVAQTGPEGGSEPQVLRSVHDAPAGTKLRVRVA
DGALAAVSEGQTDGL
433634163YP_007267790.1 3-beta-hydroxysteroid dehydrogenase [Mycobacterium canettii CIPT 14MLRRMGDASLTTELGRVLVTGGAGFVGANLVTTLLDRGHWVRSFDRAPSL
LPAHPQLEVLQGDITDADVCAAAVDGIDTIFHTAAIIELMGGASVTDEYR
KRSFAVNVGGTENLLHAGQRAGVQRFVYTSSNSVVMGGQNIAGGDETLPY
TDRFNDLYTETKVVAERFVLAQNGVDGMLTCAIRPSGIWGNGDQTMFRKL
FESVLKGHVKVLVGRKSARLDNSYVHNLIHGFILAAAHLVPDGTAPGQAY
FINDAEPINMFEFARPVVEACGQRWPRVRISGPAVHWVMTGWQRLHFRFG
FPAPLLEPLAVERLYLDNYFSIAKARRDLGYEPLFTTQQALTECLPYYVS
LFEQMKNEARAEKTAATVKP
433634161YP_007267788.1 Putative para-nitrobenzyl esterase (part 3) [Mycobacterium canettiiMNPRGNRHDPARHPGGRGSVRGGDRPELTGDIGLRPGEGSARRGLRPRQA
GNRPVRCAQVHEVPTAAILSASSEVFNEVPVRNPGTLAFVPIVDGDLLPD
YPVKLAQEGRSHPVPLIIGTNKDESALFRLMRSPLMPITPRDHVDVHPDC
RRTARSASANRGADRLRVLAMAAQSTLIEYGYRRRLPDAVGVAR
433634159YP_007267786.1 Putative para-nitrobenzyl esterase (part 1) [Mycobacterium canettiiMWPNPATVRGADNGRVRVWKGIRYAAPPLGDLRFRTPEPPERWTGVADAT
TFGPACPQPAIPNMPLDLGAVAERRLFEPEHLGAGGHRAR
433634157YP_007267784.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MRPIHIAQLDKARPVLILTREVVRPHLTNVTVAPITTTVRGLATEVPVGA
VNGLNQPSVISCDNIQTIPVSDLGRQIGYLFASQEPALVEAIGNAFDLDW
VVA
433634155YP_007267782.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MVGDCPRSRTVRWSWDTGHVTAEPQPTPRPAKPRLLQDGRDMFWSLAPLV
VGCILLAGLVGMCSFQLGGTKRGPIPSYDAAQALRADAKTLGFPIRLPQL
PGGWTPNSGGRGGIENGRADPVTGQRRNAATSIVGFISPTGRYLSLTQSN
ADEDKLVGSIHPSMYPTGTVDVGGTRWVVYEGSDENGAVEPVWTTRLTGP
GGATQLAITGAGSIDQFRTLASATQSQPPLPAR
433634153YP_007267780.1 Putative fumarase Fum (fumarate hydratase) [Mycobacterium canettii MAVDADSAEYRIEHDTMGEVRVPAKALWRAQTQRAVENFPISGRGLERTQ
IRALGLLKGACAQVNKDLGLLAPEKADAIIAAAAEIADGQHDDQFPIDVF
QTGSGTSSNMNTNEVIASIAAKGGVTLHPNDDVNMSQSSNDTFPTATHIA
ATEAAVAHLIPALQQLHDALTAKALDWHTVVKSGRTHLMDAVPVTLGQEF
SGYARQIEAGIERVRACLPRLGELAIGGTAVGTGLNAPDDFGVRVVAVLV
AQTGLSELRTAANSFEAQAARDGLVEASGALRTIAVSLTKIANDIRWMGS
GPLTGLAEIQLPDLQPGSSIMPGKVNPVLPEAVTQVAAQVIGNDAAIAWG
GANGAFELNVYIPMMARNILESFKLLTNVSRLFAQRCIAGLTANVEHLRR
LAESSPSIVTPLNSAIGYEEAAAVAKQALKERKTIRQTVIDRGLIGDRLS
IEDLDRRLDVLAMAKAEQLDSDRL
433634151YP_007267778.1 Putative glycosyl hydrolase [Mycobacterium canettii CIPT 140070017]MPKRPDNQTWRYWRTVTGVVVAGAVLVVGGLSGRVTRADNLSCSVIKCVA
LTFDDGPGPYTDRLLHILTDNDAKATFFLIGNKVAANPAGAQRIADAGME
IGSHTWEHPNMTTIPPEDITAQFSRANDAITAATGRTPTLYRPAGGLSND
AVRQAAAKVGQAEILWDVIPFDWINDSNTAATRHMLMTQIKPGSVVLFHD
TYSSTVDVVYQFIPVLKANGYRLVTVSELLGPRAPGSSYGSRENGPPVNE
LRDIPASEIPPLPNTSSPKPMPNFPITDIAGQNSGGPNNGA
433634149YP_007267776.1 Putative acyl-[acyl-carrier protein] desaturase DesA2 (acyl-[ACP] dMAQKPVADALTLELEPVVEANMTRHLDTEDIWFAHDYVPFDQGENFAFLG
GRDWDPSQTTLPRTITDACEILLILKDNLAGHHRELVEHFILEDWWGRWL
GRWTAEEHLHAIALREYLVVTREVDPVANEDVRVQHVMKGYRAEKYTQVE
TLVYMAFYERCGAVFCRNLAAQIEEPILAGLIDRIARDEVRHEEFFANLV
THCLDYTRDETIAAIAARAADLDVLGADIEAYRDKLQNVADAGIFGTPQL
RQLISDRITAWGLAGEPSLKQFVTG
433634147YP_007267774.1 Putative pantothenate kinase CoaA (Pantothenic acid kinase) [MycobaMPRLSEPSPYVEFDRKQWRALRMSTPLALTEEELIGLRGLGEQIDLLEVE
EVYLPLARLIHLQVAARQRLFAATAEFLGEPQQNPDRPVPFIIGVAGSVA
VGKSTTARVLQALLARWDHHPRVDLVTTDGFLYPNAELERRNLMHRKGFP
ESYNRRALMRFVTSVKSGSDYACAPVYSHLHYDIIPGTEQVVRHPDILIL
EGLNVLQTGPTLMVSDLFDFSLYVDARIEDIEQWYVSRFLAMRTTAFANP
ESHFHHYAALSDAKAVVAARDIWRTINRPNLVENILPTRPRATLVLRKDA
DHSINRLRLRKL
433634145YP_007267772.1 Conserved protein of unknown function- PE-PGRS family protein PE_PGMSFVVVAPEVLAAAASDLAGIGQTLAQANAAALAPTTAVLAAGADEVSAA
IASLFGAHGQAYQAVSAQMSVLHAQFVRALTGAGGAYAAAEAVNVAAAQS
VEQRLLDLINGPTLALFGRTLIGDGANGGPGQDGGPGGLLYGNGGNGGTS
TTVGVAGGNGGAAGLIGNGGFGGGGGPGAAGGNGGAGGWLFGNGGAGGAG
GTSVMPGVAGGNGGAGGAAWLFGTGGAGGHGGNGMSAPSLTGMAGGAGGN
GGAGGHAGLFGDAGAGGDGGNGGSGGSGPGGGSSGGAGGAGGAGGTGGNA
GLWGTGGTGGNGGMAGNGAAGSINGGNGGAGGHGGAGGAGGAGGALFGIG
GNGGHGAAAGTGADGGTGKFGSGGGSPGGNGGDGGAGGAGGAGGSARLLG
SGGIGGQGGTGGAAGAGGTGGQVEPGFGPGSGGTGGTGGTGGEGGRGGAG
GTGGLLFGDGGAGGHGAAAGAGGDAGMGGRGQVAGNTGGSGGVGGVGGAG
GAGGAGGNARLWGVGAAGGGGGKGGIAGMGGVAGTGLFSADGGNGGDGGD
GGAGGVGGSGGTGGLLFGIGGTGGDGGSGGAATDGRTGGFGVIGGNGGNG
GIGGAGGSGGAGGGSADGKSGWLIGTGGDGGNGAAGGKGGQNGGAGAGSL
QNGNNGTSGNGGDAGNGGNGATGGVLYGNGGAGGSGASGGSGGVGATAGA
GGSGGNGGNAQLIGDGGNGGNGATGVPGGMGGAGGRRGLLFGQAGTDGAL
L
433634143YP_007267770.1 Putative hemolysin-like protein [Mycobacterium canettii CIPT 140070MSGQADTATTAAARTPAHAAHHLVEGVARVLTKPRFRGWIHVYSAGTAVL
AGASLVAVSWAVGSAKAGLTTLAYTAATITMFTVSATYHRVNWKSATARN
WMKRADHSMIFVFIAGSYTPFALLALPGHDGRVVLSIVWGGAIAGILLKM
CWPAAPRSVGVPLYLLLGWVAVWYTATILHNAGVTALVLLFVGGALYSIG
GILYAVRWPDPWPTTFGYHEFFHACTAVAAICHYIAMWFVVF
433634141YP_007267768.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MSPANPSGTNTLALATSPYLRQHADNPVHWQQWTPQALAEAAARAVPILL
SVGYAACHWCHVMAHESFDDDEVAAAMNAGFVCIKVDREERPDIDAVYMN
ATVALTGQGGWPMTCFLTPNGRPFFCGTYYPKAAFLQLLSAISETWRERR
AEVEQASDHIAAELRSMASGLPGGGPEVAPELCDDAVAGVLREQDTAHGG
FGGAPKFPPSALLEALLRHYERTGSPAALEAVARTGNAMARGGIYDQLGG
GFARYSVDSAWVVPHFEKMLYDNALLLRAYAHWARRTGDPLARRVTAQTA
RFLLDELGSKAPADMFTSSLDADADGREGSTYVWTPEQLTEVLGGDDGRW
AAEVFGVTEAGTFEHGTSVLQLPADPDDAARLDRVRAALLAARLARAQPA
RDDKVVTSWNGLAITALAEASVALDDPALAHAARRCATRLLDLHVVDGRL
RRASLGGVVGDSAAILEDHAMLATGLLALYQLTSEGGWLTAATGLLDTAV
AHFGDPQRPGRWFDTADDAERLMLRPSDPLDGATPSGASSVTEALLTAAH
LVDAGRAERYLQLAADTLRAHAVLLARAPRSAGHWLAVAEAVVRGPLQIA
VACDLPRSSLLADARRLAPGGAIVVGGAAGSSALLVGRDRVAGADAAYVC
RGRVCDLPVTGAAELATALGVPG
433634139YP_007267766.1 Mycothiol conjugate amidase Mca [Mycobacterium canettii CIPT 140070MSELRLMAVHAHPDDESSKGAATLARYADEGHRVLVVTLTGGERGEILNP
AMDLPDVHGRIAEIRRDEMAKAAEILGVEHTWLGFVDSGLPKGDLPPPLP
DDCFARVPLEVSTEALVRVVREFRPHVMTTYDENGGYPHPDHIRCHQVSV
AAYEAAGDFCRFPDAGEPWTVSKLYYVHGFLRERMQMLQDEFARHGQRGP
FEQWLAYWDPDHDFLTSRVTTRVECSKYFSQRDDALRAHATQIDPNAEFF
AAPLAWQERLWPTEEFELARSRIPARPPETELFAGIEP
433634137YP_007267764.1 Putative transcription elongation factor GreA (transcript cleavage MTDTQVTWLTQESHDRLKAELDQLIANRPVIAAEINDRREEGDLRENGGY
HAAREEQGQQEARIRQLQDLLSNAKVGEAPKQSGVALPGSVVKVYYNGDK
SDSETFLIATRQEGVSDGKLEVYSPNSPLGGALIDAKVGETRSYTVPNGS
TVSVTLVSAEPYHS
433634135YP_007267762.1 Conserved protein of unknown function- putative proline-rich antigeMTEQPPPGGSYPPPPPPPGSSGGHEPPPAAPPGGSGYPPPPPPSSGSGYP
PPPPPPGGGAYPPPPPSAGGYAPPPPGPAIRTMPTESYTPWITRVLAALI
DWAPYVVLVGIGWVIMLVTQTSSCVTSISQYDVGQFCVSQPSMIGQLVQW
LLSVGGLAYLVWNYGYRQGTTGSSIGKSVLKFKVVSETTGQPIGFGMSVV
RQLAHFIDAIICFVGFLFPLWDAKRQTLADKIMTTVCVPI
433634133YP_007267760.1 Putative lipase LipU [Mycobacterium canettii CIPT 140070017]MAIRPVLAVGSYLPHAPWPWGVIDQAARVLLPASTTVRAAVSLPNASAQL
VRASGVLPADGTRRAVLYLHGGAFLTCGANSHGRLVELLSKFADSPVLVV
DYRLIPKHSIGMALDDCHDGYRWLRLLGYEPEQIVLAGDSAGGYLALALA
QRLQEVGEEPAALVAISPVLQLAKEHKQAHPNIKTDAMFPARAFDALDAL
VASAAARNQVDGEPEELYEPLEHITPGLPRTLIHVSGSEVLLHDAQLAAA
KLAAAGVPAEVRVWPGQVHDFQVAASMLPEAIRSLRQIGEYIREATG
433634131YP_007267758.1 Putative beta-ketoacyl CoA thiolase FadA3 [Mycobacterium canettii CMPEAVIVSTARSPIGRAMKGSLVSMRPDDLAVQMVRAALDKVPALNPHQI
DDLMMGCGLPGGESGFNIARVVAVALGYDFLPGTTVNRYCSSSLQTTRMA
FHAIKAGEGDAFISAGVETVSRFGKGNSDSWPDTKNPLFDGAQERSAAAA
AGADEWHDPRADQKLPDIYIAMGQTAENVAIITGISREEQDRWGVRSQNR
AEEAIKNGFFEREITPVTLPDGTTVSTDDGPRPGTTYEKVSELKPAFRPN
GTVTAGNACPLNDGAAAVVITSDTKAKELGLTPLARIVSTGVSGLSPEIM
GLGPIEASKKALQRAGMSITDIDLVEINEAFAVQVLGSARELGIDEDKLN
VSGGAIALGHPFGMTGARITTTLLNNLQTYDKTFGLETMCVGGGQGMAMV
IERLA
433634129YP_007267756.1 Conserved membrane protein of unknown function [Mycobacterium canetMRETSNPVFRSLPKQRGGYAQFGTGTAQQGFPADPYLAPYREAKATRPLT
IDDVVTKTGLTLAMLAGTAVVSYFLVASNVALAMPLTLVGALGGLALVLV
ATFGRKQDNPAIVLSYAALEGLFLGAISFVLANFTVASANAGVLIGEAIL
GTMGVFFGMLVVYKTGAIRVTPKFTRMVVAALFGVLVLMLGNLVLAMFNV
GGGEGLGLRSPGPLGIIFSLVCIGIAAFSFLIDFDAADQMIRAGAPEKAA
WGVALGLTVTLVWLYIEILRLLSYLQNE
433634127YP_007267754.1 Putative enoyl-CoA hydratase EchA8 (enoyl hydrase) (unsaturated acyMTYETILVERDQRVGIITLNRPQALNALNSQVMNEVTSAAAELDDDPDIG
AIIITGSAKAFAAGADIKEMAGLTFADAFAADFFATWGKLAAVRTPTIAA
VAGYALGGGCELAMMCDVLIAADTAKFGQPEIKLGVLPGMGGSQRLTRAI
GKAKAMDLILTGRTMDAAEAERSGLVSRVVPADDLLTEARATATTISQMS
ASAARMAKEAVNRAFESSLSEGLLYERRLFHSAFATDDQSEGMAAFIEKR
APQFTHR
433634125YP_007267752.1 Conserved protein of unknown function- PE-PGRS family protein (PE-PMSYMIAVPDMLSSAAGDLASIGSSINASTRAAAAATTRLLPAAADEVSAH
IAALFSGHGEGYQAIARQMAAFHEQFTLALTSSAGAYASAEATNVEQQVL
GLINAPTQALLGRPLIGNGADGTAANPNGGAGGLLYGNGGNGFSQTTAGL
AGGAGGSAGLIGNGGNGGAGGAGANGGAGGNGGWLYGSGGNGGSGGPGPA
GAIGAPGGAGGAGGAGGSAGLFGNGGVGGAGGAGGQGGAGIGGADGTKGG
DAGAGGAGGAGGWIRGHGGAGGDGGTGGQGGDGVQGEPGDTGAAGGAGGA
GGRGGDGGSAGWLSGNGGDAGTGGGGGNAGAGGEGGTFGGNGGTGGTGGT
AGGGGNGGRGAALFGHGGNAGHGGAGGNGAAGGNGADTQLGISGKGGTGG
GGGGAGAGGTGGDGGLLYGNGGAGGNGGNGGAAGKGGTGAPGLSTAQGGD
GGNGGSGGNAGNGGNGGRGSVLFGHGGNAGHGGAGGKGAVSGNGGSSITA
VGGKGGTGGGGGGAGAGGTGGDGGLLYGDGGSGGTAGSGGAGGRGGDGGA
GFGTANGGDGGNGGVGGNAGNGGNGGSAGWLSGNGGAGGGGGTAGAGGQG
GNGNSGIDPGNGGQGADTATPATAATADRPPSCSATAAPAAPAGWAAPAA
PAAAAASAAAPAVTVATATRAVPAVAAAPPACSVAAAAAVMAATVATAVW
APAAARRATAATVAAAATAATHS
433634123YP_007267750.1 Conserved protein of unknown function- PE-PGRS family protein PE_PGMSFVLVSPAQLMAAAAEVAGIGSAINAANAAALAPTSALAAAGADEVSAA
VAALFSAHAQQYQQLGARAALFHEQFVQALTGAGGAYAGAEATNVEQQVL
GLINAPTQALWGRPLIGNGADGTAANPNGGAGGLLYGNGGNGFSQTTAGL
AGGAGGSAGLIGNGGNGGAGGAGANGGAGGNGGWLYGNGGSGGSGGAGPA
GAIGAPGVAGGAGGAGGSAGLFGNGGVGGAGGAGGQGGNGAGAGASGAKG
GDAGAGGAGGAGGWLYGQGGAGGDGGAGGGGGQASPGAPGPPSQPGGAGG
AGGAGGRGGDGGSAGWLFGNGGDAGNGGGGGTAGDAGNGGQFGGDGGNGG
TGGTAGAGGNGGRGAVLFGHGGNAGHGGAGGNGGTAGAGGEHVVATAGKG
GTGGVGGDGGGGGAGGGGGLLYGNGGAGGNGGAGGAGNSGGDGGTGLNAA
LGGNGGGGGVGGNAGAGGTGGSAGWLSGNGGAGGSGGSAGAGGAGGKGGD
TPNSLAINPGIGGNGGDTGNAGNGGTGGSAAKLFGGGGAGGAGGMGSTAG
SGGSGGNNPPTGLQAAGGNGGSGHAGGHGGNGGGAGLLGGGGTGGTGGGG
GQGGLGAAAGGVDGNGGNGGNGGKGGDAQLIGDGGNGGNGGNGGAGLIAG
LDGAGGAGGTRGLIFGNAGTPGQ
433634121YP_007267748.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MVMPLVMSTTAVPSPGPTRLRVPDLLRATDQAADDVLSGRCDDLLPEGGV
PQTQRWYTRIHGDEELDIWLISWVPGQPTELHDHGGSLGALTVLSGSLNE
YRWDGRRLRRRRLDAGDQAGFPLGWVHDVVWAPRPIGGPDAAGMAAAPTL
SVHAYSPPLTAMSYYEITERNTLRRQRTELTDQPEGPG
433634119YP_007267746.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MPAPAALRVRGSSSPRVALALGSGGARGYAHIGVIQALRERGYDIVGIAG
SSMGAVVGGVHAAGRLDEFAHWAKSLTQRTILRLLDPSISAAGILRAEKI
LDAVRDIVGPVAIEQLPIPYTAVATDLLAGKSVWFQRGPLDAAIRASIAI
PGVIAPHEVDGRLLADGGILDPLPMAPIAGVNADLTIAVSLNGSEAGPAR
DAEPNVTAEWLNRMVRSTSALFDVSAARSLLDRPTARAVLSRFGAAAAES
DSWSQAPEIEQRPAGPPADREEAADTPGLPKMGSFEVMNRTIDIAQSALA
RHTLAGYPADLLIEVPRSTCRSLEFHRAVEVIAVGRALATHALEAFEIDD
DESAAATIEG
433634117YP_007267744.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MCRLFGLHSGTDAVTATFWLLNASDSLAEQSRRNPDGTGLGVFDEHHQPR
LHKQPIAAWQDADFATEAHELTGTTFVAHVRYATTGSLDIRNTHPFLQDG
RIFAHNGVVEGLDVLDERLREVGADDLVLGQTDSERVFALITASIRARDG
NESAGLIDALRWLAANVPIYAVNVLLSTATDVWALRYPESHELYILDRRG
DGAPEFHLRSKRIRAHSTHLRERSSVVFATEPMDDNPRWRLLDAGELVHV
DAACGSTGVWCYLIHPDIRFAGKISASRYCMRNTRRRELVTTRRALVLAG
GGLAGIAWETGVLRGIADESPAAARLLLDSDVLVGTSAGATVAAQISSGC
PLDTLYERQLAETSAEIDPGVDIDAITDLFPDCRDRAAHFDAPAATTDRC
RGVGGRHRSGVRPPSGDRPALAVARLAGPGVAGHRDRHRHRRIGCFPSRV
ECGAGRRGGGQLLGAGGVASGDNCRPPLHGWRGGQLGQPWCRRRL
433634115YP_007267742.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MTMSLRVIQWATGSVGVAAIKGVLQHPELELVGCWVHSAAKSGKDVGEII
GSPPLGVIATNSIDDVLALDADAVIYAPLLPSVDEVAALLRSGKNVVTPL
GWFYPSEKEAAPLEVAAQAGNATLHGAGIGPGAVTELFPLLLSVMSTGVT
FVRSEEFSDLRSYGAPDVLRYVMGFGGTPDSALTGPMQKILDGGFLQSVR
LCVDRLGFAADPQIRTSQEVAVATAPIDSPIGVIEPGQVAGRRFHWEALV
EDTVVVQIAVNWLMGSENLDPPWSFGPAGERYEIEVRGSPDTCVTIKGWQ
PQTVAAGLKSNPGIVATAAHCVNAIPATCAAPAGIQSFFDLPLITGRAAP
GLAR
433634113YP_007267740.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MSIMNGREVARESRDAQVFEFGTAPGSAVVKIPVQSGPIGGIAISRDGSL
LVVTNNGTDTVSVVGTDTCRVTQTVTSVNEPFAIAMGNAEANRAYVSTVS
SAYDAIAVIDVTTNTVLGTHALALSVSDLTLSPDDKYLYVSRNGTRGADV
AVLDTTTGALIDVVDVSQAPGTTTQCVRMSPDGSVLYVGANGPSGGLLVV
IATRAQSDEGRIGSRSRSRQKTSKPRGNQAAAGLRVVATIDIGSSVRDVA
LSPDGAIAYVASCGSDFGAVVDVIDTRTHQITSSGAIGEIGGLVTRVSVS
GDADRAYLVSEDRVTVLCTRTQEVIGTIRTGQPSCVVESPDGKYLYIADY
SGTITRTAVASTMVSGAEQLALQRRGSMQWFSPELQQYAPALA
433634111YP_007267738.1 Phage integrase family protein (fragment) [Mycobacterium canettii CMLTVRSSATAVTGKGIVESSTKTKRDRHVPVPEPVWRRLQAELPIDPNAL
VFPGRKGGFLPLGEYRWAFDNACDQVGIDGLVPHGLRRTTASLAISAGAN
VKVVQRFLGHATAAMTLDRYGHLLNDDLSGVADALGKVIENTAVSLRYAE
TEQSRAPGMR
433634109YP_007267736.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MRPRGLFPISSGIDTKRLQVELSAYVPYQRRAATHRPDATICLASALAHH
DLTDAIPAALDVAIPRGARTPASTGAIAWHHFDRATFEIGRDEIPIPGSD
QTIGIYSPERSIADAFRLRYEVGYELARDALREWLRRGGKPARLIDITSR
LPRAKSPVLRALEMLA
433634107YP_007267734.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MFAALLDTSVLWPSLQRDFLLSMAAEGLYRPLWSTAILDELSYHEAQKLV
RRGHDPAVAAQRVRGLVDRMSMAFDDAVVANWESLEGTFGFPDVGDEHVV
AAALVGGADVIVTSNVKNFPPLRPAAAESIWRERFRCGSGCGGGSNTDAA
RRSPQRRGAWLQPTSSGRRVPVLGLGRLCLR
433634105YP_007267732.1 Putative transcriptional repressor protein [Mycobacterium canettii MGKGAAFDECACYTTRRAARQLGQAYDRALRPSGLTNTQFSTLAVISLSE
GSAGIDLTMSELAARIGVERTTLTRNLEVMTRDGLVRVMAGADARCKRIE
LTAKGRAALQKAVPLWRGVQAEVTASVGDWPRVRRDIANLGQAAETCR
433634103YP_007267730.1 Putative helicase with DEAD/DEAH box [Mycobacterium canettii CIPT 1MIDRLDPLETAKQIEGSYKRYLKTLLAPRDEQLAAAFDAAIDASTLLTKG
PILELTPPYETGATCRQLIAEGVLHPNFARVDSPSFPIDQPLYVHQETAI
RKFVAGRNLVVSTGTGSGKTESFLVPIINSLIEELEHETLGPGVRALLLY
PMNALANDQLKRLRAVLAGVPEITFGRYTGETAESERAAETEFLQNNPGA
RRLSNELLSRDEMRASPPHLLLTNYAMLEYLLLRPADMDLFDGPHAGTWR
FIVMDEAHVYDGAQGSEVALLMRRLKQRVAPGAQLQCIATSASLTGSVRN
DPRGEAMEFARNLFDAPFEYVEGDSSRQDLVEPTRKTHLPTSNWKLSGQQ
LLALREGAIDLADVVPPGVGHAEALSAEEAIVELKDALGAGPVDVRALRE
RMWPGDERSGEKLDALVELGSSVHDAAGHPVLSARYHLFVRATEGAFVSF
QDDGPRIFLARHEVDPDTGRAVFEFGTCTRCGAVHLAGELDRRDRQEYFV
PSKKADASVNWLVLADSEGDVVVDEDELTLAEEEAKPGKADPTTRRLCTG
CGLLADANVTVCPSSNCCGGQLLLVREHPRATRVMARCTECGTQSRQGAR
RLRTDVNAAPAVVTTALYQRLPEAADEAADQVGGGRKLLMFSDSRQAAAF
AAPYLDRTYTRMLERRYLTQALRDPAVGGDDITVGDLAILTRERAQAAGH
FAHSMGNIEITHAVNQWVSGELMTLETRQSLEGLGLMRVALRTGAPVSMR
GFTSLGLSEHEAWALLNELVKTVRLQGAVTVLDRVDVKDERFAPRNTRVR
MRSTGSDRARQIISWNPSGTGTTNARMTFLRKVLAALSNDAPADRILMGC
WDMLDSGGFLVSESDRVLGRVVQLDHRRLSVASGADCQWYRCDTCRLLTA
FSVRDVCPNSRCTGRLKPFDLPAPEQDANHYRVVYQTMSTVPLSAREHTA
QWEAKTAADIQREFVSGKVNVLSCSTTFELGVDVGDLQSVVMRNMPPKTA
NYVQRAGRAGRRASSAALVVTYANRSAHDLAKFQDPTSMIAGRMRIPWIP
VDNARIARRHAHSVALAAYFRHCFRQRHERWKTAGEFFSTPADAQSSAAR
RVRDYLTPVPAEVAEALRAALPKGVHEEIGIIDGAWVDELGTLLGSVEEE
FGKDVADFELRIAEAVKERNFGLSKRLDATLRTITGRELLGYLANRNILP
KYGFPVDTVELSTLYAADPVGRQLELARDLSLAVYDYAPGNEVVAGGKVW
TSTGLKKRPGKELDNFQYRICRTCKRFHCARLLDAADVCPSCGNPFGAIG
KLVMPEFGFIAANETREVASAPPERRWHGGSYVETAGEDVGVYHWSGHGG
MKVTARAGVRATLAVVSDGTGEGFQLCEWCGWARAAERGSRRRKHRRPDT
NRDCDGPLVRVSLGHRYQSDVVEFTFDGVQYRWDEEANWLSSLYAILEGA
SHALEISRDDIDGALSWSADHRRSIVIFDTVPGGAGAAKKIAENVGMVLE
SAVNRVKTCECGDETSCYGCLRSYRNARFHEDLSRRGALQILGGVAG
433634101YP_007267728.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MGADTVAGVPSHLHEMLVELFTHRPVLAVELLADAHGVRLPEFVSARTEP
GELTDTAPTEYRADRVIVLSGTAAPVGAIVLEVQLARDDDKRWSWPVYVA
TLRARLRCPVTLLVICPDPRVAEWCAAAIDLGDGNRLAPRVLGPDRIPTV
TDPVQAVAIPELAVLSAIAHGADPDPVDVLVALQAGLVAMDDVALALRYH
DVVLAALPEAARHTLEELMTTGTDYEWQSEFYRKRATLGRAEGRAEGEAN
AVLAVLDARGIEISEPVRARVTGCTDLDQLDTWIRRAATATTVDDLFD
433634099YP_007267726.1 Conserved protein of unknown function- PE family [Mycobacterium canMSFLKTVPEELTAAAAQLGTIGAAMAAQNAAAAAPTTAIAPAALDEVSAL
QAALFTAYGTFYQQVSAEAQAMHDMFVNTLGISAGTYGVTESLNSSAAAS
PLSGITGEASAIIQATTGLFPPELSGGIGNILNIGAGNWASATSTLIGLA
GGGLLPAEEAAEAASALGGEAALGELGALGAAEAALGEAGIAAGLGSASA
IGMLSVPPAWAGQATLVSTTSTLPGAGWTATAPQAAAGTFIPGMPGVASA
ARNSAGFGAPRYGVKPIVMPKPATV
433634097YP_007267724.1 Putative Esat-6 like protein EsxW (Esat-6 Like Protein 10) [MycobacMASRFMTDPHAMRDMAGRFEVHAQTVEDEARRMWASAQNISGAGWSGMAE
ATSLDTMTQMNQAFRNIVNMLHGVRDGLVRDANNYEQQEQASQQILSS
433634095YP_007267722.1 Two component transcriptional regulatory protein TrcR [MycobacteriuMTTMSGYTRSQRPRQAILGQLPRIHRADGSPIRVLLVDDEPALTNLVKMA
LHYEGWDVEVAHDGQEAIAKFDKVGPDVLVLDIMLPDVDGLEILRRVRES
DVYTPTLFLTARDSVMDRVTGLTSGADDYMTKPFSLEELVARLRGLLRRS
SHLERPADEALRVGDLTLDGASREVTRDGTPISLSSTEFELLRFLMRNPR
RALSRTEILDRVWNYDFAGRTSIVDLYISYLRKKIDSDREPMIHTVRGIG
YMMRPPE
433634093YP_007267720.1 Potassium translocating ATPase- subunit C [Mycobacterium canettii CMRRQMLPALTMLLVFTVITGIVYPLAVTGVGQLFFGDQANGALLERDGQV
IGSAHIGQQFTAAKYFHPRPSSAGDGYDAAASSGSNLGPTNEKLLAAVAE
RVNAYRKENHLPADTLVPVDAVTGSGSGLDPAISVANAKLQAPRVAQARN
ISIRQVERLIEDHTDARGLGFLGEPAVNVLRLNLALDRL
433634091YP_007267718.1 Putative potassium-transporting ATPase A chain KdpA (Potassium-tranMSGTSWLQFAALIAVLLLTAPALGGYLAKIYGDEAKKPGDRVFGPIERAI
YQVCRVDPASEQRWSTYALSVLAFSVMSFLLLYGIARFQGVLPFNPTDKP
SVTDHVAFNAAVSFMTNTNWQSYSGEATMSHFTQMTGLAVQNFVSASAGM
CVLAALIRGLARKRASTLGNFWVDLTRTVLRIMLPLSFVVAILLVSQGVI
QNLHGFIVANTLEDAPQLIPGGPVASQVAIKQLGTNGGGFFNVNSAHPFE
NYTPIGNFVENWAILIIPFALCFAFGKMVHDRRQGWAVLAIMGIIWIGMS
VAAMSFEANGNPRLDALGVTQQTTVDQSGGNLEGKEVRFGAGASGLWAAS
TTGTSNGSVNSMHDSYTPLGGMVPLAHMMLGEVSPGGTGVGLNGLLVMAI
LAVFIAGLMVGRTPEYLGKKIQATEMKLVTLYILAMPIALLSFAAASVLI
SSALASRNNPGPHGLSEILYAYTSGANNNGSAFAGLTASTWWYDTTIGVA
MLIGRFFLIIPVLAIAGSLARKGTTPVTAATFPTHKPLFVGLVIGVVLIV
GGLTFFPALALGPIVEQLSTQ
433634089YP_007267716.1 Putative two component sensor kinase KdpD [Mycobacterium canettii CMTLLFADLCAIFTPCRWMIEHVTTKRGQLRIYLGAAPGVGKTYAMLGEAH
RRLERGTDVVAAVVETHGRNKTAKLLEGIEMIPPRYVEYRGTRFPELDVE
AVLRRHPQVVLVDELAHTNTPGSKNPKRWQDVQKILDAGITVISTVNIQH
LEGLNDVVEQITGIEQKEKIPDEIVRAADQVELVDITPEALRRRLAHGNV
YAAERVDAALSNYFRTGNLTALREIALLWLADQVDAALEKYRADKKITAT
WEARERVVVAVTGGPESETLVRRASRIASKSSAELMVVHVIRGDGLAGVS
APQLGRVRELATSLGATMHTVVGDDVPTALLDFAREMNATQLVVGTSRRS
RWARLFDEGIGARTVQESGGIDVHMVTHPAANRASGWSRVSARERHIASW
LAALVVPSVICAMTVAWLDRFMGIGGESALFFIGVLIVALLGGVAPAALS
ALLSGMLLNYFLTEPRYTWTIAEPDTAVTEFVLLAMAVAVAVLVDGAASR
TREARRASQEAELLALFAGSVLRGADLATLLQRVRETYSQRAVTMLRVRQ
GESTGETVACVGTNPCRDVDSADTAIEVGDDEFWMLMAGRKLAARDRRVL
TAVATQAAGLVKQRELAEEAGQAEAIAKADELRRSLLSAVSHDLRTPLSA
AKVAVSSLRTEDVAFSPEDTAELLATIEESIDQLTALVANLLDSSRLAAG
VIRPQLRRAYLEEAVQRALVSIGKGATGFYRSGIDRVKVDVGDAVAMADA
GLLERVLANLIDNALRYAPDCVVRVNAGRVRDRVLINVIDEGPGVPRGTE
EQLFAPFQRPGDHDNTTGVGLGMSVARGFVEAMGGTISATDTPGGGLTVV
IDLAAPEDRP
433634087YP_007267714.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MALTRVAAIDCGTNSIRLLIADVGAGLARGELHDVHRETRIVRLGQGVDA
TGRFAPEAIARTRTALTDYAELLTFHHAERVRMVATSAARDVVNRDVFFA
MTADVLGAALPGSAAEVITGAEEAELSFRGAVGELGSAGAPFVVVDLGGG
STEIVLGEREVIASYSADIGCVRLTERCLHSDPPTLQEVSAARRLVRERL
EPALRTVPVERARTWVGLAGTMTTLSALAQSMTAYDAAAIHLSRVPGADL
LEVCERLIGMTRKQRAALAPMHPGRADVIGGGAIVVEELARELRERAGID
QLTVSEHDILDGIALSLAG
433634085YP_007267712.1 Conserved membrane protein of unknown function [Mycobacterium canetMPEAKRPESKRRSPASRPGKAGDSVRGGRAAKPSAKPSTPAPHASRKTTR
TPHEHIVEPIKRAITESVEKRSEQRLGFTARRAAILAAVVCVLTLTIAGP
VRTYFAQRAEMEQLAATEAMLRRQIADLEEQQVKLADPAYIAAQARERLG
FVMPGDIPFQVQLPSTPSAPPQPGSDAATATNNEPWYTALWHTIADDPHL
PPAAPPAPEPGRPGPLPPASPNPEQPGG
433634083YP_007267710.1 Conserved lipoprotein of unknown function LpqU [Mycobacterium canetMSPRRWLRAVAVIGATAMLLASSCTWQLSLFIPDGVPPPPGDPVPPVDTH
AGGRPADQLREWAEKRAAALGIPVIALEAYAYAARVAEVENPKCHLAWTT
LAGIGRVESHHGTYRGATIAPNGDVSPPIRGVRLDGTGGTLRIVDRDGGG
LDGDAAVERAMGPMQFISETWRLYGVAARNDGIANVDNIDDAALSAAGYL
CWRGKDLATPRGWITALRAYNNSVIYARAVRDWATAYAAGHPL
433634081YP_007267708.1 Putative transcription-repair coupling factor Mfd (TRCF) [MycobacteMTAPGPACSDTPIAGLVDLALSAPTFQQLIQRAGGRPDELTLIGPASARL
LVASALARQGPLLVVTATGREADDLAAELRGVFGDAVALLPSWETLPHER
LSPGVDTVGTRLMVLRRLAHPDPDSDGAPLGPPLGVVVTSVRSLLQPMTP
QLGAMEPLTLTVGDESPFDGVVARLVELAYTRVDMVGRRGEFAVRGGILD
IFAPTAEHPVRVEFWGDEITEMRMFSVADQRSIPEIDIHTLVAFACRELL
LSEEVRARAAQLAARHPAAESTVAGSASDMLAKLAEGIAVDGMEALLPVL
WSDGHALLTDQLPDGTPVLVCDPEKVRTRAADLIRTGREFLEASWSVAAL
GTAENQAPVDFEQLGGSGFVELDQVRAAAARTGHPWWTLSQLSDESAIEL
DVRAAPSARGHQRDIDEIFAMLRAHIATGGYAALVAPGTGTAHRVVERLS
ESHTPAGMLDPGQAPKPGVVGVLQGPLRDGVIIPGANLVVITETDLTGSR
VSAVEGKRLAAKRRNIVDPLALTAGDLVVHDQHGIGRFVEMVERTVGGAR
REYLVLEYASAKRGGGAKNTDKLYVPMDSLDQLSRYVGGQAPALSRLGGS
DWANTKTKARRAVREIAGELVSLYAKRQASPGHAFSPDTPWQAELEDAFG
FTETVDQLTAIEEVKADMEKPIPMDRVICGDVGYGKTEIAVRAAFKAVQD
GKQVAVLVPTTLLADQHLQTFGERMSGFPVTIKGLSRFTDAAESRAVIDG
LADGSVDIVIGTHRLLQTGVRWKDLGLVVVDEEQRFGVEHKEHIKSLRTH
VDVLTMSATPIPRTLEMSLAGIREMSTILTPPEERYPVLTYVGPHDDKQI
AAALRRELLRDGQAFYVHNRVSSIDAAATRVRELVPEARVVVAHGQMPED
LLETTVQRFWNREHDILVCTTIVETGLDISNANTLIVERADTFGLSQLHQ
LRGRVGRSRERGYAYFLYPPQVPLTETAYDRLATIAQNNELGAGMAVALK
DLEIRGAGNVLGIEQSGHVAGVGFDLYVRLVGEALETYRDAYRAAADGQT
VRTAEEPKDVRIDLPVDAHLPPDYIASDRLRLEGYRRLAAASSDREVAAV
VDELTDRYGALPEPARRLAAVARLRLLCRGSGITDVTAASAATVRLSPLT
LPDSAQVRLKRMYPGAHYRATTATVQVPIPRAGGLGAPRIRDVELVQMVA
DVITALAGKPRQHIGITNPSPPGEDGRGRNTTIKERQP
433634079YP_007267706.1 Bifunctional protein GlmU [Includes: UDP-N-acetylglucosamine pyrophMTFPGDTAVLVLAAGPGTRMRSDTPKVLHTLAGRSMLSHVLHAIAKLAPQ
RLIVVLGHDHQRIAPLVGELADTLGRTIDVALQDRPLGTGHAVRCGLSAL
PDDYAGNVVVTSGDTPLLDADTLADLIATHRAVSAAVTVLTTTLDDPFGY
GRILRTQDHEVMAIVEQTDATPSQREIREVNAGVYAFDIAALRSALSRLS
SNNAQQELYLTDVIAILRSDGQTVHASHVDDSALVAGVNNRVQLAELASE
LNRRVVAAHQLAGVTVVDPATTWIDVDVTIGRDTVIHPGTQLLGRTQIGG
RCVVGPDTTLTDVAVGDGASVVRTHGSSSSIGDDAAVGPFTYLRPGTTLG
ADGKLGAFVEAKNSTIGTGTKVPHLTYVGDADIGEYSNIGASSVFVNYDG
TSKRRTTVGSHVRTGSDTMFVAPVTIGDGAYTGAGTVVREDVPPGALAVS
AGPQRNIENWVQRKRPGSPAAQAAKRASEMACQQPTQPPDVDQTP
433634077YP_007267704.1 Conserved lipoprotein protein of unknown function- LpqT [MycobacterMRPLAVAVAVATLAMSAVACGPKSPDFQSILSTSPTTSAVSTTTEVPVPL
WKYLESVGVTGEPVAPSSLTDLTVSIPTPPGWAPMKNPNISPNTEMIAKG
ESYPTAMLMVFKLDRDFDIAEALKHGTADARLSTNFTELDASTADFNGFP
SSMIQGSYDLHGRRLHTWNRIVFPTGAPPAKQRYLVQLTITSLANEAVKH
ASDIEAIIAGFVVAAK
433634075YP_007267702.1 Putative peptidyl-tRNA hydrolase Pth [Mycobacterium canettii CIPT 1MAEPLLVVGLGNPGANYARTRHNLGFMVADLLAARLGAKFKAHKRSGAEV
ATGRSAGRSLVLAKPRCYMNESGRQIGPLAKFYSVAPANIIVIHDDLDLE
FGRIRLKIGGGEGGHNGLRSVVAALGTKDFQRVRIGIGRPPGRKDPAAFV
LENFTPAERAEVPTICEQAADATELLIEQGMEPAQNRVHAW
433634073YP_007267700.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MTEFLGACLGRPRVSARAEAGGSIGWRTSMPAVGPQASALAEVRGAHQSQ
AQKPYHDVTEPLGANLRYRPAHGDSRINGHRDNPSARESSQFTAGSTAKA
VTKL
433634071YP_007267698.1 Putative dimethyladenosine transferase KsgA (S-adenosylmethionine-6MCCTSGCALTIRLLGRTEIRRLAKELDFRPRKSLGQNFVHDANTVRRVVA
ASGVSRSDLVLEVGPGLGSLTLALLDRGATVTAVEIDPLLASRLQQTVAE
HSHSEVHRLTVVNRDVLALRREDLAAAPTAVVANLPYNVAVPALLHLLVE
FPSIRVVTVMVQAEVAERLAAEPGSKEYGVPSVKLRFFGRVRRCGMVSPT
VFWPIPRVYSGLVRIDRYETSPWPTDDAFRRRVFELVDIAFAQRRKTSRN
AFVQWAGSGSESANRLLAASIDPARRGETLSIDDFVRLLRRSGGSDEATS
TGRDATVPDISGHASAS
433634069YP_007267696.1 Putative deoxyribonuclease TatD (YjjV protein) [Mycobacterium canetMVDAHTHLDACGARDADSVRSLVERAAAAGVTAVVTVADDLESARWVTRA
AEWDRRVYAAVALHPTRADALTDAARAELERLVAHPRVVAVGETGIDMYW
PGRLDGCAEPHVQREAFAWHIDLAKRTGKPLMIHNRQADRDVLDVLRAEG
APDTVILHCFSSDAAMARTCVDAGWLLSLSGTVSFRNARELRAAVPLMPV
EQLLVETDAPYLTPHPHRGLANEPYCLPYTVRALAELVNRRPEEVALITT
SNARRAYGLGWVRQ
433634067YP_007267694.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MVLRSRKSTLGVVVCLALMLGGPLNGCSSSASHRGPLNAMGSPAIPSTAQ
EIPNPLRGQYEDLMEPLFPQGNPAQQRYPPWPASYDASLRVSWRQLQPTD
PRTLPPDAPDDRKYDFSVIDSALTRLADRGMRLTLRVYAYSSCCKASYPD
GTNIAIPDWERAIASTNTSYPGPATDPSTGVVQVVPNFNDPTYLNDFAQL
LAALGRRYDGDERLSVFEFSGYGDFSENHVAYLRDTLGAPGPGPDESVAT
LGYYSQFRDQNITTASIKQLIAANVSAFGHTQLVTSPANPEIVRELLADE
VTNKLAAPVGVRSDCLGVDAPLPAWAESSTSHYVQTKDPVVAALRQRLAT
APVITEWCELPTGSSPRAYYEKGLRDVIRYHVSMTSSVNFPDQTATSPMD
PALYLVWAQANAAAGYRYSVEAQPGSQALAGKVATISVTWTNYGAAAATE
KWVPGYRLVDSTGQVVRTLPAAVDLKTLVSDQRGDRSSDQPTPASVAETV
RVDLSGLPAGHYTLRAAIDWQQHKPNGSHVVNYPPMLLARDGRDDSGFYP
VATLDIPRDAQTAVNAS
433634065YP_007267692.1 Conserved membrane protein of unknown function [Mycobacterium canetMSISCRVREGFVMRLAIVGTAAAAAIGGTLAVAPLTLSTPERVAGGTCSA
GQQCDRLAAVLMPDTATPSGPAAAEHAVPAPFEPVADTIAPGLVPRPGVP
AAAAVPRVGPPAVPGLPNIPGAAGPALPPPPALPNLAAPGVPGVGIPGVG
IPGVGIPGIGIPGVPDPITGVNTAAAVVNGVLGVGGTAAGVVTASAVAVT
YLVLAVNALESSGILPTARGTASTVASLLLPGAQSAAAALPAVGLPALPG
VTPASLLAMAAAAGLPGVGFPSLPGVSPTDLMAMAAAAGLPTSLPGLAGM
SPAELTALVAGGLPMLAAAGLPAGLAGVDPAALAAALPALAAGALPPGLP
ALPGVDPAALAAALPALAAGLPALPAGLPPLPAVPALPAPPPLPGPPPLP
ALPSRLCTPGFGPIGVCIP
433634063YP_007267690.1 Putative enzyme [Mycobacterium canettii CIPT 140070017]MVPVVSPGPLVPVADFGPLDRLRGWIVTGLITLLATVTRFLNLGSPTDAG
TPIFDEKHYAPQAWQVLNNHGVEDNPGYGLVVHPPVGKQLIAIGEAIFGY
NGIGWRFTGALLGVVLVALVVRIVRRISRSTLVGAIAGVLLICDGVSFVT
ARTALLDGFLTFFVVAAFGALIVDRDQVRERMHIALLAGRSAATVWGPRV
GVRWWRFGAGVLLGLACATKWSGVYFVLFFGAMSLAFDVAARRQYQVQRP
WLGTVRRDVLPSGYALGLIPFAVYLATYAPWFASETAIDRHAVGQAVGRN
SVVPLPDAVRSLWHYTAKAFHFHAGLTNSAGNYHPWESKPWTWPMSLRPV
LYAIDQQDVAGCGAQSCVKAEMLVGTPAMWWLAVPVLAYAGWRMFVRRDW
RYAVVLVGYCAGWLPWFADIDRQMYFFYAATMAPFLVMGISLVLGDILYH
PGQGSERRTLGLIVVCCYVALVVTNFAWLYPVLTGLPISQQTWNMEIWLP
SWR
433634061YP_007267688.1 Conserved protein of unknown function- thought to be regulated by RMCDKLGGVAIAVQGALFEHNERRQLGDGAFIDIRSGWLTGGEELLDALLS
TVPWRAERRQMYDRVVDVPRLVSFHDLTIEDPPHPQLARMRRRLNDIYGG
ELGEPFTTAGLCYYRDGSDSVAWHGDTIGRGSTEDTMVAIVSLGATRVFA
LRPRGGGPSLRLPLAHGDLLVMGGSCQRTFEHAVPKTSAPAGPRVSIQFR
PRDVR
433634059YP_007267686.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MDGIAELTAARVEDLAGMDVFQGCPAEGLVSLAASVQPLRAAAGQVLLRQ
GEPAVSFLLISSGSAEVSHVGDDGVAIIARALPGMIVGEIALLRDGPRSA
TVTTIEQLTGWTGGRGAFATMVHIPGVGERLLRTARQRLAAFVSPIPVRL
ADGTQLMLRPVLPGDRERTVHGHIQFSGETLYRRFMSARVPSPALMHYLS
EVDYVDHFVWVVTDGSDPVADARFVRDETDPTVAEIAFTVADAYQGRGIG
SFLIGALSVAARVDGVERFAARMLSDNVPMRTIMDRYGAVWQREDVGVIT
TMIDVPGPGELSLGREMVDQINRVARQVIEAVG
433634057YP_007267684.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MPEPFRIAREKVRVLRPAGRITIHTSYAGQCPPMRYAPNAAAGNIGLTMF
DRHAFVDLSRSAELVDVEQ
433634055YP_007267682.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MDDLLVKARGVLLDALAALDKQRNAVVVVGAQAIYLRSGQAIVAIAETTK
DGDLAVDPRELPREPLLEEAMKAADFYPNLNGQPGAWLNRDSIAVDLMVP
DALSEGGKSHRGARIPPHSNRATRRTVGLEAAVIDNNVMPISALDPVDGR
TFNARVAGPAALLIAKVHKIYERLDQPDRLNDKDAHDVYRLLVATTDMAA
LAATFERLLSDPVSKVVTQQAIEWLRTLFADGPAALGSIMAGRAEEGVGE
PDVVSAAVAALAADVVAVVGGPGH
433634053YP_007267680.1 Putative ribosomal-protein-alanine acetyltransferase RimJ [MycobactMAVGPLRVSAGVIRLRPVRMRDGVHWSRIRLADRAHLEPWEPSADGEWTV
RHTVAAWPAVCSGLRSEARNGRMLPYVIELDGQFCGQLTIGNVTHGALRS
AWIGYWVPSTATGGGVATGALALGLDHCFGPVMLHRVEATVRPENAASRA
VLAKVGFREEGLLRRYLEVDRAWRDHLLMAITVEEVYGSVASTLVRAGHA
SWP
433634051YP_007267678.1 Putative UTP--glucose-1-phosphate uridylyltransferase GalU (UDP-gluMSRPEVLTPFTAIVPAAGLGTRFLPATKTVPKELLPVVDTPGIELVAAEA
AAAGAERLVIVTSEGKDGVVAHFVEDLVLEGTLEARGKIAMLAKVRRAPA
LIKVESVVQAEPLGLGHAIGCVEPTLSPDEDAVAVLLPDDLVLPTGVLET
MSKVRASRGGTVLCAIEVAREEISAYGVFDVEPVPDGDYTDDPNVLKVKG
MVEKPKAETAPSRYAAAGRYVLDRAIFDALRRIDRGAGGEVQLTDAIALL
IAEGHPVHVVVHQGSRHDLGNPGGYLKAAVDFALDRDDYGPDLRRWLVAR
LGLTEQ
433634049YP_007267676.1 Conserved serine-rich protein of unknown function [Mycobacterium caMPTYSYECTQCAHRFDVVQAFTDDALTTCERCSGRLRKLFNAVGVVFKGS
GFYRTDSRESGKKSKSQTNGSSTSESTKSSGSSGSSGSSESKASGSTEKS
TSSTTAAAAV
433634047YP_007267674.1 Putative polyprenyl-diphosphate synthase GrcC2 (polyprenyl pyrophosMIPAVSLGDPQFTANVHDGIARITELINSELSQADEVMRDTVAHLVDAGG
TPFRPLFTVLAAQLGSDPDGWEVTVAGAAIELMHLGTLCHDRVVDESDMS
RKTPSDNTRWTNNFAILAGDYRFATASQLASRLDPEAFAVIAEAFAELIT
GQMRATRGPASHIDTIEHYLRVVHEKTSSLIAASGQLGAALSGAAEEEIR
RVARLGRMIGAAFEISRDIIAISGDSATLSGADLGQAVHTLPMLYALREQ
TPDTSRLRELLAGPIHDDHVAEALTLLRCSPGIGKAKNVVAAYAAQAREE
LPYLPDRQPRRALATLIDHAVSACD
433634045YP_007267672.1 Putative adhesion component transport transmembrane protein ABC traMNDQAPVAYAPLWRTAWRRLRQRPFQYILLVLGIALGVAMIVAIDVSSNS
AQRAFDLSAAAITGKSTHRLVSGPAGVDQQLYVDLRRHGYDFSAPVIEGY
VLARGLGNRAMQLMGTDPFAESAFRSPLWSNQNIAELGGFLTRPNGVVLS
RQVAQKYGLAVGDRIALQVKGAPTTVTLVGLLTPADEISNQKLSDLIIAD
ISTAQELFHMPGRLSHIDLIIKDEATATRIQQRLPAGVRMETSDTQRDTV
KQMTDAFTVNLTALSLIALLVGIFLIYNTVTFNVVQRRPFFAILRCLGVT
REQLFWLIMTESLVAGLIGTGLGLLIGIWLGEGLIGLVTQTINDFYFVIN
VRNVSVSAESLLKGLIIGIFAAMLATLPPAIEAMRTVPASTLRRSSLESK
ITKLMPWLWVAWFGLGSFGVLMLWLPGNNLVVAFVGLFSVLIALALIAPP
LTRFVMLRLAPGLGRLLGPIGRMAPRNIVRSLSRTSIAIAALMMAVSLMV
GVSISVGSFRQTLANWLEVTLKSDVYVSPPTLTSGRPSGNLPVDAVRNIS
KWPGVRDAVMARYSSVFAPDWGREVELMAVSGDISDGKRPYRWIDGNKDT
LWPRFLAGKGVMLSEPMVSRQHLQMPPRPITLMTDSGPQTFPVLAVFSDY
TSDQGVILMDRASYRAHWQDDDVTTMFLFLASGANSGALIDQLQAAFAGR
EDIVIQSTHSVREASMVIFDRSFTITIALQLVATVVAFIGVLSALMSLEL
DRAHELGVFRAIGMTTRQLWKLMFIETGLMGGMAGLMALPTGCILAWILV
RIINVRSFGWTLQMHFESAHFLRALLVAVVAALAAGMYPAWRLGRMTIRT
AIREE
433634043YP_007267670.1 Putative large-conductance ion mechanosensitive channel MscL [MycobMLKGFKEFLARGNIVDLAVAVVIGTAFTALVTKFTDSIITPLINRIGVNA
QSDVGILRIGIGGGQTIDLNVLLSAAINFFLIAFAVYFLVVLPYNTLRKK
GEVEQPGDTQVVLLTEIRDLLAQTNGDSPGRHGGRGTPSPTDGPRASTGS
Q
433634041YP_007267668.1 Putative serine protease PepD (serine proteinase) (MTB32b) [MycobacMAKLARVVGLVQEEQPSDMTNHPRYSPPPQQPGTPGYAQGQQQTYSQQFD
WRYPPSPPPQPTQYRQPYEALGGTRPGLIPGVIPTMTPPPGMVRQRPRAG
MLAIGAVTIAVVSAGIGGAAASLVGFNRAPAGPSGGPVAASAAPSIPAAN
MPPGSVEQVAAKVVPSVVMLETDLGRQSEEGSGIILSAEGLILTNNHVIA
AAAKPPLGSPPPKTTVTFSDGRTAPFTVVGADPTSDIAVVRVQGVSGLTP
ISLGSSSDLRVGQPVLAIGSPLGLEGTVTTGIVSALNRPVSTTGEAGNQN
TVLDAIQTDAAINPGNSGGALVNMNAQLVGVNSAIATLGADSADAQSGSI
GLGFAIPVDQAKRIADELISTGKASHASLGVQVTNDKDTPGAKIVEVVAG
GAAANAGVPKGVVVTKVDDRPINSADALVAAVRSKAPGATVALTFQDPSG
GSRTVQVTLGKAEQ
433634039YP_007267666.1 DNA-binding response regulator in two-component regulatory system [MSVRILVVDDDRAVRESLRRSLSFNGYSVELAHDGVEALDMIASDRPDAL
VLDVMMPRLDGLEVCRQLRSTGDDLPILVLTARDSVSERVAGLDAGADDY
LPKPFALEELLARMRALLRRTKPEDAAESMAMRFSDLTLDPVTREVNRGQ
RRISLTRTEFALLEMLIANPRRVLTRSRILEEVWGFDFPTSGNALEVYVG
YLRRKTEADGEPRLIHTVRGVGYVLRETPP
433634037YP_007267664.1 Conserved protein of unknown function- PE-PGRS family protein (fragMLALSQAGSAYAVAEAASATPLQNVLDAINAPVQSLTGRPLIGDGANGID
GTGQAGGNGGWLWGNGGNGGSGAPGQAGGAGGAAGLFGNGGAGGAGGVGA
PGGVGAIGGAGGAGGWLFGNGGAGGVGGAGGASTTFGVAGGDGGAGGVGG
HGGLIGVGGHGGDGGDGGTGGAVSLARAGTAGGAGGGPVGGVGGAGGVGG
AGGAAGAVTTIADASFNDPLGVAVNPGGNVYVTNQGSNTVSVIDPATNTV
TGSIPVGITPLGVTVNPGGNVYVTNFNSGTVSVIDPATNTVTGSPIAVGT
GPLGVAVNPGSNVYVTNFNSDTVSVIDPNTNTVTGSPITGFSGPFGVAVN
PGGNIYVTNFNSASVSVIDPNTNTVTGSPITVGTSPLGVAVNPGGNVYVT
NFGSNSVSVIDPATNTVTGSIALVDTRPYEVAASPVTGLVFVANFDTATV
SMIDAATNTVTGSALPVGLDPTGVAVNPVTGVVYVTNQASDTVSVIS
433634035YP_007267662.1 Conserved protein of unknown function- PE-PGRS family protein [MycoMRQLAGRARPAARVAAVGPAARPVPGSATARVRAGQGGIGGVGGQGGQGG
VGGTGGAAAAGGTNGDGGQGGIGGAGGAGGAGADGGGTSPGSAGGVGGQK
GSGGTGGQAGNGAGAAGGAGAGGDGGAGGIGGTGGGGSIGGAAGNGGIGG
RGGAGGMATAGGDGGDGGGGGSGGAGGTGGIGGDGGVTTVSGSGGKGGAG
GDGGQGTDGGAGINGPGGLGGRGGDGGNGGAGGSPGLGSSKEAAAAAGVV
FGSGGHGGAGGNGGDGGAGDHGPAGDNPGFAGGNGGAGGQGGQGGAASPP
DLLSDWHGLFGSNGDGGAGGDGGAGGVGGNGGVGVGSAGGAGGTGGDGGA
AGAGGAPGNGYFQQPAPQGLPIGTGGAGGEGGAGGAGGDGGQGDIGFDGG
RGGDGGPGGGGGAGGDGSGTFNAQANNGGDGGAGGGGGAGGTGGTGGVGA
DGGRGGDSGRGGDGGNAGHGGAAEFSGRGAYGGEGGSGGAGGDAGGAGTG
GAAGSGGAGGFGGNGANGGNGGNGGNGGFGGINGTFGTNGAGGTGGLGTL
LGGHNGNIGLNGATGGIGGTTLTNATVPLQLVNTTEPVVFISLNGGQMVP
VLLDTGSTGLVMDSQFLTQNFGPVIGTGTAGYAGGLTYNYNTYSTTVDFG
NGLVTLPTSVNVVTSSSPGTLGNFLSRSGAVGVLGIGPNNGFPGTSSIVT
AMPGLLNNGVLIDESAGILQFGPNTLTGGITISGAPISDVAVQINNGPLQ
QAPVMFDSGGINGTIPSALAGLPSGGFVPAGTTISVYTSDGQTLLYSYTT
TATNTPFVTSGGTMNTGHVPFAQQPIYVAYSPTAIGTTTFNWTTTFN
433634033YP_007267660.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MRIGNCSGFYGDRLSAMREMLTGGELDYLTGDYLAELTMLILGRDRMKNP
DRGYAKTFLTQLEDCLGLAIERGVRIVTNAGGLNPAGLANAVRALAARLG
IPAQVAHVEGDDLQPRAAELGLGTPLTANAYLGAWGIVDCFESGADVVVT
GRVTDASVVVGAAAAHFGWGRTDYNRLAGAVVAGHVIECGVQATGGNYAF
FTEIGDLTHAGFPLAEIAADGSSVITKHRGTGGLVSVDTITAQLLYEIAG
ARYANPDVTARMDSVELSPDGPDRVRISGVIGEPPPPTYKVSLNSIGGFR
NAMTFVLTGLDIEAKADLVRRQLEAALTVKPAELQWTLARTDHPDADTEE
TASALLTCVARDPDPANVGRHFSSAAVELALASYPGFTATAPPGDGQVYG
VFTPGYVDAGKVAHIAVHADGTRTEIPCATETLELAPADPPALPDPLPAG
PTRRVPLGLIAGARSGDKGGSANVGVWVRTDEQWRWLAHTLTVELLKELL
PETAGLVVTRHVLPNLRALNFVIEAILGQGVAYQARFDPQGKGLGEWLRS
RHVDIPETLL
433634031YP_007267658.1 Putative acetyl-/propionyl-CoA carboxylase (beta subunit) AccD2 [MyMLQSTLDPNASAYDEAAATMSGKLDEINAELAKALAGGGPKYVDRHHARG
KLTPRERVELLVDPDSPFLELSPLAAYGSNFQIGASLVTGIGAVCGVECM
IVANDPTVKGGTSNPWTLRKILRANQIAFENRLPVISLVESGGADLPTQK
EIFIPGGQMFRDLTRLSAAGIPTIALVFGNSTAGGAYVPGMSDHVVMIKE
RSKVFLAGPPLVKMATGEESDDESLGGAEMHARISGLADYFALDELDAIR
IGRRIVARLNWIKQGPAPGPVTEPLFDAEELIGIVPADLRIPFDPREVIA
RIVDGSEFDEFKPLYGPSLVTGWARLHGYPLGILANARGVLFSEESQKAT
QFIQLANRADTPLLFLHNTTGYMVGKDYEEGGMIKHGSMMINAVSNSTVP
HISLLIGASYGAGHYGMCGRAYDPRFLFAWPSAKSAVMGGAQLSGVLSIV
ARAAAEARGQQVDEAADAAMRAAVEGQIEAESLPLVLSGMLYDDGVIDPR
DTRTVLGMCLSAIANGPIKGTSNFGVFRM
433634029YP_007267656.1 Acyl-CoA dehydrogenase FadE12 [Mycobacterium canettii CIPT 14007001MTDTSFIESEERQALRKAVASWVANYGHEYYLDKARNHEHTSELWAEAGK
LGFLGVNLPEEYGGGGAGMYELSLVMEEMAAAGSALLLMVVSPAINGTII
AKFGTDEQKKRWLPGIADGSLTMAFAITEPDAGSNSHNITTTARRAGRDW
IIKGQKVFISGIDQAQAVLIVSRTEEAKTGKLRPALFVVPTDAPGFSYTP
IEMELVSPERQFQVFLDDVRLPADALVGAEDAAIAQLFAGLNPERIMGAA
SAVGMGRFALGRAVDYVKTRKVWSTPIGAHQGLAHPLAQCHIEVELAKLM
TQKAATLYDHGDDFGAAEAANMAKYAAAEASSRAVDQAVQSMGGNGLTKE
YGVAAIMTSARLARIAPISREMVLNFVAQTSLGLPRSY
433634027YP_007267654.1 Conserved membrane protein of unknown function [Mycobacterium canetMIHDLMLRWVVTGLFVLTAAECGLAIIAKRRPWTLIVNHGLHFAMAVAMA
VMAWPWGARVPTTGPAVFFLLAAVWFGATAVVAVRGTATRGLYGYHGLMM
LATAWMYAAMNPRLLPVRSCTEYATEPDGSMPAMDMTAMNMPPNSGSPIW
FSVVNWIGTVGFAVAAVFWACRFVMERRQEATQSRSPGSIGQAMMAAGMA
MLFFAMLFRV
433634025YP_007267652.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MVWHGFLAKAVPTVVTGAVGVAAYEALRKVVVKAPLRAATVSVAAWGIRL
AREAERKAGESAEQARLMFADVLAEASERAGEEVPPLAVAGSDDGHDH
433634023YP_007267650.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MSNSAQRDARNSRDESARASDTDRIQIAQLLAYAAEQGRLQLTDYEDRLA
RAYAATTYQELDRLRADLPGAAIGPRRGGECNPAPSTLLLALLGGFERRG
RWNVPKKLTTFTLWGSGVLDLRYADFTSTEVDIRAYSIMGAQTILLPPEV
NVEIHGHRVMGGFDRKVVGEGTRGAPTVRIRGFSLWGDVGIKRKPRKPRK
433634021YP_007267648.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MEAPDAMALTLADIERWDPTAIRTVFQAAINRAHGTHTASAALRDTMGLL
DFGGAAAEAAQVATHHTTVLLDHHAGACEAVARAAEKAAEEVAAIKMRLQ
LIRDAARGYHLTIAYATGTALPPPDLSSYSPADQQAILNTAIRLTEGIKR
RLADAETADEDLAAAIRCAAGDLSPEQVNAQLSHAPPTMPQLPPPDSDPE
EVKRWWHSLTPGQQDRVKQWFPNALRNRDGIPIAVRNELNLSVLQRELTR
LQNGWLSRDGVWRTDTDKLADLQALRDTLAAHPGTSLILLDTASDPRKVL
AAVGVGDVDNAERVGVTVGGLNTRVSSSVGDMVKEAGIQRAKASDLRKFA
GMPNYDAVASIAWLGYDAPDGLKDVMHDWSARDAAGPLNRFYKGLAATTN
VSDQHITAFGHSYGSLVTSLALQQGAPVSDVVLYGSPGTELTHASQLGVE
PGHAFYMIGVNDHVADTIPEFGAFGSAPQDVPGMTQLSVNTRLAPGPVLG
DGQLHERAYGHSEYARNGDNDQLRMSGYNLAAVLAGLPDDLIKPPVLPPP
TIPSGPGPFGLPIPNPDYHP
433634019YP_007267646.1 Conserved membrane protein of unknown function [Mycobacterium canetMRVPSQWTISSRVTVAWNIVGYLLYAALAFVGGFAVWFSLFFAMATDGCH
DSACDASYHVFPAMVTMWIGVGAVLLLTLVVMVRNSSRGNVVIGWPFVGL
LALGLVYVAADAVLH
433634017YP_007267644.1 Conserved protein of unknown function- possible antitoxin [MycobactMRTLYLRNVPDDVVERLERLAELAKTSVSAVAVRELAEASRRADNPALLG
DLPDIGIDTTELVGGIDAERAGR
433634015YP_007267642.1 Putative magnesium chelatase [Mycobacterium canettii CIPT 140070017MSPRNLPRTVGELRAAGHRERGVKQEIRENLLTALADGDNVWPGILGFDD
TVIPQVERALIAGHDFVLLGERGQGKTRLLRALAGLLDEWTPVIAGAELG
EHPFMPITPESIRRAAQLGDDLPVAWKHRSERYTEKLATPDTSVADLVGD
VDPIKVAEGRSLGDPETIAYGLIPRAHRGIVAVNELPDLAERIQVSMLNV
MEERDIQVRGYTLRLPLDVLVVASANPEDYTNRGRIITPIKDRFGAEIRT
HYPLELEAEMGVIAQEAHLSAQVPDYLMQVLARFARYLRESRSIDQRSGV
SARFAIAAAETVAAAARHRGAVLGETDPVARVVDLGTVIDVLRGKLEFES
GEEGREQAVLEHLLRRATADTASRVLGGIDVGSLVAAVEGGSAVTTGERV
SAKDVLAAVPGLPVVDRIARKLGAESEGERAAALELALEALYLAKRIDKV
CGEGQTVYG
433634013YP_007267640.1 5'-Phosphoribosylglycinamide Formyltransferase PurN (GART) (GAR TraMQEPLRVPPSAPARLVVLASGTGSLLRSLLDAAVGDYPARVVAVGVDREC
RAAEIAAEASVPVFTVRLADHPSRDAWDTAITDATAAHSPDLIVSAGFMR
ILGPQFLSRFYGRIVNTHPALLPAFPGTHGVADALAYGVKVTGATVHLVD
AGTDTGPILAQQPVPVLDGDDEETLHERIKVTERRLLVEVVAALATHGVT
VVGRTATMGRKATIG
433634011YP_007267638.1 Conserved membrane protein of unknown function [Mycobacterium canetMTYSPGNPGYPQAQPAGSYGGVTPSFAHADEGASKLPMYLNIAVAVLGLA
AYFASFGPMFTLSTELGGGDGAVSGDTGLPVGVALLAALLAGVALVPKAK
SHVTVVAVLGVLGVFLMVSATFNKPSAYSTGWALWVVLAFIVFQAVAAVL
ALLVETGAITAPAPRPKFDPYGQYGRYGQYGQYGVQPGGYYGQHGAQQPA
GLQSPGPQQSPQPPGYGSQYGGYSSSPSQSGSGYTAQPPAQPPAQSGSQQ
SHQGPSTPPTGFPSFSPPPPVSAGTGSQAGSAPVNYSNPSGGEQSSSPGG
APV
433634009YP_007267636.1 Putative oxidoreductase [Mycobacterium canettii CIPT 140070017]MHYGLVLFTSDRGITPAAAARLADSHGFHTFYVPEHTHIPVKREAAHPTT
GDASLPDDRYLRTLDPWVSLGAASAVTSRVRLATAVALPVEHDPITLAKS
IATLDHLSHGRVSVGVGFGWNTDELADHGVPPGRRRTMLREYLEAMRALW
TQEEACYDGEFVKFGPSWAWPKPVQPHIPVLIGAAGTEKNFKWIARSADG
WITTPRDVDIDEPVKLLQDIWAAAGRDGVPQIVALDVKPVPDKLARWAEL
GVTEVLFGMPDRSADDAAAYVERLAAKLAGCV
433634007YP_007267634.1 Putative succinyl-CoA synthetase (beta chain) SucC (SCS-beta) [MycoMDLFEYQAKELFAKHNVPSTPGRVTDTAEGAKAIATEIGRPVMVKAQVKI
GGRGKAGGVKYAATPQDAYEHAKNILGLDIKGHIVKKLLVAEASDIAEEY
YLSFLLDRANRTYLAMCSVEGGMEIEEVAATKPERLAKVPVNAVKGVDLD
FARSIAEQGHLPAEVLDTAAVTIAKLWELFVAEDATLVEVNPLVRTPDHK
ILALDAKITLDGNADFRQPGHAEFEDRAATDPLELKAKEHDLNYVKLDGQ
VGIIGNGAGLVMSTLDVVAYAGEKHGGVKPANFLDIGGGASAEVMAAGLD
VVLGDQQVKSVFVNVFGGITSCDAVATGIVKALGMLGDEANKPLVVRLDG
NNVEEGRRILTEANHPLVTLVATMDEAADKAAELASA
433634005YP_007267632.1 Putative ATP-dependent DNA helicase II UvrD1 [Mycobacterium canettiMSVHATDAKPPGPSPADQLLDGLNPQQRQAVVHEGSPLLIVAGAGSGKTA
VLTRRIAYLMAARGVGVGQILAITFTNKAAAEMRERVVGLVGEKARYMWV
STFHSTCVRILRNQAALIEGLNSNFSIYDDDDSRRLLQMVGRDLGLDIKR
YSPRLLANAISNLKNELIDPHQALAGLTEDSDDLARAVASVYDEYQRRLR
AANALDFDDLIGETVAVLQAFPQIAQYYRRRFRHVLVDEYQDTNHAQYVL
VRELVGRDSNDGVPPGELCVVGDADQSIYAFRGATIRNIEDFERDYPDTR
TILLEQNYRSTQNILSAANSVIARNAGRREKRLWTDAGAGELIVGYVADN
EHDEARFVAEEIDALAEGSEITYNDVAVFYRTNNSSRSLEEVLIRAGIPY
KVVGGVRFYERKEIRDIVAYLRVLDNPGDAVSLRRILNTPRRGIGDRAEA
CVAVYAENTGVGFGDALVAAAQGKVPMLNTRAEKAIAGFVEMFDELRGRL
DDDLGELVEAVLERTGYRRELEASTDPQELARLDNLNELVSVAHEFSTDR
ENAAALGPDDEDVPDTGVLADFLERVSLVADADEIPEHGAGVVTLMTLHT
AKGLEFPVVFVTGWEDGMFPHMRALDNPTELSEERRLAYVGITRARQRLY
VSRAIVRSSWGQPMLNPESRFLREIPQELIDWRRTAPKPSFSAPVSGAGR
FGSARPSPTRSGASRRPLLVLQVGDRVTHDKYGLGRVEEVSGVGESAMSL
IDFGSSGRVKLMHNHAPVTKL
433634003YP_007267630.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MGGSFDRAARARHQLDNLVNVVAAGSTHRLMVPSRSMHRLTKVEFQGGGP
HAWYLSDGILARDDYNGRDIHLPVFG
433634001YP_007267628.1 Putative glucose-6-phosphate isomerase Pgi (GPI) (phosphoglucose isMTSAPIPDITATPAWDALRRHHDQIGNTHLRQFFADDPGRGRELTVSVGD
LYIDYSKHRVTRETLALLIDLARTAHLEERRDQMFAGVHINTSEDRAVLH
TALRLPRDAELVVDGQDVVTDVHAVLDAMGAFTDRLRSGEWTGATGKRIS
TVVNIGIGGSDLGPVMVYQALRHYADAGISARFVSNVDPADLIATLADLD
PATTLFIVASKTFSTLETLTNATAARRWLTDALGDAAVSRHFVAVSTNKR
LVDDFGINTDNMFGFWDWVGGRYSVDSAIGLSLMTVIGRDAFADFLAGFH
IIDRHFATAPLESNAPVLLGLIGLWYSNFFGAQSRTVLPYSNDLSRFPAY
LQQLTMESNGKSTRADGSPVSADTGEIFWGEPGTNGQHAFYQLLHQGTRL
VPADFIGFAQPLDDLPTAEGTGSMHDLLMSNFFAQTQVLAFGKTAEEIAA
DGTPAHVVAHKVMPGNRPSTSILASRLTPSVLGQLIALYEHQVFTEGVVW
GIDSFDQWGVELGKTQAKALIPVITGAGSPPPQSDSSTDGLVRRYRTERG
RAG
433633999YP_007267626.1 Putative formamidopyrimidine-DNA glycosylase [Mycobacterium canettiMPELPEIEALADHLRRHAVGTTVGRVDVGALSVLKTFDPPVDALYDQTVA
GADRWGKYLGLSTGRLWLITHLSRAGWLRWSDKLTAAPLRPGKGPIALRV
HLGVPGTAPGFDLTEAGTQKRLAVWLVDDPKRVPGIAALGPDALDLGADD
LSRLLAGNTGRIKTVITDQKVIAGIGNAYSDEILHVAKISPFATAGKLSG
AQLTCLHEAMASVLSDAVRRSVGQGAAMLKGEKRSGLRVHARTGLPCPVC
GDTVREVSFADKSFQYCPTCQTGGKALADRRMSRLLK
433633997YP_007267624.1 Precorrin-6A synthase [deacetylating] [Mycobacterium canettii CIPT MGRRIHVIGIGVGDPDYLTVQAIHALNDTQVFFAMDKGEAKAGLLALRRT
ICARYVRDPGYRFVELPDPQRSTDTDYRQAVCDWHAARARIWAAAISAEL
EPDGVGAFLAWGDPSLYDSTLRVLDAVAAEVDISYDVIPGISAVQALTAR
HRIPLNEVGAPVLITTGRQLRAHGWSGSAVVMLDGDCSFQACPPDTRIWW
GAYLGTDDELLVAGTVGEVGTRIVALRDQARARHGWIMDTYLLRDR
433633995YP_007267622.1 Putative monooxygenase (modular protein) [Mycobacterium canettii CIMTATLGLADAGHRIVIVGRGAGGRDAAAALLAADVTEFVILDKAPGPARD
GHLRPGREVLRSVFDDDTDTWVLGTAGGETFRCRVVIATHRQVHVPWTPD
FAGRADYRGESFHAASWDRDFDPAGKRIAVVGTDAAAAHYISRLTESAAS
VTVFTQAPRRVVTGVPLWTTRAKRWLRRRTGAEQPAVVLATSAIDALTSS
GIRTSDGVDHPVDAIIYGTGFAIADQVGDQTLVGAGGVTIRRAWDDGMEP
YLGVAVHGFPNYFFITGPDTAAQARCVVECVKLMERTASRRIEVRRSSQQ
VFNERAQLKPAQPHRLTGGLEAFDLSSAATEDDQTYNGAATLTLAGARFR
VRVRLTGHLDPIDGNYHWQGTVFDSLPEASLTHVRAATLTIGGRSAPARI
TEQTPWGTHSVAGVGPPPYARSGPASATT
433633993YP_007267620.1 Putative oxidoreductase [Mycobacterium canettii CIPT 140070017]MRFSYAEAMTDFTFYIPLAKAAEAAGYSSMTIPDSIAYPFESDSKYPYTP
DGNREFMDGKPFIETFVLTAALGAVTTRLRFNFFVLKLPIRPPALVAKQA
GSLAALIGNRVGLGVGTSPWPEDYELMGVPFAKRGKRIDECIEIVRGLTT
GDYFEFHGEFYDIPKTKMTPAPTQPIPILVGGHADAALRRAARADGWMHG
GGDPDELDRLIARVKRLREEAGKTSPFEIHVISLDGFTVDGVKRLEDKGV
TDVIVGFRVPYTMGPDTEPLQTKIRNLEMFAENVIAKV
433633991YP_007267618.1 Putative ATP dependent DNA ligase (ATP dependent polydeoxyribonucleMGSASEQRVTLTNADKVLYPATGTTKSDIFDYYAGVAEVMLGHIAGRPAT
RKRWPNGVDQPAFFEKQLALSAPPWLSRATVAHRSGTTTYPIIDSATGLA
WIAQQAALEVHVPQWRFVAEPGSGELNPGPATRLVFDLDPGEGVMMAQLA
EVARAVRDLLADIGLVTFPVTSGSKGLHLYTPLDEPVSSRGATVLAKRVA
QRLEQAMPALVTSTMTKSLRAGKVFVDWSQNSGSKTTIAPYSLRGRTHPT
VAAPRTWAELDDPALRQLSYDEVLTRIARDGDLLERLDADAPVADRLTRY
RRMRDASKTPEPIPTAKPVTGDGNTFVIQEHHARRPHYDFRLERDGVLVS
WAVPKNLPDTTSVNHLAIHTEDHPLEYATFEGAIPSGEYGAGKVIIWDSG
TYDTEKFHDDPHKGEVIVNLHGGRISGRYALIRTNGDRWLAHRLKNQKDQ
KVFEFDNLAPMLATHGTVAGLKASQWAFEGKWDGYRLLVEADHGAVRLRS
RSGRDVTAEYPQLRALAEDFADHHVVLDGEAVVLDSSGVPSFSEMQNRGR
DTRVEFWAFDLLYLDGRSLLGASYQDRRKLLETLANATSLTVPELLPGDG
AQAFACSRKHGWEGVIAKRRDSRYQPGRRCASWVKDKHWNTQEVVIGGWR
AGEGGRSSGVGSLLMGIPGPGGLQFAGRVGTGITERELANLKEMLAPLHT
DESPFDAPLPARDAKGITYVKPALVAEVRYSEWTPEGRLRQSSWRGLRPD
KKPSEVVRE
433633989YP_007267616.1 Phosphate-transport integral membrane ABC transporter PstA2 [MycobaMGESAASGPGQTSTMAPARRAAVYRRKIVDALWWAACLCCLAVVITPTLW
MLIGVVSRAVPVFHWSVLVQDSQGNGGGLRNAIIGTAVLAIGVILVGGTV
SVLTGIYLSEFATGKTRSILRGAYEVLSGIPSIVLGYVGYLALVVYFDWG
FSLAAGVLVLSVMSIPYIAKATESALHQVPTSYREAAEALGLPAGWALRK
IVLKTAMPGIVTGMLVALALAIGETAPLLYTAGWSNSPPTGQLTDSPVGY
LTYPIWTFYNQPSKSAQDLSYDAALLLIVFLLLLIFIGRLINWLSRRRWD
V
433633987YP_007267614.1 Phosphate-binding lipoprotein PstS1 (PBP-1) (PSTS1) [Mycobacterium MKIRLHTLLAVLTAASLLLAAAGCGSKPPSGSPETGADAGTVATAPASSP
VTLAETGSTLLYPLFNLWGPAFHEKYPNVTITAQGTGSGAGIAQAAAGTV
NIGASDAYLSEGDMAAHKGLMNIALAISAQQVNYNLPGVSEHLKLNGKVL
AAMYQGTIKTWDDPQIAALNPGVNLPGTAVVPLHRSDGSGDTFLFTQYLS
KQDPDGWGKSPGFGTTVDFPAVPGALGENGNGGMVTGCAETPGCVAYIGI
SFLDQASQRGLGEAQLGNSSGNFLLPDAQSIQAAAAGFASKTPANQAISM
IDGPAPDGYPIINYEYAIVNNRQKDAATAQTLQAFLHWAITDGNKASFLD
QVHFQPLPPAVVKLSDALIATISS
433633985YP_007267612.1 Periplasmic phosphate-binding lipoprotein PstS2 (PBP-2) (PSTS2) [MyMKFARSGAAVSLLAAGTLVLTACGGGTNSSSSGAGGTSGSVHCGGKKELH
SSGSTAQENAMEQFVYAYVRSCPGYTLDYNANGSGAGVTQFLNNETDFAG
SDVPLNPSTGQPDRAAERCGSPAWDLPTVFGPIAVTYNIKGVSTLNLDGP
TTAKIFNGTITVWNDPQIQALNSGTDLPPTPISVIFRSDKSGTSDNFQKY
LDGASNGAWGKGASETFNGGVGVGASGNNGTSALLQTTDGSITYNEWSFA
VGKQLNMAQIITSAGPDPVAITTESVGKTIAGAKIMGQGNDLVLDTSSFY
RPTQPGAYPIVLATYEIVCSKYPDATTGTAVRAFMQAAIGPGQEGLDQYG
SIPLPKSFQAKLAAAVNAIS
433633983YP_007267610.1 Putative phosphate-transport integral membrane ABC transporter PstAMSPSTSIEALDQPVKPVVFRPLTLRRRIKNSVATTFFFTSFVAALIPLVW
LLWVVIARGWFAVTRSGWWTHSLRGVLPEQFAGGVYHALYGTLVQAGVAA
VLAVPLGLMTAVYLVEYGTGRMARVTTFTVDVLAGVPSIVAALFVFSLWI
ATLGFQQSAFAVALALVLLMLPVVVRAGEEMLRLVPDELREASYALGVPK
WKTIVRIVAPIAMPGIVSGILLSIARVVGETAPVLVLVGYSHSINLDVFH
GNMASLPLLIYTELTNPEHAGFLRVWGAALTLIIVVATINLAAAMIRFVA
TRRR
433633981YP_007267608.1 Periplasmic phosphate ABC transporter substrate-binding protein PstMKLNRFGAAVGVLAAGALVLSACGNDDNVTGGGATTGQASAKVDCGGKKT
LKASGSTAQANAMTRFVNVFEQACPGQTLNYTANGSGAGISEFNGNQTDF
GGSDVPLSKDEAAAAQRRCGSPAWNLPVVFGPIAVTYNLNSVSSLNLDGP
TLAKIFNGSITQWNNPAIQALNRDFTLPGERIHVVFRSDESGTTDNFQRY
LQAASNGAWGKGAGKSFQGGVGEGARGNDGTSAAAKNTPGSITYNEWSFA
QAQHLTMANIVTSAGGDPVAITVDSVGQTIAGATISGVGNDLVLDTDSFY
RPKRPGSYPIVLATYEIVCSKYPDSQVGTAVKAFLQSTIGAGQSGLGDNG
YIPIPDEFKSRLSTAVNAIA
433633979YP_007267606.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MAIPVVQLGTGNVGVHSLRALIANPEFELTGVWVSSDAKAGKDAAELAGL
ADSTGVRASTDLNAVLATGPRCAVYNAMADNRLPEALEDYRRILAAGINI
VGSGPVFLQYPWQVIPDEIIKPLQDAARAGNSSLYVNGIDPGFANDLLPM
ALAGTCESIEQIRCMEIVDYATCDSAVVMFDVMGFGKPMDQIPMLLQPGV
LSLAWGSVVRQLAAGLGISLDGVEEMYIREPAPEAFDIASGHIPKGSAAA
LRFEVLGLVDGVPAVILEHVTRLRADLCPEWPQPAQPGGSYRIEISGEPC
YAMDICLSSRHGDHNHAGLVATAMRIVNAIPAVVAAEPGIRTTLDLPLIT
GEGRYAAA
433633977YP_007267604.1 Divalent cation-transport integral membrane protein MntH (BRAMP) (MMAGEFRLLSHLCSRGSKVGELAQDTRTSLKTSWYLLGPAFVAAIAYVDPG
NVAANVSSGAQFGYLLLWVIVAANVMAALVQYLSAKLGLVTGRSLPEAIG
KRMGRPARLAYWAQAEIVAMATDVAEVIGGAIALRIMFNLPLPIGGIITG
VVSLLLLTIQDRRGQRLFERVITALLLVIAIGFTASFFVVTPPPNAVLAG
LAPRFQGTESVLLAAAIMGATVMPHAVYLHSGLARDRHGHPDPGPQRRRL
LRVTRWDVGLAMLIAGGVNAAMLLVAALNMRGRGDTASIEGAYHAVHDTL
GATIAVLFAVGLLASGLASSSVGAYAGAMIMQGLLHWSVPMLVRRLITLG
PALAILTLGFDPTRTLVLSQVVLSFGIPFAVLPLVKLTGSPAVMGGDTNH
RATTWVGWVVAVMVSLLNVMLIYLTVTG
433633975YP_007267602.1 Putative GCN5-related N-acetyltransferase [Mycobacterium canettii CMSGHSAPRRISDADDVTSFSSGEPSLDDYLRKRALANHVQGGSRCFVTCR
DGRVVGFYALASGSVAHADAPGRVRRNMPDPVPVILLSRLVVDRKEQGRG
LGSHLLRDAIGRCVQAADSIGLRAILVHALHDEARAFYVHFDFEISPTDP
LHLMLLMKDARALIGD
433633973YP_007267600.1 Putative glycine betaine transport integral membrane protein BetP [MSAKERGDQNAVVDALRSIQPAVFIPASVVIVAMIVVSVVYSSVAENAFV
RLNSAITGGVGWWYILVATGFVVFALYCGISRIGTIRLGRDDELPEFSFW
AWLAMLFSAGMGIGLVFYGVAEPLSHYLRPPRLRGVPALTDAAANQAMAL
TVFHWGLHAWAIYVVVGLGMAYMTYRRGRPLSVRWLLEPVVGRRRIEGAL
GHAVDVIAIVGTLFGVATSLGFGITQIASGLEYLGWIRVDNWWMVGMIAA
ITATATASVVSGVSKGLKWLSNINMALAAALALFVLLLGPTLFLLQSWVQ
NLGGYVQSLPQFMLRTAPFSHDGWLGDWTIFYWGWWISWAPFVGMFIARI
SRGRTIREFIGAVLLVPTVIASLWFTIFGDSALLRQRNNGDMLVNGAVDT
NTSLFRLLDGLPIGAITSVLAVLVIVFFFVTSSDSGSLVIDILSAGGELD
PPKLTRVYWAVLEGVAAAVLLLIGGAGSLTALRTAAIATALPFSIVMVVA
CYAMTKAFHFDLAATPRLLHVTVPDVVAAGNRRRHDISATLSGLIAVRDV
DSGTYIVHPDTGALTVTAPPDPLDDHVFESDRHVTRRNTTSSR
433633971YP_007267598.1 Conserved protein of unknown function- PPE family [Mycobacterium caMDFGLLPPEVNSSRMYSGPGPESMLAAAAAWDGVAAELTSAAVSYGSVVS
TLIVEPWMGPAAAAMAAAATPYVGWLAATAALAKETATQARAAAEAFGTA
FAMTVPPSLVAANRSRLMSLVAANILGQNSAAIAATQAEYAEMWAQDAAV
MYSYEGASAAASALPPFTPPVQGTDPAGPAAAAAATQAAGAGAVADAQAT
LAQLPPGILSDILSALAANADPLTSGLLGIASTLNPQVGSAQPIVIPTPI
GELDVIALYIASIATGSIALAITNTARPWHIGLYGNAGGLGPTQGHPLSS
ATDEPEPHWGPFGGAVPVSAGVGHAALVGALSVPHSWTTAAPEIQLAVQA
TPTFSSSAGADPTALNGMPAGLLSGMALASLAARGTTGGGGTRSGTSTDG
QEDGRKPPVVVIREQPPPGNPPR
433633969YP_007267596.1 Putative dioxygenase [Mycobacterium canettii CIPT 140070017]MDVEIVGKFLSTLPEDDDHPYRTGPWRPQTTEWDADDLTAVTGEVPADLD
GIYLRNTENPLHPAFATYHPFDGDGMLHVVGFRDGKAFYRNRFIRTDGFL
AENEAGGPLWPGLAEPVQLAKREHGWGARGLMKDASSTDVIVHRGIALTS
FYQCGDLYRIDPYSANTLGKESWHGRFPFDWGVSAHPKVDNKTGELLFFN
YSKQEPYMRYGVVDQNNELVHYVDVPLPGPRLPHDMAFTENYVILNDFPL
FWDPRLLERDVHLPRFYPDIPSRFAVVARRGNDIRWFEADPTFVLHFTNA
YEQGDEIVLDGFYEGDPQPLDTGGTKWEKLFRFLALDRLQSRLHRWRLNM
VTGAVHEEQLSESITEFGTINADYAASSYRYTYAATGKPSWFLFDGLVKH
DLLTGNHECYPFGDGVYGSETAMAPRVGSSAEDDGYLITLTTDMNDDASY
CLVFDAARPGDGPICKLALPERISSGTHAAWVPGAELRRWDHAESPAAAV
GL
433633967YP_007267594.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MPTRSSAPLGAPCWIDLTTSDVDRAQDFYGTVFGWAFESAGPDYGGYINA
AKGGHPVAGLMANRPEFQSPDGWATYFHTVDIHATVAKLAAAGGSSCLDP
MEVPGKGFMSLAVDPSGAAFGLWQPLQHHGFEVIGEAGSPVWHQLTTRDY
RSAIDFYRQVFGWRTEQISDTDEFCYTTAWFDDQQLLGVTDGSSCLPEGV
PSNWTIFFGAEDVDETLRVICDNGGSVVRAAENTPYGRLAAAADPTGVVF
NLSSLQA
433633965YP_007267592.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MGILDKVKNLLSQNADKVETVINKAGEFVDEQTQGNYSDAIHKLQDAASN
VVGMSEQQS
433633963YP_007267590.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MVHIVGLSIETTAPTDSAITPIMVREINIGEIPLGLRLGSDTTLLDAALA
GG
433633961YP_007267588.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MTKRAATAAMVMLLTLTGCGSAHRALGPPSGLPDASPDEVSGIQIPAGRI
DDAVAKVDGLVGELMQNTSIPGMAVAIVHGGKTLYAKGFGVRDVSKGGGP
NNKVDADTVFQLASVSKSVGATVVAHAVTDNVVTWDTPVVSKLPWFALRD
PYVTGQVTIADLYSHRSGLPDHAGDLLEDLGYDRRQVLQRLKYLPLTPFR
ISYAYTNFGVTAAADAVGAAAGRSWEDLSDEVLYRPLGMGSTSSRFTDFL
ARPNHAVNHVKVADRWEARYQRDPDAQSPAGGVSSSLNDMTHWLAMVLAD
GVYNGRRITSPEALLPVYTPQVISRHSVSPRARASFYGYGFNVGVTSSGR
TEYSHSGAFALGAATNFVVLPSEDLAIIALTNAGPIGVPETLTAEFMDLV
QYGQVREDWAALYKKAFAPLNEPAGSLVGKQPPANPAPSRPLNDYAGVYA
NDYWGPATVTYHDGQLRLSLGPKNQTFDLTHWDGDTFTFTLSTENALPGS
ISKATFAGDTLNLEYYDANKLGTFTR
433633959YP_007267586.1 Putative enoyl-CoA hydratase EchA6 (enoyl hydrase) (unsaturated acyMIGITQAEAVLTIELQRPERRNALNSQLVEELTQAIRKAGDGSARAIVLT
GQGTAFCAGADLSGDAFAADYPDRLIELHKAMDASPMPVVGAINGPAIGA
GLQLAMQCDLRVVAPDAFFQFPTSKYGLALDNWSIRRLSSLVGHGRARAM
LLSAEKLTAEIALHTGMANRIGTLADAQAWAAEIARLAPLAIQHAKRVLN
DDGAIEEAWPAHKELFDKAWGSQDVIEAQVARMEKRPPKFQGA
433633957YP_007267584.1 Two component response transcriptional regulatory protein PrrA [MycMGGMDTGVTSPRVLVVDDDSDVLASLERGLRLSGFEVATAVDGAEALRSA
TENRPDAIVLDINMPVLDGVSVVTALRAMDNDVPVCVLSARSSVDDRVAG
LEAGADDYLVKPFVLAELVARVKALLRRRGSTATSSSETITVGPLEVDIP
GRRARVNGVDVDLTKREFDLLAVLAEHKTAVLSRAQLLELVWGYDFAADT
NVVDVFIGYLRRKLEAGGGPRLLHTVRGVGFVLRMQ
433633955YP_007267582.1 Conserved exported or membrane protein of unknown function [MycobacMEHVHWWLAGLAFTLGMVLTSTLMVRPVEHQVLVRKSVRGSSAKSKPPTA
RKPAVKSGTKREESPTAKTKVATESAAEQIPVAGEPAAEQIPVAGEPAAE
QIPVAGEPAARIPVVPYAPYGPGSARAGADGSGPEGWLVKGRSDTRLYYT
PEDPTYDPTVAQVWFQDEESAARAFFTPWRKSTRRT
433633953YP_007267580.1 Outer membrane protein a OmpA [Mycobacterium canettii CIPT 14007001MASKAGLGQTPATTDARRTQKFYRGSPGRPWLIGAVVIPLLIAAIGYGAF
QRPQSVTGPTGVLPTLTPTSTGGASALSLSLLSISRSGNTVTLIGDFPDE
AAKAALMTALNGLLAPGVNVIDQIHVDPVVRSLDFSSAEPVFTASVPIPD
FGLKVERDTVTLTGTAPSPEHKDAVKRAATSTWPDMKIVDNIEVTGQAPP
GPPAAGPCADLQSAINAVTGGPIAFGNDGASLIPADYEILNRVADKLKAC
PDARVTINGYTDNTGSEGINIPLSAQRAKIVADYLVARGVAGDHIATKGL
GSVNPIASNDTPEGRAKNRRVEIVVN
433633951YP_007267578.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MSDHDRDFDVVVVGGGHNGLVAAAYLARAGLRVRLLERLAQTGGAAVSIQ
AFDGVEVALPRYSYLVSLLPSRIVADLGAPVRLARRPFSSYTPAPATAGR
SGLLIGPTGEPRAAHLAAIGAAPDAHGFAAFYRRCRLVTARLWPTLIEPL
RTREQARRDIVEYGGHEAAAAWQAMVDEPIGHAIAGAVANDLLRGVIATD
ALIGTFARMHDPSLMQNICFLYHLLGGGTGVWHVPIGGMGSVTSALATAA
ARHGAEIVTGADVFALDPDGTVRYHSDGSDGAEHLVRGRFVLVGVTPAVL
ASLLGEPVAALAPGAQVKVNMVVRRLPRLRDDSVTPQQAFAGTFHVNETW
SQLDAAYSQAASGRLPDPLPCEAYCHSLTDPSILSARLRDAGAQTLTVFG
LHTPHSVFGDTEGLAERLTAAVLASLNSVLAEPIQDVLWTDAQSRPCIET
TTTLDLQRTLGMTGGNIFHGALSWPFADDDDPLDTPARQWGVATDHERIM
LCGSGARRGGAVSGIGGHNAAMAVLACLASRRKSP
433633949YP_007267576.1 Putative triacylglycerol synthase (diacylglycerol acyltransferase) MRQQQEADVVALGQKPGLLCVPERFRAMDLPMAAADALFLWAETPTRPLH
VGALAVLSQPDNGTGRYLRKVFSAAVARQQVAPWWRRRPHRSLTSLGQWS
WRTETEVDLDYHVRLSALPPRAGNAELWALVSELHAGMLDRSRPLWQVDL
IEGLPGGRCAVYVKVHHALADGVSVMRLLRRIVTADPHQRQMPALWEVPA
QAAVAKHTAPRGSSSPLTLAKGVLGQARGVPGMVRVVADTTWRAAQCRSG
PLTLAAPHTPLNEPIAGARSVAGCSFPIERLRQVAEHADATINDVVLAMC
GGALRAYLISRGALPAAPLIAMVPVSLRDTAVIDVFGQGPGNKIGTLMCS
LATHLASPVERLSAIRASMRDGKAAIAGRSRNQVLAMSALGAAPLALAMT
LGRVPAPLRPPNVTISNVPGPQGVLYWNGARLDALYLLSAPVDGAALNIT
CSGTNEQITFGLTGCRRAVPALSILTDQLAHELELLVGVSEAGPGTRLRR
IAGRR
433633947YP_007267574.1 Conserved hypothetical protein. Putative S-adenosylmethionine-depenMRTEDDSWDVTTSVGSTGLLVAAARALETQKADPLAIDPYAEVFCRAAGG
EWADVLDGKLPGHYLTTGDFGEHFVNFQGARTRYFDEYFSRATAAGMLQV
VILAAGLDSRAFRLQWPIGTTIFELDRPQVLDFKNAVLADYHIRPRAQRR
SVAVDLRDEWQIALCNNGFDVSRPSAWIAEGLLVYLSAEAQQRLFIGIDT
LASPGSHVAVEEATPLDPCEFAAKLERERAANAQGDPRRFFQMVYNERWA
RATEWFDERGWRATATPLAEYLRRVGRAVPEADTEAAPMVTAITFVSAVR
TGSVADPARTSPSSTSIGFKRFEAD
433633945YP_007267572.1 Putative transcriptional regulatory protein (probably LuxR-family) MSRLLPTGTVTLLLADVEESTHLWQMCPEDMATAIAHLDHTVSEAITNHG
GVQPVKRYEGDSFVAAFTRASDAAACALDLQRTSLAPIRLRIGLHTGEVQ
LRDELYVGPTINRTARLRDLAHGGQVVLSAATGDLVTGRLPADAWLVDLG
RHPLRGLPRPEWVMQLCHPDIREKFPPLRTAKSSPTSILPAQFTTFVGRR
AQISEVRALLAQNRLVTLCGTGGVGKTRLAIQIASASELRDGLCFVDLAP
ITESGIVAATAARAVGLPDQPGRSTMDSLRRFIGNRRMLMVLDNCEHLLD
ACAALVVELLGACPELTILATSREPIGMAGEITWRVPSMSITDEAVELFA
DRASRVQPGFTIANHNAAAVGEICRRLDGIPLAIEFAAARVRSMSPLEIA
DGLDDCFRLLAGGVRGAVQRQQTLRASIDWSHALLTETEQILFRRLAPFV
GGFDLAAVRAVAAGSDLDPFSVLDQLTLLVDKSLVVADDCQGRTRYRLLE
TVRRYALEKLGDSGEADVHARHRDYYTALAASLNTPADNDHQRLVARAET
EIDNLRAAFAWSRENGHITEALQLASSLQPIWFGRAHLREGLSWFNSILE
DQRFHRLAVSTAVRARALADKAMLSTWLATSPVGATDIIAPAQQALAMAR
EVGDPAALVRALTACGCSSGYNAEAAAPYFAEATDLARAIDDKWTLCQIL
YWRGVGTCISGDPNALRAAAEECRDLADTIGDRFVSRHCGLWLSLAQMWA
GNLTEALELSREITAEAEASNDVPTKVLGLYTQAQVLAYCGASAAHATAG
ACIAAATELGGVYQGIGYAAMTYAALAAGDVTAALEASDAARPILRAQPD
QVTMHQVLMAQLALAGGDAIAARQFANDAVDATNGWHRMVALTIRARVAT
ARGEPELARDDAHAALACGAELHIYQGMPDAMELLAGLAGEVGSHSEGVR
LLGAAAALRQQTRQVRFKIWDAGYQASVTALREAMGGEDFDRAWAEGAAL
STDEAIAYAQRGRGERKRPARGWGSLTPTERDVVRLVSEGLSNKDIAKRL
FVSPRTVQTHLTHVYAKLGLASRVQLVDEAARRGSPS
433633943YP_007267570.1 Conserved exported protein of unknown function [Mycobacterium canetMDYAKRIGQVGALAVVLGVGAAVTTHAIGSAAPTDPSSSSTDSPVDACSP
LGGSASSLAAIPGASVPQAGVRQVDPGSIPDDLLNALIDFLAAVRNGLVP
IIENRTPVANPQQVSVPEGGTVGPVRFDACDPDGNRMTFAVRERGAPGGP
QHGIVTVDQRTASFTYTADPGFVGTDTFSVNVSDDTSLHVHGLAGYLGPF
HGHDDVATVTVFVGNTPTDTISGDFSMLTYNIAGLPFPLSSAILPRFFYT
KEIGKRLNAYYVANVQEDFAYHQFLIKKSKMPSQTPPEPPTLLWPIGVPF
SDGLNTLSEFKVQRLDRQTWYECTSDNCLTLKGFTYSQMRLPGGDTVDVY
NLHTNTGGGPTTNANLAQVANYIQQNSAGRAVIVTGDFNARYSDDQSALL
QFAQVNGLTDAWVQVEHGPTTPPFAPTCMVGNECELLDKIFYRSGQGVTL
QAVSYGNEAPKFFNSKGEPLSDHSPAVVGFHYVADNVAVR
433633941YP_007267568.1 Putative NADPH:adrenodoxin oxidoreductase FprB (adrenodoxin reductaMPHVITQSCCNDASCVFACPVNCIHPTPDEPGFATSEMLYIDPVACVDCG
ACVTACPVSAIAPNTRLDFEQLPFVEINASYYPKRPAGVKLAPTSKLAPV
TPAAEVRVRRQPLTVAIVGSGPAAMYAADELLVQQGVQVNVFEKLPTPYG
LVRSGVAPDHQNTKRVTRLFDRIAGHRRFRFYLNVEIGKHLGHAELLAHH
HAVLYAVGAPDDRRLTIDGMGLPGTGTATQLVAWLNGHPDFTDLPVDLSH
ERVVIIGNGNVALDVARVLAADPHELAATDIADHALSALRKSAVREVVVA
ARRGPAHSAFTLPELIGLTAAADVVLDPGDHQRVLDDLAIVADPLTRNKL
EILSTLGDGSAPARRVGRPRIRLAYRLTPRRVLGQRRTGGVQFSVTGTDE
LRQLNAGLVLTSIGYRGKPIPDLPFDEQAALVPNDGGRVIDPGTGEPVPG
AYVAGWIKRGPTGFIGTNKSCSMQTVQALVADFNDGRLTDPVATPTALDQ
LVQARQPQAIGCAGWRAIDAAEIARGSADGRVRNKFTDVAEMLAAATSAP
KEPLRRRVLARLRDLGQPIVLTAPL
433633939YP_007267566.1 Putative phosphoserine aminotransferase [Mycobacterium canettii CIPMADQLTPRLEIPTAIKPRDGRFGSGPSKVRLEQLQTLTTTAAALFGTSHR
QAPVKNLVGRVRSGLAELFSLPDGYEVILGNGGATAFWDAAAFGLIDKRS
LHLTYGEFSAKFAAAVSKNPFVGEPIIITSDPGSAPDPQTDPSVDVIAWA
HNETSTGVAVAVRRPEGSDDALVVIDATSGAGGLPVDIAETDAYYFAPQK
NFASDGGLWLAIMSPAALSRIEAIAATGRWVPDFLSLPIAVENSLKNQTY
NTPAIATLALLAEQIDWLVGNGGLDWAVKRTADSSQRLYSWAQERPYTTP
FVTDPGLRSQVVGTIDFVDDVDAGTVAKILRANGIVDTEPYRKLGRNQLR
VAMFPAVEPDDVSALTECVDWVVERL
433633937YP_007267564.1 Conserved membrane protein of unknown function [Mycobacterium canetMNDQRDQSVPWATGLAVAGFVAAVIAVAVVVLSLGLIRVHPLLAVGLNIV
AVSGLAPTLWGWRRTPVLRWFVLGAAVGVAGAWLALLALALGDG
433633935YP_007267562.1 Putative transcriptional regulatory protein (possibly MarR-family) MLDSDARLASDLSLAVMRLSRQLRFRNPSSPVSLSQLSALTTLANEGAMT
PGALAFRERVRPPSMTRVIASLADMGFVDRAPHPIDGRQVLVSVSESGAE
LVKAARRARQEWLAERLATLNRGERDILRSAADLMLALVDESP
433633933YP_007267560.1 Conserved protein of unknown function- PPE family- PPE13 [MycobacteMNFMVLPPEVNSARIYAGAGPAPMLAAAVAWDGLAAELGVAAASFSLLIS
GLTAGPAWQGPAAAAMAAAAAPYLSWLSAATARAEGAAAGAKAAAAVYEA
ARAATAHPALVAANRNQLLSLLLSNLFGQNAPAIAATEASYEQLWAQDVA
AMVGYHGGASTVASQLTPWQHLLSVLPRVVTAAPAGAVGVPAALAIPALG
VENIGVGNFLGIGNIGNNNVGSGNTGDYNFGIGNIGNANLGNGNIGNANL
GSGNAGFFNFGNGNDGNTNFGSGNAGFLNIGSGNEGSGNLGFGNDGDRNL
GFGNFGNTNVGSGNLGDFNLGSGNNGFSNVGFGNLGDNNLGFGNSGNNNI
GFGLTGNNMIGIGALNSGTGNFGFGNSGNNNIGFFNSGSNNVGFFNSGDN
NFGFSNAGDTNTGFWNAADRNTGFGNSGNANTGFGNSGFQNTGFGNAGFQ
NTGSGNAGFQNTGAGNAGSQNTGFGNAGDDNTGWGNSGDTNTGGFNSGDL
NTGIGSPVTQGVANSGFGNTGTGHSGFFNSGNSGSGFQNLGNGSSGFGNA
SDTSSGFQNAGTAFNSGFFNVGRFTSGLANTGTLQTSGVANSGDNSSGVF
NTSDNQSGFFDW
433633931YP_007267558.1 Conserved membrane protein of unknown function [Mycobacterium canetMANYPPDDANYRRPRRPPPMPSANRYLPPLGEQPEPERGRVPPRTTRAGE
RITVTRAAAMRSREMGSRMYLLVHRAATADGADKSGLTALTWPVMANFAV
DSAMAVALANTLFFAAASGESKSRVALYLLITIAPFAVIAPLIGPALDRL
QHGRRVALALSFGLRTALAVVLIMNYDGATGSFPSWVLYPCALAMMVFSK
SFSVLRSAVTPRVMPPTIDLVRVNSRLTVFGLLGGTIAGGAIAAGVEFVC
THLFQLPGALFVVVAITIAGASLSMRIPRWVEVTSGEVPATLSYHRDRGR
LRRRWPEEVKNLGGTLRQPLGRNIITSLWGNCTIKVMVGFLFLYPAFVAK
AHEANGWVQLGMLGLIGAAAAVGNFAGNFTSARLQLGRPAVLVVRCTVLV
TVLAIAAAVAGSLATTAIATLITAGSSAIAKASLDASLQHDLPEESRASG
FGRSESTLQLAWVLGGAVGVLVYTELWVGFTAVSALLILGLAQTIVSFRG
DSLIPGLGGNRPVMAEQETTRRGAAVAPQ
433633929YP_007267556.1 Putative acyl-CoA dehydrogenase FadE10 [Mycobacterium canettii CIPTMAQQTQVTEEQARALAEESRESGWDKPSFAKELFLGRFPLGLIHPFPKPS
DAEEARTEAFLVKLREFLDTVDGSVIERDAQIPDEYVKGLAELGCFGLKI
PSEYGGLNMSQVAYNRVLMMVTTVHSSLGALLSAHQSIGVPEPLKLAGTA
EQKRRFLPRCAAGAISAFLLTEPDVGSDPARMASTATPIDDGQAYELEGV
KLWTTNGVVADLLVVMARVPRSEGHRGGISAFVVEADSPGITVERRNTFM
GLRGIENGVTRLHRVRVPKENLIGREGDGLKIALTTLNAGRLSLPAIATG
VAKQSLKIAREWSRERVQWGKPVGQHEAVASKISFIAATNYALDAVVEMS
SQMADEGRNDIRIEAALAKLWASEMACLVADELMQIRGGRGYETAESLAA
RGERAAPVEQMVRDLRINRIFEGSSEIMRLLIAREAVDAHLTAAGDLANP
KADLRQKAAAAAGASGFYAKWLPKLVFGEGQLPTTYREFGALATHLRFVE
RSSRKLARNTFYGMARWQASLERKQGFLGRIVDIGAELFAMSAVCVRAEA
QRTADPVEGEQAYELAEAFCQQATLRVEALFHALWSNTDSIDVRLAHNVL
EGRYTWLEQGILDQSEGTGPWIASWEPGPSTEANLARRFLTVSRSSEAKL
433633927YP_007267554.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MRLILNVIWLVFGGLWLALGYLVAALVCFVLIVTIPFGFAALRIASYALW
PFGRTIVEKPTAGTGALIGNVIWVLLFGIWLALGHLVSAAAMAVTIIGIP
LALANLKLIPVSLVPLGKDIVGVNSQVPT
433633925YP_007267552.1 Putative molybdenum cofactor biosynthesis protein D 2 MoaD2 (molybdMTQVSDESAGIQVTVRYFAAAQAAAGAESEKVTLRSGATVAELIDGLSVR
DVRLATVLSRCSYLRDGIVVRDDAVALSAGDTIDVLPPFAGG
433633923YP_007267550.1 Putative molybdenum cofactor biosynthesis protein E2 MoaE2 (molybdoMTQVLRAALTDQPIFLAEHEELVSHRSAGAIVGFVGMIRDRDGGRGVLRL
EYSAHPSAAQVLADLVAEVAEESSGVRAVAASHRIGVLQVGEAALVAAVA
ADHRRAAFGTCAHLVETIKARLPVWKHQFFEDGTDEWVGSV
433633921YP_007267548.1 Putative molybdenum cofactor biosynthesis protein C 2 MoaC2 [MycobaMARASGASDYRSGELSHQDERGAAHMVDITEKGTTKRTAVAAGILRTSAQ
VVALISTGGLPKGDALATARVAGIMAAKRTSDLIPLCHQLALTGVDVDFT
VGQLDIEITATVRSTDRTGVEMEALTAVSVAALTLYDMIKAVDPGALIDD
IRVLHKEGGRRGTWTRR
433633919YP_007267546.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MTEHTPDIPLGSWLAALPDERLTQLLELRPDLAQPPPGSIAALAARAQAR
QSVKAATDELDFLRLAVFDALLVLQADTAPVPIARLLAVIGDRAAQADVL
GALADLKQRALAWGETAVRVATDAGTALPWHPGQVTLEGRSRPGDQLADL
IAGLDPAQRDVLDKLLQGSPVGRTRDAAPGAPSDRPVPRLLAMGLLRRID
AETVILPRHVGQVLRGEQPGPMELTAPDPVVSTTTPDDADAAAAGAVIDL
LREVDVLLENLGATPVAELRSGGLGVREFKRLAKATGIDEPRLGLILEIA
AAAGLIASGMPDPEPPHSDGPFWAPTVAADRFATMSPAERWHLLASAWLD
LPGRPALIGTRGPDAKPYGALSDSLFSTAAPLDRRLLLGMLAELPAGAGV
DASRASATLIWRRPRWARRLQPAPIADLLTEGHALGLVGRGAISTPARAL
LDEALEPATAPAAAVGVMARALPKPIDHFLVQADLTVVVPGPLQRELADD
LTTVATVESAGTAMVYRVSEQSIRHALDVGKSRDWLQEFFANRSKTPVPQ
GLTYLIDDVARRHGQLRIGMATSFVRCEDPTLLAQVVAAPEADGLALRAL
APTVAVSPAPISEVLVTLRGAGFAPAAEDSTGAVVDVRTRGARVPTPQRR
RPYRPPPRPNSEALKAVVAVLREVTAAPFANVRVDPAVTMSLLQRAAKDQ
ATLVISYLDAAGVATQRVVAPITLRGGQLVAFDSSSGRLRDFAIHRITSV
VSAHDR
433633917YP_007267544.1 Putative fatty acid oxidation protein FadB [Mycobacterium canettii MPDNTIQWDKDADGIVTLTMDDPSGSTNVMNEAYIESMGKAVDRLVAEKD
SITGVVVASAKKTFFAGGDVKTMIQARPEDAGDVFNTVETIKRQLRTLET
LGKPVVAAINGAALGGGLEIALACHHRIAADVKGSQLGLPEVTLGLLPGG
GGVTRTVRMFGIQNAFVSVLAQGTRFKPAKAKEIGLVDELVATVEELVPA
AKAWIKEELKANPDGAGVQPWDKKGYKMPGGTPSSPGLAAILPSFPSNLR
KQLKGAPMPAPRAILAAAVEGAQVDFDTASRIESRYFASLVTGQVAKNMM
QAFFFDLQAINAGGSRPEGIGKTPIKRIGVLGAGMMGAGIAYVSAKAGYE
VVLKDVSLEAAAKGKGYSEKLEAKALERGRTTQERSDALLARITPTADAA
DFKGVDFVIEAVFENQELKHKVFGEIEDIVEPNAILGSNTSTLPITGLAT
GVKRQEDFIGIHFFSPVDKMPLVEIIKGEKTSDEALARVFDYTLAIGKTP
IVVNDSRGFFTSRVIGTFVNEALAMLGEGVEPASIEQAGSQAGYPAPPLQ
LSDELNLELMHKIAVATRKGVEDAGGTYQPHPAEAVVEKMIELGRSGRLK
GAGFYEYADGKRSGLWSGLRETFKSGSSQPPLQDMIDRMLFAEALETQKC
LDENVLTSTADANIGSIMGIGFPPWTGGSAQFIVGYSGPAGTGKAAFVAR
ARELAAAYGDRFLPPESLLS
433633915YP_007267542.1 Putative aminotransferase [Mycobacterium canettii CIPT 140070017]MTVSRLRPYATTVFAEMSALATRIGAVNLGQGFPDEDGPPKMLQAAQDAI
AGGVNQYPPGPGSAPLRRAIAAQRRRHFGVDYDPETEVLVTVGATEAIAA
AVLGLVEPGSEVLLIEPFYDSYSPVVAMAGAHRVTVPLVPDGRGFALDAD
ALRRAVTPRTRALIINSPHNPTGAVLSATELAAIAEIAVAANFVVITDEV
YEHLVFDHARHLPLAGFDGMAERTITISSAAKMFNCTGWKIGWACGPAEL
IAGVRAAKQYLSYVGGAPFQPAVALALDTEDAWVAALRNSLRARRDRLAA
GLTEIGFEVHDSYGTYFLCADPRLLGYDDSTEFCAALPEKVGVAAIPMSA
FCDPAAGQASQQADVWNHLVRFTFCKRDDTLDEAIRRLSVLAERPAT
433633913YP_007267540.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MEALADVGVLASWSPLHKQVEVIDYYPDGRPHHVRATVKILGLVDKEVLE
YHWGPDWVCWDADQTFQQHGQHIEYTVKPEGVDKARVRFDITVEPAGPIP
GFIVKRASEHVLDAAAKGLQKLIAGAGDQGNAKS
433633911YP_007267538.1 Putative pyruvate or indole-3-pyruvate decarboxylase Pdc [MycobacteMTPQKSDACSDPVYTVGDYLLDRLAELGVSEIFGVPGDYNLQFLDHIVAH
PTIRWVGSANELNAGYAADGYGRLRGMSAVVTTFGVGELSVTNAIAGSYA
EHVPVVHIVGGPTKDAQGTRRALHHSLGDGDFEHFLRISREITCAQANLM
PATAGREIDRVLSEVREQKRPGYILLSSDVARFPTEPPAAPLPRYPGGTS
PRALSLFTEAATELIADHQLTVLADLLVHRLQAVKELEALLAADVVPHAT
LMWGKSLLDESSPNFLGIYAGAASAERVRAAIEGAPVLVTAGVVFTDMVS
GFFSQRIDPARTIDIGQYQSSVADQVFAPLEMGAALQALATILTGRGISS
PPVVPPPAGPPPAVPAGDEPLTQQMVWDRVCSALTPGNVVLADQGTSFYG
MADHRLPQGVTFIGQPLWGSIGYTLPAAVGAAVAHPDRRTVLLVGDGAAQ
LTVQELGTFSREGLSPVIVVVNNDGYTVERAIHGETAPYNDIVSWNWTEL
PNALGVTNHLAFRAQTYGQLDDALTIAAARRDRMVLVEVVLPRLEIPRLL
GQLVGSMAPQ
433633909YP_007267536.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MEGKIDMAARRQVTNKLRTQYRKASKADKGKILDRVVATTGMGRSTARRM
LTGPGLPDPAEQVDGRSLRARGFSDDARALLEHVWALMGMPCGKYLVVML
ELWLPLLTAAGDLDKPFATDAALAELTAMSAATVDRYLKPIRDKMRIKGI
STTKPSPLLRNSISIRTCADEAPDAPGVIEADTVAHCGPTLIGEFARTLT
MTDLVTGWTENHSIRNNASKWIVEGIEALQACFPFAMVIFDSDCGAEFIN
HEVAAWLQARDIEQTRSRPYQKNDQAHVESKNNHVVRKHAFYWRYDTGQE
LELLNRMWRLGSLRLNFFTPTKKAVGYTTTADGRRKRIYDKPATPWQRLQ
ASDALDAQQLSIVAARVDGINPADLTRQINTIQMQLLDLAKAKTDALATA
RHIDLAALQPSINRLAKTT
433633907YP_007267534.1 Conserved membrane protein of unknown function [Mycobacterium canetMGARAIFRGFNRPSRVLMINQFGINIGFYMLMPYLADYLAGPLGLAAWAV
GLVMGVRNFSQQGMFFVGGTLADRFGYKPLIIAGCLIRTGGFALLVVAQS
LPSVLIAAAATGFAGALFNPAVRGYLAAEAGERKIEAFAMFNVFYQSGIL
LGPLVGLALLALDFRITVLAAASVFGVLTVAQLVALPQHRADSEHEKTSI
LQDWRVVVRNRPFLTLAAAMTGCYALSFQIYLALPMQASILMPRNQYLLI
AAMFAVSGLVAVGGQLRITRWFAVRWGAERSLVVGATILAASFIPVAVIP
NGQRFGVAVAVMALVLSASLLAVASAALFPFEMRAVVALSGDRLVATHYG
FYSTIVGVGVLVGNLAIGSLMSAARRLNTDEIVWGGLILVGIVAVAGLRR
LDTFTSGSQDMTGRWAAPR
433633905YP_007267532.1 Conserved lipoprotein of unknown function LpqS [Mycobacterium canetMEGQHVVWMRSAIVAVALGVLVAAVVAQCWFPQLHRHLAHRNHPLATSVG
SEFVINTDHGHLVDNSTPPCPERLATAVLPRSDTPVFLPDVVAAAPGMTA
ALTDPVAPAARGPPAAQGSVRTGQDLLTRFCLARR
433633903YP_007267530.1 Putative two component system sensor kinase [Mycobacterium canettiiMAMTSSAELDRVRWAHQLRSYRIASVLRIGVVGLMVAAMVVGTSRSEWPQ
QIVLIGVYAVAALWALLLAYSASRRFFALRRFRSMGRLEPFAFTAVDVLI
LTGFQLLSTDGIYPLLIMILLPVLVGLDVSTRRAAVVLACTLVGFAVAVL
GDPVMLRAIGWPETIFRFALYAFLCATALMVVRIEERHTRSVAGLSALRE
ELLAQTMTASEVLQRRIAEAIHDGPLQDVLAARQELIELDAVTPGDERVG
RALAGLQSASERLRQATFELHPAVLEQVGLGPAVKQLAASTAQRSGIKIS
TDIDYPIRSGIDPIVFGVVRELLSNVVRHSGATTASVRLGITDEKCVLDV
ADDGVGVTGDTMARRLGEGHIGLASHRARVDAAGGVLVFLATPRGTHVCV
ELPLKR
433633901YP_007267528.1 Putative dehydrogenase [Mycobacterium canettii CIPT 140070017]MTRTSEGLAAFVVDQLEELYRRMWVLRLLDMALEQLRIEGLINGPLEAGF
GQEALSVGAAAALGEGDIIITTHRPHAQHVGTDAPLGPVIADMLGATAGD
LEGADENALIADPRAGLPAAIRVVKQSPLLAIGHAYALWLRDTGRVTLCV
TQDCDVDADAFNEAADLAAVWQLPVVILVENIRGALSVHLDRYAHEPRVY
RRAVAYGMPGVSVDGNDVEAVRDCVANAVVRARAGGGPTLVQAITYRTTD
FSGSDRGGYRDLAGSEQFLDPLIFARRRLIAAGTTRGRLDEQERAACQQV
ADAVAFAKARARPNGGGPISRPTSGWHQQPKTRF
433633899YP_007267526.1 Conserved membrane protein of unknown function [Mycobacterium canetMVAASIVHHSAAPANRGRYHGIWSMTPAVASVVVPIMASYGPIHGGHLLA
AVVVGSAGAALCLPLARALRRPTPSAMTTD
433633897YP_007267524.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MNDKRRAIYTHGYHESVLRSHRRRTAENSAGYLLPHLEPGLSVLDVGCGP
GTITVDLAARVAPGSVTGVEPTDDALSLARVEAQLHRLSNISFTTSDVHK
LDFPDDAFDVVHAHQVLQHVADPVRALQEMRRVCTPGGIVAARDADYAGF
IWFPKLPALDRWLDLYERAARANGGEPDAGRRLLSWARAAGFDDVTPTAS
VWCFATASAREWWGLMWADRILQSDLAHQLVDSGLATAAQLEEISTAWRE
WAAAPDGWLAIPHGEILCRA
433633895YP_007267522.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MDQIGADLAEAVERHLTEYGVRVLGGLSALNSAHPESLDLEIDGHPLTIT
ALYLPHLSATAALQAWDTAGAGSPLLVVGPRLHPSSAETLRARGLWYIDG
AGNAYLRHQGGLLIDVRGRRSAVSAQPGTLGDGLHSDGPRNPFTPKRAQV
VCVLLDAPQLVDAPLRAIAASAGVSVGMAKETMDTLRTTGFFEHLGSRRR
LVRTDELLDLWAAAYPGGLGRANKLLVASGDIHTWSAPDGLAVAVSGEQA
VPDEIRNPESLMLYVDTPAPGLPADLLIHNRWHRDPHGSIVIRKLFWRNL
PDEQPGLAPAALIYADLLASREPRQVEVAHLMRRQDERLCRL
433633893YP_007267520.1 Conserved protein of unknown function (part2) [Mycobacterium canettMLATRATQADHDLLAQHFAVSQPGWPATTASRRSLVDALLDQLTPGS
433633891YP_007267518.1 Conserved protein of unknown function- PE-PGRS family protein [MycoMSFVIAAPDLVAMATENLAGIGASLTAANAAAAVPTSGLLAAAGDEVSAA
IAALFSSHGQQYQAMSAQAAAFHARFVQALAGAMGAYAAAEAANASPLQT
LEQGVLGAINAPAAALSGRPFIGNGTNGAPGTGEAGGPGGWLLGNGGNGG
SGAPGQTGGAGGAAGLLGHGGTGGAGGTGASGGKGGTGGWLWGSGGAGGA
GGSGGGSGGAGGNALMFGIGGNGGAGGAASGVGNGGVGGAGGAGGALVAI
GGAGGAGGAATTGTGGAGGAGNNALGLFFGLGGSGGQGGDSAMGSGGAGG
AGGSGGAASPFGIDIGIGGAGGHGGAGTNGGAGGAGGAGGSSGTVFALDL
SWGGAGGNGGAATTGTGGAGGTGGFAVAPDFIGFGAAYGGAGGLGGAATG
AGGTGGTGGVGAGGFAALGVGVGGAGGAGGAATETGGIGGAGGLGVGLLG
GAGGAGGPGGAASAGSGGHGGTGGDALGLIGAGIGGVGGVGGAADTGGNG
GAGGSGTGLLGGVGGAGGHGGAASAGTGGSGGAGGDGFGFVGAGGNGGNA
GTGVGVNGANGGNGGSATGVLAAVGGAGAAGGDATSGTGGFGGAGGSAGG
LIFALGGAGAAGGDASTGLGGPGGPGGTGTASNPFGIAIAIGGAGAQGGA
GTSGGAGGAGGDGVFEGIAVIGLGFGGAAGAGGAATGDGATGGAGGFGGA
GASLANFLGFSILHGGAGGAGGTATGTGGNGGAGGGGGLSSPVILGIGIG
GAGGDGGGALGVLGGMGGDGGDGGEAVAVGIAVGGAGGAGGAAPTGNGGA
GGNGGEALGLVGVGGNGGNAGTGVGANTGGNGGDTTIVVNGMLAPSVLGY
GGNGGNGVNGGAGGTGGKAGAFGAPGQNGLP
433633889YP_007267516.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MSETPSATVELGDTRRAGYRLQRAEVLNWGTFDSQVWRFTPNTDTALLTG
DIGSGKSTIVDAITTLLVPSHKAAYNKAAGADARERTLRSYVEGHYKSER
NEATGKSRAKGLRENRRTYSVILGVFTNHGYDETVTLAQVFQQRESTGQP
YRFFVTATKELSIATDFADFGSDLRDLRKRLRAAGADIFDEFPKYATSLR
RLLGIRSEQALELFHQTVSMKSVGNLNDFVRDHMLEPSDSTDRVRDIIAH
FEDLTKAHDAVKRAREQLDALEPVVQTTAKYDAALAERDTRERERSAARL
YIAELRSNLLAGEIERLDAEGSALWQQQDAAEAKQQKLNHERESLIEERA
KAGGDRIGELERLASEARVQAETRRRTRTLFDAAVFDAGLEPVAGSEEFA
ALSALVSAERSRLAADKRAVDAASADAIGRERELQRKCDVVAEELTSLEQ
RTSNLPVEQVEVRAELCAALRLTPEDLPYAGELLDVFDEHSDWRGAAERV
LRGFALSLLVPQQHYDAVAAWVNGRRLTFHGRGGKVTGAKLVYERVPRQR
VRLQPPEHDGLLLAECVDVKDGPFREYLVNELTKRADFRCTASLEEFRSQ
RRAVTREGQVRSGERHEKDDRHRVDDPRRWVLGWANERKIAALRTELAEL
EVERETAETQLARLTEQRTALQGKLDALLRVEGFRSWLDLDVDEAEARAN
DHDAERARLQTGSSRLEEITHALNRNAEQAAVVAQLIKKLTGRLATTAAE
KNQAEQDKRRDDEFVEGQPEQELATARASYAALDERLGQHRPTRAADCAE
TETNLSADLHRRIEKLTRELGGYGQSLGQHMAEVLRRWPELRADMDANVE
ARHDFLAFRERVATDDLPRFESEFKEQLNKNAIQELAGFNNWLNRQASVI
DERVHRINEALGAVPYNPGHVIKLEKEPTTNQDVAQFRSDLRNLTNDSLA
VDGDQYSEQRFLDVKRIIERFRGRDGYAEADKNWTRRVTDVRNWFVFSAS
ERDVETDLEWEHYSDSDGKSGGQKEKLAYTILAASLAYQFGLKWGAEQSR
DFRFAVIDEAFGRGSDVSTRYALDLFATLGLQLLIITPLQKVHVIEPYVK
AIGFVDNPTGTYSRLQTMTIEEYRKRRDGRRP
433633887YP_007267514.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MEYATIDALRERHPAWRLLRAGNSTLILSFLGMFFVEGNRGACPVSQVAA
ALDDHLYALNIEISTENGQERFPKDARSYLEDWAATDTGYLRRFYPTGDD
EVHYEVTPAFEKAYTWVMGLKGRSFVGTESRLHTVVELLRQIVHGTEVEP
DARLAELRRRRDELDAEMAAVEAGVVQVLDATGVRDRYQQLATTARELLS
DFREVEENFRLLDRAAREKIAAWEGSKGELLAELVGSRSEITGSDQGRSF
QAFYDFLLSESRQAELAELLAKVSTLKTIEADDRIRGIHHDWSEAADRAQ
RTVRQISEQLRRFLDDQIWVENRRVLDLVRAVESVALELRDNPPTFGLEV
DQPGIEIVLPFERPLYQPPAVVAVESVIPSASEEVDTDLLFTQTFIDQAR
LIETIRDVLPENSSALLSDVVAVHPIEQGAAEIVGYLALNDEDVAVEMDD
ADETLLEYADPADPDFTKRARLPKVTVRRR
433633885YP_007267512.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MSVDIFRDPLFTPVEVSHYLKIPRSTVYYWLNASSVGNVPLVHHITPERR
GAASVPFAALVEAFVLRALRNELRFTKRQITDTVTDVRANFGTDFALASK
RIATDGIDIFIHHNDGEFVRVGDHQILIRDAVGDYLRYITWSPDTEYASR
LRLRSFGDEARVVIDPRFAWGAPVVERNKVPVQAVLDLWAAGEPLSVVAK
EYGLTAAETEEICRVGLKQAA
433633883YP_007267510.1 Transposase [Mycobacterium canettii CIPT 140070017]MIDGAVNELEPLVGVVAACRLTGKSRATLHRQRNPKPPVQGPKRPPAQHP
GALTELERARVLEVLRSDRFVDKSPAQVWAVLLDEGTYLCSISTMYRLLR
ANGEVCERRRQASHPPRVKPELVATGPNQVWSWDVTKLKGPVRGEYYDLF
VMLDIFSRKAVNHLLVPTEDAEAAKAFIEEAFAKNGGIAPDHLHSDNGTS
MTSKNVHQLLVDLGVTRSLSRPHVSNDNPYSESGFKTMKYCPVFPERFAS
FDEAEAFCDKFFHYYNHEHRHSGIGLHTAASVHDGTAHAIRARRAETLAA
AYAANPDRFRRKPTPPKLPEAAWINEPPKENTDTEHAA
433633881YP_007267508.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MLPETNQDEVQPNAPVALVTVEIRHPTTDSLTESANRELKHLLINDLPIE
RQAQDVSWGMTAPGGAPTPVADRFVRYVNRDNTTAASLKNQAIVVETTAY
RSFEAFTDVVMRVVDARAQVSSIVGVERIGLRFVLEIRVPAGVDGRITWS
NWIDEQLLGPQRFTPGGLVLTEWQGAAVYRELQPGKSLIVRYGPGMGQAL
DPNYHLRRTTPAQTGPFFLLDIDSFWTPSGGSIPEYNRDALVSTFQDLYG
PAQVVFREMITSRLKDELLRQ
433633879YP_007267506.1 Putative deaminase [Mycobacterium canettii CIPT 140070017]MTDCARRTIDLAPERRRECWPFATVIVKDGEVLAESANKMAQTNDPTAHA
EILAIRAACTKLGTEHLVGTTLDVLAHERSAIAAPTG
433633877YP_007267504.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MTQDTSATCPLTSTVQDSSPVAGQVGRPIGFRGPAGGCPVSPLGYESPPL
PLGADSLTWRYFGDWRGMLQGPWAGSMQNMHPQLGAAVEDHSTFFRERWP
RLLRSLYPIGGVVFDGDRAPVTGVQVRDYHITIKGVDGAGRRYHALNPDV
FYWAHATFFVGTLHVAERFCGGLTEAQRRQLFDEHVQWYRMYGMSMRPVP
ATWEEFQDYWDHMCRNVLENNFAARAVLDLTDLPKPPFAQRVPDWLWAAQ
RKLLARFFVWLTVGLYDPPVRELMGYRWSRRDEWLHRRFGDIVRLVFALV
PFRFRKHPRARAGWDRATGRIPADAPLVQTPARNLPPPDERDNPTHYCPK
V
433633875YP_007267502.1 Putative acyl-[acyl-carrier protein] desaturase DesA1 (acyl-[ACP] dMSAKLTDLQLLHELEPVVEKYLNRHLSMHKPWNPHDYIPWSDGKNYYALG
GQDWDPDQSKLSDVAQVAMVQNLVTEDNLPSYHREIAMNMGMDGAWGQWV
NRWTAEENRHGIALRDYLVVTRSVDPVELEKLRLEVVNRGFSPGQNHQGH
YFAESLTDSVLYVSFQELATRISHRNTGKACNDPVADQLMAKISADENLH
MIFYRDVSEAAFDLVPNQAMKSLHLILSHFQMPGFQVPEFRRKAVVIAVG
GVYDPRIHLDEVVMPVLKKWRIFEREDFTGEGAKLRDELALVIKDLELAC
DKFEVSKQRQLDREARTGKKVSAHELHRTAGKLAMSRR
433633873YP_007267500.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MSDGESAAPWARLSESAFPDGVDRWTTVPPASWVTAQAPRDTQNVGCHAT
GAVSVADLIARLGPAFPDRPTHRHVAPAPEPSGRGPKVPDDADDQQDTEA
IAIPAHSLEFLSELPDLRAANYPRAGHARREPELPGKQLTGSARVRPLRI
RRTSPAPAKPAPNSGRRPMVLAARSLAALFAALALALTGGAWQWSASKNS
RLNMVSALDPHSGDIVNPSGQHGDENFLLVGMDSRAGANANIGAGDAEDA
GGARSDTVMLVNIPASRERVVAVSFPRDLAITPIQCEAWNPETGKYGPIY
DEKTGTMGPRLVYTETKLNSAFSFGGPKCLVKVIQKLSGLSINRFIAIDF
VGFARMVEALGGVEVCSTTPLRDYELGTVLEHAGRQVIDGPTALNYVRAR
QVTTEGNGDYGRIKRQQLFLSSLLRSMISTDTLFNLGRLNNVVNMFIGNS
YVDNVKTKDLVELGRSLQHMAAGHVTFVTVPTGITDQNGDEPPRTSDMKA
LFTAIIDDDPLPLENDHNAQRLGNTPTTPPTTTKKAPQAGQTNEIQHQQV
TTTSPKEVTVQVSNSTGQAGLATTATDQLRRNGFNVMAPDDYPSSLRATT
VFFSPGNEQAAATVAAAFGQSKIERVTGIGQLVQVVLGQDFSAVRAPLPS
GSTVSVQISRNSSSPPTKLPEDLTVTNAADTTCE
433633871YP_007267498.1 Putative phosphate-transport ATP-binding protein ABC transporter PhMAKRLDLTDVNIYYGSFHAVADVSLAILPRSVTAFIGPSGCGKTTVLRTL
NRMHEVIPGARVEGAVLLDDQDIYAPGIDPVGVRRAIGMVFQRPNPFPAM
SIRNNVVAGLKLQGVRNRKVLDDTAEYSLRGANLWDEVKDRLDKPGGGLS
GGQQQRLCIARAIAVQPDVLLMDEPCSSLDPISTMAIEDLISELKQRYTI
VIVTHNMQQAARVSDQTAFFNLEAVGKPGRLVEIASTEKIFSNPNQKATE
DYISGRFG
433633869YP_007267496.1 GlnR-like transcriptional regulatory protein [Mycobacterium canettiMLELLLLTSELYPDPVLPALSLLPHTVRTAPAEASSLLEAGNADAVLVDA
RNDLSSGRGLCRLLSSTGRSIPVLAVVSEGGLVAVSADWGLDEILLPSTG
PAEIDARLRLVVGRRGDLADQESLGKVSLGELVIDEGTYTARLRGRPLDL
TYKEFELLKYLAQHAGRVFTRAQLLHEVWGYDFFGGTRTVDVHVRRLRAK
LGPEHEALIGTVRNVGYKAVRPARGRPPAVDPDDEDADPGRDGMQEPLVD
PLRSQ
433633867YP_007267494.1 Putative thioredoxin ThiX [Mycobacterium canettii CIPT 140070017]MTTMIVASLATGALATIARWLLTRRSVILREVGPETAPAAPARTAELGLS
GAGPTVVHFSAPGCAPCDRVRRVVGEVCADLGDVAHIEVDLDVNPQAARR
FSVLSLPTTLIFDVDGRQRYRTSGVPKAADLRSALKPLLA
433633865YP_007267492.1 Conserved protein of unknown function SseC2 [Mycobacterium canettiiMLWTPARTDRCPASVDLEKETVITGRVVDGDGQAVGGAFVRLLDSSDEFT
AEVVASATGDFRFFAAPGSWTLRALSAAGNGDAVVQPSGAGIHEVDVKIA
433633863YP_007267490.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MSSGAGSDATGAGGVHAAGSGDRAVAAAVERAKATAARNIPAFDDLPVPA
DTANLREGADLNNALLALLPLVGVWRGEGEGRGPDGDYRFGQQIVVSHDG
GDYLNWESRSWRLTATGDYQEPGLREAGFWRFVADPYDPSESQAIELLLA
HSAGYVELFYGRPRTQSSWELVTDALARSRSGVLVGGAKRLYGIVEGGDL
AYVEERVDADGGLVPHLSARLSRFVG
433633861YP_007267488.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MAAVSAPDPGPDAGAIWHYGDPLGEQRAGQADAVLVDRSHRAVLTLDGGD
RQTWLHSISTQHVSDLPEGASTQNLSLDGQGRVEDHWIQTELGGTTYLDT
EPWRGEPLLAYLRKMVFWSMVTPRAADMAVLSLLGPRLAEQRVLDALGLD
VLPAEWLAVPLAGGGIVRRMPDGLAGQIELDVVVKRGDRADWQRRLTQAG
VRPAGIWAYEAHRVAHRVPARRPRLGVDTDERTIPHEVGWIGGPGAGAVH
LNKGCYRGQETVARVHNLGRPPRMLVLLHLDGSVQRPSTGDAVLAGGRTV
GRLGTVVEHVELGPVALALLKRGLPGDTALVTGPEAEVAAVIDVDSLPPA
DDVGAGRRAVERLRGGIR
433633859YP_007267486.1 Putative phosphoribosylformylglycinamidine cyclo-ligase PurM (AIRS MTDLAKGPGKDPGSRGITYASAGVDIEAGDRAIDLFKPLASKATRPEVRG
GLGGFAGLFTLRGDYREPVLAASSDGVGTKLAIAQAMDKHDTVGLDLVAM
VVDDLVVCGAEPLFLLDYIAVGRIVPERLSAIVAGIADGCMRAGCALLGG
ETAEHPGLIEPDHYDISATGVGVVEADNVLGPDRVKPGDVIIAMGSSGLH
SNGYSLVRKVLLEIDRMNLAGYVEEFGRTLGEELLEPTRIYAKDCLALAA
ETRVRTFCHVTGGGLAGNLQRVIPHGLIAEVDRGTWTPAPVFTMIAQRGR
VRRTEMEKTFNMGVGMIAVVAPEDTTRALAVLTARHLDCWVLGTVCKGGK
QGPRAKLVGQHPRF
433633857YP_007267484.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MSARDRADPAKTRQVVLALADWLRDETLPAPDTDVLAAAVRLTARTLAAL
APGASVEVRIPPFAAVQCISGPRHTRGTPPNVVQTDPRTWLLVATGLSGV
AQARASGALQLSGSRAGEIEAWLPLVDLG
433633855YP_007267482.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MHRLRAAEHPRPDYVLLHISDTHLIGGDRRLYGAVDADDRLGELLEQLNQ
SGLRPDAIVFTGDLADQGEPAAYRKLRGLVEPFAAQLGAELVWVMGNHDD
RAELRKFLLDEAPSMAPLDRVCMIDGLRIIVLDTSVPGHHHGEIRASQLG
WLAEELATPAPDGTILALHHPPIPSVLDMAVTVELRDQAALGRVLRGTDV
RAILAGHLHYSTNATFVGIPVSVASATCYTQDLTVAAGGTRGRDGAQGCN
LVHVYPDTVVHSVIPLGGGETVGTFVSPGQARRKIAESGIFIEPSRRDSL
FKHPPMVLTSSAPRSPVD
433633853YP_007267480.1 Phosphoribosylformylglycinamidine synthase II PurL (FGAM synthase IMLDTVEHAATTPDQPQPYGELGLKDDEYRRIRQILGRRPTDTELAMYSVM
WSEHCSYKSSKVHLRYFGETTSDEMRAAMLAGIGENAGVVDIGDGWAVTF
KVESHNHPSYVEPYQGAATGVGGIVRDIMAMGARPVAVMDQLRFGPADAP
DTRRVLDGVVRGIGGYGNSLGLPNIGGETVFDPCYAGNPLVNALCVGVLR
QEDLHLAFASGAGNKIILFGARTGLDGIGGVSVLASDTFDAEGSRKKLPS
VQVGDPFMEKVLIECCLELYAGGLVIGIQDLGGAGLSCATSELASAGDGG
MTIQLDSVPLRAKEMTPAEVLCSESQERMCAVVSPKNVDAFLAVCRKWEV
LAAVIGEVTDGDRLQITWHGETVVDVPPRTVAHEGPVYQRPVARPDSQDA
LNADRSAKLARPVTGDELRATLLALLGSPHLCSRAFITEQYDRYVRGNTV
LAEHADGGMLRVDESTGRGIAVSTDASGRYTLLDPYAGAQLALAEAYRNV
AVTGATPVAVTNCLNFGSPEDPGVMWQFAQAVRGLADGCAALGIPVTGGN
VSFYNQTGSAAILPTPVVGVLGVIDDVRRRIPTGLGAEPGETLMLLGDTR
DEFDGSVWAQVTADHLGGLPPVVDLAREKLLAAVLSSASRDGLVSAAHDL
SEGGLAQAIVESALAGETGCRIVLPEGADPFVLLFSESAGRVLVAVPRTE
ESRFRGMCEARGLPAVRIGVVDQGSDAVEVQGLFTVSLAELRATSEAVLP
RYFG
433633851YP_007267478.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MVARPDGPRLGFQKVPDPAPGKNRVHVDFTTKDLDAEVLRLVAAGASEVG
RHQVGESFRWVVLADPEGNAFCVAGQ
433633849YP_007267476.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MAVPAVSPQPILAPLTPAAIFLVATIGADGEATVHDALSEISGLVRAIGF
RDPTKHLSVVVSIGSDAWDRLFAGPRPTELHPFVELTGPRHAAPATPGDL
LFHIRAETMDVCFELAGRILKSMGDAVTVVDEVHGFRFFDNRDLLGFVDG
TENPSGPIAIKATTIGDEDRNFAGSCYVHVQKYVHDMASWESLSVTEQER
VIGRTKLDDIELDDNAKPANSHVALNVITDDDGTERKIVRHNMPFGEVGK
GEYGTYFIGYSRTPAVTEQMLRNMFLGDPAGNTDRVLDFSTAVTGGLFFS
PTIDFLDDPPPLPQAATPTLAARSLSIGSLKGSPR
433633847YP_007267474.1 Putative oxidoreductase [Mycobacterium canettii CIPT 140070017]MTAAQQDQTPMATPGCREGETYDVVVLGAGPVGQNVADRARAGGLRVAVV
ERELVGGECSYWACVPSKALLRPVIAISDARRVDGAREAVAGSINTAGVF
GRRNRYVADWDDTGQADWVSGIGATLIRGDGRLDGPRRVVVTKSSGESVA
LTARHAVVICTGSRPALPDLPGIIEARPWTNRQATDNSTVPDRLAIVGAG
GVGVEMATAWQGLGASVTLLARGSGLLPRMEPFVGELIGRGLADAGVDVR
VGVSVRALARPDPTGPVVLELDDGTELRVDEVLFATGRAPRTDDIGLETI
GLTPGSWLDVDDTCRVRAVDDGWLYAAGDVNHRALLTHQGKYQARIAGAA
IGARAAGRPLDTTSWGMHATTADHHAVPQAFFTDPEAAAVGLTADQAAQA
GHRIKAIDVEIGDVVMGARLFADGYTGRARMVVDVDRGHLLGVTMVGPGA
AELLHSATVAVAGQVPIDRLWHAVPCFPTISELWLRLLESYRDSFYLLV
433633845YP_007267472.1 Putative transcriptional regulatory protein (probably GntR-family) MTSVKLDLDAADLRISRGSVPASTQLAEALKAQIIQQRLPRGGRLPSERE
LIDRSGLSRVTVRAAVGMLQRQGWLVRRQGLGTFVADPVEQELTCGVRTI
TEVLLSCGVTPQVDVLSHQTGPAPQRISETLGLVEVLCIRRRIRTGDQPL
ALVTAYLPPGLGPAVEPLLSGGADTETTYAMWERRLGVRIARATHEIHAA
GASPDVADALDLAVGSPVLVVDRTSYTNDGKPLEVVVFHHRPERYQFSVT
LPRTLPGSGAGIIEKRDFT
433633843YP_007267470.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MTLANNGTGMDQFLMPTEYLDAGHPLVRTTAATLIRDAVSDTERVRRIYY
YVRDLPYDVLASFRYLAQGHHRASDVIGHGVAFCMGKASSFVALCRAAGV
PARIAFQTIDAPDKEFLSPQVRALWGGRTGRPFPWHSLGEAYLGRRWVKL
DATIDAPTAARLGKPYRQEFDGATPIPTVEGTILRENGSYADYPSAVAQW
YQRIAQSVLKALQSTEVHALVAADDELWTGPPVELADATHRL
433633841YP_007267468.1 Phosphoribosylformylglycinamidine synthase 1 [Mycobacterium canettiMTARIGVITFPGTLDDVDAARAARQAGAEVVSLWHADADLKGVDAVVVPG
GFSYGDYLRAGAIARFAPVMDEVVAAADRGMPVLGICNGFQVLCEAGLLP
GALTRNVGLHFICRDVWLRVASTSTAWTSRFEPDADLLVPLKSGEGRYVA
PEKVLDELEGEGRVVFRYHDNVNGSLRDIAGICSANGRVVGLMPHPEHAI
EALTGPSDDGLGLFYSALDAVLTA
433633839YP_007267466.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MHRPPWLAQLRRRLRIGVQLGSRVVLEQGRQSRDVYVIGVLVGDQDRGQT
GDSLEAVRESTGIEEQAGLTELSEEAGMAEMRELHVYDCALMGAFPMRLI
LATMLVAGRLLATLMAAPSAQAEPETCPPICDQIPATAWISTHAVPLNSQ
YRWPAMAGAAVAVTRATPRFGFEQVCATPAFPHDSRDWAVAGRVTVVHPD
GQWQLQAQVLHWRGDTARGGQIAASVFGTAVAALRACQLGAPLQSPSVTD
DEPTRMAAVISGPVIMHTYLVAHVSSSTISELTLWSSGPPQVPWPTVADS
AVLDALTAPLCEAYIGSCP
433633837YP_007267464.1 Putative FAD-binding dehydrogenase [Mycobacterium canettii CIPT 140MALTCTDMSDAVAGSDAEGFTADAIVVGAGLAGLVAACELADRGLRVLIL
DQENRANVGGQAFWSFGGLFLVNSPEQRRLGIRDSHELALQDWLGTAAFD
RPEDYWPEQWAHAYVDFAAGEKRSWLRARGLKIFPLVGWAERGGYDAQGH
GNSVPRFHITWGTGPALVDIFVRQLRDRPTVRFAHRHQVDKLIVEGNAVT
GVRGSVLEPSDEPRGAPSSRKSVGKFEFRASAVIVASGGIGGNHELVRKN
WPRRMGRIPKQLLSGVPAHVDGRMIGIAQKAGAAVINPDRMWHYTEGITN
YDPIWPRHGIRIIPGPSSLWLDAAGKRLPVPLFPGFDTLGTLEYITKSGH
DYTWFVLNAKIIEKEFALSGQEQNPDLTGRRLGQLLRSRAHAGPPGPVQA
FIDRGVDFVHANSLRELVAAMNELPDVVPLDYETVAAAVTARDREVVNKY
SKDGQITAIRAARRYRGDRFGRVVAPHRLTDPKAGPLIAVKLHILTRKTL
GGIETDLDARVLKADGTPLAGLYAAGEVAGFGGGGVHGYRALEGTFLGGC
IFSGRAAGRGAAEDIR
433633835YP_007267462.1 Putative multidrug resistance integral membrane efflux protein EmrBMLGNAMVEACPAEGDAPVPITPAGRPRSGQRSYPDRLDVGLLRTAGVCVL
ASVMAHVDVTVVSVAQRTFVADFGSTQAVVAWTMTGYMLALATVIPTAGW
AADRFGTRRLFMGSVLAFTLGSLLCALALNILLLIIFRVLQGFGGGMLTP
VSFAILAREAGPKRLGRVMAVVGIPMLLGPVGGPILGGWLIGAYGWRWIF
LVNLPVGLSALVLAAIVFPRDRPAASENFDYLGLLLLSPGLATFLFGVSS
SPARGTMADRHVLIPVITGLALIAAFVAHSWYRAEHPLIDMRLFQNRAVA
QANMTMTVLSLGLFGSFLLLPSYLQQVLHQSPMQSGVHIIPQGLGAMLAM
PIAGAVMDRRGPAKIVLVGIMLIAAGLGTFAFGVARQADYLPILPTGLAI
MGMGMGCSMMPLSGAAVQTLAPRQIARGSTLISVNQQVGGSIGTALMSVL
LTYQFNHSETIATAKKVALTPESAGRGVAVDPSSLPRQTSFAAQLLHDLS
HAYAVVFVIATALVVSTLIPAAFLPKQQASHRRAPLLSA
433633833YP_007267460.1 Phosphoribosylaminoimidazole-succinocarboxamide synthase PurC (SAICMRPALSDYQHVASGKVREIYRVDDEHLLLVASDRISAYDYVLDSTIPDKG
RVLTAMSAFFFGLVDAPNHLAGPPDDPRVPDEVLGRALVVRRLEMLPVEC
VARGYLTGSGLLDYQATGKVCGIALPPGLVEASRFATPLFTPATKAALGD
HDENISFDRVVEMVGALRANQLRDRTLQTYVQAADHALTRGIIIADTKFE
FGIDRHGNLLLADEIFTPDSSRYWPADDYRAGVVQTSFDKQFVRSWLTGS
ESGWDRGSDRPPPPLPEHIVEATRARYINAYERISELKFDDWIGPGA
433633831YP_007267458.1 Putative cytochrome P450 126 cyp126 [Mycobacterium canettii CIPT 14MTTAAGLSGIDLTDLDNFADGFPHHLFAIHRREAPVFWHRPTEHTPDGEG
FWSVATYAQTLEVLRDPVTYSSVTGGQRRFGGTVLQDLPVAGQVLNMMDD
PRHTRIRRLVSSGLTPRMIRRVEDDLRRRARGLLDGVEPGAPFDFVVEIA
AELPMQMICILLGVPETDRHWLFEAVEPGFDFRGSRRATMPKLNVEDAGS
RLYTYALELIAGKRAEPADDMLSVVANATIDDPDAPALSDAELYLFFHLL
FSAGAETTRNSIAGGLLALAENPDQLQTLRSDFELLPTAIEEIVRWTSPS
PSKRRTASRAVSLGGQPIEAGQKVVVWEGSANRDPSVFDRADEFDITRKP
NPHLGFGQGVHYCLGANLARLELRVLFEELLSRFGSVRVVEPAEWTRSNR
HTGIRHLVVELRGG
433633829YP_007267456.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MYFVGVDLAWAGRNPTGVAAVGADGCLVGVGAARDDASVLAALRPYVVGD
CLVAFDAPLVVTNRTGQRPAEAALNRDFRRFEAGAYPANTEKPEFADGPR
AARLARQLALDMDPLSSATRRAIEVYPHPATVALFRLPRALKYKAKPGRS
VDLLKSELLRLMDGVEGLAQAGVRMQVAGQPDWVSLRRQVTVAQRKSDLR
AAEDPVDAVVCAYVALYAQRRPADVTIYGDFTTGYIVTPSLPADFRSAPD
AARRARARR
433633827YP_007267454.1 Conserved exported protein of unknown function [Mycobacterium canetMMARMPELSRRAVLGLGAGTVLGATSAYAIDMLLQPRTSHAAPAAAIGTN
VPLAPTPALDPAPPAQAAPTMSTGSFVSAARAGKMTNWAIARPPGQTQAL
RPVIALHGLGGSASAVMDGGVEQGLAQAVNAGLPPFAVVSVDGGSSYWHQ
RASGEDAGAMVLNELIPLLDTQQLDTSRVAFLGWSMGGYGALLLGSRLGP
AHTAAICAVSPALWLSAGSVAPGSFDGPDDWSANSVFGLPALRSIPIRVD
CGNSDPFYAATKQFVAQLPHPPAGGFSPGGHNGGFWSAQLPAELTWIAPL
LTG
433633825YP_007267452.1 Putative phosphoribosylamine--glycine ligase PurD (glycinamide riboMRVLVIGSGAREHALLLALGKDPQVSGLIVAPGNAGTARIAEQHDVDITS
AEAVVSLAREVGADMVVIGPEVPLVLGVADAVRAAGIVCFGPGKDAARIE
GSKAFAKDVMAAAGVRTANSEIVDSPAHLDAALDRFGPPAGDPAWVVKDD
RLAAGKGVVVTADRDVARAHGAALLEAGHPVLLESYLDGPEVSLFCVVDR
TVVVPLLPAQDFKRVGEDDTGLNTGGMGAYAPLPWLPDNIYREVVSRIVE
PVAAELVRRGSSFCGLLYVGLAITARGPAVVEFNCRFGDPETQAVLALLE
SPLGQLLHAAATGKLADFGELRWRDGVAVTVVLAAENYPGRPRVGDVVVG
SEAEGVLHAGTTRRDDGAIVSSGGRVLSVVGTGADLSAARAHAYEILSSI
RLPGGHFRSDIGLRAAEGKISV
433633823YP_007267450.1 Putative dehydrogenase/reductase [Mycobacterium canettii CIPT 14007MTAHPETPRLGYIGLGNQGAPMVKRLLDWPGGLTVFDVRVEAMAPFVEGG
ATAAASVSDVAEADIISITVFDDAQVRSVITADNGLATHAKPGTIVAIHS
TISDTTAVDLAEKLKPQGIHIVDAPVSGGAAAAAKGELAVMVGADGEAFQ
RIKEPFSRWASLLIHAGEPGAGTRMKLARNMLTFVSYAAAAEAQRLAEAC
GLDLVALGKVVRHSDSFTGGAGAIMFRNTTAPMEPADPLRPLLEHTRGLG
EKDLSLALALGEVVSVDLPLAQLALQRLAAGLGVPYPDTEPAKET
433633821YP_007267448.1 Putative aldehyde dehydrogenase NAD dependent AldA (aldehyde dehydrMALWGDGNSALLIDGKLSDGRAGTFPTVNPATEEVLGVAADADAEDMGRA
IEAARRAFDSTDWSRNTELRVRCVRQLRDAMQQHVEELRELTISEVGAPR
MLTASAQLEGPVGDLSFAADTAESYPWKQDLGEASPLGIATRRTLAREAV
GVVGAITPWNFPHQINLAKLGLALAAGNTVVLKPAPDTPWCAAALGEIIV
EHTDFPPGVVNIVTSSNHALGAMLAKDPRVDMISFTGSTATGRAVMADAA
ATIKKVFLELGGKSAFVVLDDADLAAASAVSAFSACMHAGQGCAITTRLV
VPRAHYDEAVAIAAATMSSIRPGDPNDPGTVCGPLISARQRDRVQGYLDL
AVAEGGRFACGGARPADREVGFYIEPTVIAGLTNDARVAREEIFGPVLTV
IAHDGDDDAVRIANDSPYGLSGTVYGADPQRAARIASRLRVGTVNVNGGV
WYCADAPFGGYKQSGIGREMGLLGFEEYLEAKLIATAAN
433633819YP_007267446.1 Putative cytochrome P450 123 CYP123 [Mycobacterium canettii CIPT 14MTVRIGDPELVLDPYDYDFHEDPYPYYRRLRDEAPLYRNEERNFWAVSRH
HDVLQGFRDSTALSNAYGVSLDPSSRTSEAYRVMSMLAMDDPAHLRMRTL
VSKGFTPRRIRELEPQVLELARIHLDSALQTESFDFVAEFAGKLPMDVIS
ELMGVPDTDRARIRALADAVLHREDGVADVPPSAMAASIELMRYYADLIA
EFRRRPANNLTSALLAAELDGDRLSDQEIMAFLFLMVIAGNETTTKLLAN
AVYWAAHHPGQLARVFADHSRIPMWVEETLRYDTSSQILARTVAHDLTLY
DTTIPEGEVLLLLPGSANRDDRVFDDPDDYRIGREIGCKLVSFGSGAHFC
LGAHLARMEARVALGELLRRIRNYEVDDDNAVRVHSSNVRGFAHLPISVQ
AR
433633817YP_007267444.1 Lanosterol 14-alpha demethylase [Mycobacterium canettii CIPT 140070MSAVALPRVSGGHDEHGHLEEFRTDPIGLMQRVRDECGDVGTFQLAGKQV
VLLSGAQANEFFFRAGDDDLDQAKAYPFMKPIFGEGVVFDASPERRKEML
HNAALRGEQMKGHAATIEDQVRRMIADWGEAGEIDLLDFFAELTIYTSSA
CLIGKKFRDQLDRRFAKLYHELERGTDPLAYVDPYLPIESFRRRDEARKG
LVALVADIMNGRIANPPTDKSDRDMLDVLIAVKDETGTPRFSADEITGMF
ISMMFAGHHTSSGTASWTLIELMRHRDAYAAVINELDELYGDGRSVSFHA
LRQIPRLENVLKETLRLHPPLIILMRVAKGEFEVQGHRIHEGDLVAASPA
ISNRIPEDFPDPDDFVPARYEQPRQEDLLNRWTWIPFGAGRHRCVGAAFA
IMQIKAIFSVLLREYEFEMAQPPESYRNDHSKMVVQLAQPACVRYRLRSG
TGG
433633815YP_007267442.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MAGYPRDELEDVVHRWLQANRTAERRGDWTLLADFYTDDATYGWNVGPNE
DVMCVGIDEIRDIALGQEMDGLQGWRYPYQRVVIDEKQGEVVGFWKQVAT
DANGAEQEVYGIGGSWFRYAGGGKWNWQRDFFDFGHVSALYLELLKAGKL
SPGMQKRIERAVSGDKVPGYYPLGKTPVPLW
433633813YP_007267440.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MTQTTQSPALIASQSSWRCVQAHDREGWLALMADDVVIEDPIGKSVTNPD
GSGIKGKEAVGAFFDTHIAANRLTVTCEETFPSSSPDEIAHILVLHSEFD
GGFTSEVRGVFTYRVNKAGLITNMRGYWNLDMMAFGNQE
433633811YP_007267438.1 Two component system response sensor kinase membrane associated PhoMARHLRGRLPLRVRLVAATLILVATGLVASGIAVTSMLQHRLTSRIDRVL
LEEAQIWAQITLPLAPDPYPGHNPDRPPSRFYVRVISPDGQSYTALNDNT
AIPAVPANNDVGRHPTTLPSIGGSKTLWRAVSVRASDGYLTTVAIDLADV
RSTVRSLVLLQVGIGSAVLVVLGVAGYAVVRRSLRPLAEFEQTAAAIGAG
QLDRRVPQWHPRTEVGRLSLALNGMLAQIQRAVASAESSAEKARDSEDRM
RQFITDASHELRTPLTTIRGFAELYRQGAARDVGMLLSRIEGEASRMGLL
VDDLLLLARLDAHRPLELRRVDLLALASDAAHDALAMDPKRRITLEVLDG
PGTPEVLGDESRLRQVLRNLVANAIQHTPESADVTVRVGTEGDDAILEVA
DDGPGMSQEDALRVFERFYRADSSRARASDGTGLGLSIVDSLVAAHGGAV
TVTTALGEGCCFRVSLPRVSDVDQLSLTPVVPGPP
433633809YP_007267436.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MNLGQTLVGIATWPARAGLAAADTGLNMAGAAVDMAKQALGDAGGASGST
SMANMLGIDDTIARANRLARLLDDDMPLGRAIAPNGPLDRMLRPGGVVDL
LTQPGGLLDRLTAEGGAMQRALQPGGLADQLLAEDGLIERVLSEDGLADR
LLAEGGLIDKMTAKDGPLEQLADVADTLARLTPGMEALEPAIATLQDAVI
ALTMVVNPLSSIAERIPLPGRRPARRSSSRSVHSQRIVDTE
433633807YP_007267434.1 Protein of unknown function [Mycobacterium canettii CIPT 140070017]MGSNQGGGRKPRPDVVALCLIIITTPPPFDNAPQSTIQALMNGYFSGFS
433633805YP_007267432.1 Transcriptional modulator of MazE/toxin- MazF [Mycobacterium canettMRRGEIWTASARQGYAGKPRPVVIVQDDRFDATDSVTFCPFTTDTTAIPL
LRIPLQPNGTNGLAAPSSIMVDKITTVHRSKLRQRIGKVTTAEMLQIERA
LLVFLGMTG
433633803YP_007267430.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MGVSVENADTLSRVDHLRDVPAAVRFLSCEPLLGPLDGIDLTEIGWVIAG
GESGPRYRPMELS
433633801YP_007267428.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MAAMAGAFCPNTFDTANNHVRTRLACTTAGCTTPASASSNAPAAARACRA
ASSAWAPAAVNQLAYGPAAFAIAADAGPCQAPPANPDVTDPNEAAAACNS
SANPSQAPAAANRGRDPAPRYIRSELVSGGNHAKLTITVLLTPVTNRYSA
SLGAQCEGIGAFVGIALRGLARGLSHQASVCFMRVAGVCHLRIRICAGSR
RELSIPRGRS
433633799YP_007267426.1 Transposase [Mycobacterium canettii CIPT 140070017]MYITRVPNRGSPPAVLLRESFRENGKVKTRTLANLSRWPEHKLDRLDRAL
KGLPPADWDLSEAFEIARSLPHGHVAAVLGTAEKLGIAELIDPTPSRPRN
LVLAMLIGQIIEPGSKLAIARGLRTETATSSLGAVLGVAGADEDDLYDAM
DWALARKDGIETALAARHLADGTLVLYDVSSAAFEGHTCPLGAIGHARDG
VKGRLQIVYGLLCSPAGVPVAIEVFKGNTADPKTLKAQIDKLKTRFGLTN
IALVGDRGMLTSARIRDELRPAHLDWISALRAPQIKTLVEDGALQLTLFD
EQNLFEITHPDYLGERLVCCHNPALAEQRARKRAELLAATENQLQAIAEA
TRRQRRPLRGQDKIGLRVGKVRNKFKMAKHFDIEITDETFSFTRNQQAIA
AEAALDGIYVLRTSLPERALGRDEVVLRYKDLGDVERFFRTLNSELDVRP
IRHRLADRVRAHMFLRMLSYYISWHMKQALAPILFTDNDKPVAAAKRTNP
LAPAQRSNEALNKAARKRTEDDYPVHSFTSLLTDLATICANYIQPTDDLP
PFTKTTTPTPLQRRAFDLLAVSHRHGLP
433633797YP_007267424.1 Methylmalonate-semialdehyde dehydrogenase MmsA (methylmalonic acid MTTQISHFIDGQRTAGQSTRSADVFDPNTGQIQAKVPMAGKSDIDAAVAS
AVEAQKGWAAWNPQRRARVLMRFIELVNDTIDELAELLSREHGKTLADAR
GDVQRGIEVIEFCIGIPHLLKGEYTEGAGPGIDVYSLRQPLGVVAGITPF
NFPAMIPLWKAGPALACGNAVVLKPSERDPSVPVRLAELFTEAGLPPGVF
QVVHGDKEAVDAILHHPDIKAVGFVGSSEIAQYIYATAAATGKRSQCFGG
AKNHMIVMPDADLDQAVDALIGAGYGSAGERCMAISVAVPVGEQTAERLR
ARLIERINNLRVGHSLDPKADYGPLVTEAALARVRDYIGQGVAAGAEIVI
DGRERTSDDLTFGLPEGNANLEGGFFIGPTLFDHVTPDMSIYTDEIFGPV
LCMVRAHDYEEALRLPSEHEYGNGVAVFTRDGDTARDFIARVQVGMVGVN
VPIPVPVAYHTFGGWKRSGFGDLNQHGPASIQFYTKVKTVTSRWPSGIKD
GAEFVIPTMS
433633795YP_007267422.1 Putative 3-hydroxyisobutyrate dehydrogenase MmsB (HIBADH) [MycobactMTAIAFLGLGHMGAPMSANLVGAGHVVRGFDPAPAAAAAAAAAGVTVFGS
APEAVAEADVVITMLPTGAVVRRCYTEVLAAARPATLFIDSSTISVTDAR
EVHALAESHGMLQLDAPVSGGVKGAAAGTLAFMVGGDESALQRARPMLEP
MAGKIIHCGAAGAGQAAKVCNNMVLAVQQIVIGEAFVLAEKLGLSAQSLF
DVITGATGNCWAVHTNCPVPGPVPSSPANNDFKPGFATALMNKDLGLAME
AVASTGAAAPLGSHAAQIYAEFIASDADHGALDFSAVIHTLRARADA
433633793YP_007267420.1 Transposase [Mycobacterium canettii CIPT 140070017]MRPATPLICAFIDEHKERFGVVPICRALAIQGAAIAPRTYWAHRASAPSK
RALWDTTITEILAGYYQPDADGKRPPESLYGSLKMWAHLQRQGIPVARRT
VERIMRHNGWRGVMRARRPPRTTERDPAATRAPDLVGRRWRVGAPNLLEV
ADFTYVALDTGGFGYTAFVVDAYAGLIPGWECSMVKDTGFVERALRHAAA
FRARQGHPFDDTVHHSDAGSQYTAIHYGETLMLEGLIPSIGTVGDALDNA
LCETTIGLYKTECVRPGSPFRTGPIRTVADLENMTSAWVSWYNTSRLMHR
LGRIPPAEAEDEYYARLQAGKHTGHT
433633791YP_007267418.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MRIKPGTVHYDSTEELELLNQLWQLVSLRLNFFTPTKKAVGFRP
433633789YP_007267416.1 Conserved protein of unknown function- probable antitoxin [MycobactMRTTVSISDEILAAAKRRARERGQSLGAVIEDALRREFAAAHVGGARPTV
PVFDGGTGPRRGIDLTSNSALSAVLDEGLELNSRK
433633787YP_007267414.1 Protein of unknown function [Mycobacterium canettii CIPT 140070017]MTKRLPPSPVSLNLISVYPVCLSAPVSLFFFFLFIFYFIFFIF
433633785YP_007267412.1 Membrane protein of unknown function- partial [Mycobacterium canettMLLCCAILFFSPFSQLFLLYFLFFIFLFILILHFCFFFFLLSFFFFILIS
SRFLNPFFSFLIHLFFLFFLPVFSLGLPAFV
433633783YP_007267410.1 Exported protein of unknown function [Mycobacterium canettii CIPT 1MSWVMVSPELVAAAAADLAGIGSAISSANAAAAVNTTGLLTAGADEVSTA
IAALFGAQGQAYQAASAQAAAFYAQFVQALSAGGGAYAAAEAAAVSPLLA
PINAQFVAATGRPLIGNGANGAPGTGANGGPGGWLIGNGGAGGSGAPGAG
AGGNGGAGGLFGSGGAGGAGGDRLRRRRGRRGRRGRRERHAVRRRRCRRC
RRGLHRRRRRGRWGVRGRRKRRHAVRRLPGRCCRVFLEWRLLPAEPAAPC
LVC
433633781YP_007267408.1 Exported protein of unknown function [Mycobacterium canettii CIPT 1MRLGFGGAGGTGGIGGNANGGAGGNGGTGGQLWGSGGVGGEGGAALSVGD
TGGAGGVGGSAGLIGNGGNGGNGGTGANAGSPGTGGAGGLLLGQNGLNGL
P
433633779YP_007267406.1 Protein of unknown function [Mycobacterium canettii CIPT 140070017]MLPTTVVIHTVTAEALGRIGIDAPRIPGSLDVAAHAAIGLLPLVAGCDRR
HRRPVRGARAGRAAQVSLCMTAIRVEPVSSNAVCTGPAAQVGDQSLSPPR
DYAYQALQPDASAPGAPQPTALFGKNGVVVFDAAVYWLLVVYGHRGWSWA
LAR
433633777YP_007267404.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MDAVAATGAAAPLGSHAAEIYAEFAADHAALDFSAVIETLRGS
433633775YP_007267402.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MTRQQLAHLLRRACAVVGDADVLVLGSQSILGSFDENELPPQATASQEAD
IAFVNDPARDKADHVDVAIGEMSDFHRSNGVYAESVHIDTAILPNGWRDR
LVSWTVESSRPAKPRFLEPHDLAVAKLAAGREKDKAFVAALIRSGLLDVG
VIQARVLLLPEETDPRIGQRIAAWLNYYGAGNHSS
433633773YP_007267400.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MPDETGLGADAARAREAALTQHIGVSAETDRAVVPTLRQAYDSLVGGRRR
LGAIGAEIENAVGRQRALGLDTPAGARNFSRFLTTKAHDITRVLAATAAE
SQAGAARLRSLASSYQAVGFGPKPQEPPPDPVPFPPYQPKVWAACRARGQ
DPDKVVRT
433633771YP_007267398.1 Putative transcriptional regulatory protein [Mycobacterium canettiiMASENRDPIAAARANWERSGWGDVSLGMVAVTSVMRAHQILLARVETALR
PYDLSFSRFELLRLLAFSRIGALPITKASDRLQVHVTSVTHAIRRLEADG
LVRRVPHPTDGRTTLVQITELGRSTVEDATVTLNEQVFANVGMGAEESQA
LVSAVETLRRNAGDF
433633769YP_007267396.1 Putative alternative RNA polymerase sigma factor SigL [MycobacteriuMARVSGAAAAEAALMRALYDEHAAVLWRYALRLTGDAAQAEDVVQETLLR
AWQHPEVIGDTARPARAWLFTVARNMIIDERRSARFRNVVGSTDQSGTPE
QSTPDEVNAALDRLLIADALAQLSAEHRAVIQRSYYRGWSTAQIANDLGI
AEGTVKSRLHYAVRALRLTLQELGVTR
433633767YP_007267394.1 Putative adenylate kinase Adk (ATP-AMP transphosphorylase) [MycobacMRVLLLGPPGAGKGTQAVKLAEKLGIPQISTGELFRRNIEEGTKLGVEAK
RYLDAGDLVPSDLTNELVDDRLNNPDAANGFILDGYPRSVEQAKALHEML
ERRGTDIDAVLEFRVSEEVLLERLKGRGRADDTDDVILNRMKVYRDETAP
LLEYYRDQLKTVDAVGTMDEVFARALRALGK
433633765YP_007267392.1 Conserved protein of unknown function- possible S-adenosylmethioninMTQTGSARFEGDSWDLASSVGLTATMVAAARAVAGRAPGALVTDQFAEPL
VRAVGVDFFVRMASGELDPDELAEDEANGLRRFADAMAIRTHYFDNFFLD
ATRAGIQQAVILASGLDSRAYRLRWPTGTIVFEVDQPQVIDFKTTTLAGL
GAAPTTDRRTVAVDLRDDWPTALQKAGFDNAQRTAWIAEGLLGYLSAEAQ
DRLLDQITAQSVPGSQFATEVLRDINRLNEEELRGRMRRLAERFRRHGLD
LDMSGLVYFGDRTDARTYLADHGWRTASASTTDLLAEHGLPPIDGDDAPF
GEVIYVSAELKQKHQDTR
433633763YP_007267390.1 D-xylulose kinase XylB [Mycobacterium canettii CIPT 140070017]MSRDDVTIGIDIGTTAVKAVAADDNGRVTARVRIGHQLAVPAPDRLEHDA
DEAWRRGPLAALDRLVGPDTRALAVAAMVPSLTAVDPAGRPITPGLLYGD
ARGRVPNASVARAQSVPSVGETAEFLRWTSGQAPDATGYWPAPAVANYAL
SGEAVIDYATAVTTLPLFDGTGWNATACADCGVTVDRMPRVETFGVGVGQ
VRGTGAVLAVGAVDALCEQIVAGADRDGDVLVLCGATLIVWTTISAARQV
PGLWTIPHTAPGKSQIGGASNAGGLFLNWVDRVIGPGDPALADPRRVPVW
LPYIRGERTPFHEPDRRAVLDGVDLSQDAASVRRAAYEASGFVVRQLIEL
SGAPVARIVAAGGGTRMQPWMQAIADATGRPVEVSRVAEGAALGAAFLGR
LAAGLESSIADAARWASTDRIVEPSADWAGPTKERYRRFLALSGSKLA
433633761YP_007267388.1 Putative L-fuculose phosphate aldolase FucA (l-fuculose-1-phosphateMNFVDDPQSAVLAAAKDMLRRGLVEGTAGNISARRSDGNVVITPSSVDYA
EMLLDDLVLVDAAGVVLHAKDGRSPSTELNLHLACYRAFDDIGSVIHSHP
VWATMFAVAHEPIPACIDEFAIYCGGDVRCTEYAASGTPEVGRNAVRALE
GRAAALIANHGLVAVGPRPDQVLRVTALVERTAQIVWGARALGGPVPIPE
DVCRNFTGVYGYLRANPL
433633759YP_007267386.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MPRAHDDNWDLASSVGATATMVAAGRALATKDPRGLINDPFAEPLVRAVG
LDFFTKLIDGELDIATTGNLSPGRAQAMIDGIAVRTKYFDDYFRTATDGG
VRQVVILAAGLDARAYRLAWPAGTVVYEIDQPQVIDFKTTTLAGIGAKPT
AIRRTVYIDLRADWPAALQAAGLDSTAPTAWLAEGMLIYLPPDPRTGCST
TAPNSVLRAARSLPNLSRALWISTQAGYEKWRIRFASTAWTSTWRRWCIP
ANAATSSTTCAPRAGTLRAQCGPTYSGAMVCPFPPHTTTIRSAKSSSSEV
V
433633757YP_007267384.1 Putative protease IV SppA (Endopeptidase IV) (Signal Peptide PeptidMVAFLPSIPGVEDLRSLVGRVDTARHHGVPNGCVLEFNLRSVPPETTGFD
PLTVLTGGGRPMALRDAVAAIHRAAEDPRVAGLIARVQLPPSPAGAVQEL
REAIAAFSAVKPSLAWAETYPGTLSYYLASAFGEVWMQPSGSVGLVGFAT
NATFLRDALHKAGIEAQFVARGEYKSAANLFTEDGFTDAHREAVTRMLDS
LQDQVWQAVAKSRNIDVDALDELADRAPLLRDDAVTCGLIDRIGFRDQAY
ARMAELVGVEKGSPESSGSQTSPDEKPPRMYLARYASSARPRLTPPVPSI
PGRRPKPTIAVVTLEGPIVNGRGGPQLLPLGPSSAGGDTIAAALREVAAD
DSVSAIVLRVDSPGGSVTASETIWREVARARDRGKPVVASMGAVAASGGY
YVSMGADAIVANPGTITGSIGVITGKLVVRDLKDRLGVGSDAVRTNANAD
AWSIDAPFTPDQQAHREAEADLFYSDFVERVAEGRKMTTDAVDVVARGRV
WTGADALDRGLVDELGGLRTAVRRAKVLAGLDEDTEVRIVSYPGSSLWDM
VRPRPSSRPAAASLPDAVGALLARSIVGIVEQVEQTLGGASVLWLGESRL
433633755YP_007267382.1 Putative 50S ribosomal protein L30 RpmD [Mycobacterium canettii CIPMSQLKITQVRSTIGARWKQRESLRTLGLRRIRHSVIREDNAATRGLIAVV
RHLVEVEPAQTGGKT
433633753YP_007267380.1 Putative 50S ribosomal protein L18 RplR [Mycobacterium canettii CIPMAQSVSATRRISRLRRHTRLRKKLSGTAERPRLVVHRSARHIHVQLVNDL
NGTTVAAASSIEADVRGVPGDKKARSVRVGQLIAERAKAAGIDTVVFDRG
GYTYGGRIAALADAARENGLSF
433633751YP_007267378.1 Putative 30s ribosomal protein S8 RpsH [Mycobacterium canettii CIPTMTMTDPIADFLTRLRNANSAYHDEVSLPHSKLKANIAQILKNEGYISDFR
TEDARVGKSLVIQLKYGPSRERSIAGLRRVSKPGLRVYAKSTNLPRVLGG
LGVAIISTSSGLLTDRQAARQGVGGEVLAYVW
433633749YP_007267376.1 Putative 50S ribosomal protein L5 RplE [Mycobacterium canettii CIPTMTTAQKVQPRLKERYRSEIRDALRKQFGYGNVMQIPTVTKVVVNMGVGEA
ARDAKLINGAVNDLALITGQKPEVRRARKSIAQFKLREGMPVGVRVTLRG
DRMWEFLDRLTSIALPRIRDFRGLSPKQFDGVGNYTFGLAEQAVFHEVDV
DKIDRVRGMDINVVTSAATDDEGRALLRALGFPFKEN
433633747YP_007267374.1 Putative 50S ribosomal protein L14 RplN [Mycobacterium canettii CIPMIQQESRLKVADNTGAKEILCIRVLGGSSRRYAGIGDVIVATVKDAIPGG
NVKRGDVVKAVVVRTVKERRRPDGSYIKFDENAAVIIKPDNDPRGTRIFG
PVGRELREKRFMKIISLAPEVL
433633745YP_007267372.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MLTELVDLPGGSFRMGSTSFYPEEAPIHTVTVRAFAVERHPVTNAQFAEF
VSATGYVTIAEQPLDPGLYPGVDAADLCPGAMVFCPTAGPVDLRDWRQWW
DWVPGACWRHPFGRDSDIADRAGHPVVQVAYPDAVAYARWAGRRLPTEAE
WEYAARGGTTATYAWGDQEKPGGMLMANTWQGRFPYRNDGALGWVGTSPV
GTFPANGFGLLDMIGNVWEWTTTEFYPHHRIDPPSTACCAPVKLATAADP
TISQTLKGGSHLCAPEYCHRYRPAARSPQSQDTATTHIGFRCVADPVSG
433633743YP_007267370.1 Putative 30s ribosomal protein S17 RpsQ [Mycobacterium canettii CIPMMAEAKTGAKAAPRVAKAAKAAPKKAAPNDAEAIGAANAANVKGPKHTPR
TPKPRGRRKTRIGYVVSDKMQKTIVVELEDRMRHPLYGKIIRTTKKVKAH
DEDSVAGIGDRVSLMETRPLSATKRWRLVEILEKAK
433633741YP_007267368.1 Putative 50s ribosomal protein L16 RplP [Mycobacterium canettii CIPMLIPRKVKHRKQHHPRQRGIASGGTTVNFGDYGIQALEHAYVTNRQIESA
RIAINRHIKRGGKVWINIFPDRPLTKKPAETRMGSGKGSPEWWVANVKPG
RVLFELSYPNEGVARAALTRAIHKLPIKARIITREEQF
433633739YP_007267366.1 Putative 50S ribosomal protein L22 RplV [Mycobacterium canettii CIPMTAATKATEYPSAVAKARFVRVSPRKARRVIDLVRGRSVSDALDILRWAP
QAASGPVAKVIASAAANAQNNGGLDPATLVVATVYADQGPTAKRIRPRAQ
GRAFRIRRRTSHITVVVESRPAKDQRSAKSSRARRTEASKAASKVGATAP
AKKAAAKAPAKKAPASSGVKKTPAKKAPAKKAPAKASETSAAKGGSD
433633737YP_007267364.1 Putative 50s ribosomal protein L2 RplB [Mycobacterium canettii CIPTMAIRKYKPTTPGRRGASVSDFAEITRSTPEKSLVRPLHGRGGRNAHGRIT
TRHKGGGHKRAYRMIDFRRNDKDGVNAKVAHIEYDPNRTARIALLHYLDG
EKRYIIAPNGLSQGDVVESGANADIKPGNNLPLRNIPAGTLIHAVELRPG
GGAKLARSAGSSIQLLGKEASYASLRMPSGEIRRVDVRCRATVGEVGNAE
QANINWGKAGRMRWKGKRPSVRGVVMNPVDHPHGGGEGKTSGGRHPVSPW
GKPEGRTRNANKSSNKFIVRRRRTGKKHSR
433633735YP_007267362.1 Putative 50S ribosomal protein L4 RplD [Mycobacterium canettii CIPTMAAQEQKTLKIDVKTPAGKVDGAIELPAELFDVPANIALMHQVVTAQRAA
ARQGTHSTKTRGEVSGGGRKPYRQKGTGRARQGSTRAPQFTGGGVVHGPK
PRDYSQRTPKKMIAAALRGALSDRARNGRIHAVTELVEGQNPSTKSARAF
LASLTERKQVLVVIGRSDEAGAKSVRNLPGVHILAPDQLNTYDVLRADDV
VFSVEALNAYIAANTTTSEEVSA
433633733YP_007267360.1 30s ribosomal protein S10 RpsJ (transcription antitermination factoMAGQKIRIRLKAYDHEAIDASARKIVETVVRTGASVVGPVPLPTEKNVYC
VIRSPHKYKDSREHFEMRTHKRLIDIIDPTPKTVDALMRIDLPASVDVNI
Q
433633731YP_007267358.1 Transposase [Mycobacterium canettii CIPT 140070017]MICAFIDERREEFGVVPICRALAVHGVQIAPRTYWAHRSAAPSKRALWDT
TITEILAGIYEPDAQGKRPPESLYGSLKMWAHLRRQGIPVARCTVERIMR
YHNWRGVVRATKVRTTIADPAAERAPDLVKRRFKAVRPDVLWVADFTYVQ
LVCGRFVYTAFVIDVYAGVIVGWECSNSKHAGFVESALRQAAALRRRQGH
ALAGGTIHHSDAGSQYTAIHFGETLMIEGLVPSIGTVGDALDNALCETTI
GLYKTECVREGSPFRNGPLTTVADVESITSAWVHWYNTARLMHRLDRRPP
AEVEAEYYAQQPIGQHTGHT
433633729YP_007267356.1 Putative membrane sugar transferase [Mycobacterium canettii CIPT 14MTATRLPDGFAVQVDRRVRVLGDGSALLGGSPTRLLRLAPAARGLLCDGR
LKVRDEVSAELARILLDATVAHPRPPSGPSHRDVTVVIPVRNNASGLRRL
VTSLRGLRVIVVDDGSACPVVSDDFVGAHCDIEVLHHPRSKGPAAARNTG
LAACTTDFVAFLDSDVTPRRGWLESLLGHFCDPTVALVAPRIVSLAEGEN
PVARYEALHSSLDLGQREAPVLPHSTVSYVPSAAIVCRSSAIRDVGGFDE
TMHCGEDVDLCWRLIEAGARLRYEPIALVAHDHRTQLRDWIARKAFYGGS
AAPLAVRHPDKTAPLVISGGALMAWILMSIGTGLGRLASLVIAVLTGRRI
ARAMRCAETSFLDVLAVATRGLWAAALQLASAICRHYWPLALLAAILSRH
CRRVVLIAAVVDGVVDWLRRREGADDDAEPIGPLTYLVLKRVDDLAYGAG
LWYGVVRERNIGALKPQIRT
433633727YP_007267354.1 Putative L-lactate dehydrogenase (cytochrome) LldD1 [Mycobacterium MAEAWFETVAIAQQRAKRRLPKSVYSSLIAASEKGITVADNVAAFSELGF
APHVIGATDKRDLSTTVMGQEVSLPVIISPTGVQAVDPGGEVAVARAAAA
RGTVMGLSSFASKPIEEVIAANPKTFFQVYWQGGRDALAERVERARQAGA
VGLVVTTDWTFSHGRDWGSPKIPEEMNLKTILRLSPEAITRPRWLWKFAK
TLRPPDLRVPNQGRRGEPGPPFFAAYGEWMATPPPTWEDIGWLRELWGGP
FMLKGVMRVDDAKRAVDAGVSAISVSNHGGNNLDGTPASIRALPAVSAAV
GDQVEVLLDGGIRRGSDVVKAVALGARAVMIGRAYLWGLAANGQAGVENV
LDILRGGIDSALMGLGHASVHDLSPADILVPTGFIRDLGVPSRRDV
433633725YP_007267352.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MWGLLTVPAPAQARRADSSEFDPDRGWRLHPQVAVRPEPFGALLYHFGTR
KLSFLKNRTILAVVQTLADYPDIRSACRGAGVDDCDQGPYLHALSVLAGS
NMLVPRQTT
433633723YP_007267350.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MTGTEHLVHTLRSQGRVCTSSSSPMYRELLELVAADVESGGVFASILADQ
KGAPEGQAVPLRLLGGLHRMVLDGRAPVLRRWYPSTGGTWQAEAAWPDIV
RTATDQPESLRAALDRPPQTNEVGRSAALIGGLLIACLQFDLPIRLFEIG
SSAGLNLRPDRYRYRYLGGEWGLADSPVRIDNAWLGELPPTATVRIVERH
GYDIAPIDVTSPDGELNALSYIWPDQTDRLERLRGAIAVARNIPADLHRQ
AAHAAVAGMTLTDDALTVLWHSITWQYLPADERAAIRAGIDALAAQADAH
CPFVHLTLEPAHQRPGAQIKYLVRMRSWPGGHARVLGECHPHGHR
433633721YP_007267348.1 Putative ferredoxin reductase [Mycobacterium canettii CIPT 14007001MNAHVTSREGVNEFDDGIVIVGGGLAAARTAEQLRRAGYSGRLTIVSDEV
HLPYDRPPLSKEVLRSEVDDVALKPREFYDEKDIALRLGSAAVSLDTGEQ
TVTLADGTVLGYDELVIATGLVPRRIPSLPDLDGIRVLRSFDESMALRKH
ASAARHAVVVGAGFIGCEVAASLRGLGVDVVLVEPQPAPLASVLGEQIGQ
LVTRLHRDEGVDVRTGVTVAEVRGKGHVDAVVLTDGTELPADLVVVGIGS
TPATEWLEGSGVEVDNGVICDKAGRTSAPNVWALGDVASWRDPMGHQARV
EHWSNVADQARVVVPAMLGTDVPTGVVVPYFWSDQYDVKIQCLGEPHATD
VVHLVEDDGRKFLAYYERDGVLVGVVGGGMAGKVMKVRGKIAAGAPIAEV
LDQTQA
433633719YP_007267346.1 Conserved membrane protein of unknown function [Mycobacterium canetMLARYIKMQLLVLLCGGLVGPIFLVVYFTLGLGSLMSWMFYVGLIITVAD
VLVALALTNYGAKTAAKTAALERSGVLALAQITGLSETGTRINDQPLVKV
HLHISGPGITPFDTEDRVIASVTRLGNLTARKLVVLVNPATQQYLIDWER
SALVNGLVPAQFTVAEDNKTYDLSGQTGPLMEILQILKANNVPLNRMVDI
RSNPALRQQVQAVVRRAAERQAPAAEPASQGSIAERLAELESLRASGAVN
AAEYESKRAQIISEI
433633717YP_007267344.1 Putative elongation factor G FusA1 (EF-G) [Mycobacterium canettii CMAQKDVLTDLSRVRNFGIMAHIDAGKTTTTERILYYTGINYKIGEVHDGA
ATMDWMEQEQERGITITSAATTTFWKDNQLNIIDTPGHVDFTVEVERNLR
VLDGAVAVFDGKEGVEPQSEQVWRQADKYDVPRICFVNKMDKIGADFYFS
VRTMGERLGANAVPIQLPVGAEADFEGVVDLVEMNAKVWRGETKLGETYD
TVEIPADLAEQAEEYRTKLLEVVAESDEHLLEKYLGGEELTVDEIKGAIR
KLTIASEIYPVLCGSAFKNKGVQPMLDAVVDYLPSPLDVPPAIGHAPAKE
DEEVVRKATTDEPFAALAFKIATHPFFGKLTYIRVYSGTVESGSQVINAT
KGKKERLGKLFQMHSNKENPVDRASAGHIYAVIGLKDTTTGDTLSDPNQQ
IVLESMTFPDPVIEVAIEPKTKSDQEKLSLSIQKLAEEDPTFKVHLDSET
GQTVIGGMGELHLDILVDRMRREFKVEANVGKPQVAYKETIKRLVQNVEY
THKKQTGGSGQFAKVIINLEPFTGEEGATYEFESKVTGGRIPREYIPSVD
AGAQDAMQYGVLAGYPLVNLKVTLLDGAYHEVDSSEMAFKIAGSQVLKKA
AALAQPVILEPIMAVEVTTPEDYMGDVIGDLNSRRGQIQAMEERAGARVV
RAHVPLSEMFGYVGDLRSKTQGRANYSMVFDSYSEVPANVSKEIIAKATG
E
433633715YP_007267342.1 Putative 30s ribosomal protein S12 RpsL [Mycobacterium canettii CIPMPTIQQLVRKGRRDKISKVKTAALKGSPQRRGVCTRVYTTTPKKPNSALR
KVARVKLTSQVEVTAYIPGEGHNLQEHSMVLVRGGRVKDLPGVRYKIIRG
SLDTQGVKNRKQARSRYGAKKEKG
433633713YP_007267340.1 Conserved membrane protein of unknown function [Mycobacterium canetMKWNTVAASLAAGVITIAVALAAPPPAAHAKNGDTHVTGQGIERTLDCNE
STLLVNGTQNIVTALGTCWAVTVMGSSNTVVADTIINDITVYGWDETVFF
RNGDPFIWDRGRELGMVNRLQRVG
433633711YP_007267338.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MSANGGVDRVGAEPDIMEFVEQMGGYFESRSLTRLAGRLLGWLLVCDPER
QSSEELATALAASSGGISTNARMLIQFGFIERLAVAGDRRTYFRLRPNAF
AAGERERIRAMAELQNLADVGLRALGDAPPHRSRRLREMRDLLAYMEKVV
SDALGRYSQRTGEDD
433633709YP_007267336.1 Putative conserved transmembrane transport protein MmpL5 [MycobacteMIVRRTAAPTGSVPPGRPAARPFIPRMIRTFAVPIILGWLVTIAVLNVTV
PQLEAVGQMQAVSMSPDAAPSMISMKHIGKVFAEGDSDSAAMIVLEGQRP
LGDAAHAFYDQMIGRLQADTTHVQSLQDFWGDPLTATGAQSGDGKAAYVQ
VKLAGNQGESLANESVEAVKTIVERLAPPPGVKVYVTGSAALVADQQQAG
DRSLQVIEVVTFTVIIVMLLLVYRSIITSAIMLTMVVLGLLATRGGVAFL
GFHRIIGLSTFATNLLVVLAIAAATDYAIFLIGRYQEARGLGQDRESAYY
TMFGGTAHVVLGSGLTIAGATFCLSFTRLPYFQTLGVPLAIGMVIVVTAA
LTLGPAIIAVTSRFGKLLEPKRMARVRGWRKVGAAIVRWPGPILVGAVAL
ALVGLLTLPGYRTNYNDRNYLPADLPANEGYAAAERHFSQARMNPEVLMV
ESDHDMRNSADFLVINKIAKAIFAVEGISRVQAITRPDGKPIEHTSIPFL
ISMQGTSQKLTEKYNQDLTARMLEQVNDIQSNIDQMERMHSLTQQMADVT
HEMVIQMTGMVVDVEELRNHIADFDDFFRPIRSYFYWEKHCYDIPVCWSL
RSVFDTLDGIDVMTEDINNLLPLMRRLDTLMPQLTAMMPEMIQTMKSMKA
QMLSMHSTQEGLQDQMAAMQEDSAAMGEAFDASRNDDSFYLPPEVFDNPD
FQRGLEQFLSPDGHAVRFIISHEGDPMSQAGIARIAKIKTAAKEAIKGTP
LEGSAIYLGGTAAMFKDLSDGNTYDLMIAGISALCLIFIIMLIITRSVVA
AAVIVGTVVLSLGASFGLSVLIWQHILGIELHWLVLAMAVIILLAVGADY
NLLLVARLKEEIHAGINTGIIRAMGGSGSVVTAAGLVFAFTMMSFAVSEL
TVMAQVGTTIGMGLLFDTLIVRSFMTPSIAALLGKWFWWPQVVRQRPVPQ
PWPSPASARTFALV
433633707YP_007267334.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MPAMTARSVVLSVLLGAHPAWATASELIQLTADFGIKETTLRVALTRMVG
AGDLVRSADGYRLSDRLLARQRRQDEAMRPRTRAWHGNWHMLIVTSIGTD
ARTRAALRTCMHHKRFGELREGVWMRPDNLDLDLESDVAARVRMLTARDE
APADLAGQLWDLSGWTEAGHRLLGDMAAATDMPGRFVVAAAMVRHLLTDP
MLPAELLPADWPGAGLRAAYHDFATAMAKRRDRTQLLEVT
433633705YP_007267332.1 Putative acyl-CoA dehydrogenase FadE8 [Mycobacterium canettii CIPT MRDTHVVTNQVPPLENYNPASSAVLVEALIREGGQWGLDEVNEVGALSGS
ARALRWGELADRNRPILHTHDAYGYRVDEVEYDPAYHELMRTAITHGMHA
APWADDRPGAHVVRAAKTSVWTVEPGHICPISMTYAVVPALRHNPELAAL
YEPLLTSREYDPELKPATTKAGITAGMSMTEKQGGSDVRAGTTQATPNAD
GSYSLTGHKWFTSAPMCDIFLVLAQAPGGLSCFLLPRVLPDGTRNRMFLQ
RLKDKLGNHANASSEVEYDGAVAWLVGEEGRGVPTIIEMVNLTRLDCTLG
SATSMRTGLIRAVHHAQHRKAFGAYLIDQPLMRNVLADLAVEAEAATIVA
MRMAGATDNAVRGDETEALLRRIGLAAAKYWVCKRSTGHAAEALECLGGN
GYVEDSGMPRLYREAPLMGIWEGSGNVSALDTLRAMATRPECVEVLFAEL
ARSAGQDPRLDGHVERLRPQLGDLDTIAYRARKIAEDICLALQGSLLVRH
GHPAVAEAFLATRLGGQWGGAYGTMPAGLDLAPILERALVKG
433633703YP_007267330.1 Putative hydrolase [Mycobacterium canettii CIPT 140070017]MLCVGRGIADITGESADCGMLGYGKSDQRTAGIHMRLRSRAFVFQDDSPG
GSARLLLVVADLPLPMHNVTTEVLRRLAALYGDSYSEQNTMITTTHTHAG
PGGYCGHLVYNLSTSGFRPATFAAIVEGIVESVQHAHDDVAPAEVTLSHG
ELHGASINRSPSAFDRNPASDREFFPDRIDPHTTLVRIDRGEATVAAIHF
FATHGTSMTNRNRLISGDNKGFAAYHWERTVAGADYLGGQPDLIAAFAQT
NPGDMSPHVDGPITGASIPERELENTRRIGLCQFEDAVGLLGSATPIGPG
IDARLTYVDLSSVLVRGEYTPDGQEHRTGRPIFAAAAMAGTDEGEGFRGF
RQGRNPFWDKLSGAIYWLAKPVGAVHAPKGLVVPAFLLNRIQPFVQEIVP
VQLVRLGRLYLIGIPGEPTIVAGLRLRRTVASIVGADLADVLCVGYSNAY
IHYVTTPEEYVEQRYEGGSTLFGRWELPALMQTVAGLAEAMRDGRPAPPG
PRPRPFDPLSWLRAAPADTGSFGTVIVEPATAYRPGATAEAEFVSALPNN
DLRRGASYVEVVRADGAGWVRVADDGDWATSFRWRRHGRSGSRVSIRWDI
PDDATPGRYRIVHHGAARERNGGLQAFTATTREFTVG
433633701YP_007267328.1 DNA-directed RNA polymerase (beta chain) RpoB (transcriptase beta cMADSRQSKTAASPSPSRPQSFSNNSVPGAPNRVSFAKLREPLEVPGLLDV
QTDSFEWLIGSPRWRESAAERGDVNPVGGLEEVLYELSPIEDFSGSMSLS
FSDPRFDDVKAPVDECKDKDMTYAAPLFVTAEFINNNTGEIKSQTVFMGD
FPMMTEKGTFIINGTERVVVSQLVRSPGVYFDETIDKSTDKTLHSVKVIP
SRGAWLEFDVDKRDTVGVRIDRKRRQPVTVLLKALGWTSEQIVERFGFSE
IMRSTLEKDNTVGTDEALLDIYRKLRPGEPPTKESAQTLLENLFFKEKRY
DLARVGRYKVNKKLGLHVGEPITSSTLTEEDVVATIEYLVRLHEGQTTMT
VPGGVEVPVETDDIDHFGNRRLRTVGELIQNQIRVGMSRMERVVRERMTT
QDVEAITPQTLINIRPVVAAIKEFFGTSQLSQFMDQNNPLSGLTHKRRLS
ALGPGGLSRERAGLEVRDVHPSHYGRMCPIETPEGPNIGLIGSLSVYARV
NPFGFIETPYRKVVDGVVSDEIVYLTADEEDRHVVAQANSPIDADGRFVE
PRVLVRRKAGEVEYVPSSEVDYMDVSPRQMVSVATAMIPFLEHDDANRAL
MGANMQRQAVPLVRSEAPLVGTGMELRAAIDAGDVVVAEESGVIEEVSAD
YITVMHDNGTRRTYRMRKFARSNHGTCANQCPIVDAGDRVEAGQVIADGP
CTDDGEMALGKNLLVAIMPWEGHNYEDAIILSNRLVEEDVLTSIHIEEHE
IDARDTKLGAEEITRDIPNISDEVLADLDERGIVRIGAEVRDGDILVGKV
TPKGETELTPEERLLRAIFGEKAREVRDTSLKVPHGESGKVIGIRVFSRE
DEDELPAGVNELVRVYVAQKRKISDGDKLAGRHGNKGVIGKILPVEDMPF
LADGTPVDIILNTHGVPRRMNIGQILETHLGWCAHSGWKVDAAKGVPDWA
ARLPDELLEAQPNAIVSTPVFDGAQEAELQGLLSATLPNRDGDVLVDADG
KAMLFDGRSGEPFPYPVTVGYMYIMKLHHLVDDKIHARSTGPYSMITQQP
LGGKAQFGGQRFGEMECWAMQAYGAAYTLQELLTIKSDDTVGRVKVYEAI
VKGENIPEPGIPESFKVLLKELQSLCLNVEVLSSDGAAIELREGEDEDLE
RAAANLGINLSRNESASVEDLA
433633699YP_007267326.1 Putative arylsulfatase AtsD (aryl-sulfate sulphohydrolase) (arylsulMPQPRTHLPIPSAARTGLITYDAKDPDSTYPPIEQLRPPAGAPNVLLILL
DDVGFGASSAFGGPCRTPTAELLAGNGLRYNRFHTTALCSPTRQALLTGR
NHHSAGMGGITEIATGAPGYSSVLPNTMSPIARTLKLNGYNTAQFGKCHE
VPVWQTSPVGPFDAWPSAGGGFEYFYGFIGGEANQWYPSLYEGTTPVEVN
RTPEEGYHFMADMTDKALGWIGQQKALAPDRPFFVYFAPGATHAPHHVPR
EWADKYRGRFDAGWDALREETFARQKELGVIPADCRLTARHAEIPAWDDM
PEDLKPVLCRQMEVYAGFLEYTDHHVGRLVDGLQRLGVLDDTLVFYIIGD
NGASAEGTINGTYNEMLNFNGMADIETPRFMRERLDKFGGPESYNHYSVG
WAHAMDTPYQWTKQVASHWGGTRNGTIVHWPNGIAAKGEMRWQFHHVIDV
APTILEAAGLPEPLFVNGVQQHPIEGVSMAYSFDDAQAPDRHETQYFEMF
GNRGIYHKGWTAVTKHKTPWLLVGEQTVAFDDDVWELYDTTKDWSQAKDL
AKEMPEKLHELQRLWLIEATRYNVLPLDDDTASRINPDLAGRPVLIRGNT
QVLFSNMGRLSENCVLNLKNKSHSVTAEIEVPETGAEGVIVAQGASIGGW
SLYANDGKLKYCYNLGGIKHFYAESADPLPAGPHQVRMEFAYAGGGLGKG
GEVTLYVDGQQVGDGHVEATLAIVFSADDGCDVGMDSGSPVSPDYAPGSN
AFNGRVKGVQLAIAEAAAAAGHLVDPEHAIRIALARQ
433633697YP_007267324.1 Conserved protein of unknown function- possible antitoxin [MycobactMTMLSFRADDRDVDLADAWARRLRIGRSELLRDALRRHLAALAADQDVQA
YTDRPLTDDENALAEIADWGPAEDWADWADAAR
433633695YP_007267322.1 Conserved membrane protein of unknown function [Mycobacterium canetMEAGRADTVAPTHRWGLGAFLVVELVFLVASTSLAVVLTGHGPVSAGVLA
LALAAPTVVAAGLAILITRLRGNGPRTDLRLRWSWRGLRLGLMFGFGGML
VTMPASLVYTAIVGPKANSAVVRIFGGVRASWPWALVVFLVVVFVAPLCE
EIVYRGLLWGAVDRRWGRWAALVVTTVVFALAHLEFARAPLLVVVTIPIA
LARFYSGGLLASIVTHQVTNLLPGIVLLLGLTGAISLP
433633693YP_007267320.1 Conserved protein of unknown function- possible toxin VapC6 [MycobaMIYFLVDSSAVWRLQRQPELTEAWNSALLSGAVGSCEPQRAEFRRSARNA
DEFDQMSRMFGDVYPDVPVPKSVWRWIDSAQHRLARAGAVRALSVVDLLI
CGTAAARGLVVLHDDADYELAERHLPDIRVRRVVSADD
433633691YP_007267318.1 Putative dioxygenase [Mycobacterium canettii CIPT 140070017]MTAAQAAESQNPYLEGFLAPVSTEVTATDLPVTGRIPEHLDGRYLRNGPN
PAAEVDPATYHWFTGDAMVHGVALRDGKARWYRNRWVRTPAVCAALGEPI
SARPHPRTGIIEGGPNTNVLTHAGRTLALVEAGVVNYELTDELDTVGPCD
FDGTLHGGYTAHPQRDPHTGELHAVSYSFARGRRVQYSVIGTNGHARRTV
DIEVAGSPMMHSFSLTDNYVVIYDLPVTFDPMQVVPASVPRWLRRPARLV
IQSVLGRVRIPDPIAALGNRMQGHSDRLPYAWNPSYPARVGVMPREGGNE
DVRWFDIEPCYVYHPLNAYSECRNGSEVLVLDVVRYSRMFDRDRRGPGGD
SRPSLDRWTINLATGAVTAECRDDRAQEFPRINETLAGGPHRFAYTVGIE
GGFLVGAGAALSTPLYKQDCVTGSSTVASLDPDLLIGEMAFVPNPSARAE
DDGILMGYGWHRGRDEGQLLLLDAQTLESIATVHLPQRVPMGFHGNWAPT
T
433633689YP_007267316.1 Putative 50s ribosomal protein l7/l12 RplL (SA1) [Mycobacterium canMAKLSTDELLDAFKEMTLLELSDFVKKFEETFEVTAAAPVAVAAAGAAPA
GAAVEAAEEQSEFDVILEAAGDKKIGVIKVVREIVSGLGLKEAKDLVDGA
PKPLLEKVAKEAADEAKAKLEAAGATVTVK
433633687YP_007267314.1 Putative glucokinase [Mycobacterium canettii CIPT 140070017]MLTLCLDIGGTKIAAGLADPGGVLVHTATRPTPAHGGAEQVWAAVAEMIA
DALGVAGGAVGGVGIASAGPVDLHSGRVSPLNIGSWRGFPLLNRVVAAVP
GVPVRLGGDGVCMALGEHWLGAGRGARFLLGMVVSTGVGGGLVLDGVPYF
GRTGNAGHVGHVVVDPDGSTCPCGGRGCVETMASGPSMARWARANGWSAP
SRVGAKELAEAAMAGDTVALRAFRRGARALAATIASVGATCDLDLVVIGG
GVAKAGRLLFDPLRAALSDYARLDFLAGLRVVPAELGGDAGLVGAARLAA
IA
433633685YP_007267312.1 Alpha-mannosidase [Mycobacterium canettii CIPT 140070017]MMGGTYNEPNTNLTSPETTIRNLVHGIGFQRDVLGAEPATAWQLDVFGHD
PQFPGMAADAGLTSSSWARGPHHQWGPAQGGVDRMQFCSEFEWIAPSGRG
LLTHYMPAHYSAGWWMDSSTSLADAEAATYALFDQLKKVALTRNVLLPVG
TDYTPPNKWVTAIHRDWGARYTWPRFVCALPKEFFAAVRAELADRGWAAS
PQTRDMNPIYTGKDVSYIDTKQANRAAENAVLEAERFAVFAALLTGAEYP
QAALAKAWVQLAYGAHHDAITGSESDQVYLDLLTGWRDAWELGRAARDNS
LALLSGAVTGADDSVVVWNPLTQRRTDIVTARVDPPLQAGVRVFDPDGAE
VAALVEHDGRSVTWLACDVPSLGWRVYRLVPADEAPGWELVPGTDIANEH
YRLAVDPERGGAVSSLVHDGRQLIAAGRVANELALYEEYPSHPTQGEGPW
HLLPKGPVVRSSSAPAAVWAYRGPLGQRLVVRGRIGTLLRYTQTLTLWDG
VDRVDCRTTIDEFTGEDRLLRLRWPCPVPGAMPISEVGDAVVGRGFALLH
EGPASVDTAQHPWTLDNPAYGWFGLSSAVRVRAGNEVRAVSVAEVVSPSE
TSSGPMARDLMVALVRAGVTATCSGADKPRYGHLDVDSNLPDARIALGGP
ARNTFTKAVLAEADPVYTAELQRQLAKTGTARVWVPAANPLVRAWLPGAD
LRAPCALPVLVIDGRDEQHLSAAVASLADDLADAEIVVHQRAAPRMEPFE
DRTVAMLNRGVPSFAVDTEGTLHTALMRSCTGWPSGVWIDQPRRTAPDGS
NFQLQHWTHDFDYALVCGVGDWRRAAIPARSAQFSHPLLAVTPRERHGKL
PTVGSLLHVEPADSVRLGALKAAGNPLATGSARPVQPAAVALRLVETIGA
DADATIGCQLGEVRALQLADLLETPIQRKRSIDLHGYRIATVLARLDTAT
VLAADGVPLAPHAETAQPLYARYWLHNRGPAPVGGLPAVAHLHPRRVSGE
PGDDVVLRLTAASDCTDSVLSGVVEVVCPLGWSAAPARLPVTLGAGEHLQ
ADIALSIPAGAPPGPYPVRAQLRVVDTALPAAWRQVVEDVCVATVGADSE
LEELVYLVDGPADIELAAGDRARLAVTIGSRAHAELALEAHAISPWGTWE
WIGPPALGAVLPARGTAELAFDVTPPAWLEPGQWWALVRVGCAGQLVYSP
AVKVSVT
433633683YP_007267310.1 Carboxyl esterase LipG [Mycobacterium canettii CIPT 140070017]MDIRSGTAVSGDVKLYYEDMGDLDHPPVLLIMGLGAQMLLWRTDFCARLV
AQGLRVIRYDNRDVGLSTKTERHRPGQPLATRLVRSWLGLPSQAAYTLED
MAADAAALLDHLDVKHAHVVGASMGGMIAQIFAARFAERTKTLAVIFSSN
NHRFLPPPAPRALLALLTGPPPDSPRDVIVDNAVRVSKIIGSPAYPIPED
QVRAEAAESYDRNFHPWGIAQQFGAILGSGSLLRYDRRIVAPTVVIHGRA
DKLMRPFGGRAVARAINGARLVLIDGMGHDLPRQLWDRVIGELTRNFAEA
G
433633681YP_007267308.1 Methoxy mycolic acid synthase 2 MmaA2 (methyl mycolic acid synthaseMVNDLTPHFEDVQAHYDLSDDFFRLFLDPTQTYSCAHFEREDMTLEEAQI
AKIDLALGKLGLQPGMTLLDIGCGWGATMRRAIAQYDVNVVGLTLSKNQA
AHVQKSFDEMDTPRDRRVLLAGWEQFNEPVDRIVSIGAFEHFGHDRHADF
FARAHKILPPDGVLLLHTITGLTRQQMVDHGMPLTLWLARFLKFIATEIF
PGGQPPTIEMVEEQSAKTGFTLTRRQSLQPHYARTLDLWAEALQEHKSEA
IAIQSEEVYERYMKYLTGCAKLFRVGYIDVNQFTLAK
433633679YP_007267306.1 Methoxy mycolic acid synthase 4 MmaA4 (methyl mycolic acid synthaseMTRMAEKPISPTKTRTRFEDIQAHYDVSDDFFALFQDPTRTYSCAYFEPP
ELTLEEAQYAKIDLNLDKLDLKPGMTLLDIGCGWGTTMRRAVERFDVNVI
GLTLSKNQHARCEQVLASIDTNRSRQVLLQGWEDFAEPVDRIVSIEAFEH
FGHENYDDFFKRCFNIMPADGRMTVQSSVSYHPYEMAARGKKLSFETARF
IKFIVTEIFPGGRLPSTEMMVEHGEKAGFTVPEPLSLRPHYIKTLRIWGD
TLQANKDKAIETTSEEVFNRYMKYLRGCEHYFTDEMLDCSLVTYLKPGAA
A
433633677YP_007267304.1 Putative 50s ribosomal protein L11 RplK [Mycobacterium canettii CIPMAPKKKVAGLIKLQIVAGQANPAPPVGPALGQHGVNIMEFCKAYNAATEN
QRGNVIPVEITVYEDRSFTFTLKTPPAAKLLLKAAGVAKGSAEPHKTKVA
KVTWDQVREIAETKKTDLNANDIDAAAKIIAGTARSMGITVE
433633675YP_007267302.1 Putative preprotein translocase SecE1 [Mycobacterium canettii CIPT MSDEGDVADEAVADGAENADRRGSGGRTALVTKPVVRPQRPTGKRSRSRA
AGADADVDVEEPSTADSEATGVAKDDSTTKAVSKAARAKKASKPKARSVN
PIAFVYNYLKQVVAEMRKVIWPNRKQMLTYTSVVLAFLAFMVALVAGADL
GLTKLVMLVFG
433633673YP_007267300.1 (3R)-hydroxyacyl-ACP dehydratase subunit HadB [Mycobacterium canettMALREFSSVKVGDQLPEKTYPLTRQDLVNYAGVSGDLNPIHWDDEIAKVV
GLDTAIAHGMLTMGIGGGYVTSWVGDPGAVTEYNVRFTAVVPVPNDGKGA
ELVFNGRVKSVDPESKSVTIALTATTGGKKIFGRAIASAKLA
433633671YP_007267298.1 Putative 50s ribosomal protein L33 2 RpmG2 [Mycobacterium canettii MASSTDVRPKITLACEVCKHRNYITKKNRRNDPDRLELKKFCPNCGKHQA
HRETR
433633669YP_007267296.1 Putative glyoxalase II (Hydroxyacylglutathione hydrolase) (GLX II) MSKDRLYFRQLLSGRDFAVGDTFATQMRNFAYLIGDRTTGDCVVVDPAYA
AGDLLDALESDDMQLSGVLVTHHHPDHVGGSMMGFQLPGLAELLERASVP
VHVNTHEALWVSRVTGIPVGDLITHEHGDKVSVGDIDIELLHTPGHTPGS
QCFLLDGRLVAGDTLFLEGCGRTDFPGGDSDEMYRSLRQLAELPGDPTVF
PGHWYSAEPSASLSEVKRSNYVYRPASLDQWRMLMGG
433633667YP_007267294.1 Probable Enoyl-CoA hydratase EchA3 (Enoyl Hydrase) (Unsaturated acyMSDPVSYTRKDSIAVISMDDGKVNALGPAMQKALNAAIDNADRDDVGALV
ITGNGRVFSGGFDLKILTSGEVQPAIDMLRGGFELAYRLLSYPKPVVMAC
TGHAIAMGAFLLSCGDHRVAAHAYNIQANEVAIGMTIPYAALEIMKLRLT
RSAYQQATGLAKTFFGETALAAGFIDEIALPEVVVSRAEEAAREFAGLNQ
HAHAATKLRSRADALTAIRAGIDGIEAEFGL
433633665YP_007267292.1 Exodeoxyribonuclease V beta chain [Mycobacterium canettii CIPT 1400MDRFNLLGPLPREGTTTVLEASAGTGKTFALAGLVTRYLAETAATLDEML
LITFNRAASRELRERVRGQIVEAVGALQGGAPPSGALVEHLLRGSDAERA
QKRLRLRDALANFDAATIATTHEFCGSVLKSLGVAGDNAADVELKESLTD
LVTEIVDDRYLANFGRQETDPDLTYAEALALALAVVNDPCAQLRPRDPEP
GSKAAVRLRFATEVLEALEHRKGRLRVQGFDDLLIRLASALEAADSPARD
RMRERWRIVLVDEFQDTDPIQWRVLERAFSGHSALILIGDPKQAIYGFRG
GDIHTYLTAAGTADARYTLGVNWRSDRALVESLQTVLRDATLGHADIVVR
GTDAHHAGHRLASAPRPAPFRLRVVKRHTLGYDGTAHVPIEALRRHIPDD
LAADVAALLASGATFAGRPVVAADIAVIVEHHKDARACRNALAEAGIPAI
YTGDTDVFASQAAKDWLCLLEAFDAPQRSGLVRAAACTMFFGETAESLAT
EGDALTDRVAATLREWADHARHRGVAAVFQAAQLAGMGRRVLSQRGGERD
MTDLAHIAQLLHQAAHRERLGLPGLRDWLRRQAKAGAGPPEHNRRLDSDA
AAVQIMTVFVAKGLQFPIVYLPFAFNRNVRSDDILLYHDDGTRCLYIGGK
DGGAQRRTVEGLNRVEAAHDNLRLTYVALTRAQSQVVAWWAPTFDEVNGG
LSRLLRGRRPGESQVPDRCTPRITDEQAWAVFAQWEAVGGPSVEESVIGA
ASALAKPVPVPGFEVRHFHRRIDTTWRRTSYSDLVRGSEAVTVTSEPAAG
GRADEVEIAVVAAPGSGADLTSPLAALPSGASFGSLVHAVLETVDPAAPD
LAAELEAQVRRHAPWWTVDVDHAQLAPELARALLPMHDTPLGPAAAALTL
RQIGVRDRLRELDFEMPLAGGDLRGRSPDVSLADVGELLASHLPGDDPLS
PYADRLGSAGLGDQPLRGYLAGSIDVVLRLPGQRYLVVDYKTNHLGDTAA
DYGFERLTEAMLHSDYPLQALLYVVVLHRFLRWRQRDYAPARHLGGVLYL
FVRGMCGAATPVTAGHPAGVFTWNPPTALVVALSDLLDRGRLQS
433633663YP_007267290.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MRIGVGVSTAPDVRRAAVEAAAHAREELAGGAPALAVLLGSRSHTDQAVD
LLAAVQESVEPAALIGCVAQGIVAGRHELENEPAVAVWLASGPPAETFHL
DFVRTGSGALITGYRFDRTAHDLHLLLPDPYSFPSNLLIEHLNTDLPGTT
VVGGVVSGGRRRGDTRLFRDRDVLTSGLVGVRLPGAHGVSVVSQGCRPIG
EPYIVTGADGAVITELGGRPPLHRLREIILGMAPDEQELVSRGLQIGIVV
DEHLAVPGQGDFLIRGLLGADPTTGAIGIGEVVEVGATVQFQVRDAAAAD
KDLRLAVERAAAELPGPPVGGLLFTCNGRGRRMFGVTDHDASTIEDLLGG
IPLAGFFAAGEIGPVAGHNALHGFTASMALFVD
433633661YP_007267288.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MAVTTWLIDKSAYTRLAQSPDAQVWIDRIERGMVRISTITRLEVGYSFAD
RDGSTQRICLAAACPDAARIPHAGGGRSGS
433633659YP_007267286.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MINVVVEGRSDEQVARAVVHAAGHEVAKIVVKNGKRRLDRLLANYNRAAT
HAPWVILRDSDAQCPASLRATLMAGIDNVSPLFHLRIAHPMSEGWLLADN
QGFADFFHVKASQIPADPESLQNAKQTVLNLCSKSRSRSLRRDMVVSGDK
VGPLYTVRIGEFAAKRWNVDSASTRSPSLRRAIERISSIPQSNHGGP
433633657YP_007267284.1 Conserved protein of unknown function with PIN domain [MycobacteriuMVIDTSALVAVLSDEPDAERFEAAVEADPVRLMSTASYLETAIVIEARFG
EPGGRELDLWLHRAAVDLVAVHADQADAARAAYRTYGKGRHRAGLNYGDC
FSYGLAKTSGQPLLFKGEDFQHTDIATVALP
433633655YP_007267282.1 Conserved membrane protein of unknown function [Mycobacterium canetMSFCVYCGAELADPTRCGACGAYKIGSTWHRATTPTFGAATTATGWRPDP
TGRHEGRYFVAGQPTDLVREGDAEAVDPLGQRQLDQSGAVGVSPSAVPGR
VRSGHRRLWWALAGVVAFLGLVGAGVVGTLFLNRDRESIDGKYLAALRRS
GLTGEFNSDANAIARGKQVCRQLQAGGEQQGMPVDQVAVQYYCPQFSEGF
HILETITVTGSFTLKDESPSVYAPAIIVSGSSCSGSAGYADIDRGTQVTV
KNGKGDILATAFLQAGQGGRFLCTFLFSFEITEGEDRYVVSVSRRGEMSY
SFADLKANGLSLALG
433633653YP_007267280.1 Putative galactokinase GalK (galactose kinase) [Mycobacterium canetMTVSYGAPGRVNLIGEHTDYNLGFALPIALPRRTVVTFTPEHTGAITVRS
DRADGSARIPLDTTPGQVTGWAAYVAGAIWALRGAGHPVPGGAISITSDV
EIGSGLSSSAALIGAVLGAVGAATGTRIDRLERARLAQRAENDYVGAPTG
LLDHLAALFGAPKTALLIDFRDITVRPVAFDPDACDITLLLMDSRARHRH
AGGEYALRRASCERAAADLGVSSLRAVQDRGLAVLGAIADPIDARRARHV
LSENQRVLDFVAALADSDFTAAGRLLTASHESMREDFAITTERIDLIAES
AVRAGALGARMTGGGFGGAVIALVPAARAGDVADAVRRAAVDAGYDEPAV
SRTYAAPGAAERR
433633651YP_007267278.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MYAEHDVVVLTRDVPDKSLIAGDVGAVVGRYAAGGYEVEFTAANGCTVAV
VTLAGDDIRPRRRREIPHVREVA
433633649YP_007267276.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MTDQKCVRCGGDKLVEGAVVWNAPLRFKREGAGHFNRGTQVNAVACETCG
HIDLYLERRARGSTK
433633647YP_007267274.1 Conserved protein of unknown function- possible antitoxin [MycobactMRTTIDLPQDLHKQALAIARDTHRTLSETVADLMRRGLAANRTTALSSDP
RTGLPLVSVGTVVTSEDVRSLEDEQ
433633645YP_007267272.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MLPSLSQILAWGTEHLVEAANFWAETADRWEEVFLQMRNQSHVIVWVGAG
GDALRARTRADLAIVSGKADQLRQAAGIARAGAGTIGAAQRRVIYAVDDA
HNAGFTVGEDLSVTDTRASGTTAERVARHAQAQTFAGDIRQRALQLVVSE
QEVASKITAATAGIATTTFPETPSIGDTIIGNDNRDAGVRLVDFTQDGTT
SPPPPFAPWDTPDGTPPPGTGLSPKLQQMLLGGDPASLTGQGLVDNVRRF
VQSLPENDPNTAWLRAQVADLQAHVADIEYARTHCSTSDWIDRTALFAGG
VVSTGVLALTAETGVGGAAAMASGLGTAVAGKNLVQCLTGGK
433633643YP_007267270.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MGPIRQPRLTVRPGRLPGIIAGVAAKRMNREQFFGAASGLDEDRLRKALW
NLYWRGTANMRERIEAELASDGRARPARKIKPPADPDIVGWEVDEFVSLA
RSGAYLGGDRRVSPRERSRWRFTFKRLAAEAQDALRAEDAEPAASALEQL
IDLAREADGYDYFRSDDPVAAAGFVVSDVAAAAGHPHFREFAAEIGAAIP
P
433633641YP_007267268.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MDDELRGLLVRYARGELSADDARRAILRYPKWRVAEIDGELETVALDDGT
PVLIAESSASEGREYSGLELVRDIAPLVGGLSFDPDEPWGSAFRPGALPE
LQSWARTVELEDAVAKPGPGQRDLLYEGPWWVAVSPGTGRPAVHRADGLD
VITIMTAPDAAATFRQTERHRGLDVVRLGPALWGDLAKRSDFDALRLNPL
RPLAQLWPPHVPAMLVAGRDPRPNAEPLPARTVAEIHLWLDQHGARQEKR
ELSNRATPVGEVTVARAWWNYDRREIAFTRVAPASDTEGLGSGPSRILCA
GKLRQSIQSKLAGLPPLTWRADASHRQRAALAVGWALELEKLVCGERVPF
AALRTPEGAHLWHLQPQAFTARAIRKLRDRAASFQ
433633639YP_007267266.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MIDVSLARRCEAHGYDYFRSDDPVAAAGFVVSAVWSCGRGPGNATGFGRL
SKPLRHS
433633637YP_007267264.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MALNIKDPSVHQAVKQIAKITGESQARAVATAVNERLARLRSDDLAARLL
AIGHKTASRMSPEAKRLDHDALLYDERGLPA
433633635YP_007267262.1 Conserved protein of unknown function- putative antitoxin [MycobactMKAVVDAAGRIVVPKPLREALGLQPGSTVEISRYGAGLHLIPTGRTARLE
EENGVLVATGETTIDDEVVFGLIDSGRK
433633633YP_007267260.1 Protein of unknown function [Mycobacterium canettii CIPT 140070017]MAVVERAIAPSVLAALADTPVVVVNGARQVGKTTLVARLDYPRSSEVVSL
DDVANRDAARDDPRAFVSRPVDTLVIDEAQLEPGLFRAIKAEVDRDRRPG
RFLLTGSARLLSAPDMADALVGRVEIIELWPFSQGERAGFADGFVDVLFT
APRELIHGSDIRRADLVERIATGGFPDIVARSPSRRRAWFDNYLTTATQS
VIREISPIERLAENAACASALRRAYRCRAQRERTGERPVDPGSHHRLDIW
PCWKRRSSSTGCRPGRPT
433633631YP_007267258.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MADGRDHLSHLLVEDRSINAEFRRGGRGNPKIRPVEDRVEHGRDRLAELR
STLESSDEARSELHTDEELRALGTIITLEGEDPAYPLKIDSLQQFTRHIK
SPRRPKWLLLSVLPADPDAGVSERATVWVSDAYRPHFLQLFENYLEKTSS
SGKPRNNELVANIARIRSTVLQDLWQSDGEPTRGTTSWWEIWLRRSGNGP
DLLRRFAQTPNLGVSSHMLRLVDRDVMWIEATWEQLEVLPFTAVPVAEIR
RPEFIDSIEDLSAEEQAEYADDLAQRLEPADEHQPAVCHLDTGVARTHIL
IEGSLAPHDLQTVVGTSGFDRDGHGTKMAGVALFGDLDQHLIGSDQVVLR
HRLESVRILPTRSEPPHEPRTYGDVTAQAVSLPEVTSALRRRVFCLPVTT
NSDTPEKPGQPTLWSATIDALAVGTSVVRNGEELQLLSPPNPDAARLIVV
SAGNVDHFVVQHLEESDTSPVRDPGQAWNALTVGACTEMINPPTDPTYVG
WTTVAEGGELSPHSRTSLPFGPRPWPIKPDIVLEGGNVLHDGASLFEPNH
AALSLRSTGHTNDQALASANATSAATAQASRLAALAMAAYPGYWPETIRA
LLVHGAEWTPAMRTALDAARKRNLQAQQMMLRRYGWGVPTEDRVLYSSGQ
AVTLVVQDEFVPFEGDEFKVPAFRLHDLPWPREVLQDLGDALVTLRVTLS
YFIEPTASRRGWRQRYKYPSHSLRFELQDPLESEMHFVQRVNRDAGTEEA
GGRPAPGRVKWVVGANQRNLGSLHQDIWETSGIELAESGKLAVYPVGGWW
KNNRRRDRIDKAVRYALVVSLRTVEAGVDLYTPVANLLHIPTAVTVD
433633629YP_007267256.1 Type III restriction-modification enzyme- R/helicase subunit [MycobMSESIDNPILNSPYQQPDRYYEVGPKGPTGQIREGRRPSESFIPIAIAKK
GKGDEQAEFDFDATGERRERNSLINDLRRDIAKWRRGGEYPGVTPISRKL
LQHWANPDRENRVLFCQREAAETAIFLTEVAGRKGVTDWRQRLEPQNEAH
NGGLPRVALKMATGAGKTVVMAMLIAWQTLNKAQTPRDARFSNRFLVVTP
GITIRDRLRVLLPEDAQNYYDLRDLIPADLKGGLEQARIVITNFHAFQLK
DTKEIRNVARNTRLLLKGDRTSDPFKENPQAMVGRVLRDLGATGRDKQQI
VVFNDEAHHCYSDRPVASGDKLSAEEKDANEQARVWFKGLQAVAKHVGIK
QIYDLSATPYYLAGSGYNEGHLFPWTVSDFSLMDAIESGIVKVPRTPVDD
DADHPLVTYLRLWDFIGDKLPKRAAKGKVDNWIPPPELEGALRSLHRSYT
KAFEHWESALQPYGETPPVFIVVCPNTVVSKLVYDWIAGEAVEVDGELVA
HRPGKLRLLSNVVDGKPLARPRTILIDSAQLESGEGMKADFKKAAAAEIA
AFKSEYRRRNPGADVDKITEDELLREVMNTVGKAGKLGEQVRCVVSVSML
TEGWDANTVTHILGVRAFRSQLLCEQVVGRGLRRRSYAVKPDTGCFEPEY
ANVYGIPFQFISSDRPVADPKPPRPVIEVGAVEGREHLRITFPKLDGYRV
EMPNEPIWLDAEDAAPFEIGPNTVPRWVEMQGVVGEAERESGDRRHYRTQ
QVAFALAKRILDTRFNTGEDRQPWRFPELVRISNQWLDQCVTVAPGYDFG
HLMTITEAQAEACEAIWSAIVGQIGNRRERLRPMLNRFDPEGSTGNVNFP
TRKATVPTTKSEVSHITLDGKDGNTWEQLLAAELELNGNVASYVKNDHLG
FTIPYVHKGRSHSYVTDFLVRLKKRDPDDVVRTLIIEVSGSQKSPGPTKA
KADTARNSWCAAVNNHGGFGRWGYTEMTNPLEFKTRLAEAIGLLYDDAPI
VGDPDLLDFDDRRSARGA
433633627YP_007267254.1 Protein of unknown function [Mycobacterium canettii CIPT 140070017]MRLTRIKISNFRSFLGDHEFEVAAGATYFVGPNNCGKSNLISAVEMALNP
DIPFVPQRDRPATTQGIGAPPKTRITLIFTKTDNSSPQRTLLRRAKMYEH
ALRDKHGRQTERKGTTYAEDGELHRVVTFGAQGTRQVSYEAKAMGAVSLP
AGSAEHRKLDSQFDRVVRFGVLHSGEDLRSVLSGQFREVLQLVIRDHLGD
EQRETDELRDKYVKGLKTKLLQPLRDKLHENVSSMFPEIKLVDLLPEVRS
LDETLSSVGVELEDAAATELTGKGTGLRGAVLVAMLQYLADKSKRSLVLA
VEEPEAFLHPGAQESIAAQLEALAERPEVTLLVTTHSPHIISRQSSARIT
ELRKSAAGNTSSAGSARGDEERAELLGSLFTDAGLARVLERATSVPPGIR
AVVVTEGYTDERFLRYGLTAAGRLDLLDGIHFIDAGGAKKVVSQAVLTSS
ATDLPVLALLDHDQHGEAACKHLLHFNWRMDEEIISLKHWPGRCRDQSHD
IEIEDLIPPNVAARVSAAVGDEAYDATLRCDSRMHYSYSTVWKERALDRL
PRELRGEDCPHLVWLGEEINKRISKITARAERKRLSSSQDGAI
433633625YP_007267252.1 Protein of unknown function [Mycobacterium canettii CIPT 140070017]MLREDVVADTLVPDGVWESLAAYRQP
433633623YP_007267250.1 Conserved protein of unknown function- possible antitoxin VapB4 [MyMSATIPARDLRNHTAEVLRRVAAGEEIEVLKDNRPVARIVPLKRRRQWLP
ATEVIRELVRLGPDTTNLGEELRETLTQTTDDVRW
433633621YP_007267248.1 Conserved protein of unknown function- MCE family Mce2F- thought toMLTRAIKTQLVLLTVLAVIAMVVLGWYFLRIPSLVGIGRYTLYAELPRSG
GLYRTANVTYRGITIGKVTAVEPTERGARATMSIDNGYQIPTDASANVHS
VSAVGEQFVDLVSTRTGGPYLRHGQTITTTTVPSQIGPALDAANRGLAVL
PKDRVASVLHEASEAVGGLGSSLNRLIEATQAIAHDVRGSLEDIDDIIER
SAPIIDSQVNSGNEIARWAANLNTLAAQTAQTDPAVRSILANAAPTADQV
NATFSDVWESLPQTLANLEVVIDMLKRYHNGVEQALVFLPQSGAIAQSVT
TEFPGQAGLGVGGLALNQPPPCLTGFLPASEWRSPADTSTAPLPKGTYCR
IPMDASNVVRGARNNPCVDVPGKRAATPRECRSNEPYVPGGTNPWYGDPN
QMLSCPAPAARCDQPVKPGQVIPAPSVNNGINPLPADQLPGTPPPVNDPL
QRPGSGTVQCNGQQPNPCVYTPSTFPTTIYDVQSGKVVAPDGVVYSVEAS
THAGADGWKVMLAPTG
433633619YP_007267246.1 Conserved protein of unknown function- MCE family- MCE2D- thought tMSTIFDIRSLRLPKLSAKVVVVGGLVVVLAVVAAAAGARLYRKLTTTTVV
AYFSEALALYPGDKVQIMGVRVGSIDTIEPAGDKMRVTLHYSNKYQVPAT
ATASILNPSLVASRTIQLSPPYTGGPVLQDGAVIPIERTQVPVEWDQLRD
SINGILRQLGPTERQPKGPFGDLIESAADNLAGKGRQLNETLNSLSQALT
ALNEGRGDFVAITRSLALFVSALYQNDQQFVALNENLAEFTDLFTKSDHD
LADAVERIDDVLGTVRKFVSDNRSVLAADVNNLADVTTTLVQPEPRDGLE
TALHVLPTYASNFNNLYYPLHSSLVGQFVFPNFANPIQLICSAIQAGSRL
GYQESAELCAQYLAPVLDALKFNYLPFGSNPFSSAATLPKEVAYSEERLR
PPPGYKDTTVPGIFSRDTPFSHGNHEPGWVVAPGMQGMQVQPFTANMLTP
ESLAELLGGPDIAPPPPGTNLPGPPNAYDESNPLPPPWYPQPASLPAGAA
GQAGPGQ
433633617YP_007267244.1 Conserved protein of unknown function- MCE family- Mce2B- thought tMKTTGTTIKLGIVWLVLSVFTVMIIVVFGQVRFHHTTGYSAVFTHVSGLR
AGQFVRAAGVEVGKVAKVTLIDGDKRVLVDFTVDRSLSLDQATTASIRYL
NLIGDRYLELGRGHSGQRLAPGATIPLEHTQPALDLDALLGGFRPLFQTL
DPDKVNSIASSIITVFQGQGATINDILDQTASLTATLADRDRAIGEVVNN
LNTVLATTVKHQTEFDRTVDKLEVLITGLKNRADPLAAAAAHISSAAGTL
ADLLGADRPLLHSSFGHLEGIQQPLIDELAELDHVLGKLPDAYRIIGRAG
GIYGDFFNFYLCDISLKVNGLQPGGPVRTVKLFGQPTGRCTPQ
433633615YP_007267242.1 Conserved membrane protein of unknown function- YrbE2B [MycobacteriMVESSTASAAAVLRARYPRTAASLDRYGGGTARRLERTGTFARFTRISVV
QIGWALRRYRRETLRLVAEIGMGTGAMAVVGGTVAIIGFVTLSGGSLIAI
QGFASLGNIGVEAFTGFFAALANTRVAAPIVSGVALAATVGAGATAQLGA
MRISEEIDALEVMGIKSISFLVSTRILGGLVVIMPLYALALDMAFTSGQV
VTTVFYGQSNGTYEHYFRTFLRPEDVGWSVVEVVIIAVVVMITHCYYGYT
ASGGPVGVGQAVGRSMRFSLVSVVVVVLLAELALYGVDPNFNLTV
433633613YP_007267240.1 Putative transcriptional regulatory protein (GntR-family) [MycobactMALQPVTRRSVPEEVFEQIATDVLTGEMPPGEALPSERRLAELLGVSRPA
VREALKRLSAAGLVEVRQGDVTTVRDFRRHAGLDLLPRLLFRNGELDISV
VRSILEARLRNFPKVAELAAERNEPELAELLQDSLRALDTEEDPIVWQRH
TLDFWDHVVDSAGSIVDRLMYNAFRAAYEPTLAALTTTMTAAAKRPSDYR
KLADAICSGDPTGAKKAAQDLLELANTSLMAVLDSQASRQ
433633611YP_007267238.1 Conserved exported protein of unknown function [Mycobacterium canetMRARRLRRALAALLAVAGLFVPFIVGVPTAYDGEPVFVAIPVEHVDTLIG
TGTGAAIVGEINNFPGASVPFGMVQYSPDTVDNYAGYDYDNPHSTGFSMT
HASVGCPAFGDISMLPTTTPLGSQPWSAWEEIAHDDTEVGVPGYYTVRFP
GTGVIAELTATTRTGVGRFRYPRNGWPALLHVRSGASLAGNYAATLQIED
NTTITGSATSGGFCGKKNLYTVYFAMKFSQPFSSYGTWDGYAVYPGSHSV
NSSYSGGYVGFPAGSVLEVRTALSYVSVDGARANLDAEGGASFDDIRAAT
SSEWNAALSRIAVAGRGPGDVDTFYTCLYRSLLHPNTFNDVDGRYIGFDG
VIHSVASGHTHYANFSDWDTYRSLAPLQGLLFPQRASDMIQSLVTDAEQS
GAYPRWALANSATGMMSGDSVVPLIVNLYAFGARDFDLKSALHYMVNAAT
QGGVGLNGFLERPGIAAYLRLGYGPQTAEFRANGRIAGASVTLEWSVDDF
AISRFADSLGDRATAAAFQNRSQYWQNLFNPTTGYISPRSAAGFFPDGPG
FVAHPSGFGQDGYDEGNAEQYLWWVPHNVAGLVTALGGRTAVAKRLDRFT
KKLNVGPNEPYLWAGNEPGFGVPWLYNYIGQPWKTQRTVDRVRGLFGPTP
GGAPGNDDLGALSSWYVWAALGLYPSTPGTTILTVNTPLFDRAVIALPTG
KSIQITAPGASGRNRLKYIDGLTIDRQPSNQTFLPESIVRTGGDLTFSLA
GTPNKVWGTAASAAPPSFGAGSSAVTVNIAQPIIGIVPGATGTVTVDAQR
MIDGVDDYTVTPTSYVVGIAAAPVSGQFDDDGAVSASVAITVARSVPSGY
YPIYVTTSAGDSARTLIVLVVVAEAVE
433633609YP_007267236.1 Conserved protein of unknown function with PIN domain- possible toxMIVDTSALLAYFDAAEPDHAAVSECIDSSADALVVSPYVVAELDYLVATR
VGVDAELAVLRELAGGAWKLANCGAAEIEQAARIVKKYQDQRIGIADAAN
VVLADRYRTRTILTLDRRHFSALRPIGGGRFTVIP
433633607YP_007267234.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MTDQSYAVDIAHPPAALLRLVNPILRSLLHTPLAGPLRTQLMVVSFTGRK
TGRHFSIPLSAHVIDNDLYALTEAGWKHNFSDGAAAQVVYGGKTTAMRGE
LIRDRAVVSELFLRAAQAYGVKRGQRMLGLSFRDRRIPTLDEFAEAVDRL
KLVAIRLTPADNS
433633605YP_007267232.1 Conserved protein of unknown function- PE-PGRS family protein PE_PGMSLVIATPEMLTTATTDLAKIGSTITAANTAAAAVAKVLPASADEVSVAV
AALFGTHAQEYQAVSAQVATFHDRFVQTLAAAASSNAAAEAANVEQSLLA
AVNAPTQVLFGRPLIGNGADGARGTGQPGQFGSPGADGRGGAGGAGGGGG
AGGSF
433633603YP_007267230.1 Putative regulatory protein (possibly ArsR-family) [Mycobacterium cMLEVAAEPTRRRLLQLLAPGERTVTQLASQFTVTRSAISQHLGMLAEAGL
VTARKQGRERYYRLDERGVLRLRALMESFWSDELDRLAADAAHYPPSRGD
CAMPFEKAVVVPLDPTSTFALITRPDRLRRWMAVAARIELRTGGAYRWTV
TPGHSAAGTVIDVDPGKRVVFTWGWEDHGDPPPGGSTVTITLTPVDGGTE
VRLVHDGLTDEQAARHAEGWNHFLDRLVVAGQHGDAGPDEWAAAPDPLDE
LSCAEATLAVLQRVLRGIGATDLTRQTPCTEYDVSQLADHLMRSLAIIGA
AAGAQLAPRDVDAPLETQVADAAQAVLEAWRRRGLAGTVELNSDQVPAAV
PVGILCLEFLVHAWDFAIATGSQVIVSEPVSEYVLAVAGKVITPATRNSA
GFAAPAAVGSFAPVLDRLIAFTGRQPTAGHVSAN
433633601YP_007267228.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MRALRRCALFAWWQEWAAPLWIGCSFTAWTRLLIRNRFAVHWSRWHFAVC
YTLFSVVHSYLGLWQKVLFGRRVATTVIADPPIFIVGHWRTGTTLLHELL
VLDERHTGPTSYECLVPHHFLLTEWLAPLAEFLVSKHRVMDNMDLSLRHP
QEDEFVLCMLGQPSPYLTIAFPNRPPQFLRYLDLEQLTSQELAAWKQSLF
RFVQQVYFRRRKRVVLKNPPHSFRIKVLLDLFPQARFIHIVRDPYVVYPS
TIHLRKSLYSKHGLQRPTFEGLDEQVLSTYVDLYRKLDEGRKLVDPSRFY
ELRYEDLIADPEGQLRRLYEHLELGGFERYLPRLRRYLADHAEYETNNYE
LTAEQRSVVAQRWGEVIDRYGYGDPTPEPAHRRPTAGG
433633599YP_007267226.1 Putative cytochrome P450 [Mycobacterium canettii CIPT 140070017]MTIRSTSEARLPWDAADPYPFYEQRRGVDDPVWDDTAQAWLVFGYHAAQQ
VLGGPGWAIDPLANPNAGLAVDAASSELFKRSMLFADGAEHLRLRGAVRD
VFTPSFITGLTAGVEAIAAAVIDHPRTGTEFDFMTEIALPLPLAVMGEWL
GLDVESSRLFRALSSATIRILVPLATLEEIQTGAAALTRLVAHFLPLAAD
RRSNPSDDLLSFIAADPDLQLDEVVMTALNIAVAGHETTVYLLGTAAIRL
FTPRANGTRMIDELDPADPSLITELLRLDGPVQATARTATQVQRIGATEI
AHGQQVIAVIAAANRDPAVFDEPDRLRVGRRGPAPLTFGYGPHYCLGAAL
ARLQISVALRRIVARNPVVCGAATWDKSPALRGPVSLPMRFAGS
433633597YP_007267224.1 Putative oxidoreductase [Mycobacterium canettii CIPT 140070017]MKVAISGAGVAGAALAHWLQRTGHTPTVIERAPKFRTGGYMIDFWGVGYR
VAKRMGIADQIAAAGYHMEHVRSVGPNGEVKADLGVDVFRRMVGDDFTSL
PRGDLAAAIYTTIEDQVETIFDDSIATIDEHRDGVRLTFERSAPRDVDLV
IGADGLHSNVRRLVFGPERDFEHYLGCKVAACVVDGYRPRDERSYVLYNT
VDRQLARFALRGDRTMFLFVFRAEHDNPGVAPKDELRDQFGDVGWESRDI
LAALDDVEDLYFDVVSQIRMDRWSRGRVLLIGDAAGCISLLGGEGTGLAI
TEAYVLAGELARAAGDHRRAFDAYETRLRPFIEGKQASAAKFIWFFATRT
RFGLWFRNVAMRTMNFGPLATLFAGSVRDDFELPDYTW
433633595YP_007267222.1 Putative nicotinate phosphoribosyltransferase [Mycobacterium canettMAIRQHIGALFTDLYEVTMAQAYWAERMSGTAVFEIFFRKLPPGRSYIMA
AGLADVVEFLEAFRFDEQDLRYLRSLGQFSDEFLRWLAGVRFTGDVWAAP
EGTVIFPNEPAVQLIAPIIEAQLVETFVLNQIHLQSVLASKAARVVAAAG
GRPVVDFGARRAHGTDAACKVARTSYLAGAAGTSNLLAARQYGIPTFGTM
AHSFVQAFDSEVAAFEAFARLYPATMLLVDTYDTLRGVDHVIELAKRLGN
RFDVRAVRLDSGDLDELSKATRARLDAAGLEQVEIFASSGLDENRIAALL
AVRCPIDGFGVGTQLVVAQDAPALDMAYKLVAYDGSGRTKFSSGNVIYPG
RKQVFRKLEHGVFGGDTLGEHRENLPGDPLLVPIMTNGRRIRQHAPTLDG
ARDWARQQMDALPPELRSLEDTGYAYPVAVSDRIVGELARLRHADTAEAH
PGSNVVGAKAKRP
433633593YP_007267220.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MKLFDDRGDAGRQLAQRLAQLSGKAVVVLGLPRGGVPVAFEVAKSLQAPL
DVLVVRKLGVPFQPELAFGAIGEDGVRVLNDDVVRGTHLDAAAMDAVESK
QLIELQRRAERFRCGRDRIPLTGRIAVIVDDGIATGATAKAACQVARAHG
AEKVVLAVPIGPDDIVARFAGYADQVVCLATPALFFAVGQGYRNFTQTSD
DEVVALLDRAHRDFAEAGAVDAAADPPLRDEEVQVVAGPVPVAGHLTVPE
KPRGIVVFAHGSGSSRHSTRNRYVADVLTGAGLATLLFDLLTAEEERNRA
NVFDIELLASRLIDVTGWLATQPDTTSLPVGYFGASTGAGAALVAAADPR
VNVRAVVSRGGRPDLAGDSLGSVVAPTLLIVGGRDQVVLELNQRAQAVIP
GKCQLTVVPGATHLFEEPGTLEQVAKLACDWFIDHLYGPGPSG
433633591YP_007267218.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MKAKVGDWLVIKGATIDQPDHRGLIIEVHSSDGSPPYVVRWLETDHVATV
IPGPDAVVVTAEEQNAADERAQHRFGAVQSAILHARGT
433633589YP_007267216.1 Putative methyltransferase/methylase [Mycobacterium canettii CIPT 1MELSPDRIMAIGGGYGPSKVLLTAVGLGLFTELGDEAMTAEAIADRLGLL
KRPAIDFLDALVSLDLLARDGDGPGSHYRNTPETAHFLDEARPTYAGGLL
KIWNERNYRFWADLTEALKTGKAQSEVKQTGRPFFEALYADPRRLEAFMA
AMDAASRRNIELLAERFPFERYRRLCDVGGADGLLSRIVAAAHPHLQCVS
FDLPAVTEIARRKLTAEGLGERVQACAGDFLADPLPEADVITMGQILHDW
NLDRKQQLVAKAYEALSKEGAFIVIETLIDDARRENTTGLMMSLNMLIEF
GDAFDYSAADFRRWCGEVGFRSFEVIPLAGGSSAAVAYK
433633587YP_007267214.1 Putative monooxygenase [Mycobacterium canettii CIPT 140070017]MSVTPNAGCVDVVIVGAGISGLGAAYRIIERNPQLTYTILERRARIGGTW
DLFRYPGVRSDSSIFTLSFPYEPWTREEGIADGAHIREYLTDMAHKYGID
RHIEFNSYVRAADWDSSTDTWTVTFEQNGVHKHYRSRFVFFGSGYYNYDE
GYTPDFGGIEKFGGAVVHPQHWPEDLDYTGKKIVVIGSGATAVTLIPSLT
DRAEKVTMLQRSPTYLISASKYSMFAAVVRKALPPKTSHLIVRMYNALLE
AVFWFLSRKTPVFVKWLLRRTAIKNLPEGYDIETHFTPRYNPWDQRLCLI
PDADLYNAITSGRAEVVTDHIDHFDATGIALKSGGHLDADIIVTATGLQL
QALGGAAISLDGVEIDPRDRFVYKAHMLEDVPNLFWCVGYTNASWTLRAD
MTARATAKLLAHMAAHGHTRAAPHLGDEAMDEKPSWDIQAGYVKRAPYAL
PKSGTKRPWNVRQNYLADAIDYRFDRIEEAMVFGAA
433633585YP_007267212.1 Putative protease HtpX homolog [Mycobacterium canettii CIPT 1400700MTWHPHANRLKTFLLLVGMSALIVVVGALFGRTALMLAALFAVGMNVYVY
FNSDKLALRAMHAQPVSELQAPAMYRIVRELATSAHQPMPRLYISDTAAP
NAFATGRNPRNAAVCCTTGILRILNERELRAVLGHELSHVYNRDILISCV
AGALAAVITALANMAMWAGMFGGNRDNANPFALLLVALLGPIAATVIRMA
VSRSREYQADESGAVLTGDPLALASALRKISGGVQAAPLPPEPQLASQAH
LMIANPFRAGERIGSLFSTHPPIEDRIRRLEAMARG
433633583YP_007267210.1 Putative oxidoreductase [Mycobacterium canettii CIPT 140070017]MSVDNSADVVVVGAGPAGSAAAAWAARAGRDVLVIDTASFPRDKSCGDGL
TPRAVVELQQLGLGKWLADHIRHRGLRMSGFGGEVEVDWPGPSFPSYGSA
VARLELDDRIRKVAEDTGARMLLGAKAVAVHHDSSRRVVSLTLADGTEVG
CRQLIVADGARSPLGRKLGRRWHRETVYGVAVRGYLSTAYSDDPWLTSHL
ELRSPDGAVLPGYGWIFPLGNGEVNIGVGALSTSRRPADLALRPLISYYT
DLRRDEWGFTGQPRAVSSALLPMGGAVSGVAGPNWMLIGDAAACVNPLNG
EGIDYGLETGRLAAELLDSRDLARLWPALLADRYGRGFSVARRLALLLTF
PRFLPAAGPITMRSTALMNIAVRVMSNLVTDDDRDWVARVWRGGGQLSRL
IDRRPPFS
433633581YP_007267208.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MKGTKLAVVVGMAVAAVSLAAPVRADDYDAPFNNTIHRFGIYGPQDYNAW
LAKISCERLSRGVDGDAYKSATFLQRNLPRGTTQGQAFQFLGAAIDHYCP
EHVGVLQRAGTR
433633579YP_007267206.1 Mannosyltransferase PimB [Mycobacterium canettii CIPT 140070017]MCGVRVAIVAESFLPQVNGVSNSVVKVLEHLRRTGHEALVIAPDTPPGED
RAERLHDGVRVHRVPSRMFPKVTTLPLGVPTFRMLRALRGFDPDVVHLAS
PALLGYGGLHAARRLGVPTVAVYQTDVPGFASSYGIPMTARAAWAWFRHL
HRLADRTLAPSTATMESLIAQGIPRVHRWARGVDVQRFAPSARNEALRRR
WSPDGKPIVGFVGRLAPEKHVDRLTGLAASGAVRLVIVGDGIDRERLQSA
MPTAVFTGARYGKELAEAYASMDVFVHSGEHETFCQVVQEALASALPVIA
PDAGGPRDLITPHRTGLLLPVGEFEHRLPDAVAHLVHERQRYALAARRSV
LGRSWPVVCDELLGHYEAVRGRRTTQAA
433633577YP_007267204.1 Bifunctional 2-oxoglutarate decarboxylase and SHCHC synthase [MycobMNPSTTQARVVVDELIRGGVRDVVLCPGSRNAPLAFALQDADRSGRIRLH
VRIDERTAGYLAIGLAIGAGAPVCVAMTSGTAVANLGPAVVEANYARVPL
IVLSANRPYELLGTGANQTMEQLGYFGTQVRASISLGLAEDAPERTSALN
ATWRSATCRVLAAATGARTANAGPVHFDIPLREPLVPDPEPLGAVTPPGR
PAGKPWTYTPPVTFDQPLDIDLSVDTVVISGHGAGVHPNLAALPTVAEPT
APRSGDNPLHPLALPLLRPQQVIMLGRPTLHRPVSVLLADAEVPVFALTT
GPRWPDVSGNSQATGTRAVTTGAPRPAWLDRCAAMNRHAIAAVREQLAAH
PLTTGLHVAAAVSHALRPGDQLVLGASNPVRDVALAGLDTRGIRVRSNRG
VAGIDGTVSTAIGAALAYEGAHERTGSPGSPPRTIALIGDLTFVHDSSGL
LIGPTEPIPRSLTIVVSNDNGGGIFELLEQGDPRFSDVSSRIFGTPHDVD
VGALCRAYHVESRQIEVDELRPTLEEPGAGMRVLEVKADRSSLRQLHAAI
KAAL
433633575YP_007267202.1 Putative muconate cycloisomerase MenC (cis- cis-muconate lactonizinMIPVLPPLEALLDRLYVVALPMRVRFRGITTREVALIEGPAGWGEFGAFV
EYQSAQACAWLASAIETAYCAPPPVRRDRVAINATVPAVAAAQVGEVLAR
FPGARTAKVKVAEPGQSLADDIERVNAVRELVPTVRVDANGGWGVAEAVA
AAAALTADGPLEYLEQPCATVAELAELRRRVDVPIAADESIRKAEDPLAV
VRAQAADIAVLKVAPLGGISALLDIAARIAVPVVVSSALDSAVGIAAGLT
AAAALPELDHACGLGTGGLFEEDVAEPAAPVDGFLAVARTTPDPARLQAM
GAPPQRRQWWIDRVKDCYSLLVPSFG
433633573YP_007267200.1 Putative fatty-acid-CoA ligase FadD8 (fatty-acid-CoA synthetase) (fMSTSGHDAKSGAMRDQDCPGELLRNPTHNGHLLVGALKRHQNKPVLFLGD
TRLTGGQLADCISQYIQAFEALGAGTGVAVGLLSLNRPEVLMIIGAGQAR
GYRRTALHPLGSLADHAYVLNDAGISSLIIDPNPMFVERALALLEQVDSL
QQILTIGPAPDALKHVAVDLSAEAAKYQPQPLVAADLPPDQVIGLTYTGG
TTGKPKGVMGTAQSIATMTSIQLAEWEWPANPRFLMCTPLSHAGAAFFTP
TVIKGGEMIVLAKFDPAEVLRIIEEQRITATMLVPSMLYALLDHPDSHTR
NLSSLETVYYGASAINPVRLAEAIRRFGPIFAQYYGQSEAPMVITYLAKG
DHDEKRLTSCGRPTLFARVALLDEHGKPVKQGEVGEICVSGPLLAGGYWN
LPDETSRTFKDGWLHTGDLAREDSDGFYYIVDRVKDMIVTGGFNVFPREV
EDVVAEHPAVAQVCVVGAPDEKWGEAVTAVVVLRSNAARDEPAIEAMTAE
IQAAVKQRKGSVQAPKRVVVVDSLPLTGLGKPDKKAVRARFWEGAGRAVG
433633571YP_007267198.1 Conserved protein of unknown function- possible toxin with PIN domaMRASPTSPPEQVVVDASAMVDLLARTSDRCSAVRARLARTAMHAPAHFDA
EVLSALGRMQRADALTVAHVDAALEELRQVPVTRHGLSSLLAGAWSRRDT
LRLTDALYVELAETAGLVLLTTDERLARAWPSAHAIS
433633569YP_007267196.1 Putative fatty acyl-CoA reductase [Mycobacterium canettii CIPT 1400MSKSPLRWLTEQITLAGMRPPISPQLLINRPAMQPIDLTGKRILLTGASS
GIGAAAAKQFGLHRAVVVAVARRKDLLDAVADRITGDGGTAMSLPCDLSD
MEAIDALVEDVEKRIGGIDILINNAGRSIRRPLAESLQRWHDVERTMVLN
YYAPLRLIRGLAPGMLERGDGHIINVATWGVLSEASPLFSVYNASKAALS
AVSRIIETEWGSQGVHSTTLYYPLVATPMIAPTKAYDGLPALTAAEASEW
MVTAARTRPVRIAPRVAVAVNALDSIGPRWVNALMQRRNEQLNP
433633567YP_007267194.1 Putative low-affinity inorganic phosphate transporter integral membMNLQLFLLLIVVVTALAFDFTNGFHDTGNAMATSIASGALAPRVAVALSA
VLNLIGAFLSTAVAATIAKGLIDANLVTLELVFAGLVGGIVWNLLTWLLG
IPSSSSHALIGGIVGATIAAVGLRGVIWSGVVSKVIVPAVVAALLATLVG
AVGTWLVYRTTRGVAEKRTERGFRRGQIGSASLVSLAHGTNDAQKTMGVI
FLALMSYGAVSTTASVPPLWVIVSCAVAMAAGTYLGGWRIIRTLGKGLVE
IKPPQGMAAESSSAAVILLSAHFGYALSTTQVATGSVLGSGVGKPGAEVR
WGVAGRMVVAWLVTLPLAGLVGASTYGLVHFIGGYPGAILGFALLWLTAT
AIWLRSRRAPIDHTNVNADWEGNLTAGLEAGAQPLADQRPPVPAPPAPTP
PPNHRAPQFGVTTRNAP
433633565YP_007267192.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MNRFLTSIVAWLRAGYPEGIPPTDSFAVLALLCRRLSHDEVKAVANELMR
LGDFDQIDIGVVITHFTDELPSPEDVERVRARLAAQGWPLDDVRDREEHA
433633563YP_007267190.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MRIGRREGLAVAIGLVLVGAAFVLPRLNLGIKPRSDIGLERFATRAGAAP
IFGYWDAHVGWGTAPAVLTAVAVVAWGPVVAHRLPWRVLTLGTWATAAAW
AFSLAMIDGWQRGFAGRLTTRDEYLWQVPGIADIPATLRTFTSRILDFQP
NSWVTHVSGHPPGALLTFVWLDRIGLRGGGWAGLVCLLVGSSAAAAVLIA
VRVLASEQMARRTAPFVAVAPTAIWIAVSADGYFAGVAAWGIALLAVAVH
GATRFPALVAAGAGLLLGWGVFLNYGLVLIVLPGMAVLAAADWRPVLRAL
GPAVLAALAVAVSFAVAGFSWFDGYTLVQQRYWQGIAKDRPFGYWSWANL
ACVVCAIGLGSVAGLSRVFDRAAISRRSGCHLLLLAVLAAIALADLSMLS
KAETERIWLPFTIWLTAAPALLPPRSHRLWLAVNAAGALLLNSIIFTNW
433633561YP_007267188.1 Putative dolichyl-phosphate sugar synthase (dolichol-phosphate sugaMLPCLNEAESLPAVLAAIPAGYRALVVDNNSTDDTAAVAARHGAQVVVEP
RPGYGSAVHAGVLAATTPIVAVIDADGSMDAGDLPKLVAELDKGADLVTG
RRRPVAGLHWPWVARVGTVVMSWRLRTRHRLPVHDIAPMRVARREALLDL
GVVDRRSGYPLELLVRAAAAGWRVVELDVSYGPRTGGKSKVSGSLRGSII
AILDFWKVIS
433633559YP_007267186.1 Conserved integral membrane protein of unknown function [MycobacterMSLSSDDTRRREIVRDLAAGALLISALFFPWNLYFGFRIPDSNKTVFGLL
LAVTLLSLAPLSLTFAGRRSQLRLGLNVPYLLLVLAFVVFDAIQTIRSGG
TVHVPGGVGPGGWLGITGALLSAQPALTGATTDEGSHSRWLRATQFLGYT
SMLGAALSTGFNLSWRVRYALAPAAGASGFGKQNLAVIDTAVVYGLVALA
AVLVASRWLLRPTAAEALSTVALGGSTLIAGSIVWSLPIGREIDAFHGIA
QNTSTAGVGYEGYLVWAAAAAMCAPLTLFRSPNAPPIDKTVWRAASRNGL
LLIAVWCLGSVAMRLTDLVVAVLLNYPFSRYDSMALAAFDLATAVLAIWL
RFNMATEALPARLISSLCGLLCTFTVSRVIVGVVLAPRFQASSGGSAHPV
YGNDLAQQITSTFDVVLCGLALGILAAAIVIGRPRQLPQPPHTPALSRPA
GSPRIFRSAGSTHPVRPKIYRPPDHPS
433633557YP_007267184.1 Putative 5'-methylthioadenosine phosphorylase Pnp (MTA phosphorylasMHNNGRMLGVIGGSGFYTFFGSDTRTVNPDTPYGQPSAPITIGTIGAHDV
AFLPRHGAHHQYSAHAVPYRANMWALRALGVRRVFGPCAVGSLDPELGPG
AVVVPDQLVDRTSGRADTYFDSGGVHAAFADPYCPTLRAAVTGLPGVVDG
GTMVVIQGPRFSTRAESQWFAAAGCNLVNMTGYPEAVLARELELCYAAIA
LVTDVDAGVAAGDGVKAADVFAAFGENIELLKRLVRAAIDRVADERTCTQ
CQHHAGVPLPFELP
433633555YP_007267182.1 Conserved PilT domain containg protein of unknown function [MycobacMIYLDTSAMVKLVVREVESVALIEWLNEQGDVDPASTAAGALRGSRGDCC
TSVVGRIELLRAAFRVADGGSVGMSGSEEGEPEIVLAARQLLDKIDTLVL
TDEIAAAAAIAAPADLRTADAIHLATVLVHRPAVSAVCVYDRRLAAACEA
RGCTVVAPGGNPKPPC
433633553YP_007267180.1 Conserved protein of unknown function- uncharacterized PE-PGRS famiMSIVLVTPELVAAAAAELAGIGSAIGAANAAAGAPTMALLAAGADEVSAA
VAAVFSSYAQQYQALSAAAAAFHDQFVRALAAGAGAYAGAEAANVEQQLL
NAINAPTLALLGRPLIGNGADGAAGTGQAGGAGGLLYGNGGNGGSGAAGQ
AGGAGGAAGLIGHGGTGGVGGTGAAGGAGGTGGWLFGNGGAGGTGGAVTG
VSTTGGPGGHGGDAGLYGFGGAGGAGGFGQSGAAGGAGGAGGAGGWLYGD
GGDGGAGGNGGNESGTGVSGVGGVGGAGGAGGLLFGNGGDGGVGGVGGDG
SSTQDSGGDGGAGGAGGAGGWLLGNGGAGGAGGAASIKVATGGLGGDGGD
AGLFGFGGDGGWGGRGVDARFGAAGGAAGAGGAGGWLYGDGGDGGVGGVG
GAVFSLSSGAGGAGGAGGSGGWLFGNGGDGGAGGGGGGRLGSGSGAGGDG
AVGGAGGAGAWFGNGGAGGVGGGGGRGTTAIGGDGGAGGAGGAGGWLYGD
GGAGGAGGGGHGRGGTGNNGGDGGDGGRGGDAQLLGNGGAGGAGGAGGPA
GFGASPGAGAAGGGGGAGGSLFGSPGTTGPHG
433633551YP_007267178.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MLYLLLVLVLATLIYVGWRVARSQMSRPKTRVIGPDDDPEFLWRLSHGDN
NPR
433633549YP_007267176.1 Putative cytochrome C-type biogenesis protein CcsA [Mycobacterium cMNTPHVNEGLARYSDWAFTSALVALVVALLLLAFEFAQVRGRGLAPLAVP
AGSVATDSATPGIVADQRHRPFDERVGRGGLAVAYLGIGLLLACVVLRGL
ATQRVPWGNMYEFINLTCLSGLVAGAVALRRARYRPLWVFLLVPVLILLT
VSGRWLYANAAPVMPALQSYWLPIHVSVVSLGSGVFLVAGVASILFLVRT
SRLGEPTADGALAGMVRRLPDAQTLDGIAYRTTIFAFPVFGFGVIFGAIW
AEEAWGRYWGWDPKETVSFVAWVVYAAYLHARSTAGWRDRKAAWINVAGF
VAMVFNLFFVNLVTVGLHSYAGVG
433633547YP_007267174.1 Putative cytochrome C-type biogenesis protein CcdA [Mycobacterium cMTGFTEIAAVGPLLVAVGVCLLAGLVSFASPCVVPLVPGYLSYLAAVVGV
SEGEVQLPAGVVKPPVAARWRVAGSAALFVAGFTTVFVLGTVAVLGMTTT
LITNQQLLQRVGGVLIVVMGLVFVGFIGALQRQARFTPRQLTSVAGAPLL
GAVFALGWTPCLGPTLTGVITVASATEGATVARGIVLVIAYCLGLGIPFV
LLAFGSAWAVAGLGWLRRHTRAIQIFGGALLIAVGAALVTGVWNDVVSWL
RDAFVSDVRLPI
433633545YP_007267172.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MPEETRVHVVRHGEVHNPTGILYGRLPGFHLSATGAAQAGAVADALAGRD
IVAVIASPLQRAQETAAPIAARHDLAVETDPDLIESANFFEGRRVGPGDG
AWRDPRVWWQLRNPFIPSWGEPYVDIAARMTTAVDKARVRGAGHEVVCVS
HQLPVWTLRLYLTGKRLWHDPRRRDCALASVTSLIYDGDRLVDVVYSQPA
AL
433633543YP_007267170.1 Conserved protein of unknown function- PE-PGRS family PE_PGRS33 (frMAPAGPAAPGGQGGTSGDDISVGGTGNGQVGGVGGAGGAGGASGWLYGTG
GTGGTGGQGGTGGDGGLGTIGGSGGTGGGGGTGGAGGWLIGAGGMGGQGG
TGGTPGSLGSIGGTGGYGGKGGTGGWLYGSGGAGGHGGSGGAVGTFGIAA
TGGNGGNGGNAQLVGDGGAGGAGGPAGPGGDPQNGAGGAGGAGGLLFGNP
GAAG
433633541YP_007267168.1 Putative transferase [Mycobacterium canettii CIPT 140070017]MLTTLGAWVACIGDARWLTDYTEILAGAGLSVRHTRHTEAHDDTLLTMIE
RIEARITALRITAPETLAANGAAPDTVLAYTAPARDP
433633539YP_007267166.1 Conserved protein of unknown function- PPE family PPE16 (fragment) MNFLVLPPEVNSALMYAGAGSAPMLAASAAWDGLAAELSSAASSFASVTS
GLVAAVWQGPAAAAMAAVAAPYSSWLSAAAAEQARAVAAVYEAARAATVP
PALVAANRNQLVSLVLSNLFGQNAPAIAATEAAYEGLWAADVAAMVGYHG
GASAVASRTLATEISATATWAAGTSATRTSAAETRDSSTWAAATMATSIW
VAEMTATPTSVLGTWAAATWALGIAATTISVSGSRATTWSALAR
433633537YP_007267164.1 Conserved exported protein of unknown function- probable WAG22-likeMSFVVVAPEALAASAADLARIGSAVVAANVAAAAPTIEVLAAGADEVSAQ
IAALFGAHAQSYQAVSARVVAFHEQFVRALSVGGASYGAAEAANAQQNLL
DAINAPTLALLGRPLIGNGANGAPGTGQAGGPGGILIGNGGAGGSGGPNQ
NGGNGGAAGLFGIGGAGGAGGTNGDGGAGGAGWLFGAGGAGGAGGSGGAT
GGAGGAGGAGGWFGAGGAGGPGGFGATVGGVGGAGGTGGLLFGAGGTGGT
GGLGPVGGVGGVGGDARLIGTGGDGGVGGSGVAGNGGAGGAGGAAGLFGF
GSGGLFGAGGNGRVGGTSTLGTGGAGGAGGSGGPFGAGGAGGDGGFGFQV
GAAGGDGGDGGAGGWFGPGGAGGTGGSGTVAGGAGGAGGTGMLFGDGGAG
GDGGAASLSGSIGGAGGAGGGGGWFGAGGDGGTGGRGSATGGAGGVGGTG
GRLFGAGGDGGTGGTGLTNGGAGGDGGDGVLFGAGGNGGAGGAGATNGAG
GAGGAGGKGGMLSGDGGSGGAGGFGAFQGAGGAGGSGGAGGLFGNGGDGG
DGGIPAAGGNGGAGGAGGNGGGLIGAGGDGGAGGTSLGGDGGAGGAGGSA
SGLFGDGGSGGAGGNGPNAGGAGGAGGNAGLVGNGGNGGVGGDADPFQGA
AGAGGNGGGAVLIGNGGNGGNSGIGFLPATAGTGGTRGQLLGENGLDGLA
P
433633535YP_007267162.1 Integrase- catalytic region (modular protein) [Mycobacterium canettMAATIGYLFAKHKRTYGSPRITADLRDMGWRVSVNTVAALMREQGLVARR
KRRRHGTTKPDKSARKAPDLLGRDFSPRDHPNLAWVGDLTEIPTDEGKLH
LASVIDLHSRRVPGFAMGVHHDAALARAALCMAIAVRGGSVAGVIFHTDQ
GGEYTGELFASACRSARVTQSMGRTGSALDNAAAESFNSTLEWELLRTTT
STHVKRHVTRSPPGSTSITLNVGIPRTACSAPSTTNAPVVNNVVSNQPVN
STPRNGRHEPRRRRLRRRCPARRAPRQATGPPLRPQGSLPRSLRDGPTAR
P
433633533YP_007267160.1 Conserved protein of unknown function- possibly exported [MycobacteMSRPGTCVIGLTLLVGLVVAMVIDNPGCPRSYRPLSLDYRLNPVAVIGDS
YTTGTDEGGLGPKSWTARTWQKLAARGVRIAADVAAEGRAGYGVPGDHGN
VFADLTARAVQPDDVLVVFFGSRNDQGMYPADPEMLAEKARDAFDLARHR
APSARLLVIGPPWPTAEVPVPMLRIRDVLGAQARAAGAVFVDPIADQWFV
DRPELIGADGVHPSDAGHEYLAEKIAPLISMQLVG
433633531YP_007267158.1 Putative anti-sigma-factor antagonist [Mycobacterium canettii CIPT MTTAIPTSRSASSVTTRPVNDAVDYGGAQIRAYLHHLATVVTIRGEIDAA
NVEQVSEHIRRFSLGTNPMVLDLSELSHFSAAGISLLCILDEDCRAAGVE
WALVASPAVVEQLGGGYDQGEHEAMFPMARSVHRALSDLADAIDRRRQLV
LPLISKSA
433633529YP_007267156.1 Conserved membrane protein of unknown function [Mycobacterium canetMIARYRAGAELFLACAALAGSAASWSRTRSTVAVAPVIDGQPVTLSVVYH
PQLLVLTLLLATIAGVLSVVGTARLRRARAGLNAHPDGLNQRPPGGWCH
433633527YP_007267154.1 Putative delta-aminolevulinic acid dehydratase HemB (porphobilinogeMSMSSYPRQRPRRLRSTVAMRRLVAQTSLEPRHLVLPMFVADGIDEPRPI
TSMPGVVQHTRDSLRRAAAAAVAAGVGGLMLFGVPRDQDKDGVGSAGIDP
DGILNVALRDLAKDLGEATVLMADTCLDEFTDHGHCGVLDDRGRVDNDAT
VARYVELAVAQAESGAHVVGPSGMMDGQVAAIRDGLDAAGYIDVVILAYA
AKFASAFYGPFREAVSSSLSGDRRTYQQEPGNAAEALREIELDLDEGADI
VMVKPAMGYLDVVAAAADVSPVPVAAYQVSGEYAMIRAAAANNWIDERAA
VLESLTGIRRAGADIVLTYWAADAAGWLT
433633525YP_007267152.1 Putative porphobilinogen deaminase HemC (PBG) (hydroxymethylbilane MIRIGTRGSLLATTQAATVRDALIAGGHSAELVTISTEGDRSMAPIASLG
VGVFTTALREAMEAGLVDAAVHSYKDLPTADDPRFTVAAIPPRNDPRDAV
VARDGLTLGELPVGSLVGTSSPRRAAQLRALGLGLEIRPLRGNLDTRLNK
VSSGDLDAIVVARAGLARLGRLDDVTETLEPVQMLPAPAQGALAVECRAG
DSRLVAVLAELDDADTRAAVTAERALLADLEAGCSAPVGAIAEVVESIDE
DGRVFEELSLRGCVAALDGSDVIRASGIGSCGRARELGLSVAAELFELGA
RELMWGVRH
433633523YP_007267150.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MSRPQVELLTRAGCAICVRVAEQLAELSSELGFDMMTIDVDVAASTGNPG
LRAEFGDRLPVVLLDGREHSYWEVDEHRLRADIARSTFGSPPDKRLP
433633521YP_007267148.1 Conserved membrane protein of unknown function- MmpS2- possible traMRMISVSGAVKRMWLLLAIVVVAVVGGLGIYRLHSIFGVHEQPTVMVKPD
FDVPLFNPKRVTYEVFGPAKTAKIAYLDPDARVHRLDSVSLPWSVTVETT
LPAVSVNLMAQSNADVISCRIIVNGAVKDERSETSPRALTSCQVSSG
433633519YP_007267146.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MTVPEEAQTLIGKHYRAPDYFLVGREKIREFAVAVKDDHPTHYSEPDAAA
AGYPALVAPLTFLAIAGRRVQLEIFTKFNIPINIARVFHRDQKFRFHRPI
LANDKLYFDTYLDSVIESHGTVLAEIRSEVTDAEGKPVVTSVVTMLGEAA
HHEADADATVAAIASI
433633517YP_007267144.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MGNVAGETRANVIPLHTNRSRVAARRRAGQRAESRQHPSLLSDPNDRASA
EQIAAVVREIDEHRRAAGATTSSTEATPNDLAQLVAAVAGFLRQRVTGDY
TVDEFGFDPHFNSAIVRPLLRFFFKSWFRVEVSGVENIPRDGAALVVANH
AGVLPFDGLMLSVAVHDEHPAHRDLRLLAADMVFDLPVIGEAARKAGHTM
ACTTDAHRLLASGELTAVFPEGYKGLGKRFEDRYRLQRFGRGGFVSAALR
TKAPIVPCSIIGSEEIYPMLTDVKLLARLFGLPYFPITPLFPLAGPVGLV
PLPSKWRVAFGEPICTADYASTDADDPMVTFELTDQVRETIQQTLYRLLA
GRRNIFFG
433633515YP_007267142.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MTSTNGPSARDTGFVEGQQAKTQLLTVAEVAALMRVSKMTVYRLVHNGEL
PAVRVGRSFRVHAKAVHDMLETSYFDAG
433633513YP_007267140.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MNALFTTAMALRPLDSDPGNPACRVFEGELNEHWTIGPKVHGGAMVALCA
NAARTAYGTAGQQPIRQPVAVSANFLWAPDPGTMRLVTSIRKRGRRISVA
DVELTQGGRTAVHAVVTLGEPEHFLPGVDGSGGASGTAPLLSANPVVELM
APEPPEGVVPIGPGHQLAGLVHLSEGCDVRPVLSTLRPATDGRPPVIQLW
ARPRGVAPDALFALLCGDLSAPVTFAVDRIGWAPTVAFTAYLRALPADGW
LRVLCTCVEIGQDWFDEDHIVVDRLGRIVVQTRQLAMVPAQ
433633511YP_007267138.1 Conserved membrane protein of unknown function [Mycobacterium canetMTGPHPETESSGNRQISVAELLARQGVTGAPARRRRRRRGDSDAITVAEL
TGEIPIIRDDHHHAGPDAHANQSRAVNGRVQVGEAAPQSPPEPVAEQVAE
EPTRTVYWSQPEPRWPKSPPQDRRESGPELSEYPRPLRHTHSDRAPAGPP
SGAEHMSPDPVEHYPDLWADLSVDVLDTEVGEAEAATEVREAEPGRGERH
AAAAGTDVEGDGAAEAPVARRALDVVPTLWRGTLIVLQSILAVAFGAGLF
IAFDQLWRWNSIVALVLSVMVILGLVVSVRAVRKTEDIASTLIAVAVGAL
ITLGPLALLQSG
433633509YP_007267136.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MPAVLGYGGIPRRASWSNVESVANSRRRPVHPGQEVELDFAREWVEFYDP
DNPEHLIAADLTWLLSRWTCVFGTPACQGTVAGRPNDGCCSHGAFLSDDD
DRTRLADAVHKLTDDDWQFRAKGLRRKGYLELDEHDGQPQHRTRKHKGAC
IFLNRPGFAGGAGCALHSKALKLGVPPLTMKPDVCWQLPIRRSQEWVTRP
DGTEILKTTLTEYDRRGWGSGGADLHWYCTGDPAAHVGTKQVWQSLADEL
TELLGEKAYGELAAMCKRRSQLGLIAVHPATRAAQ
433633507YP_007267134.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MGESTTQPAGGAAVDDETRSAALPRWRGAAGRLEVWYATLSDPLTRTGLW
VHCETVAPTTGGPYAHGWVTWFPPDAPPGTERFGPQPAQPAAGPAWFDIA
GVRMAPAELTGRTRSLAWELSWKDTAAPLWTFPRVAWERELLPGAQVVIA
PTAVFAGSMAVGETTHRVDGWRGGVAHIYGHANAKRWGWIHADLGDGDVL
EVVTAVSHKPGLRRLAPLAFVRFRIDGKDWPASPLPSLRMRTTLGVRHWQ
LEGRIGGREALIRVDQPPERCVSLGYTDPDGAKAVCTNTEQADIHIELGG
RHWSVLGTGHAEVGLRGTAAPAIKEGTPA
433633505YP_007267132.1 Putative oxidoreductase GMC-type [Mycobacterium canettii CIPT 14007MSRLADRAKSYPLASFGAALLPPELGGPLPAQFVQRVDRYVTRLPATSRF
AVRAGLASLAAASYLTTGRSLPRLHPDERARVLHRIAALSPEVAAAVEGL
KAIVLLANGADTYAHELLARAQEHDAARPDAELTVILSADSPSVTRADAV
VVGSGAGGAMVARTLARAGLDVVVLEEGRRWTVEEFRSTHPVDRYAGLYR
GAGATVALGRPAVVLPMGRAVGGTTVVNSGTCFRPSLAVQRRWRDEFGLG
LADPDQLGRHLDDAEQTLRVAPVPLEIMGRNGRLLLQAATSLGWRAAPIP
RNAPGCQGCCQCAIGCPSNAKFGVHLNALPQACAAGARIISRARVERILH
RAGRAYAVRARRPDGTTLDVLADAVVVAAGATETPGLLRRSGLGGHPRLG
HNLALHPATMLAGLFDDDIFAWRGVLQSAAAHEFHESDGVLIEATSTPPG
MGSMVFPGYGAELLRWLDRAPQIATFGAMVADRGVGAVRSVRGETVVRYD
IAPGDITKLRVALQAIGRLLFAAGAVEVLTGIPGAPPVRSLPDLQDVLRR
ANPRSLHLAAFHPTGTAAAGVDEQLCPVDATGRLRGVEGVWVADASILPS
CPEVNPQLSIMAMALAVADQTVAKVVGVR
433633503YP_007267130.1 Two component sensor histidine kinase SenX3 [Mycobacterium canettiiMTVFSALLLAGVLSALALAVGGAVGMRLTSRVVEQRQRVATEWSGITVSQ
MLQCIVTLMPVGAAVVDTHRDVVYLNERAKELGLVRDRQLDDQAWRAARQ
ALGGEDVEFDLSPSKRSATGRSGLSVHGHARLLSEEDRRFAVVFVHDQSD
YARMEAARRDFVANVSHELKTPVGAMALLAEALLASADDSETVRRFAEKV
LIEANRLGDMVAELIELSRLQGAERLPNMTDVDVDTIVSEAISRHKVAAD
NADIEVRTDAPSNLRVLGDQTLLVTALANLVSNAIAYSPRGSLVSISRRR
RGANIEIAVTDRGIGIAPEDQERVFERFFRGDKARSRATGGSGLGLAIVK
HVAANHDGTIRVWSKPGTGSTFTLALPALIEAYHDDNERPEQAREPELRS
NRSQREEELSR
433633501YP_007267128.1 Conserved membrane protein of unknown function [Mycobacterium canetMMTLKVAIGPQNAFVLRQGIRREYVLVIVALCGIADGALIAAGVGGFAAL
IHAHPNMTLVARFGGAAFLIGYALLAARNAWRPSGLAPSESGPAALIGVV
QMCLVVTFLNPHVYLDTVVLIGALANEESDLRWFFGAGAWVASLVWFAVL
GFSAGRLQPFFATPAAWRILDALVAVTMIGVAVVVLVTSPSAPTANVALI
I
433633499YP_007267126.1 Glycosyltransferase MshA [Mycobacterium canettii CIPT 140070017]MAGVRHNDGSGLIAQRRPVRGEGATRSRGPSGPSNRNVSAADDPRRVALL
AVHTSPLAQPGTGDAGGMNVYMLQSALHLARRGIEVEIFTRATASADPPV
VRVAPGVLVRNVVAGPFEGLDKYDLPTQLCAFAAGVLRAEAVHEPGYYDI
VHSHYWLSGQVGWLARDRWAVPLVHTAHTLAAVKNAALADGDGPEPPLRT
VGEQQVVDEADRLIVNTDDEARQVISLHGADPARIDVVHPGVDLDVFRPG
DRRAARAALGLPVDERVVAFVGRIQPLKAPDIVLRAAAKLPGVRIIVAGG
PSGSGLASPDGLARLADELGISARVTFLPPQSHTDLATLFRAADLVAVPS
YSESFGLVAVEAQACGTPVVAAAVGGLPVAVRDGITGTLVSGHEVGQWAD
AIDDLLRLCAGPRGRVMSRAAARHAATFSWENTTDALLASYRRAIGEYNA
ERQRRGGEVISDLVAVAKPRHWTPRRGVGA
433633497YP_007267124.1 Putative short-chain type oxidoreductase [Mycobacterium canettii CIMTTIGTHKRVAVVTGASSGIGEATARTLAAQGFHVVAVARRADRITALAN
QIGGTAIVADVTDDAAVEALARALSRVDVLVNNAGGAKGLQFVADADLEH
WRWMWDTNVLGTLRVTRALLPKLIDSGDGLIVTVTSIAALEVYDGGAGYT
AAKHAQGALHRTLRGELLGKPVRLTEIAPGAVETEFSLVRFDGDQQRADA
VYAGMTPLVAADVAEVIGFVATRPSHVNLDQIVIRPRDQASASRRATHPV
R
433633495YP_007267122.1 Putative UDP-N-Acetylenolpyruvoylglucosamine reductase MurB (UDP-N-MKRSGVGSLFAGAHIAEAVPLAPLTTLRVGPIARRVITCTSAEQVVAALR
HLDSAAKTGADRPLVFAGGSNLVIAENLTDLTVVRLANSGITIDGNLVRA
EAGAVFDDVVVRAIEQGLGGLECLSGIPGSAGATPVQNVGAYGAEVSDTI
TRVRLLDRCTGEVRWVSARDLRFGYRTSVLKHADGLAVPTVVLEVEFALD
PSGRSAPLRYGELIAALNATSGERADPQAVREAVLALRARKGMVLDPTDH
DTWSVGSFFTNPVVTQDVYERLAGDAATRKDGPVPHYPAPDGVKLAAGWL
VERAGFGKGYPDAGAAPCRLSTKHALALTNRGGATAEDVVTLARAVRDGV
HDVFGITLKPEPVLIGCML
433633493YP_007267120.1 Putative amidohydrolase [Mycobacterium canettii CIPT 140070017]MRIALAQIRSGTDPAANLQLVGKYAGEAATAGAQLVVFPEATMCRLGVPL
RQVAEPVDGPWANGVRRIATEAGITVIAGMFTPTGDGRVTNTLIAAGPGT
PNQPDAHYHKIHLYDAFGFTESRTVAPGREPVVVVVDGVRVGLTVCYDIR
FPALYTELARRGAQLIAVCASWGSGPGKLEQWTLLARARALDSMSYVAAA
GQADPGDARTGVGASSAAPTGVGGSLVASPLGEVVVSAGTQPQLLVADID
VDNVAAARDRIAVLRNQTDFVQIDKAQSRG
433633491YP_007267118.1 Putative deoxyribose-phosphate aldolase DeoC (phosphodeoxyriboaldolMLGQPTRAQLAALVDHTLLKPETTRADVAALVAEAAELGVYAVCVSPSMV
PVAVQAGGVRVAAVTGFPSGKHVSSVKAHEAAAALASGASEIDMVIDIGA
ALCGDIDAVRSDIEAVRAAAAGAVLKVIVESAVLLGQSNAHTLVDACRAA
EDAGADFVKTSTGCHPAGGATVRAVELMAETVGPRLGVKASGGIRTAADA
VAMLNAGATRLGLSGTRAVLDGLS
433633489YP_007267116.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MLVLLVAVLVTAVYAFVHAALQRPDAYTAADKLTKPVWLVILGAAVALAS
ILYPVLGVLGMAMSACASGVYLVDVRPKLLEIQGKSR
433633487YP_007267114.1 Putative transcriptional regulatory protein [Mycobacterium canettiiMSSEEKLAAKVSTKASDVASDIGSFIRSQRETAHVSMRQLAERSGVSNPY
LSQVERGLRKPSADVLSQIAKALRVSAEVLYVRAGILEPSETSQVRDAII
TDTAITERQKQILLDIYASFTHQNEATREECPSDRTPTDD
433633485YP_007267112.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MAERIPAVTVKTDGRKRRWHQHKVERRNELVDGTIEAIRRHGRFLSMDEI
AAEIGVSKTVLYRYFVDKNDLTTAVMMRFTQTTLIPNMIAALSADMDGFE
LTREIIRVYVETVAAQPEPYRFVMANSSASKSKVIADSERIIARMLAVML
RRRMHEAGMDTGGVEPWAYLIVGGVQLATHSWMSDPRMSSDELIDYLTML
SWSALCGIVEAGGSLEKFREQPHPSPIVPAWGQV
433633483YP_007267110.1 Mycolic acid synthase PcaA (cyclopropane synthase) [Mycobacterium cMSVQLTPHFGNVQAHYDLSDDFFRLFLDPTQTYSCAYFERDDMTLQEAQI
AKIDLALGKLNLEPGMTLLDIGCGWGATMRRAIEKYDVNVVGLTLSENQA
GHVQKMFDQMDTPRSRRVLLEGWEKFDEPVDRIVSIGAFEHFGHQRYHHF
FEVTHRTLPADGKMLLHTIVRPTFKEGREKGLTLTHELVHFTKFILAEIF
PGGWLPSIPTVQEHAEKVGFRVTRVQSLQLHYARTLDMWAAALEANKDQA
IAIQSQTVYDRYMKYLTGCAKLFRQGYTDVDQFTLEK
433633481YP_007267108.1 Putative 3-hydroxybutyryl-CoA dehydrogenase FadB2 (beta-hydroxybutyMSDAIQRVGVVGAGQMGSGIAEVSARAGVEVTVFEPAEALITAGRNRIVK
SLERAISAGKVTERERDRALGLLTFTTDLNDLSDRQLVIEAVVEDEAVKS
EIFAELDRVVTDPDAVLASNTSSIPIMKVAAATKQPQRVLGLHFFNPVPV
LPLVELVPTLVTDEAAAARTEEFASTVLGKQVVRCSDRSGFVVNALLVPY
LLSAIRMVEAGFATVEDVDKAVVAGLSHPMGPLRLSDLVGLDTLKLIADK
MFEEFKEPHYGPPPLLLRMVEAGQLGKKSGRGFYTY
433633479YP_007267106.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MSLDKKLMPVPDGHPDVFDREWPLRVGDIDRAGRLRLDAACRHIQDIGQD
QLREMGFEETHPLWIVRRTMVDLIRPIEFGDMLRCRRWCSGTSNRWCEMR
VRVDGRKGGLIESEAFWIHVNRETEMPARIADDFLAGLHRTTSVDRLRWK
GYLKPGSRDDASEIHEFPVRVTDIDLFDHMNNSVYWSVIEDYLASHAELL
RGPLRVTIEHEAPVALGDKLEIISHVHPAGSTEIFGPGLVDRAVTTLTYV
VGDEPKAVASLFNL
433633477YP_007267104.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MTGQNGQLARISPGKFRQLGPVNWLVAKLAARAVGAPQMHLFTTLGYRQY
LFWTFAIYTGRLLRGRLPGVDTELVILRVAHLRSCEYELQHHRRMARRRG
LDANTQATIFAWPDVPDGDGPRKVLSARQQALLQATDELIKDRMITAGTW
ERLATHLGPRLLIEFCLLATQYDAIAATITALAIPLDNPQ
433633475YP_007267102.1 Dihydrolipoamide dehydrogenase Lpd (lipoamide reductase (NADH)) (liMTHYDVVVLGAGPGGYVAAIRAAQLGLSTAIVEPKYWGGVCLNVGCIPSK
ALLRNAELVHVFTKDAKAFGISGEVTFDYGIAYDRSRKVAEGRVAGVHFL
MKKNKITEIHGYGTFADANTLLVDLNDGGTESVTFDNAIIATGSSTRLVP
GTSLSANVVTYEEQILSRELPKSIIIAGAGAIGMEFGYVLKNYGVDVTIV
EFLPRALPNEDADVSKEIEKQFKKLGVTILTATKVESIADGGSQVTVTVT
KDGVAQELKAEKVLQAIGFAPNVEGYGLDKAGVALTDRKAIGVDDYMRTN
VGHIYAIGDVNGLLQLAHVAEAQGVVAAETIAGAETLTLGDHRMLPRATF
CQPNVASFGLTEQQARDEGYDVVVAKFPFTANAKAHGVGDPSGFVKLVAD
AEHGELLGGHLIGHDVAELLPELTLAQRWDLTASELARNVHTHPTMSEAL
QECFHGLVGHMINF
433633473YP_007267100.1 Conserved membrane protein of unknown function [Mycobacterium canetMLVGNAIGLLAGVACSVLVHARIRPDIVIAMVVGIPSAIGLLVILFSGRR
WVTMLGAFILALAPGWFGVLVAIQVASSG
433633471YP_007267098.1 Putative aldehyde dehydrogenase [Mycobacterium canettii CIPT 140070MTVFSRPGSAGALMSYESRYQNFIGGQWVAPVRGRYFENPTPVTGQPFCE
VPRSDAADIDKALDAAQAAAPGWGKTAPAERAAILNTIADRIDKNAAALA
VAEVWDNGKPVREALAADIPLAVDHFRYFAAAIRAQEGALSQIDEDTVAY
HFHEPLGVVGQIIPWNFPILMAAWKLAPALAAGNTAVLKPAEQTPASVLY
LMSLIGDLLPPGVVNVVNGFGAEAGKPLASSDRIAKVAFTGETTTGRLIM
QYASHNLIPVTLELGGKSPNIFFADVLAAHDDFCDKALEGFTMFALNQGE
VCTCPSRSLIQADIYDEFLELAAIRTKAVRQGDPLDTETMLGSQASNDQL
EKVLSYIEIGKQEGAVIIAGGERAELGGDLSGGYYMQPTIFTGTNNMRIF
QEEIFGPVVAVTSFTDYDDAIGIANDTLYGLGAGVWSRDGNTAYRAGRDI
QAGRVWVNCYHLYPAHAAFGGYKQSGIGREGHQMMLEHYQHTKNLLVSYS
DKAMGFF
433633469YP_007267096.1 Conserved protein of unknown function- possible toxin [MycobacteriuMADAGRLTGIHSATTGPTLPRHVSAEAWCRLSRLPATPKSPIPGVVAGGE
RWSGRRFEGAGPAGWIRRCATSPLPS
433633467YP_007267094.1 Conserved exported protein of unknown function [Mycobacterium canetMSRLSSILRAGAAFLALGIAAATFPQSAAADSTEDFPIPRRMIATTCDAE
QYLAAVRDTSPVYYQRYMIDFNNHANLQQATINKAHWFFSLSPAERRDYS
EHFYNGDPLTFAWVNHMKIFFNNKGVVAKGTEVCNGYPAGDMSVWNWA
433633465YP_007267092.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MSQAPGNEIPHTLAALDWGGITCQSGAGCTNRANYVVHLHAVDECNDPDL
DPFGNTVEILCIACLWHVEAKVLLQVGRLTRSPGAFCLTCGAPVREPNDI
MRDVAAL
433633463YP_007267090.1 Putative transcriptional regulatory protein [Mycobacterium canettiiMRYPLAVAQLGFQRARTEENKRQRAAALVEAARSLALETGVASVTLTAVA
GRAGIHYSAVRRYFTSHKEVLLHLAAEGWARWSGTVCEQLGEPGPMSAPR
VAEALANGLAADPLFCDLLANLHLHLEQEVDVDRVIEVKRTSIAAVIALV
DAIESALPALGRSGAFDILLAAYSLAATLWQIANPPERLTDAYAEEPELL
PPEWNLDFAAALTRLLTATLLGLLAESPCECRSPAR
433633461YP_007267088.1 Conserved membrane protein of unknown function- MmpL4 [MycobacteriuMSTKFANDSNTNARPEKPFIARMIHAFAVPIILGWLAVCVVVTVFVPSLE
AVGQERSVSLSPKDAPSFEAMGRIGMVFKEGDSDSFAMVIIEGNQPLGDA
AHKYYDGLVAQLRADKKHVQSVQDLWGDPLTAAGVQSNDGKAAYVQLSLA
GNQGTPLANESVEAVRSIVESTPAPPGIKAYVTGPSALAADMHHSGDRSM
ARITMVTVAVIFIMLLLVYRSIITVVLLLITVGVELTAARGVVAVLGHSG
AIGLTTFAVSLLTSLAIAAGTDYGIFIIGRYQEARQAGEDKEAAYYTMYR
GTAHVILGSGLTIAGATFCLSFARMPYFQTLGIPCAVGMLVAVAVALTLG
PAVLHVGSRFGLFDPKRLLKVRGWRRVGTVVVRWPLPVLVATCAIALVGL
LALPGYKTSYNDRDYLPDFIPANQGYAAADRHFSQARMKPEILMIESDHD
MRNPADFLVLDKLAKGIFRVPGISRVQAITRPEGTTMDHTSIPFQISMQN
AGQLQTIKYQRDRANDMLKQADEMATTIAVLTRMHSLMAEMASTTHRMVG
DTEEMKEITEELRDHVADFDDFWRPIRSYFYWEKHCYGIPICWSFRSIFD
ALDGIDKLSEQIGVLLGDLREMDRLMPQMVAQIPPQIEAMENMRTMILTM
HSTMTGIFDQMLEMSDNATAMGKAFDAAKNDDSFYLPPEVFKNKDFQRAM
KSFLSSDGHAARFIILHRGDPQSPEGIKSIDAIRTAAEESLKGTPLEDAK
IYLAGTAAVFHDISEGAQWDLLIAAISSLCLIFIIMLIITRAFIAAAVIV
GTVALSLGASFGLSVLLWQHILAIHLHWLVLAMSVIVLLAVGSDYNLLLV
SRFKQEIGAGLKTGIIRSMGGTGKVVTNAGLVFAVTMASMAVSDLRVIGQ
VGTTIGLGLLFDTLIVRSFMTPSIAALLGRWFWWPLRVRSRPARTPTVPS
ETQPAGRPLAMSSDRLG
433633459YP_007267086.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MHHSFAYRSYSWYVDVDNLPQLPWWLRPFARFHADDHFADPFSCPPHSSL
RDRLDAFFAARGLAIPDGRITALLQARVLGYVFNPLSIFWCHDRDGQLRH
VIAEVHNTYGGRHAYLLPPADLPVVTAKNFYVSPFHQLAGYYLIRAPRPD
RELDVTVTLHRDRRQVCPEFTATLRGQRRPATTRQIAMMQIISPLAPMVV
AARIRIQGIRLWLRRVPVVPR
433633457YP_007267084.1 Conserved membrane protein of unknown function [Mycobacterium canetMVTSVSALAVAVVHSVAFAIGRRIGRYNVVDVVWGLGFVAVAVAAATLGH
GDPVRRWLLLALVSTWGLRLSWHMYRKTAGQGEDPRYADLLRGATPVQAL
RKVFGLQGLLTLFVSFPLQLSAVTGPTPKPLLAVGGVGLAVWLVGITFEA
VGDWQLWVFKSDPANRGVIMDRGLWAWTRHPNYFGDACVWWGLWLITIND
WAPLATVGSPLLMTYLLVDVSGARLTERYLKGRPGFAEYQRRTAYFVPRP
PRSARR
433633455YP_007267082.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MTEHTDFELLELATPYALNAVSDDERADIDRRVAAAPSPVAAAFNDEVRA
VRETMAVVSAATTAEPPAHLRTAILDATKPEVRRQSRWRTAAFASAAAIA
VGLGAFGLGVLTRPSPPPTVAEQVLTAPDVRTVSRPLGAGTATVVFSRDR
NTGLLVMNNVAPPSRGTVYQMWLLGGAKGPRSAGTMGTAAVTPSTTATLT
DLGASTALAFTVEPGTGSPQPTGTILAELPLG
433633453YP_007267080.1 Conserved protein of unknown function- PPE family protein [MycobactMTSPHFAWLPPEINSALMFAGPGSGPLIAAATAWGELAEELLASIASLGS
VTSELTSGAWLGPSAAAMMAVATQYLAWLSTAAAQAEQAAAQAMAIATAF
EAALAATVQPAVVAANRGLMQLLAATNWFGQNAPALMDVEAAYEQMWALD
VAAMAGYHFDASAAIAQLAPWQQVLRNLGIDIGKNGQINLGFGNTGSGNI
GNNNIGSGNLGSGNTGSGNIGSGNTGSGNLGFGNLGDANIGFGNTGSGNI
GFGITGDHQMGFGGFNSGSGNIGFGNSGTGNVGFFNSGSGNIGIGNSGSL
NIGFGTSGTINAGLGSAGSMSTSFWNAGMQHAALGSAAGTEVALASSAGY
ATGGMSTAALSSGILGSALGSTGGLQHGLANALNSGLTNTPVATPASAPV
GGLDSGNPNTGSGGAATGSGANPGLRGSGTSYPGLVNSVSNDSGLRNTAV
REPGVTGSSAPGSGIPKSNFYPSPDRESADANQRIGQPVGSE
433633451YP_007267078.1 60 kDa chaperonin 2 GroEL2 (protein cpn60.2) (GroEL protein 2) (65 MAKTIAYDEEARRGLERGLNALADAVKVTLGPKGRNVVLEKKWGAPTITN
DGVSIAKEIELEDPYEKIGAELVKEVAKKTDDVAGDGTTTATVLAQALVR
EGLRNVAAGANPLGLKRGIEKAVEKVTETLLKGAKEVETKEQIAATAAIS
AGDQSIGDLIAEAMDKVGNEGVITVEESNTFGLQLELTEGMRFDKGYISG
YFVTDPERQEAVLEDPYILLVSSKVSTVKDLLPLLEKVIGAGKPLLIIAE
DVEGEALSTLVVNKIRGTFKSVAVKAPGFGDRRKAMLQDMAILTGGQVIS
EEVGLTLENADLSLLGKARKVVVTKDETTIVEGAGDTDAIAGRVAQIRQE
IENSDSDYDREKLQERLAKLAGGVAVIKAGAATEVELKERKHRIEDAVRN
AKAAVEEGIVAGGGVTLLQAAPTLDELKLEGDEATGANIVKVALEAPLKQ
IAFNSGLEPGVVAEKVRNLPAGHGLNAQTGVYEDLLAAGVADPVKVTRSA
LQNAASIAGLFLTTEAVVADKPEKEKASVPGGGDMGGMDF
433633449YP_007267076.1 Putative molybdopterin biosynthesis protein MoeA2 [Mycobacterium caMRSVEEHQRVVAEMIRACRPITVSLTQAQGLVLARDVVAPLSLPVFDNSA
MDGYAVRAEDTSGATPQNPVMLPVAEDIPAGRADMLTLQPVTAHRIMTGA
PVPTGATAIVPVEATDGGVDSVTIRQQASPGKHIRRSGEDVAAGTTVLHN
GQIVTPAVLGLAAALGLAELPVLPRQRVLVISTGSELVSPGTPLQPGQIY
ESNSIMLAAAVRDAGAAVVATATAGDDVAQFGAILDRYAVDADLIITSGG
VSAGAYEVVKDAFGSADYRGGDHGVEFVKVAMQPGMPQGVGRVAGTPIVT
LPGNPVSALVSFEVFIRPPLRMAMGLPDPYRPHRSAVLTESLTSPRGKRQ
FRRAILDHQAGTVISYGPPASHHLRWLASANGLLDIPEDVVEVAAGTQLQ
VWDLT
433633447YP_007267074.1 Putative CDP-diacylglycerol--serine O-phosphatidyltransferase PssA MIGKPRGRRGVHLQILPSAMTVLSICAGLTAIKFALEHQPKAAIALIAAA
AILDGLDGRVARILDAQSRMGAEIDSLADAVNFGVTPALVLYVSMLSKWP
VGWVVVLLYAVCVVLRLARYNALQDDGTQPAYAHEFFVGMPAPAGAVSMI
GLLALKMQFGEGWWTSVWFLSFWVTGTSILLVSGIPMKKMHAVSVPPNYA
AALLAVLAICAAAAVLAPYLLIWVIIIAYMCHIPFAVRSQRWLAQHPEVW
DDKPKQRRAVRRASRRAHPYRPSMARLGLRKPGRRL
433633445YP_007267072.1 Putative transcriptional regulator- XRE family- Helix-turn-helix prMSAGAAVREWRTRRRLSQLALAHQVGVSPRHISFVETGRANASRNLLLGI
GESLDLPLSARNRLLLAGGYAPAFSEHTLDAERMRPVKAAVDAVLCGHAP
YPAIVTDACWNLVAANVGCLVLVEGVDPTLVSRPINVMRLCLHPRGLAAR
LRNHAEVRSAILRRIRRHVEATAAPDIRRLYEEVSGYPAPRAAHATEQPT
ELYVPFRLVTLDGVELRFVNTIATFGSPLDICVESLAMESFFPADTATGD
HLHRLDSGQRLRTIADQYPQLLDFISGR
433633443YP_007267070.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MTSDFAPVELAMFPLESVPLPDEDLPLRIFEPRYAALVRDCMDTADPGFG
VVLISRGREVGGGDTRCDVGTLARITECADAGSGRYMLRCRVGERIRVCD
WLPDDPYPRAKVRFWPDQPGHPVTAAQLLEVEDRVMALFERIAAARGVRL
PARDVVLGYPVVDPADTGQRLYALACRVPMGPADRYAVLAAPSAADRLIC
LGDALDSVAAMVEFELST
433633441YP_007267068.1 Superoxide dismutase [Cu-Zn] SodC [Mycobacterium canettii CIPT 1400MPKPADHRNHAAVSTSVLSALFLGAGAALLSACSSPQHASTVPGTTPSIW
TGSPAPSGLSGHDEESPGAQSLTSTLTAPDGTKVATAKFEFANGYATVTI
ATTGVGKLTPGFHGLHIHQVGKCEPNSVAPTGGAPGNFLSAGGHYHVPGH
TGTPASGDLASLQVRGDGSAMLVTTTDAFTMDDLLSGAKTAIIIHAGADN
FANIPPERYVQVNGTPGPDETTLTTGDAGKRVACGVIGSG
433633439YP_007267066.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MDSAMARAIRSGDDAEVADGLTRREHDILAFERQWWKFAGVKEEAIKELF
SMSATRYYQVLNALVDRPEALAADPMLVKRLRRLRASRQKARAARRLGFE
VT
433633437YP_007267064.1 Putative Gcn5-related N-acetyltransferase [Mycobacterium canettii CMVSWPGLGTRVTVRYRRPAGSMPPLTDAVGRLLAVDPTVRVQTKTGTIVE
FSPVDVVALRVLTDAPVRTAAIRALEHAAAAAWPGVERTWLDGWLLRAGH
GAILAANSAVPLDISAHMNTITEISAWYASRDLQPWLAVPDRLLPLPAGL
AGERREQVLVRDVSTGEPDRSVTLLDHPDDTWLRLYHQRLPLDMATPVLD
GELAFGSYLGVAVARAAVTDAPDGTRWVGLSAMRAADEQSATGSAGRQLW
EALLGWGASLGATRGYARVHDTATSVLAESLGFRLHHRCRYLPAQSVGWD
TF
433633435YP_007267062.1 Conserved membrane protein of unknown function [Mycobacterium canetMSVVGGTVRTVGRTVSGAATATTAAAGAVGGAAVSGIVGGVTGAAKGIQK
GLSSGSKSTAAAALAIGAIGVAGLVDWPILLAVGGGALLLRKLNRTPEVA
APPVKAKLAPVPDKPAAAKEAPAKASKTTARKTSGRRAGTAELRSTN
433633433YP_007267060.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MAEKNTRRATSQREAVAKIREAETIVMNLPICGQVKIPRPEHLAYYGGLA
ALAALELIDWPVALVIATGHILANNHHNRVLEELGEAMEEA
433633431YP_007267058.1 Putative phosphomethylpyrimidine kinase ThiD (HMP-phosphate kinase)MTPPRVLSIAGSDSGGGAGIQADMRTMALLGVHACVAVTAVTVQNTLGVK
DIHEVPDDVVAGQIEAVVTDIGVQAAKTGMLASSRIVATVAATWRRLELS
VPLVVDPVCASMHGDPLLAPSALDSLRGQLFPLATLLTPNLDEARLLVDI
EVVDAESQRAAAKALHALGPQWVLVKGGHLRSSDGSCDLLYDGVSCYQFD
AQRLPTGDDHGGGDTLATAIAAALAHGFTVPDAVDFGKRWVTECLRAAYP
LGRGHGPVSPLFRLS
433633429YP_007267056.1 Conserved membrane protein of unknown function [Mycobacterium canetMRLHDASAAAPESRMHIARHGEAVNRRQMFIGITGLLLAVIGLMALWFPV
YLDQYDAYGIKVTCGSGWRSNLTQALYADGNDNTQALVTRCDTALLVRRA
WAIPSVALGWLLVTGFLVMWVHNDQHQGQSYPGYRA
433633427YP_007267054.1 Putative lipoprotein aminopeptidase LpqL- possibly membrane anchoreMVNKSRMMPAVLAVAVVVAFLTTGCIRWSTQSRPVVNGPAAAEFAVALRN
RVSTDAMMAHLSKLQDIANANDGTRAVGTPGYQASVDYVVNTLRNSGFDV
QTPEFSARVFKAEKGVVTLGGNTVEARALEYSLGTPPDGVTGPLVAAPAD
DSPGCSPSDYDRLPVSGAVVLVDRGVCPFAQKEDAAAQRGAVALIIADNI
DEQAMGGTLGANTDVKIPVVSVTKSVGFQLRGQAGPTTVKLTASTQSFKA
RNVIAQTKTGSSANVVMAGAHLDSVPEGPGINDNGSGVAAVLETAVQLGN
SPHVSNAVRFAFWGAEEFGLIGSRNYVESLDIDALKGIALYLNFDMLASP
NPGYFTYDGDQSLPLDARGQPVVPEGSGGIERTFVAYLKMAGKTAQDTSF
DGRSDYDGFTLAGIPSGGLFSGAEVKKSAEQAELWGGTADEPFDPNYHQK
TDTLDHIDRTALGINGAGVAYAVGLYAQDLGGPNGVPVMADRTRHLIAKP
433633425YP_007267052.1 Putative protein ThiS [Mycobacterium canettii CIPT 140070017]MIVVVNEQQVEVDEQTTIAALLDSLGFGDRGIAVALNFSVLPRSDWATKI
CELRKPVRLEVVTAVQGG
433633423YP_007267050.1 Putative thiamine-phosphate pyrophosphorylase ThiE (TMP pyrophosphoMHESRLASARLYLCTDARRERGDLAQFAEAALAGGVDIIQLRDKGSPGEL
RFGPLQARDELAACEILADAAHRYGALFAVNDRADIARAAGADVLHLGQR
DLPVNVARQILAPDTLIGRSTHDPDQVAAAAAGDADYFCVGPCWPTPTKP
GRAAPGLGLVRVAAELGGDDKPWFAIGGINAQRLPAVLDAGARRIVVVRA
ITSADDPRAAAEQLRSALTAAN
433633421YP_007267048.1 Conserved membrane protein of unknown function [Mycobacterium canetMTVELAHPSTEPLGSRSPAEPAHPRRWFISTTPGRIMTIGIVLAALGVAS
AFATSTTIEHRQQVLTAVLDHTEPLSFAAGRLYTTLSVADAAAATAFIAQ
AEPGGVRLRYEQAITDASVAVTRASSGLTDESLVQLLGRINAELAVYTGL
VEIARANNRAGNPVGSSYLSEASGLMQSTILPDAQRLYQATSARVDRETT
ASTQIPAPVILVVATTVVFGAFAHRWLARRTRRRINPGLVVGALGILVMV
VWVGTALTISTTASRSAKDTAAESLKTITNLAITAQQARADETLSLIRRG
DEEVRKQAFYQRIDAMQRQLNDYMARRHAVDKPDLQGADQLLVRWRQAND
RINSYISVGNYRAATQVALGKGEDDATPAFDKLDEALTKAMGQSRTQLRH
DILNAHRGLAGAQVGGVVLSLGAAIAVALGLWPRLKEYR
433633419YP_007267046.1 Putative serine/threonine-protein kinase PknG [Mycobacterium canettMAKASETERSGPGTQPADAQTATSATVRPLSTQAVFRPDFGDEDNFPHPT
LGPDTEPQDRMATTSRVRPPVRRLGGGLVEIPRAPDIDPLEALMTNPVVP
ESKRFCWNCGRPVGRSDSETKGASEGWCPYCGSPYSFLPQLNPGDIVAGQ
YEVKGCIAHGGLGWIYLALDRNVNGRPVVLKGLVHSGDAEAQAMAMAERQ
FLAEVVHPSIVQIFNFVEHTDRHGDPVGYIVMEYVGGQSLKRSKGQKLPV
AEAIAYLLEILPALSYLHSIGLVYNDLKPENIMLTEEQLKLIDLGAVSRI
NSFGYLYGTPGFQAPEIVRTGPTVATDIYTVGRTLAALTLDLPTRNGRYV
DGLPEDDPVLKTYDSYGRLLRRAIDPDPRQRFTTAEEMSAQLTGVLREVV
AQDTGVPRPGLSTIFSPSRSTFGVDLLVAHTDVYLDGQVHAEKLTANEIV
TALSVPLVDPTDVAASVLQATVLSQPVQTLDSLRAARHGALDADGVDFSE
SVELPLMEVRALLDLGDVAKATRKLDDLAERVGWRWRLVWYRAVAELLTG
DYDSATKHFTEVLDTFPGELAPKLALAATAELAGNADEHKFYQTVWSTND
GVISAAFGLARARSAEGDRVGAVRTLDEVPPASRHFTTARLTSAVTLLSG
RSTSEVTEEQIRDAARRVEALPPTEPRVLQIRALVLGGALDWLKDNKAST
NHILGFPFTSHGLRLGVEASLRSLARVAPTQRHRYTLVDMANKVRPTSTF
433633417YP_007267044.1 Putative phosphate acetyltransferase Pta (phosphotransacetylase) [MMADSSAIYLAAPESQTGKSTIALGLLHRLTAMVAKVGVFRPITRLSAERD
YILELLLAHTSAGLPYERCVGVTYQQLHADRDDAIAEIVDSYHAMADECD
AVVVVGSDYTDVTSPTELSVNARIAVNLGAPVLLTVRAKDRTPDQVASVV
EVCLAELDTQRAHTAAVVANRCELSAIPAVTDALRRFTPPSYVLPEEPLL
SAPTVAELTQAVNGAVVSGDVALREREVMGVLAAGMTADHVLERLTDGMA
VITPGDRSDVVLAVASAHAAEGFPSLSCIVLNGGFELHPAIAALVSGLRL
RLPVIATALGTYDTASAAASARGLVTATSQRKIDTALELMDRHVDVAGLL
AQLTIPIPTVTTPQMFTYRLLQQARSDLMRIVLPEGDDDRILKSAGRLLQ
RGIVDLTILGDEAKVRLRAAELGVDLDGATVIEPCASELHDQFADQYAQL
RKAKGITVEHAREIMNDATYFGTMLVHNCHVDGMVSGAAHTTAHTVRPAL
EIIKTVPGISTVSSIFLMCLPDRVLAYGDCAIIPNPTVEQLADIAICSAR
TAAQFGIGPRVAMLSYSTGDSGKGADVDKVRAATELVRAREPQLPVEGPI
QYDAAVEPSVAATKLGDSPVAGRATVLIFPDLNTGNNTYKAVQRSAGAIA
IGPVLQGLRKPVNDLSRGALVDDIVNTVAITAIQAQGVHE
433633415YP_007267042.1 Conserved protein of unknown function- Beta lactamase like protein MAELVQITDKVHLARGHAVNWVLVTDDTGVLLIDAGYPGDRAEVLASLNK
LGYTPGDVRAIVLTHAHIDHLGSAIWFAREHSTPVYCHAEEVGHAKREYR
ENASVFDVALRSWRPRVAVWGIHLLRRGGLTGDGIPTAQPLTAEAAAGLP
GQPMAIFTPGHTSGHCSYVVDGVLASGDALITGHPMLRHRGPQLLPAVFS
HSQQNSIRSLAALALLETNILAPGHGELWHGPIRKATDEALERAQKSNHV
FR
433633413YP_007267040.1 Putative fatty-acid--CoA ligase [Mycobacterium canettii CIPT 140070MSVISTLRDRATTTPSDEAFVFMDYDTKTGDQIDRMTWSQLYSRVTAVSA
YLISYGRHADRRRTAAISAPQGLDYVAGFLGALCAGWTPVPLPEPLGSLR
DKRTGLAVLDCAADVVLTTSQAETRVRATIATHGASVTTPVIALDTLDEP
SGDNCDLDSQLSDWSSYLQYTSGSTANPRGVVLSMRNVTENVDQIIRNYF
RHEGGATRLPSSVVSWLPLYHDMGLMVGLFIPLFVGCPVILTSPEAFIRK
PARWMQLLAKHQAPFSAAPNFAFDLAVAKTSEEDMAGLDLGHVNTIINGA
EQVQPNTITKFLRRFRPYNLMPAAVKPSYGMAEAVVYLATTKAGSPPTST
EFDADSLARGHAELSTSETERATRLIRYHSDDKEPLLRIVDPDSNIELGP
GRIGEIWIHGKNVSTGYHNADDALNRDKFQASIREASAGTPRSPWLRTGD
LGFIVGDEFYIVGRMKDLIIQDGVNHYPDDIETTVKEFTGGRVAAFSVSD
DGVERLVIAAEVRTEHGPDKVTIMDFSMIKRLVVSALSKLHGLHVTDFLL
VPPGALPKTTSGKISRAACAKQYGANKLQRVATFP
433633411YP_007267038.1 Putative transmembrane transport protein MmpL1 [Mycobacterium canetMRSQRLAGHLSAAARTIHALSLPIILFWVALTIVVNVVAPQLQSVARTHS
VALGPHDAPSLIAMKRIGKDFQQFDSDTTAMVLLEGQEKLGDEAHRFYDV
LVTKLSQDTTHVQHIENFWGDPLTAAGSQSADGKAAYVQLNLTGDQGGSQ
ANESVAAVQRIVDSVPPPPGIKAYVTGPGPLSADRVVYGDRSLHTITGIS
IAVIAIMLFIAYRSLSAALIMLLTVGLELLVVRGIISTFAVNDLMGLSTF
TVNVLVALTIAASTDYIIFLVGRYQEARATGQNREAAYYTMFGGTAHVVL
ASGLTVAGAMYCLGFTRLPYFNTLASPCAIGLVTVMLASLTLAPAIIAVA
SRFGLFDPKRATTKRRWRRIGTVVVRWPGPVLAATLLIALIGLLALPKYQ
TNYNERYYIPSAAPSNIGYLASDRHFPQARMEPEVLMVEADHDLRNPTDM
LILDRIAKTVFHTPGIARVQSITRPLGAPIDHSSIPFQLGMQSTMTIENL
QNLKDRVADLSTLTDQLQRMIDITQRTQELTRQLTDATHDMNAHTRQMRD
NANELRDRIADFDDFWRPLRGFTYWERHCFDIPICWSMRSLLDSMDNVDK
LTEDLANLTDDTERMDTVQRQLLAQLDPTIATMQTVKDLAQTLTSAFSGL
VTQMEDMTRNATVMGRTFDAANNDDSFYLPPEAFQNPDFQRGLKLFLSPD
GTCARFVITHRGDPASAEGISHIDPIMQAADEAVKGTPLQGASIYLAGTS
STYKDIHEGTLYDVMIAVVASLCLIFIIMLGITRSVVASAVIVGTVALSL
GSAFGLSVLIWQHILHMPLHWLVLPMAIIVMLAVGSDYNLLLIARFQEEI
GAGLKTGMIRAMAGTGRVVTIAGLVFAFTMGSMVASDLRVVGQIGTTIMI
GLLFDTLVVRSYMTPALATLLGRWFWWPRRVDRLPAATPTTPGRRVHPGH
AARAAIPK
433633409YP_007267036.1 Acyl-CoA dehydrogenase FadE7 [Mycobacterium canettii CIPT 140070017MSTDIPPAFDRTDPLGLDASLSSDEIALRDTVRGFCAEHVTPHVAGWFED
GDLPVARDLVKQFGDLGLLGMHLRGYGCDGASAVHYGLACLELEAADSGI
RSLVSVQGSLAMFAIASFGSEEQKLRWLPAMATGDLVGCFGLTEPDAGSD
PAAMKTRARRHGSDWVINGRKMWITNGSIADIAIVWAATEDGSGVIRGFI
IPTDTPGFAANTIHHKLSLRASITSELLLDDVRLPAEALLPYATGLKAPL
ACLSEARYGIVWGAIGAARSAWQCALDYAIQRTQFGRPIAGFQLTQAKLV
DMAVELHKGQLLALHLGRRKDSVGLRPEQVSFGKLNNTREAIEICRTART
ILGGNGISLEYPVIRHMVNLESVLTYEGTAEMHQLVLGQALTGLAAFR
433633407YP_007267034.1 Putative membrane NADH dehydrogenase NdhA [Mycobacterium canettii CMTPPSRESSTLRKRHHVVIIGSGFGGLNAAKALKRADVDITLISKTTTHL
FQPLLYQVATGILSEGDIAPTTRLILRRQKNVRVLLGEVNAIDLKAQTVT
SKLMDMTTVTPYDSLIVAAGAQQSYFGNDEFATFAPGMKTIDDALELRGR
ILGAFEAAEVSTDHAERERRLTFVVVGAGPTGVEVAGQIVELAERTLAGA
FRTITPSECRVILLDAAPAVLPPMGPKLGLKAQRRLEKMDVEVQLNAMVT
AVDYKGITIKEKDGGERRIECACKVWAAGVAASPLGKMIAEGSDGTEIDR
AGRVIVEPDLTVKGHPNVFVVGDLMFVPGVPGVAQGAIQGARYATTVIKH
MVKGNDDPANRKPFHYFNKGSMATISRHSAVAQVGKLEFAGYFAWLAWLV
LHLVYLVGYRNRIAALFAWGISFMGRARGQMAITSQMIYARLVMTLMEQQ
AQGALAAAEQAEHAEQEAAG
433633405YP_007267032.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MSYAGDITPLQAWEMLSDNPRAVLVDVRCEAEWRFVGVPDLSSLGREVVY
VEWATSDGTHNDNFLAELRDRIPADADQHERPVIFLCRSGNRSIGAAEVA
TEAGITPAYNVLDGFEGHLDAEGHRGVVGWRAIGLPWKQR
433633403YP_007267030.1 Conserved protein of unknown function- PPE family [Mycobacterium caMDFGALPPEINSARIYSGPGSRPLMQAAAAWQRLANELTATAASYSAVIS
GLTGDDWLGPSALSMAAAAVPYVAWLRATAASAEQAAAQAVAAANAYESA
YAATVPPTVIATNRSTMLSLVKTNVFGQNTPAIATSEAQYGEMWAQDIVA
MEGYAGASAAASQLPPFTPPPATTTGAGPLSDAATTAAQPVAPAAAATDV
SLLPTLQSFLPPPFNAIPNPIEDLDVLVAAAVTVAAGSLGVSAAQLGEIY
RHDVVDEAQKAPHCPAESDQTPAGAAGGGDIPEGGGRFTSPPQPPVAALA
GYSANIGGLSVPHSWNLPPAVRQVAAMFPGATPMYMTGGSDGSYAGLAAA
GLAGTGLAGLAARGGSAPTPAAAAPAGAGGAGPAATRPAAQQTPAIPAAA
AGSAIPGLPPGLPPGVVANLAATLAAIPGATIIVVPPSPNANQ
433633401YP_007267028.1 Monooxygenase [Mycobacterium canettii CIPT 140070017]MGLEDRDALRVLHNAFGPDHPERPNELVRQFYAHWFALDASVRDLFPPDM
GAQRAAFAQALHWVYGELVAQRAEEPVAFLAQLGRDHRKYGVLPTQYDTL
RRALYATLRDYLGHPSRGAWTDAVDEAAGESLDLIIGVMSGAADAEDAPA
WWDGTVVEHIRVSRDLAVVRLQLDRPLHYYPGQYVNVHVPQCPRRWRYLS
PAIPADPNGRIEFHVRVVPGGLVSNAIVGETRPGDRWRLSGPHGAFRVDR
DGGDVLMVAGSTGLAPLRALIMDLSRFAVNPRVHLFFGARYRCELYDLPT
LWQIAAHNPWLSVSPVSEYNGDPAWAADYPDVSAPRGLHVRQTGRLLDVV
TKYGGWGDRQILICGGPAMVRATKAALIAKGAPPERIQHDPLSR
433633399YP_007267026.1 Conserved HTH-domain containing protein of unknown function [MycobaMETFASVLADGRARLGWDQAEFGRRVGVGQQTVSRWERGLSRPKRAMAVT
VANVLGLTADEVLAAAGYIGAVADSSKEISPSVRPLAPTLPFHELTPERF
EAACVEILQHLHPGGHASRFGGPGERQDGIDVLVDGESRAIAQCKRHQQF
GPKDVETAVRAVASPAAKNYLFLSRRTATASARAEMARHDTWQLWDGEDL
SRYVRTKMTRDDSAVRFVDSYFPNHREPFLGVPQPGPWLSIAEFYAATSG
NQPFTHDWVLAGRQTDLAELQTAIESNAHHAAVLFGRGGTGKTRLLRSIA
EIFDGQDWLVRMLPTGSQPDPSAYELLPTHGDVLLIIDDAHERDDVGHIV
ARVRARNRAARVLIACRPYGERDLDRELCRVGVVLSDLPPVRLGDLTEDE
AAVLAREALGPEHSRFADRLAMLTLDCPLATTVGGYLIRTGALDPRNLEQ
DDRIRRQILLGFKDALIAESPHGDSGQRSAVIEAISALQPFRSGDPGFQS
AIAKLVDAPYNRIRHHLRSLEDSGVLIRRGDSLRLAPDLLGDVVLADACF
DKKAGIDSGYLSHVLAAATDDALANAFVNISRVDWQVGHGLAEAAASIWG
SIQRDLEKREIETHLKILALLKRVAPFQPERVISVVRWILDNPVEETPAG
VDPVSLFRRTWRDVLDELPAILHAASGPLECFRESCGILWELAQTDRRPT
HQYPNHPLRVLRELAEYAPQRPPEYNEAIVELAESWAEKAPELSPLTAIE
GLVATEGSTHRYSAGTQTLSIHPFALRQDVVRPIRRRAIELALREIRSGD
YRRGVAGAQFAQLALRYPAGSFGRQVSDEEPKSWNADFIETIDALKELLY
SVQLDPVVCVAILETLHTHSGGHGDGPTRGAAEAAIAALPDSVAFEFALV
VHDGWGALVHEVGTDFERHLRAISDRLSRISSRAVSELDDTALVLLVEER
LQREISAFDRDITGGSRLLGALIEQRSSVIEAIVTRLFENNDSALQILTR
TLVSLLGRWRPEALMGTVHRLLHHPAPAVRMQTIAGLADRDRSVRALHEG
ELELLQQSASCPEVDVRLAVVWAARALAATDARVAGDLLTRIRFSDSRIV
AQHIFLCLDWDSKHLSWPALSAEQQSTLLAGLTDVDDIDDHSIMEFLRRL
AAENPRRVLGLLRQRIEVAEGMHDLRHFSPLPYHWRDPLPLRDHPDFLTH
LRELLAWLGDDSSWKRMHFGRGLFAAAAGAFDEPVLSLLLEILRTETEAD
ARTVARVLEEAPNEFVFDHVGFVSEALTSAARFGTDTLKTMRTSLYNSAT
TGMREGRPGEPFPQDLRLRDECTAIADALPEATAVAHFYRDLSHYGDEAV
KRELRRDNADHRAW
433633397YP_007267024.1 Putative orotate phosphoribosyltransferase PyrE (OPRT) (OPRTase) [MMAELVRQLSVVRGRVTLSSGREADYYVDLRRATLHHRASVLIGRLMRELT
DDWDYALVGGLTMGADPVATAIMHAPGRPIDAFVVRKSAKTHGMQRLIEG
SEVAGRRVLVVEDTSTTGGSALTAVHTVQDAGGDVVGVATVVDRDTGAAE
AIQAEGLLYRSVLGLADLGLR
433633395YP_007267022.1 Putative RNA methyltransferase (RNA methylase) [Mycobacterium canetMSALGPGPTEWGAPTGGVGPWAGDLPDDPRYDPTLLREGDARNVVDAYRY
WTREAIIADIDGRRHPLHVAIENFGHDANIGSVVRTANAFAVHTVHIVGR
RRWNRRGAMVTDRYQRLCHHDSTAELLDFAAGAGLTVVAVDNVPGAARLE
RTALPRECLLVFGQEGPGITEDTRTGAALTVSIAQFGSTRSINAGVAAGI
AMHAWIWQHADLGRAW
433633393YP_007267020.1 Putative transcriptional regulatory protein (probably Lysr-family) MTPAQLRAYSAVVRLGSVRAAAAELGLSDAGVSMHVAALRKELDDPLFTR
TGAGLAFTPGGLRLASRAVEILGLQQQTAIEVTEAAHGRRLLRIAASSAF
AEHAAPGLIELFSSRADDLSVELSVHPTSRFRELICSRAVDIAIGPASES
SIGSDGSIFLRPFLKYQIITVVAPNSPLAAGIPMPALLRHQQWMLGPSAG
SVDGEIATMLRGLAIPESQQRIFQSDAAALEEVMRVGGATLAIGFAVAKD
LAAGRLVHVTGPGLDRAGEWCVATLAPSARQPAVSELVGFISTPRCIQAM
IRGSGVGVTRFRPKVHVTLWS
433633391YP_007267018.1 Putative carbon monoxyde dehydrogenase medium subunit CoxM [MycobacMDHAIGLLDRLGEGARVVAGGHSLLPMMKLRIANPEYLVDINDLAPELGY
VVVGGINNPNLVRLGAMTRHREILDSDALAAVCPIFRDAERVIADPVVRN
RGTLGGSLCQADPAEDLSTVCTVLDAVCLAKGPSGEREIAIDDFLVGPYE
TALAHNEVLIEVRIPLRHNTSSAYAKVERRVGDWAITAAGAAVTLDGQTI
LAARVGLTAVNPDPVALAELSAGLVGQPATEEVFAEAGRRAAQACTPVTD
VRGTAEYKRHLACELTVRTLRTAAGRVLGAPAAPEA
433633389YP_007267016.1 Carbon monoxide dehydrogenase large chain [Mycobacterium canettii CMTTIESRPPSPEDLADNAQQPCGHGRMMRKEDPRFIRGRGTYVDDVVLPG
MLHLAILRSPYAHARIVRIDVTAAQAHPKVKAVVTGADLAAKGLAWMPTL
ANDVQAVLATDKTRFQGQEVAFVVAEDRYSARDACELVDVDYEPLDPVVD
ARRALDPSAPVIRTDLEGKSDNHIFDWETGDAAATEAVFAKADVVVQQEI
VYPRVHPAPMETCGAVADLDPVTGKLTLWTTSQAPHAHRTLYALVAGLPE
HKIRVISPDIGGGFGNKVPIYPGYVCAIVASLLLGKPVKWMEDRSENLTS
TGFARDYIMVGEIAANRDGKILAIRSNVLADHGAFNAQAAPAKYPAGFFG
VFTGSYDIEAAYCHMTAVYTNKAPGGVAYACSFRITEAVYFVERLVDCLA
FELKMDPAELRLRNLLRPNQFPYQSKTGWVYDSGDYETTMRKAMAMIGYD
ALRAEQKERRARGELMGIGMSFFTEAVGAGPRKDMDILGLGMADGCELRV
HPTGKAVLRLSVQTQGQGHETTFAQIVAEELGVAPDDIEVVHGDTDQTPF
GLGTYGSRSTPVSGGAAALVARKVRDKAKIIASGMLEVSVADLQWEKGKF
HVKGDPSAAVTIADIAMRAHGAGDLPEGIEGGLDAEVCYNPSNLTYPYGA
YFCVVDIDPGTAVVKVRRFLAVDDCGTRINPMIIEGQVHGGIVDGIGMAL
MEMIAFDSDGNCLGGSLMDYLIPTALEVPHLETGHTVTPSPHHPIGAKGI
GESATVGSPPAVVNAVVDALAPFGVRHADMPLTPSRVWEAMQGRATPPI
433633387YP_007267014.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MTATQVTGVVLAAGRSNRLGTPKQLLPYRDTTVLGATLDVARQAGFDQLI
LTLGGAASAVRAAVALHGTDVVVVEDVERGCAASLRVALGRVHPRATGIV
LMLGDQPGVDPATLRRLVSDGPAGDVMVCRYADGVGHPFWFSRSVFGELA
RLHGDRGVWKLVHSGRHPVRELAVDGCVPLDVDTWDDYRRLLESVPS
433633385YP_007267012.1 Putative membrane oxidoreductase [Mycobacterium canettii CIPT 14007MPGAQLIGHEGDEYLGKVKVKVGPVTSEFSGKVHFVEQDRNQHRAVFDAK
GKEARGTGNAAATVAAQLHEVGERTRVTVDTDLKIVGKLAQFGSGMLQQV
SEKLLGQFVDSLEAELAAQSSESPQGTPPATEAAPIDLLQLADGGQLKKY
GSALLAALTVLLLIWVLRRRRCSGGTARLRGTKR
433633383YP_007267010.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MPKAVDRVTRVAADLVDSAAAEGARQSRSAKQQLDHWARVGRAVSNQHTA
SRRRVEAALAGHLPMTDLTLEEGVVFNAEISAAIEERLSRTNYGDVLAAQ
GITTVALNDTGDIVEHRPDGTSVVLAATP
433633381YP_007267008.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MNLANRAASAETAVTQRHLRPLWALPGTQLAVVAWPSTRRDRLFGSWHYW
WQAHLLDCLVDAQLRDPQPQRRARINRQVRSHRVRNNFSWLNSYYDDMAW
LALALERADRVAGVRRRRALPKLTNQFVEAWVPEDGGGIPWRKQDQFFNA
PANGPAGLFLARYPDQYGKRLKRAEQMADWIDRTLIDPETHLVFDGIKAG
SLVRAQYTYCQGVVLGLETELAVRTGPAARARHCARVHRLVAAVNEHMAP
LGVLRGAGGGDGGLFAGITARYLALVATTLPGDSADDAAARDTARAIVLA
SAQSAWDYRQTVDGLPVFGAFWDRTAELPTAGGEQARSVRGAVHSSAIAE
RDLSVQLSGWMLMEAAHSAAAVSSLG
433633379YP_007267006.1 Putative fructose-bisphosphate aldolase Fba [Mycobacterium canettiiMPIATPEVYAEMLGQAKQNSYAFPAINCTSSETVNAAIKGFADAGSDGII
QFSTGGAEFGSGLGVKDMVTGAVALAEFTHVIAAKYPVNVALHTDHCPKD
KLDSYVRPLLAISAQRVSKGGNPLFQSHMWDGSAVPIDENLAIAQELLKA
AAAAKIILEIEIGVVGGEEDGVANEINEKLYTSPEDFEKTIEALGAGEHG
KYLLAATFGNVHGVYKPGNVKLRPDILAQGQQVAAAKLGLPADAKPFDFV
FHGGSGSLKSEIEEALRYGVVKMNVDTDTQYAFTRPIAGHMFTNYDGVLK
VDGEVGVKKVYDPRSYLKKAEASMTERVVQACNDLHCAGKSLTR
433633377YP_007267004.1 Conserved membrane protein of unknown function [Mycobacterium canetMPNAPEPDRPAGESGSEPAGERPADPGEERTESYPLVPHDAETETVVITT
SDNDAAVTQPEGQRERRFTAPGFDAKETQVIVTAHEAATEVFQTNQAPTT
PPRMPTGMPPKTAVPQSIPPRTGAKSVRQRTWGWALAVVVIVLALAAIAI
LGTVLLTRGRHSKMSQEDQVRQAIQSLDIAIQTGDLTALRSLTCGSTRDG
YVDYDERDWAETYRRVSAAKQYPVIASIDQVVVNGAHAEANVTTFMAFDP
QVRSTRSLDLQFRDDQWKICQSSSN
433633375YP_007267002.1 Conserved membrane protein of unknown function [Mycobacterium canetMKNIGQRESVRPSPIFLGLVGLTAVGGALAWLAGETVQPLAYAGVFVMVI
AGWLVSLCLHEFGHAFTAWRFGDHDVAVRGYLTLDPRRYSHPMLSLGLPM
LFIALGGIGLPGAAVYVHTWFMTTARRTLVSLAGPTVNLALAMLLLTATR
LLFDPIHAVLWAGVAFLAFLQLTALVLNLLPIPGLDGYAALEPHLRPETQ
RALAPAKQFALVFLLVLFLAPTLNRWFFGVVYWLFDLSGVSHRLAAAGSA
LTRFWSIWF
433633373YP_007267000.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MQQENEEFAVPKIATPTDDELRERRTQILAKLGVSFEDLRARAEQYALVG
DEHEAWEDLQSIAFLLGETRA
433633371YP_007266998.1 Putative adenylosuccinate synthetase PurA (IMP--aspartate ligase) (MPAIVLIGAQWGDEGKGKATDLLGGRVQWVVRYQGGNNAGHTVVLPTGEN
FALHLIPSGVLTPGVTNVIGNGVVIDPGVLLNELQGLQDRGVDTAKLLIS
ADAHLLMPYHIAIDKVTERYMGSKKIGTTGRGIGPCYQDKIARIGIRVAD
VLDPEQLTHKVEAACEFKNQVLVKIYNRKALDPAQVVDALLEQAEGFKHR
IADTRLLLNAALEAGETVLLEGSQGTLLDVDHGTYPYVTSSNPTAGGAAV
GSGIGPTRIGTVLGILKAYTTRVGSGPFPTELFDEHGEYLSKTGHEFGVT
TGRRRRCGWFDAVIARYAARVNGITDYFLTKLDVLSSLESVPVCVGYEID
GRHTRDMPMTQRDLCRAKPVYEELPGWWEDISGAREFDDLPAKARDYVLR
LEALAGAPVSCIGVGPGREQTIVRRDVLQDRP
433633369YP_007266996.1 Conserved protein of unknown function- PPE6/PPE7 family protein [MyMSFAVLPPEINSARLYVGAGLTPMLDAAAAWDGLADELGSAATSFSAVTA
GLAGSSWLGAASTAMAGAAAPYLGWLSAAAAQAQQAATQTRLAAAAFEAA
LAATVHPAIISANRALFVSLVVSNLLGQNAPAIAATEAAYEQMWAQDVAA
MFGYHAGASAAVSALTPFGQALPTVADGGALVSAAAAQVTTRVFRNLGLA
NVGEGNVGNGNVGNFNLGSANIGNGNIGSGNIGSSNIGFGNVGPGLTAAL
NNIGFGNTGSNNIGFGNTGSNNIGFGNTGDGNRGIGLTGSGLLGFGGLNS
GTGNIGLFNSGTGNVGIGNSGTGNWGIGNSGNSYNTGFGNSGDANTGFFN
SGIANTGVGNAGNYNTGSYNPGNSNTGGFNMGQYNTGYLNSGNYNTGLAN
SGNVNTGAFITGNFNNGFLWRGDHQGLIFGSPGFFNSTSAPSSGFFNSGA
GSASGFLNSGANNSGFFNSSSGAIGNSGLANAGVLVSGVINSGNTVSGLF
NMSLVAITTPALISGFFNTGSNVSGFFGGPPVFNLGLANRGVVNILGNAN
IGNYNILGSGNVGDFNILGSGNLGSQNILGSGNVGSFNIGSGNIGVFNVG
SGSLGNYNIGSGNLGIYNIGFGNVGDYNVGFGNAGDFNQGFANTGNNNIG
FANTGNNNIGIGLSGDHQQGFNIASGWNSGTGNSGLFNSGTNNVGIFNAG
TGNVGIANSGTGNWGIGNPGTDNTGILNAGSYNTGFLNAGDFNTGFYNTG
SYNTGGFNVGNTNTGNFNVGDTNTGSYNPGDTNTGFFNPGNVNTGAFDTG
DFNNGFLVAGDNQGQIAIDLSVTTPFIPINEQMVIDVHNVMTFGGNMITV
TEDSTVFPQTFYLSGLFFFGPVNLSASTLTVPTITLTIGGPTVTVPISIV
GALESRTITFLKIDPAPGIGNSTTNPSSGFFNSGTGGTSGFQNVGGGSSG
VWNSGLSSAIGNSGFQNLGSLQSGWANLGNSVSGFFNTSTVNLSTPANVS
GLNNIGTNLSGVFRGPTGTIFNAGLANLGQLNIGSANLGDFNLGSGNVGS
FNVFSGNQGSYNVGPANLGNYNIGFANLGNYNIGFGNAGDFNQGFANTGN
NNIGFANTGNNNIGIGLSGDNQQGFNFAGGWNSGTGNIGLFNSGTNNVGI
GNSGTGNWGIGNSGSGNTGIGNTGSTNTGFFNTGIVNTGVANAGSYNTGW
YNTGDTNTGIANLGDFNTGFYNTGNFSTGFANQGDIATGAFITGDMGNGA
FWRGDQQGLFSAGYRVHVPEIPAHVTVEVPVNIPITASFTNTVYSGITLE
QINFGFTIDIAGIPLLAGAISKAVLPPITGTGPAITVNIGDPGGSTAIRI
PATASVGPFDVTFVNIPATTGFFNATTDPSSGFFNGGPGTVSGIANIGAN
ISGFQNVANSATSGFNNYGSLQSGLANLGDTVSGVFNTGIGAPANVSGMF
NIGSNLAGFFHDQVTGMSMFNLGLGNIGQFNVGFSNVGDSNAGLANIGGF
NLGSGNLGSFNVFGGNQGSYNIGPANLGNYNIGLGNLGSYNFGFGNAGDF
NLGFANTGNNNIGFANTGNNNIGIGLSGDNQQGFNFAGGWNSGSGNGGLF
NSGTNNIGLFNSGTGNIGIGNSGTGNWGIANTGDTNTGIFNTGDVNTGLL
NAGNVNTGIFNTGHYNTGSFNAGSFNTAGFNPGSYNTGYLNTGSYNTGLA
NSGDVNTGGFITGNYSNGFWWRGDYQGLAGISQTITVPDTAVPVKLHVPI
FLDIPVTGTLGTFTVHGFRFPEITGDIFLIGIPFNAATLDAFSFPNISIV
LPNIGINLGSGPDPLIDIAGTGGLLPIKIPLIDIPAAPGFGNSTTTPSSG
FFNTGTGTVSGVGNVGSNSSGFFNLTSGSSGISGVQNFGELISGGFNFGN
TVSGLVNASTLGLSMPANLSGGGNVGATVAGFVNNTQILNLGFGNVGSGN
VGHGNIGDSNVGLGNLGNSNVGHGNIGSFNVFSGNRGSYNIGPANLGNYN
IGLSNLGSYNFGFGNAGDFNLGFANSGSNNIGFANTGNNNIGIGLSGDNQ
QGFGSWNSGTANTGLFNSGTNNIGLFNSGTGNIGIGNSGTGNTGIGNPGV
GNTGLGNSGTGNWGLWNPGTGNMGVANVGTYNTGGYNVGSTNTGIANVGI
ANTGSYNTGSTNTGSFNDGDFNTGFYNTGDYNTGFYNTGDVNTGAFIGGN
FSNGAFWQSDHQGQWGAHYAITVPQIPLLNFSLNIPVNIPIHLDFGTLAV
NGFQIPAITLRALGVTHFSVGPIIVPRIAGTLPVIDINIGDPGGSTSIPI
TITSGAGPVVIPLLDIPPAPGFGNSTTGPSSGFFNSGTGSSSGFGNVGAN
NSGFWNTAFAGIGNSGLQNFGSLQSGWANLGNTVSGFYNTSASDFATPAN
LSGLSNVGADLTGVLRGPNGSTFNAGLANLGQFNVGSANLGSANLGSANL
GNSNVGFGNIGNANIGGANIGDFNVGIANTGPGLTAAVNNIGIGNTGNYN
IGVGNTGNYNIGFGNTGNNNIGIGLSGDNQIGFGPLNAGIANMGLFNLGD
NNFGMANAGNFNQGIANTGNNNIGLFNTGNNNVGIGLTGDGLSGFSSLNS
GAGNTGFFNSGTANTGLFNSGTGNTGLFNSGTGNVGIGNMGTGGFGVGLS
GDNQVGIGGTNSGSFNIGLFNSGTGNVGIGNSGTGNVGIGNTGTGNTGIG
NSGNYNTGLLNAGLVNTGIANPGNHNTGLFNIGTFNTGIANPGHYNTGSY
NTGSYNTGMANAGDYGTGAFITGSMNNGLLWRADRQGLLAANYTITIERP
AAFLNVDIPVNIPITGDITNVSIPAITFPRIDASGSVDIGILSGTVLAPV
GPITLHGGDASAPLNTPIEIDFGPSPAINLNIGKPDGSTVINIVGGAGAG
PISIPIIDLRPAPGFFNATTGPSSGFLNWGAGSASGLLNFGNNSGLYNFA
TSSMGNSGFQNYGSLQSGWANLGNSISGIYNTGLGAPANVSGLLNIGTNL
AGWLQNGPTETTFSVGLANLGFWNLGSANIGNYNLGSANIGVYNLGSANI
GDFNLGSANIGDFNLGSANIGSSNIGFGNVGPGLTAAIGNIGFGNTGNGN
IGIGNTGTGNIGFGNTGNGNIGIGLTGDTMTGFGGWNSGTGNIGLFNSGT
GNIGFGNSGTGNWGIGNSGDYNTGIGNTGSTNSGFFNTGLVNTGIGNSGD
YNTGLFNAGNTNTGSFNPGDYNTGGFNPGNYNTGYFNPGNSNTGLANSGD
VNTGAFNSGNYSNGFFWRGDYQGLGGFAYQSAVSEIPWSYDIGSNIEIPI
EGDINAITQDAFTIDEFEIPIKLRVSVCVIYIPFKGCVKHVSVTIPITTE
HLGPYEIDASTINPDQPIDTAFTQTLDFAGSGTVGAFPFGFGWQQSPGFF
NSTTTPSSGFFNSGAGGASGFLNDAAAAVSGLGNVFTETSGFFNAGGVGN
SGFQNFGNLLSGWANLGNTVSGFYNTSMLDLMTQAFISGVGNFGSQLSGF
FKVGEGP
433633367YP_007266994.1 Conserved protein of unknown function- PE-PGRS family [MycobacteriuMRQALAAATWAQQQALSAVNEQFLAMTGRPLIGDGANGTMAAPNGGNGGW
LYGNGGDGWNSTVAGQAGGNGGDAGLWGNGGAGGAGGGSLASTLAGGAGG
HGGAGGWLIGNGGAGGNGGDGGVVTSPGVSGGTGGNGGAGGLLWGTGGSG
GNGGDGGNQTDLFLPGGGGSGGHGGSAGLIGSGGDGGSGGAGGDARPDGP
VGAAQGGNGGAGGHGGDGGLLSGTGAAGGSGGAGGSGRLTGGLGGDGGSG
GNGGALSVSGNGGVGGTGGAGGGVVPGFTGDRGAGGAGGTGGNAGMWGNG
GAGGNGGGDLASAVTDGAGGHGGNGGWLYGDGGAGGNGWIAGGAGGNGGA
GGNGGDAGLWGNGGAGGNGGGQLGSLVAGGAGGHGGASGWLYGDGGAGGN
GGIAGGATGAAGAAGGAGGKSWLIGNGGAGGHGGDGAQSFSFSVVSGTGG
AGGDGGAGGLLSGSGGIGGNGGRGGNQLSADLLIAGSGGAGGDGGRGGLI
GNGGDGGTGGEGGVGGTSGAGGAGGDGGHAWLSGNGGAGGSGGLGGGHDF
QLLVSSDQGASGGAGGNGGNGGLLSGNGGHGGAGGMGGFGKLTGGLGGDG
GDGGNAGSLSGDGGGGGGGGPGGNSNLGLNFGFIGDGGDGGTGGTGGNAA
TLIGNGGNGGNGGNGGIGSTVGIGGDGGDGGHGGRRGRFASSFGAEGQPG
ADG
433633365YP_007266992.1 Conserved protein of unknown function- PPE family [Mycobacterium caMSFLVLPPEVNSALMFAGAGSGPTLAAAAAWDGLAAELGQQAASFASVTS
GLADGSWRGPAAAAMAAAAARYAGWLNAVGGQALAAAAQANAAAAAYEAA
RAATVPPGLVAANRNQLVSLVLSNLFGQNAPAIAATEAAYEQLWATDVAA
MVGYHSWAKAVAAELAPWQHALRALPNPAAAAAAAASPVVAALGLPGLGI
SNTGMTNVGIGNIGNSNLGSGNTGSFNLGNGNIGNANVGSGNTGLFNLGN
GNRGDTNVGSGNIGFLNLGSGNNGTGNFGSGNLFGDRNVGVGNRGSFNLG
SGNLGSFNVGAGNRGSSNVGFGNLGTLNLGLGNLGDNNLGFGNSGNNNIG
FGLTGDNMIGIGGLNSGTGNVGFGNSGDNNIGFFNSGSDNIGFFNSGDRN
FGFANAGDTNTGFANAGDTNTGFGNAGHSNFGFGNAGFRNMGLGNAGSGN
MGFGNTGDVNTGWGNAGSFNTGFDNAGDTNTGWGNSGETNTGGVNSGDLN
TGIGSSDSQPVMNSGFGNTGTGNSGFYNLGDLSSGFRNTGNAAGFNGLNS
GFFNTGDVAAGVANSGRFNTGLFNMGRETAGIGNSATGPAFPDTSGVFNS
GNRSSGFFNTGDDASGFFDLSSVALPGAASLAATLGSPAAALAAALPAID
LPAANGGVGNIGNYNLGAGNIGSANFSVGNIGNANLGSGNAGNANLGSGN
TGFFNLGNGNLGNTNFGSGNLGNLNVGNGNIGSGNLGLGNIGSGHLGSGN
WGGLNIGSGNRGLRNLGSGNFGSSNIGLGNLGNNNLGFGNNGNNNIGFGL
TGDNLIGIGALNSGVGNMGFGNSGNNNVGFFNSGSNNIGFFNSGDGNFGF
ANSGDTNTGFWNAGGTNTGFGNGGGINFGNGNAGGGNVGHGNAGNFNLGY
GNSGDANTGSHNSGNVNTGFYNSGDTNTGWGNSGDINTGAYNSGDLNTAV
GSTEHQAGPNSGFGHTGSGNSGFFNFGDGNAGFQNSNTGGGAVGHSGLGN
LGDATNVGFLNSGSNNTGILNTGTFNAGVGNSGNGSSGVENSGDNSSGFR
NSRDDQSGFFDG
433633363YP_007266990.1 Putative chaperone protein DnaJ1 [Mycobacterium canettii CIPT 14007MAQREWVEKDFYQELGVSSDASPEEIKRAYRKLARDLHPDANPGNPAAGE
RFKAVSEAHNVLSDPAKRKEYDETRRLFAGGGFGGRRFDSGFGGGFGGFG
VGGDGAEFNLNDLFDAASRTGGTTIGDLFGGLFGRGGSARPSRPRRGNDL
ETETELDFVEAAKGVAMPLRLTSPAPCTNCHGSGARPGTSPKVCPTCNGS
GVINRNQGAFGFSEPCTDCRGSGSIIEHPCEECKGTGVTTRTRTINVRIP
PGVEDGQRIRLAGQGEAGLRGAPSGDLYVTVHVRPDKIFGRDGDDLTVTV
PVSFTELALGSTLSVPTLDGTVGVRVPKGTADGRILRVRGRGVPKRSGGS
GDLLVTVKVAVPPDLAGAAQEALEAYAAAERSSGFNPRAGWAGNR
433633361YP_007266988.1 Putative chaperone protein DnaK (Heat Shock Protein 70) (Heat ShockMARAVGIDLGTTNSVVSVLEGGDPVVVANSEGSRTTPSIVAFARNGEVLV
GQPAKNQAVTNVDRTVRSVKRHMGSDWSIEIDGKKYTAPEISARILMKLK
RDAEAYLGEDITDAVITTPAYFNDAQRQATKDAGQIAGLNVLRIVNEPTA
AALAYGLDKGEKEQRILVFDLGGGTFDVSLLEIGEGVVEVRATSGDNHLG
GDDWDQRVVDWLVDKFKGTSGIDLTKDKMAMQRLREAAEKAKIELSSSQS
TSINLPYITVDADKNPLFLDEQLTRAEFQRITQDLLDRTRKPFQSVIADT
GISVSEIDHVVLVGGSTRMPAVTDLVKELTGGKEPNKGVNPDEVVAVGAA
LQAGVLKGEVKDVLLLDVTPLSLGIETKGGVMTRLIERNTTIPTKRSETF
TTADDNQPSVQIQVYQGEREIAAHNKLLGSFELTGIPPAPRGIPQIEVTF
DIDANGIVHVTAKDKGTGKENTIRIQEGSGLSKEDIDRMIKDAEAHAEED
RKRREEADVRNQAETLVYQTEKFVKEQREAEGGSKVPEDTLNKVDAAVAE
AKAALGGSDISAIKSAMEKLGQESQALGQAIYEAAQAASQAAGAAHPGGE
PGGAHPGSADDVVDAEVVDDGREAK
433633359YP_007266986.1 Conserved lipoprotein of unknown function- LpqJ [Mycobacterium caneMRLSLIARGMAALLAATALVAGCSTTIDGRPVASPGSGPTEPTFPTPRPT
TAPPGTTAPAQPTTPVSPTAPAGAIPLPPDSNGYVFIETKSGMTRCQINR
DSVGCEAPFTNSPLRDGEHANGIHITAGGSVQWVLGNLGAIPTVSIDYQT
YEAQGWTIDATTDGTRFTNNRTGHGMFVSIEKVDTF
433633357YP_007266984.1 Putative GTPase- isoniazid inductible gene protein iniA [MycobacterMTQPDDPRRVGVIVKLIDHTIAIAKLNERGDLVQRLTRARQRITDPQVRV
VIAGQLKQGKSQLLNSLLNLPAARVGDDEATVVITVVSYSAQPSARLVLA
AGPDGTTAAVDIPVDDISTDVRRAPHAGGREVLRVEVGAPSPLLRGGLAF
IDTPGVGGLGQPHLSATLGLLPEADAVLVVSDTSQEFTEPEMWFVRQAHQ
ICPVGAVVATKTDLYPRWREIVNANAAHLQRARVPMPIIAVSSLLRSHAV
TLNDKELNEESNFPAIVKFLSEQVLSRATERVRAGVLGEIRSATEQLAVS
LGSELSVVNDPNLRDRLASDLERRKREAQQAVQQTALWQQVLGDGFNDLT
ADVDHDLRTRFRTVTEDAERQIDSCDPTAHWAEIGNDVENAIATAVGDNF
VWAYQRSEALADDVARSFADAGLDSVLSAELSPHVMGTDFGRLKALSRME
SKPLRRGQKMIIGMRGSYGGVVMIGMLSSVVGLGLFNPLSVGAGLILGRM
AYKEDKQNRLLRVRGEAKANVRRFVDDISFVVSKQSRDRLKMIQRVLRDH
YREIAEEITRSLTESLQATIAAAQVAEAERDNRIRELQRQLGILSQVNDN
LAGLEPTLTPRATLGRA
433633355YP_007266982.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MANSLLDFVISLVRDPEAAARYAANPERSIAEAHLTDVTRADVNSLIPVV
SDSLSMSEPIGAAGGAHADDRGNVWASGAATAALDAFAPHADAGVVQQHG
AVGSVLNQPTPPGPGATPTDPRPFRAGPHETSALLTSAEIPDTTSEDGGL
PTDHPAVWNHPVVDPHTVEPDHHGYDIHG
433633353YP_007266980.1 Putative iron-sulfur-binding reductase [Mycobacterium canettii CIPTMTTQTLIRLILGMSMTAVVGVFALRRVWWLYNLVMSGQPASGRTGNLGAR
VWTQISEVLGQRRLLKWSIPGLAHFFTMWGFFILLTVYIEAYGFLFEEKF
HIPVIGRWDALGFLQDFFATAVFLGITTFAIIRILRNPREIGRSSRFYGS
HNGGAWLVLFMIFNVIWTYVLVRGSAVNNGTLPYGNGAFLSQLFGAILRP
LGQPANEIIETTALLLHIGVMLAFLILVLHSKHLHIFLAPINVTFKRLPD
GLGPLLPLEADGKPIDFENPSEDAVFGRGKIEDFTWKAMLDFATCTECGR
CQSQCPAWNTGKPLSPKLVIMDLRDHWMAKAPYILGQKDASADGEAGHQE
HHHVPESGFGRVPGHGPEQATRPLVGTEEQGGVIDPDVLWSCVTCGACVE
QCPVDIEHVDHIVDMRRYQVMMESEFPSELSVLFKNLETKGNPWGQNASD
RTNWIDEVDFDVPVYGQDVDSFDGYEYLFWVGCAGAYDDKAKKTTKAVAE
LLAVAGVKYLVLGAGESCNGDSARRSGNEFLFQQLAQQAVETLDGLFEGV
ESIDRKIVVTCPHCFNTIGKEYRQLGANYTVLHHTQLLNRLVRDKRLVPV
TPVSQDITYHDPCYLGRHNKVYEAPRELIGAAGANLTEMPRHAERSFCCG
AGGARMWMEEHIGKRINHERVDEALATNAAAIATACPFCRVMVTDGVNDR
QEEAGRSGVEVLDVAQVLLGSLDHDKAELPAKGTAAKQAPERAPKAAPKA
AAPVTPVEAPAEAPQAPAPAAPAAPVKGLGMAAGAKRPGAKKAAPTPAAP
AAPAAPATPAAPVKGLGIAAGAKRPGAKKTPAPAPGLAGPAAQPQPEAKP
QPEPAAPPKPQTDGDPAAPAAPVKGLGIARGARPPGKR
433633351YP_007266978.1 Conserved protein of unknown function (13E12 repeat family protein)MFDTIAGGGSSPEVIAHFDEHFERHYPSKTAESGAFIDQICAATRAENRA
AAAQLVAIGELFGYRLSRCSDTEEWAIDTMAAVAAEVGAALRISQGLAAS
RLRYARAMRERLPKTAAVFQAGDIGYLMFATIVYRTDLIVDPEVLAAVDT
ALAANVARWPSMTKARLAGQVDKIVARVDADAVRRRRECQADRQFWVGES
QEGLCEIGGSMFAVDAHALDQRLSALAGTVCEHDPRTREQRRADALGALA
AGADRLGCRCGRPDCPAGKRPAASPVLIHVIAEHATLTGTATTPASALGA
DGLITPELLAELAKTATLVPLVHPGDAPPEPGYVPSKALADFVRCRDLTC
RWPGCDQPATNCDVDHSIPYAEGGPTHAANLNCKCRTHHLVKTFWGWQER
QLPDGTLILTSPTGHTYVTTPGSALLFPSLCHFTGGMPAPEADPPYEYCG
GRTAMMPKRRRTRAQDRAYRIATERRQNHAARTTRRADPVSHVGPALPEI
DDEPPPF
433633349YP_007266976.1 Alpha-D-glucose-1-phosphate thymidylyltransferase RmlA [MycobacteriMRGIILAGGSGTRLYPITMGISKQLLPVYDKPMIYYPLTTLMMAGIRDIQ
LITTPHDAPGFHRLLGDGAHLGVNISYATQDQPDGLAQAFVIGANHIGAD
SVALVLGDNIFYGPGLGTSLKRFQSISGGAIFAYWVANPSAYGVVEFGAE
GMALSLEEKPVTPKSNYAVPGLYFYDNDVIEIARGLKKSARGEYEITEVN
QVYLNQGRLAVEVLARGTAWLDTGTFDSLLDAADFVRTLERRQGLKVSIP
EEVAWRLGWIDDEQLVQRARALVKSGYGNYLLELLERN
433633347YP_007266974.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MDYSSAYLEQTHAFGELIRNVDQSTPVPTCPGWSLGQLFRHVGRGDRWAA
QIVRDRLEDFLDPRSVEGGKPPPDPDDAISWLYGGARLLVDAVEQTGVET
PVWTFLGPRPAGWWVRRRLHEVAVHRADVAITVGGEFTLEPNVAADGISE
FLERIAVQAGSGGAPLPLEDDDTLHLHATDPGLGGAGEWTVRLGEPGITW
SHEHGKGAVALRGGATELLLAMVRRVSVADTGIELLGDAGVWHKWLDRTP
L
433633345YP_007266972.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MARSIPADRFSAIVAASARVFIAHGYQRTQVQDVADALALAKGTLYGYAQ
GKAALFAAAVRYGDAQEALPLASELPVAAPVAGEIAALVSARLAGEVTDM
RLTHALRATLPPGATTGDARAELAGIVTDLYSRLARHRIALKLVDRCAPE
LPDLAEVWFGTGRNAQVDAVQAYLVHRERAGLLILPGPAPMVARTIVELC
ALWAVHLHFDPSPEPWSIVQPGVIDDDAIAATLAEFVVRATTAASD
433633343YP_007266970.1 Putative transcriptional regulatory protein (possibly TetR/AcrR-famMQQQRTNRDKLLDGALACLRERGYGNTSSRDIARAAGVNIASINYHFGSK
DALLDDALGRCFSTWNQRVQEAFDHSRAAGPAGQILAVLEATVDSFEQIR
PAVYACVESYAPALRSEALRARLAAGYADVRQHSVDLAGAALAGTDVAPP
ENLSTIVSVLMAVIDGLMIQWIADPSATPRSTEVIRALASIGAAVTSQLR
433633341YP_007266968.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MGPKGSLRLVKRQPELLVAQHEHWQDTYRAHPVLYGTRPSEPGVYAAEVF
NADGVQRVLELAAGHGRDTLYFAGQGFTVVATDFSDVAVAQLRRSAQARG
VSARVQPIVHDLRQPLPVKTGSIDGVFAHMALCMALSTSEIHAVVAEVGR
VLRPGGKFIYTVRHTGDAHYGAGQAHGDDIFECAGFAVHFFRRELVARLA
TGWVLEEVHDFEEGELPRRLWRVTVTKPA
433633339YP_007266966.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MNSCNRLPCAHEVLAVFAHPDDESFGLGAVLGDFTAQGTRLRGLCFTHGE
ASTLGRTDRNLGEVRREELAAAAQVLGVDHVQLLAYPDNGLAQIPLNELT
QRVVDALAGADLLLVFDDNGVTGHPDHRRATEAALAAASTPGIPVLAWAL
PQPIADRLNAEFSASFGGRGHGHLDIMIEVDRSRQLAAIGCHFTQSADNP
VLWRRLELLGDREYLRWLRRSVP
433633337YP_007266964.1 Putative deoxycytidine triphosphate deaminase Dcd (dCTP deaminase) MLLSDRDLRAEISSGRLGIDPFDDTLVQPSSIDVRLDCLFRVFNNTRYTH
IDPAKQQDELTSLVQPVDGEPFVLHPGEFVLGSTLELFTLPDNLAGRLEG
KSSLGRLGLLTHSTAGFIDPGFSGHITLELSNVANLPITLWPGMKIGQLC
MLRLTSPSEHPYGSSRAGSKYQGQRGPTPSRSYQNFIRST
433633335YP_007266962.1 Conserved membrane protein of unknown function [Mycobacterium canetMVTFPVLAGILGGVVPSVRTPSAAMVSGVQHFAAGIVMAAVAGEVLPDLR
SRGPLWLIVVGFSAGVAVLVALRRFDGHGEHQDGDDVGELPVGFLTVVAV
DLFIDGLLVATGATVSSRTAIIITIALTVEVLFLGLAVALRLAGSGMPRI
RAAATTSALSLVIAVGGVSGAVALGRAGNTVLTLVLAFAAAALLWLVVEE
LLVEAHETPERPWMAVMFFAGFLILYGLGVME
433633333YP_007266960.1 Putative muconolactone isomerase [Mycobacterium canettii CIPT 14007MEFLVTMTTRVPDSMPADEVERVRAREAVRSRELAAQGKLLRLWRPPLRP
GEWRTLGLFAADDNGELEQLLASMPPRSWRTDDVTPLGAHPNDPVGKGIT
IAPGKGPEFLIATTITVPPGTPAQVVDDTVAREARRAPELAGRGHLVRLW
ALPDGPDGQRTLGLWRARDPGELMAILESLPLAGWMTIETTPLSPHPDDP
IRMP
433633331YP_007266958.1 Conserved membrane protein of unknown function [Mycobacterium canetMNPEDDPEARIRELERPLADVARASELGGSQSGGYTYPPGPPPPPYSYGG
PFGGPSPRSSSGNRAWWILAAVVVVGVLVLVGGIAAFSAQRLSRGNFVVL
SPTPSVSRAISGSSPTPSAQPATTLPPAGASLSVSGVNMNRTIACNDSIV
SVSGMSNTVVITGHCTSLTVSGMRNSVTVDSVDTIEAAGFNNEVTYHSGS
PKISNAGGSNIVQQG
433633329YP_007266956.1 Conserved membrane protein of unknown function proline and threoninMYDPLGLSIGTTNLVAAGNGGPPVTRRAVLTLYPHCAPKIGVPSQNPNLI
EPGALMSGFVERIGDAVALVSPDGSVHDPDLLLVEALDAMVLAAGADASS
SEIAIAVPAHWKPGAVHALRNGLRTHVGFVRSGMAPRLVSDAIAALTAVN
SELGLPHGGVVGLLDFGGSATYVTLVETKSDSRTSDFQPVSATARYQDFS
GSQIDQALLLRVIDQFGYGDDVDPASTAAVGQLGQLREQCRAAKERLSTD
VATELFAELAGCSSSIEMTREQLEDLIQDPLTGFIYAFDDMLARHNASWA
DLAAVVTIGGGANIPLVTQRLSFHTRRPVLTASQPGCAAAMGALLLANRG
GERDWRTRTSIGLATAAAAGTSVIELPAGDVMVIDHEALTDRELAWSQTD
FPGEAPARFEGDSYNEGGPCWSMRLNVVEPPKGPAWRRIRVSQLLIGVSA
VVAMTAIGGVALTLTAIERRPSPLPTPIVPSLAPMPPGSVVPSSRAPTPP
PPPSTVAPLPSAAPAPTTVAPAPPPPTQVVTTTTAPPVTTTPRPSPTTTT
TTTAPSTTTTTEPPVTTTSTIPTSPTTTTTVKMTTEWLHVPFLPVPIPVP
IPQNPGAGEPQNPFGSLGSG
433633327YP_007266954.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MCCNGVVTPGDPAADIAAIKQLKYRYLRALDTKHWDDFTDTLAKDVTGDY
GSSVGTELHFTNRADLVDYLRQALGPGVITEHRVTHPEITVTGDTATGIW
YLQDRVIVAEFNFMLIGAAFYHDQYRRTADGWRISATGYDRTYEATMSLA
GLNFNIRPGRALAD
433633325YP_007266952.1 Conserved membrane protein of unknown function [Mycobacterium canetMTRPQALLAVSLAFVATAVYAVMWVGHSQDWGWLHSFDWSLLNAAHDIGI
KNPAWVRFWDGVSLILGPVVLRPLGLLAAMIALAKRKIRIALLLLACLPL
NAIMTIAAKSVAHRPRPATALVSAHSTSFPSGHALEATASVLALLTVLLP
MLHSRFTRHLAVTVGALCVLTVGVARVALNVHHPTDVVAGWALGYLYFLV
CLCVFRPPSIFGAQRASHALSPPVELSRQPEPEVDTAR
433633323YP_007266950.1 Putative oxidoreductase [Mycobacterium canettii CIPT 140070017]MFSAPERRAVYRVIAERRDMRRFVPGGVVSGDVLARLLHAAHAAPSVGLM
QPWRFIRITDETLKRRIHALVDDERLLTAEALGPRAQEFLALKVEGILDC
AELLVVALCDRRGSYIFGRRTLPQMDLASVSCAIQNLWLAARSEGLGMGW
VSLFDPQRLAALLAMPADAEPVAILCLGPVPEFPDRPALELDGWAYARPL
AEFVSENRWSYPSAPATDHDYGE
433633321YP_007266948.1 Conserved protein of unknown function with PIN domain (fragment) [MMTDQRWLIDKSALVRLTDSPDMEIWSNRIERGLVHITGVTRLPDQPLAQV
T
433633319YP_007266946.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MSNALHLAADTGRVITCPFIPGRVPEDLLAMVVAVEQPNGTLLPELVQWL
PVAALGAPLGNAGVAALREAASVVTALLC
433633317YP_007266944.1 Conserved protein of unknown function- PE-PGRS family protein PE_PGMSFVIAQPEIIAAAAGELASIRSAITAANTAAAAQTTGVVSAAADEVSTA
VAALFSSHAQAYQAASARAAAFHAQVVRTLTVDAGAYASAEAANAGPNML
AAINAPAQALVGRPLIGNGANGAPGTGQAGGDGGLLFGNGGNGGSGAPGQ
AGGAGGAAGFFGNGGNGGDGGAGANGGAGGTAGWFFGFGGNGGAGGIGVA
GINGGLGGAGGDGGNAGWFGNGGNGGIGGVGADGANAVNPGLATPVTPAA
NGGNGLNLVGVPGTAGLGADGANGSAIGQAGGAGGDGGNASTSGGIGIAQ
TGGAGGAGGAGGDGAPGGNGGNGGSVEHTGTTGSSASGGNGATGGNGGVG
APGGAGGNGGHVSGGDANTAGAGGKGGTGGAGGAGGPGGHGGSVLVGPVG
DSGKGGAGGDGGAGVSATGIAGTGGRGGNGGHGGLWIGNGGDGGAGGAGG
VGGAGAAGAIGGHGGDGGSVNAALAASTAGDGGKGGVGGDGGDGAAGGDG
GVGGDGGGRGIFGQFGAGGAGGAGGVGGAGGAGGTGGGGGNGGAIFNAGT
PGAAGAGGDGGDGGTGAAGGKGGAGGSGGVNGATGADGAKGLDGATGGKG
DNGNPG
433633315YP_007266942.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MSRAVRPYLVLATQRSGSTLLVESLRATGCAGEPQEFFQYLPSTGMAPQP
REWFAGVDDDTILQLLDPLDPGTPDTATPVAWREHVRTSGRTPNGVWGGK
LMWNQTALLQQRAAQLPDRSGDGLRAAIRDVIGNEPVFVHVHRPDVVSQA
VSFWRAVQTQVWRGHPDPKRDSQAVYHAGAIAHIVRNLRDQENGWRAWFA
EEGIDPIDIAYPVLWRNLTAIVASVLDAIGQDPKLAPAPMLERQANQRSD
EWVDRYRAEAPRLGLPT
433633313YP_007266940.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MSGTFTADAIGPPVPIPDVPGADAGAEGLPSRSVLSARQRILVESSAIAD
VALRTAVASVLSATVTPAVVANALRHVNEGRERSNLNFYAELAAAHDPAK
SFPAPTELPKVTSRPASPLTEWVARGTVDNIAFASGFRAINPTMRQRWSA
LTANNIVHAQHWRHSDGPRPTLCVIHGFMGSSYLLNGLFFSLPWYYRSGY
DVLLYTLPFHGQRAEKFSPFSGFGYFTSGLSGFAEAMAQAVYDFRSIVDY
LRHIGVDRIALTGISLGGYTSALLASVESRLEAVIPNCPVVMPAKLFDEW
FPANKLVKLGLRLTNISRDELIAGLAYHGPLNYRPLLPKDRRMIITGLGD
RMAPPEHAVTLWKHWDRCALHWFPGSHLLHVSQLDYLRRMTVFLQGLMFD
433633311YP_007266938.1 Membrane-anchored mycosin MycP3- protease [Mycobacterium canettii CMIRAAFACLAATVVVAGWWTPPAWAIGPPVVDAAAQPPSGDPGPVAPMEQ
RGACSVSGVIPGTDPGVPTPSQTMLNLPAAWQFSRGEGQLVAIIDTGVQP
GPRLPNVDAGGDFVESTDGLTDCDGHGTLVAGIVAGQPGNDGFSGVAPAA
RLLSIRAMSTKFSPRTSGGDPQLAQATLDVAVLAGAIVHAADLGAKVINV
STITCLPADRTVDQAALGAAIRYAAVDKDAVIVAAAGNTGASGSVGASCD
SNPLTDLSRPDDPRNWAGVTSVSIPSWWQPYVLSVASLTSAGQPSKFSMP
GPWVGIAAPGENIASVSNSGDGALANGLPDAHQKLVALSGTSYAAGYVSG
VAALVRSRYPGLNATEVVRRLTATAHRGARESSNIVGAGNLDPVAALTWQ
LPAEPGGGAAPAKPVADPPVPAPKDTTPRNVAFAGAAALSVLVGLTAATV
AIARRRREPTE
433633309YP_007266936.1 ESX-1 secretion-associated protein EspG3 [Mycobacterium canettii CIMDAIPNAVELTVDNAWFIAETIGAGTFPWVLAITMPYSDAAQRGAFVDRQ
RDELTRMGLLSPQGVINPVVADWIKVVCFPDRWLDLRYVGPASADGACEL
LRGIVALRTGTGKTSNKTGNSVVALRNAQLVTFTAMDIDDPRALVPILGV
GLAHRPPARFDEFSLPTRVGARADERLRSGVPLGEVVDYLGIPASARPVV
ESVFSGPRSYVEIVAGCNRDGRHTTTEVGLSIVDTSAGRVLVSPSRAFDG
EWVSTFSPGTPFAIAVAIQTLTGCLPDGQWFPGQRVSRDFSTQSS
433633307YP_007266934.1 ESAT-6 like protein EsxG (conserved hypothetical protein TB9.8) [MyMSLLDAHIPQLVASQSAFAAKAGLMRHTIGQAEQAAMSAQAFHQGESSAA
FQAAHARFVAAAAKVNTLLDVAQANLGEAAGTYVAADAAAASTYTGF
433633305YP_007266932.1 PE family protein PE5 [Mycobacterium canettii CIPT 140070017]MTLRVVPEGLAAASAAVEALTARLAAAHASAAPVITAVVPPAADPVSLQT
AAGFSAQGVEHAVVTAEGVEELGRAGVGVGESGASYLAGDAAAAATYGVV
GG
433633303YP_007266930.1 ESX conserved componant EccB3 [Mycobacterium canettii CIPT 14007001MTNQQHDHDFDHDRRSFASRTPVNNNPDKVVYRRGFVTRHQVTGWRFVMR
RIAAGIALHDTRMLVDPLRTQSRAVLMGVLIVITGLIGSFVFSLIRPNGQ
AGSNAVLADRSTAALYVRVGEQLHPVLNLTSARLIVGRPVSPTTVKSTEL
DQFPRGNLIGIPGAPERMVQNTSTDANWTVCDGLNAPSRGGADGVGVTVI
AGPLEDTGARAAALGPGQAVLVDSGAGTWLLWDGKRSPIDLADHAVTSGL
GLGADVPAPRIIASGLFNAIPEAPPLTAPIIPDAGNPASFGVPAPIGAVV
SSYALKDSGKTISDTVQYYAVLPDGLQQISPVLAAILRNNNSYGLQQPPR
LGADEVAKLPVSRVLDTRRYPSEPVSLVDVTRDPVTCAYWSKPVGAATSS
LTLLAGSALPVPDAVHTVELVGAGNGGVATRVALAAGTGYFTQTVGGGPD
APAAGSLFWVSDTGVRYGIDNELQGVAGGGKAVEALGLNPPPVPIPWSVL
SLFVPGPTLSRADALLAHDTLAPDIRPARPVSAEGGSR
433633301YP_007266928.1 Putative S-adenosylmethionine-dependent methyltransferase [MycobactMRTEGDSWDITTSVGSTALFVATARALEAQKSDPLAVDPYAEAFCRAAGG
SWADVLDGKLPDHKLKSTDFGEHFVNFQGARTKYFDEYFRRAAGTGVRQV
VILAAGLDSRAYRLLWPDGTTVFELDRPQVLDFKREVLASHGVQPRAQRR
EIAVDLREDWPHALRDSGFDPAAPSAWIAEGLLIYLPATAQERLFTGIDA
LAGPRSHVAVEDGAPMGPDEYAAKVAEERAAIAEGAEQHPFFQLVYNERC
APAAEWFGRRGWTAVGTLLNDYLAAVGRPVPGPESEAGPMFARNTLVSAA
RV
433633299YP_007266926.1 Uncharacterized PE-PGRS family protein PE_PGRS3 (fragment) [MycobacMSFVIAAPEVIAAAATDLASLGSTINAANAAAAANTTALMAAGADEVSTA
IAALFGAHGQAYQALSAQAQAFHAQFVQNLAAGGGAYAAAEAAATSPLLA
PINEFFLANTGRPLIGNGANGAPGTGANGGDGGWLIGNGGAGGSGAAGVN
GGAGGNGGAAGLLGMGGAGGAGGSATTGTGGAGGAGGSALLFGAGGAGGA
GGGAGRWGDRWSRRGRRGRWQRPGCFGAPPAWAGPVGPPGSSLAPVGPVD
PVGTENCSPAGGPGKRGV
433633297YP_007266924.1 Conserved protein of unknown function with PIN domain [MycobacteriuMFLIDVNVLLAAHRGDHPNHRTVRPWFDRLLAADDPFTVPNLVWASFLRL
ATNRRIFEIPSPRADAFAFVEAVNAQPHHLPTSPGPRHLMLLRKLCDEAD
ASGDLIPDAVLAAIAVEHHCAVVSLDRDFARFASVRHIRPPI
433633295YP_007266922.1 Putative transcriptional regulatory protein (possibly TetR-family) MTRSDRPYRGVEAAERLATRRRQLLSAGLDLLGSDQHDIAELTIRTICRR
AGLSVRYFYESFTDKDEFVGRVFDWVVAELVATTQAAVTAVPPREQTRAG
MANIVRTITADARVGRLLFSTQLANAVITRKRAESSALFAMLSGQHAVDT
LHAPANDHVKAVAHFAVGGVGQTISAWLAGDVRLDPDQLVDQLAALLDEL
TDPNLSRPRVAATAAKSGANDPQPPEVAGQPPSSARPARRS
433633293YP_007266920.1 Putative transcriptional regulatory protein [Mycobacterium canettiiMPDFPTQRGRRTQAAIDAAARTVVVRNGILATTVADITAEAGRSAASFYN
YYDSKEAMVRQWALRFRDDANQRALSVIRHGLSDRERAYEAAAAHWYTYR
NRLAEAISVSQLAMVSDDFAQYWSEICQIPISFITETVKRAQAHGYCVGD
DPQLMAEAIVAMFNQFCYLQLSGKRSRRGQPDDQACIQTLANIYYRAIYS
KEDSSN
433633291YP_007266918.1 Putative acyl-CoA dehydrogenase Fade6 [Mycobacterium canettii CIPT MPIAITPEHYELADSVRSLVARVAPSEVLHAALESPVENPPPYWQTAAEQ
GLQGVHLAESVGGQGFGILELAVVLAEFGYGAVPGPFVPSAIASALIAAH
DPQAKVLAELATGAAIAAYALDSGLTATRHGDVLVIRGEVRAVPAAAQAS
VLVLPVAIESRDEWVVLRNDQLEIEAVKSLDPLRPIAHVRANAVDVSDDA
LLSNLTMTTAHALMSTLLSAEAVGVARWATDTASAYAKIREQFGRPIGQF
QAIKHKCAEMIADTERATAAVWDAARALDEAGESSSDVEFAAAVAATLAP
ATAQRCTQDCIQVHGGIGFTWEHDTNVYYRRALMLAACFGRGSEYPQRVV
DTATSAGMRPVDIDLDPSTEKLRAQIRAEVAALKAMPREPRTVAIAEGGW
VLPYLPKPWGRAASPVEQIIIAQEFTSGRVKRPQIAIATWIVPSIVAFGT
DDQKQRLLPPTFRGDIFWCQLFSEPGAGSDLASLTTKATRVDGGWRITGQ
KIWTTGAQYSQWGALLARTDPSAPKHNGITYFLLDMKSEGVQVKPLRELT
GKEFFNTVYLDDVFVPDELVLGEVNRGWEVSRNTLTAERVSIGGSDSTFL
PTLDEFVDFVRDYRFEGQFDQVARHRAGQLIAEGHATKLLNLRSTLLTLA
GGDPMPPAAISKLLSMRTGQGYAEFAVSSFGTDAVIGDTERLPGKWGEYL
LASRATTIYGGTSEVQLNIIAERLLGLPRDP
433633289YP_007266916.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MSRMAAPVSQDVHGRQVIVTHPDRVVFPAHNDRKGYTKFDLVRYYLAVAE
GAMRGVAGRPMILKRFVKGISAEAVFQKRAPANRPDWVDVAELHYASGRS
AAEAVIHDAAGLAWVINLGCVDLNPHPVLAGDLDHPDELRVDLDPMPGVA
WQRVVEVALVVREVLEDYGLTAWPKTSGSRGFHVYARIAPCWSFPQVRLA
AQTVAREVERRLPDAATSRWWKEEREGVFVDFNQNAKDRTVASAYSVRAT
PDARVSTPLHWEEVPGCDPAVFTMATVPGRFAGIGDPWAGMDDAVGRLDR
LLMLAEELGPPQKAQSAKPLIEIARAKTRAEAMAALDIWRDRYPGAAALL
RPADVLVDGMRGPSSIWYRIRINLQHVPADQRPPQEELIADYSPWPR
433633287YP_007266914.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MTSSLVPISEARAHLSRLVRESADDDVVLMNHGRPAAILISAERYESLME
ELEDLRDRLSVHEREHVTMPLDKLGAELGVDIGRV
433633285YP_007266912.1 Putative 5-oxoprolinase OplA (5-oxo-l-prolinase) (pyroglutamase) (5MVGAGWHFWVDRGGTFTDVVARRPDGRLLTHKLLSDHPARYRDAAVAGIR
ALLANGEAGTRVDAVRMGTTVATNALLERKGERTLLVITRGFGDALRIAY
QNRPRIFDRRIVLPEMLYERVVEVDERVTADGRVLRAPDLEALGEKMRQA
HADGIRAVAVVCLHSYLYPAHEREIGTLAQRIGFAQISLSSEVSPLMKLV
PRGDTTVVDAYLSPVLRRYINQVADQMRGVRLMFMQSNGGLAQAGHFRGK
DAILSGPAGGIVGMVRMSALAGFDHVIGFDMGGTSTDVSHYAGEYERVFT
TQVAGVRLRAPMLDIHTVAAGGGSILHFDGSRYRVGPDSAGADPGPACYR
GGGPLCVTDANVMLGRIQPTHFPSVFGPSGDQPLDAGTVRRGFTDLAADI
AARTGDDRSPEQVAEGYLRIAVANMANAVKKISVQKGHDVTRYALTTFGG
AGGQHACAVADALGIRTVLIPPMAGVLSALGIGLADTTAMREQSVEIPLG
PAAPQRLASVAESLERAARAELLDEGVQGERIRVVRRVHLRYEGTDTAIP
VQLAEIETMATAFESSHRALYTFLLDRPLIAEAISVEATGLTEQPDLSQL
GDQANDTTGSSETVRIYSNGLWRDAPLRRREAMRPGDVLTGPAIIAEANA
TTVVDDGWQATMTATGHLLAQRVVAPPRPDTATQAGFEAGFEAGFEADPV
LLEIFNNLFMSIAEQMGFRLEATAQSVNIRERLDFSCALFDPDGNLVANA
PHIPVHLGSMGTTVKEVIRRRLSGMKPGDVYAVNDPYHGGTHLPDITVIT
PVFNTGGEDVLFFVASRGHHAEIGGITPGSMPADSREIHEEGVLFDNWLL
AENGRFREAETRRLLTEAPFGSRNPDTNLADLRAQIAANQKGVDEVGKMI
DHFGRDVVAAYMRHVQDNAEEAVRRVIDRLDNGAYRYRMDSGATIAVRIT
VDRAARSATIDFTGTSAQLDTNFNAPTSVVNAAVLYVFRTLVADDIPLND
GCLRPLRIVVPEGSMLAPTHPAAVVAGNVETSQAITGALFAALGVQAEGS
GTMNNVTFGNERHQYYETVGSGSGAGDGYHGASVVQTHMTNSRLTDPEVL
EWRYPVLLREFAVRHGSGGAGRWRGGDGAIRRLEFTEPMTVSTLSGHRRV
RPYGMAGGSPGELGRNRVERADGSTVELAGCGSTHLEPGDTLVIETPGGG
GYGPASTSARRRR
433633283YP_007266910.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MDAALACTVLDYGDHALMLQCDSTADAMAWTDALRAAALPGVVDIVAASR
TVLVKLDAPRYQGVTRQRLRRLRVTPEAVAAADHRCDLVIDVVYDGPDLA
EVARCTGLSTAAVINAHTATGWRAGFSGSAPGFAYLIDGDPCLRVPRRPE
RRTSVPPGSVALADGFSAIYPSQAPSDWQIIGHTDAVLWDVDRPQPALLT
PGMWVQFRAA
433633281YP_007266908.1 Aminoglycoside 2'-N-acetyltransferase Aac (AAC(2')-IC) [MycobacteriMHTQVHTARLVHTADLDSETRQDIRQMVTSAFAGDFTETDWEHTLGGMHA
LIWHHGAIIAHAAVIQRRLIYRGNALRCGYVEGVAVRADWRGQRLVSALL
DAVEQVMRGAYQLGALSSSARARRLYASRGWLPWHGPTSVLAPTGPVRTP
DDDGTVFVLPIDISLDTSAELMCDWRAGDVW
433633279YP_007266906.1 Putative transcriptional regulatory protein [Mycobacterium canettiiMAQAHSAPLTGYRIAVTSARRAEELCALLRRQGAEVCSAPAIKMIALPDD
DELQNNTEALIADPPDILVAHTGIGFRGWLAAAEGWGLANELLESLSSAR
IISRGPKATGALRAAGLREEWSPDSESSHEVLEYLLESGVSSTRIAVQLH
GAADSWDPFPEFLGGLRFAGAQVVPIRVYRWKPAPLGGVFDQLVTGIARR
QFDAVTFTSAPAAAAVLERSRELDIEHQLLDALRTDVHAMCVGPVTSRPL
IRKGVPTSAPERMRLGALARHIAEELPLLGSCTFKAAGHVIEIRGTSVLV
DDSVKPLSPSGMAILRALVHRPGGVVSRGDLLRVLPGDGSDTHAVDTAVL
RLRTALGDKNIVATVVKRGYRLAVDSRHGDV
433633277YP_007266904.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MARSQEPSRGLLDPVAKMLRLPFGTPEFIEKIVTGSVNQVGRRTLYVLIT
TWDAAGGGPFAASAIATTGLAKTAEIVQSMFIGPVFNPLLKMLGADKIAI
RASLCAAQLVGLGIMRYGVRSEPLHSMSVEMLVDAIGPTMQRYLVGDIGR
G
433633275YP_007266902.1 Conserved protein of unknown function- PPE family protein [MycobactMTAPIWMASPPEVHSALLSSGPGPGPLLVSAEGWHSLSIAYAETADELAA
LLAAVQAGTWDGPTAAVYVAAHTPYLAWLVQASANSAAMATRQETAATAY
GTALAAMPTLAELAANHTLHGVLVATNFFGINTIPIALNEADYARMWMQA
ATTMASYQAVSTAAVAAAPQTAPAPQIVKANAPTAASDEPNQVQEWLQWL
QKIGYTDFYNNVIQPFINWLTNLPFLQAMFSGFDPWLPSLGNPLTFLSPA
NIAFALGYPMDIGSYVAFLSQTFAFIGADLAAAFASGNPATIAFTLMFTT
VEAIGTIITDTIALVKTLLEQTLALLPAALPLLAAPLAPLALAPASAAGG
FAGLSGLAGLVGIPPSAPPVIPPVAAIAPSIPTPTPTPAPGPAPTAVTAP
TPPPGPPPPPVTAPPPVTGAGIQSFGYLVGDLNSAAQARKAVGTGVRKKT
PEPDSAEAPAAAAMPEEQVQPQRRRRPKIKQLGRGYEYLDLDPETGHDPT
GSPQGAGTLGFAGTTHKASPGQVAGLITLPNDAFGGSPRTPMMPGTWDTD
SATRVE
433633273YP_007266900.1 Putative bifunctional cobalamin biosynthesis protein CobU: cobinamiMRILVTGGVRSGKSTHAEALLGDAADVVYVAPGRPAAGSDPDWDARVALH
RARRPPTWLTVETADVATALSEARSPVLVDCLGTWLTAIMDGEALWSAAT
ADVYAVLEARLDGLCAALTGLPTAIVVTNEVGLGVVPSHSSGVLFRDLLG
TINRRVAAVCDEVHLVIAGRVLKL
433633271YP_007266898.1 Putative nitrite reductase NAD(P)H large subunit [Mycobacterium canMPTAGSSRAPAAAREIVVVGHGMVGHRLVEAVRARDADGSLRITVLAEEG
DAAYDRVGLTSYTESWDRAQLALPGNDYAGDQRVRLLLNTRVTQIDRATK
SVVTAAGQRHRYDTLVLATGSYAFVPPVPGHDLPACHVYRTFDDLDAIHA
GAQCTLDGGHTDGGVVIGGGLLGLEAANALRQFGLQTHVVEMMPRLMAQQ
IDEAGGALLARMIADLGIAVHVGTGTESIESVKHSDGSVSVRVRLTDGEV
IDAGVVIFAAGIRPRDELARAAGLAIGDRGGVLTDLSCRTSDPDIYAVGE
VAAIDGRCYGLVGPGYTSAEVVADRLLDGSAEFPEADLSTKLKLLGVDVA
SFGDAMGATENCLEVVINDAVKRTYAKLVLSDDATTLLGGVLVGDASSYG
VLRPMVGAELPGDPLALIAPAGSGAGAGALGVGALPDSAQICSCNNVTKG
ELKCAIADGCGDVPALKSCTAAGTSCGSCVPLLKQLLEAEGVEQSKALCE
HFSQSRAELFEIITATEVRTFSGLLDRFGRGKGCDICKPVVASILASTGS
DHILDGEQASLQDSNDHFLANIQKNGSYSVVPRVPGGDIKPEHLILIGQI
AQDFGLYTKITGGQRIDLFGARVDQLPLIWQRLVDGGMESGHAYGKAVRT
VKSCVGSDWCRYGQQDSVQLAIDLELRYRGLRAPHKIKLGVSGCARECAE
ARGKDVGVIATEKGWNLYVAGNGGMTPKHAQLLASDLDKETLIRYIDRFL
IYYIRTADRLQRTAPWVESLGLDHVREVVCEDSLGLAEEFEAAMQRHVAN
YKCEWKGVLEDPDKLSRFVSFVNAPDAVDSTVTFTERAGRKVPVSIGIPR
VRS
433633269YP_007266896.1 Conserved protein of unknown function [Mycobacterium canettii CIPT MSTTAELAELHDLVGGLRRCVTALKARFGDNPATRRIVIDADRILTDIEL
LDTDVSELDLERAAVPQPSEKIAIPDTEYDREFWRDVDDEGVGGHRY
433633267YP_007266894.1 Putative succinate dehydrogenase [iron-sulfur subunit] (succinic deMVEVERHSYDVVVIGAGGAGLRAVIEARERGLKVAVVCKSLFGKAHTVMA
EGGCAAAMGNANPKDNWKTHFGDTMRGGKFLNNWRMAELHAKEAPDRVWE
LETYGALFDRTDDGRISQRNFGGHTYPRLAHVGDRTGLELIRTLQQKVVS
LQQEDHAELGDYEARIKVFAECTITELLKDQGAIAGAFGYWRESGRFIVF
EAPAVVLATGGIGKSFKVTSNSWEYTGDGHALALRAGATLINMEFVQFHP
TGMVWPPSVKGILVTEGVRGDGGVLKNSENSRFMFDYIPPVFKGQYAETE
EEADQWLKDNDSARRTPDLLPRDEVARAINSEVKAGRGTPHGGVYLDIAS
RLTPAEIKRRLPSMYHQFKELAEVDITTQAMEVGPTCHYVMGGVEVDADT
GAATVPGLFAAGECAGGMHGSNRLGGNSLSDLLVFGRRAGLGAADYVRAL
SSRPAVSAEAIDAAAQQALSPFEGPKDGSAPENPYALHMDLQYVMNDLVG
IIRNADEISRALTLLAELWARYHNVLVEGHRQYNPGWNLSIDLRNMLLVS
ECVARAALQRTESRGGHTRDDHPGMDPNWRKILLVCRAAETMGTGGSGAG
DSNCHINVTQQLQTPMRPDLLELFEISELEKYYTDEELAEHPGRRG
433633265YP_007266892.1 Conserved membrane protein of unknown function [Mycobacterium canetMAETSHRVSSADGASKRILRLIIAQSGFYSAALQLGNVSIVLPFVVAELD
AELWIAALIFPAFTAGGAIGNVVAPPAVAAVPRRHRLFIIVSCLAVLAGV
NALCATIGKGSVAGILLVVNVTLIGVVSAISFVAFADLVAAMPSGTARAR
ILLTEVGVGAALTAVVAATLSFVPDQHPLSRNIHLLWTAAVAMAISAAIC
RALPHRIVPRVHAAPGLHKLVYVGWTAIRTNGWYRRYLLVQVLFGSVVLG
SSFHSIRVAAVPGDQPDEVVAVVLFVCVGLLGGIALWNRVRERFGLVGLF
VGSALVSIAAAVLSIAFDLAGAWPNVVAIGLVIALVSIANQSVFTAGQLW
IARDAEPGLRTSLISFGQLVINAGLVGMGLALGLIAQDHDAVWPVMIVLL
LNLTAAYSATRFAPAKSVDVPGLPQVSRTSRPKTGG
433633263YP_007266890.1 Putative acyl-CoA dehydrogenase FadE5 [Mycobacterium canettii CIPT MSHYRSNVRDQVFNLFEVLGVDKALGHGEFSDVDVDTARDMLAEVSRLAE
GPVAESFVEGDRNPPVFDPKTHSVMLPESFKKSVNAMLEAGWDKVGIDEA
LGGMPMPKAVVWALHEHILGANPAVWMYAGGAGFAQILYHLGTEEQKKWA
VLAAERGWGSTMVLTEPDAGSDVGAARTKAVQQADGSWHIDGVKRFITSG
DSGDLFENIFHLVLARPEGAGPGTKGLSLYFVPKFLFDVETGEPGERNGV
FVTNVEHKMGLKVSATCELAFGQHGVPAKGWLVGEVHNGIAQMFEVIEQA
RMMVGTKAIATLSTGYLNALQYAKSRVQGADLTQMTDKTAPRVTITHHPD
VRRSLMTQKAYAEGLRALYLYTATFQDAAVAEAVHGVDAKLAVKVNDLML
PVVKGVGSEQAYAKLTESLQTLGGSGFLQDYPIEQYIRDAKIDSLYEGTT
AIQAQDFFFRKIVRDKGVALAYVSGQIQEFVDSGSGNGRLKTERALLAKA
LTDVQGMAAALTGYLMAAQQDVTSLYKVGLGSVRFLMSVGDLIIGWLLQR
QAAVAVAALDAGATGDERSFYEGKVAVASFFAKNFLPLLTSTREVIETLD
NDIMELDEAAF
433633261YP_007266888.1 Putative 3-oxoacyl-[acyl-carrier protein] reductase FabG4 (3-ketoacMAPKRSSDLFSQVVNSGPGSFLARQLGVPQPETLRRYRAGEPPLTGSLLI
GGAGRVVEPLRAALEKDYDLVGNNLGGRWADSFGGLVFDATGITEPAGLK
GLHEFFAPVLRNLGRCGRVVVVGSTPEATTSTNERIAQRALEGFTRSLGK
ELRRGATTALVYLSPDAKPAATGLESTMRFLLSAKSAYVDGQVFSVGADD
STPPADWEKPLDGKVAIVTGAARGIGATIAEVFARDGAHVVAIDVESAAE
NLAETASKVGGTALWLDVTADDAVDKISEHLRNHHGGKADILVNNAGITR
DKLLANMDDARWDAVLAVNLLAPLRLTEGLVGNGSIGEGGRVIGLSSIAG
IAGNRGQTNYATTKAGMIGITQALAPGLAAKGITINAVAPGFIETQMTAA
IPLATREVGRRLNSLLQGGQPVDVAEAIAYFASPASNAVTGNVIRVCGQA
MIGA
433633259YP_007266886.1 Conserved protein of unknown function- win PIN domain [MycobacteriuMELYQLLRNPMVVTRPLEGPEAAEVCQTFRRNRRWALLENAPVMNEVWVL
AATPRIARRRLFDARLALTLRHHGVDEFATRNINGFTDFGFSRVWDPITS
DG
433633257YP_007266884.1 Conserved lipoprotein of unknown function LpqI [Mycobacterium canetMAFPRTLAILAAAAALVVACSHGGTPTGSSTTSGASPATPVAVPVPRSCA
EPAGIPALLSPRDKLAQLLVVGVRDAADAQAMVTNYHVGGILIGSDTDLT
IFDGALAEIVAGGGPLPLAVSVDEEGGRVSRLRSLIGGRGPSARELAQTR
TVQQVRDLARNRGRQMRKLGITIDFAPVVDVTDAPDDTVIGDRSFGSDPA
TVTAYAGAYAQGLRDAGVLPVLKHFPGHGRGSGDSHNGGVTTPPLDDLVG
DDLVPYRTLVTQAPVGVMVGHLQVPGLTGSEPASLSKAAVNLLRTGTGYG
APPFDGPVFSDDLSGMAAISDRFGVSEAVLRTLQAGADIALWVTTKEVPA
VLDRLEQALRAGELPMSAVDRSVVRVATMKGPNPGCGR
433633255YP_007266882.1 Conserved membrane protein of unknown function [Mycobacterium canetMAPLSRKWLPVVGAVALALTFAQSPGQVSPDTKLDLTANPLRFLARATNL
WNSDLPFGQAQNQAYGYLFPHGTFFVIGHLLGVPGWVTQRLWWAVLLTVG
FWGLLRVAEALGVGGPSSRVVGAVAFALSPRVLTTLGSISSETLPMMLAP
WVLLPTILALRGTSGRSVRALAAQAGLAVALMGAVNAIATLAGCLPAVIW
WACHRPNRLWWRYTAWWLLAMALAT