Antigen browsing page


The page has been created to visualized all the protein sequence their gene ID and protein ID from NCBI from selected strain. The strain can be selected from the option given in the form and then click submit to display all the proteins and their corresponding information available in our database. The output will be presented in a tabular format where Gene ID is linked to display an antigen card. If you click on gene ID of a proteins, the number of epitopes mapped and/or predicted will be displayed in result page.

Please select a strain:

Selected strain is M_gilvum_PYR-GCK
Gene IDProtein IDProtein DetailsSequence
161898739YP_001132789.2 3-ketosteroid-delta-1-dehydrogenase [Mycobacterium gilvum PYR-GCK]MAQQEYDVVVVGSGAAGMVAALTAAHQGLSTIVVEKAPHYGGSTARSGGG
VWIPNNEVLKRDGVKDTTEAARTYLHSIVGDAVPAEKIDTYLDRGPEMLS
FVLKHSPLKLCWVPGYSDYYPETPGGKPTGRSVEPKPFNAKKLGPDEKGL
EPPYGKVPLNMVVMQQDYVRLNQLKRHPRGVLRSLKVGVRSVWANATGKN
LVGMGRALIAPLRIGLQKAGVPVLLNTALTDLHVEDGVVTGIYVVATGDS
VNAEPQLIRARRAVILGSGGFEHNEQMRVKYQRAPITTEWTVGAVANTGD
GILAAEKLGAALEIMEDAWWGPTVPLEGAPWFALSERNSPGSIIVNMAGK
RFMNESMPYVEACHHMYGGQYGQGPGPGENIPAWLIFDQQYRDRYIFAGL
QPGQRIPSKWLESGVIVKADTLDELAARTGLPTDAFKATVDRFNGFARSG
RDEDFKRGESAYDRYYGDPTNKPNPNLGEITQGPFYAAKMVPGDLGTKGG
IRTDVHGRALRDDGSVIEGLYAAGNVSSPVMGHTYPGPGGTIGPAMTFGY
LAALHIAGAAPAATSSSGKG
161898737YP_001136332.2 30S ribosomal protein S12 [Mycobacterium gilvum PYR-GCK]MPTINQLVRKGRRDKIAKVKTAALKGSPQRRGVCTRVYTTTPKKPNSALR
KVARVRLTSAVEVTAYIPGEGHNLQEHSMVLVRGGRVKDLPGVRYKIIRG
SLDTQGVKNRKQARSRYGAKKEKS
229302805YP_001135090.2 glutamine amidotransferase subunit PdxT [Mycobacterium gilvum PYR-GMSDPRVGVLALQGDTREHLAALREAGAQPGTVRRAAELAAVDALVIPGGE
STAMSHLLRELELLEPLRARLADGMPAYGSCAGMILLATEIADAGVPGRE
ALPLSGIDMTVRRNAFGRQVDSFEDDIAFDGLDGPVHAVFIRAPWVERVG
PGVEVLARAAGHPVAVRQGRNLATAFHPEVTGDRRVHRLFVDSLR
161898738YP_001135823.2 3-ketosteroid-delta-1-dehydrogenase [Mycobacterium gilvum PYR-GCK]MTAASATIPAGLPVSDTTVDLLVVGSGTGMSAALAAHEAGLSVLIVEKSE
YVGGSTARSGGALWLPASPVLGAAGAGDSVERARTYLDAVVDGAAPSERS
AGFLAHLTGTLDMLRRTTPMKLFWAREYSDYHPEQPGGSAAGRTCECRPL
DTAVLGEYLPRLRPGVMEVTIPMPTTGADYRWLNLMTRVPRKGLPTIAKR
LGQGVGGLLLGRRYAAGGQALAAGLFAGVLRAGIPVWTDTALVELTGDDA
RVTGAVVSHRGTEITVTARRGVVLAAGGFDHNMDMRWKFQSESLQPGVSL
GADTNTGDAIRIAQDRGAAIGLMDQSWWFPAVAPLPGKAPAVMLAERSLP
GSLIVDQNGRRFANESSDYMSFGQRVLELERTGTPVESMWIVFDQKYRNS
YVFAAELFPRMAIPQSWYDAGIAHRADDFSELAGLMGVPPETFGDTMRRF
NESAGAGIDSDFHRGESAYDRYYGDPTVTPSPNLRPLAKGPFYAVKMVLS
DLGTCGGLRADERARVLREDGAAIEGLYAIGNCAANAFGATYPGAGATIA
QGLVYGYVAALDAARG
145225846YP_001136524.1 TetR family transcriptional regulator [Mycobacterium gilvum PYR-GCKMRRARNTDSPTEQESAILKAAAEEVALVGVGRLSMDVVARQAGVSRSTLY
RRFPSRDALITELGRQTFEFAMARLQTVAIDDGPQQAAVAAFREGVRLLT
GEPVMRRFLQLDGEFTATTEMVAEARLFLVSAATAMAKALRAAGATMPDS
ELLAVAEVHIRLAASLVQVNTDVLDVTDDEAVARYARTYLAPLVR
145225844YP_001136522.1 small multidrug resistance protein [Mycobacterium gilvum PYR-GCK]MAWLILVASGFLEAVWATALGMSNGFRRRRPTVVFAVAMPASLAGLAYAM
TEVPTGTAYAVWVGIGATLTVVWAIVTKKEAATTARVLLLCLLVGSVVGL
KAVS
145225842YP_001136520.1 O-succinylbenzoate synthase [Mycobacterium gilvum PYR-GCK]MADLADILDRLHVVALPMRVRFRGITTREVALIDGPAGWGEFGPFLEYEP
PEAAHWLASGVAAAYRPMPEVRRARIPINATVPAVPADAVPDVLVRFPGA
RTAKVKVAEPGHTLADDVARVNAVRAAGLTARVDANGGWTVEQAVAAAQA
LTADGALEYLEQPCRTVPELAEVRRRVDVPVAADESIRKADDPLHVVRSG
AADVAVLKVAPLGGVQTMLDIAAQIDIPVVVSSALDTAVGIGAGLVAAGC
LPRLEHACGLGTGSLFVDDVAEPRTPVDGYLPAAAVTPDPARITALAASD
DRRQWWIDRVRACYPLMS
145225840YP_001136518.1 ThiJ/PfpI domain-containing protein [Mycobacterium gilvum PYR-GCK]MQVAIMLYPGFTALDFIGPYESLRWLPDTEVRFVWHEPGPIAADSHVLLV
GATHSFDETPSPDVILIPGGFATMEHARDEVVLAWVRRAHETSTWTTSVC
SGSVILAAAGVLDGKRATSHWAALPVLKTLGAQPVGDQRIVEADAKTVTA
AGVSAGIDLGLWLAGRIAGEEKAKAIQLSMEYDPQPPFDSGHMSKASAGT
KALATAMMGREMVRPAALAASTGLLWDAALKRIRRAKRRQGSLSAP
145225838YP_001136516.1 alpha/beta hydrolase fold protein [Mycobacterium gilvum PYR-GCK]MAYDDRGSGDPVLFIAGRGGAGRTWHLHQVPVFTRAGYRCVTFDNRGIGA
TENAEGFTTETMIGDTAALIEQLDLAPVRIVAVSMGSFIAQELMVARPEL
VHSAVLMATRGRHDRTREFFWRGEHALASSGIDLPPEFDAKVRLLESFSP
KTLNDDNAVRDWIDMFTMWPQKPTPGIRTHLSISPQDNRLAAYQNVTTPA
LVIGFGDDVVLPPHLGREVANALPNGRFVEIPDTGHLGFIEKPEVVNTAI
LNFFADTL
145225836YP_001136514.1 hypothetical protein Mflv_5262 [Mycobacterium gilvum PYR-GCK]MTATDVLDRGRARWRAVRPYLTAFLFGAGGDTRRAKVFRRIRIGIIVLAC
LVTLQSVLLVLGAWRNDRQIERHLGVAEATVLDAGPRRSTIEFVTPDRIT
YRPELGVLYPSELENGMRIYVEYDVNNPDLVRVQHRNAALAIIPAGSIAV
VGWLVAAAALGATALIERRTQRPVSV
145225834YP_001136512.1 group 1 glycosyl transferase [Mycobacterium gilvum PYR-GCK]MRVAIVAESFLPNVNGVTNSVLRVIEHLRRTGHEALVIAPDTPRGEPPAD
RVYDGVRVHRVPSAMFPKVTSLPLGVPRPRMVGVLRGFDPDVVHLASPAL
LGWGGVHAARHLGVPTVAVFQTDVAGFAQSYGIGMMSRASWAWTRRLHSK
ADRTLAPSTSAMENLAAHGIPRVHKWARGVDVTGFAPSARDQRLRQSWSP
QGKPIVGFVGRLAPEKHVERLAPLHARDDIQLVIVGDGVDRARLESAFPR
AVFTGALYGPELAAAYASMDVFVHGGEHETFCQAVQEAMASGLPVIAPDA
GGPRDLVAPYRSGLLLPVAEFEDRLSESVDHLVVERRRYSQAARRSVLGR
TWPVICDELVGHYEAVVGARALRAA
145225832YP_001136510.1 ubiquinone/menaquinone biosynthesis methyltransferase [MycobacteriuMNRASLEKNPHEVASMFDGVARRYDLTNTVLSLGQDRFWRRATREALQLS
PADKVLDLAAGTAVSTVELASSGAWCVAADFSVGMLAAGASRRVPKVAGD
ATRLPFDDGVFDAVTISFGLRNVVDFSAGLREMARVTRPGGRLVVCEFST
PTNGLFSTVYKEYLMKALPAMATAVSSNPDAYVYLAESIRAWPDQRALAR
RIEAAGWSDVRWRNLTGGIVALHAATKP
145225830YP_001136508.1 hypothetical protein Mflv_5256 [Mycobacterium gilvum PYR-GCK]MTNLSGPHQQQGDPKPAPRQVVASFDNYADAQRLVDRMSDGGFPVEHVRI
IGDELRTVERVVGRMTKGRAAFAGAASGAWFGLFIGLLLAIFTVGPVWIV
TMLTALVIGSFWGGVFGFVAHIATGGERDFDSVKSLEARRYDVCVSAELA
AEAARFTQGP
145225828YP_001136506.1 geranylgeranyl reductase [Mycobacterium gilvum PYR-GCK]MDTPAVGAIRGSSGADVVVIGAGPAGSSAAAWAARSGRDVLVIDSAQFPR
DKACGDGLTPRAVAELDRLGLRSWLDGRIAHRGLRMSGFGSDVEVPWPGP
SFPPTSSAVPRTELDERIRLVAVDDGAKMKLGVKAVDVERDSTGRVTGVV
LDSGELVRCSSLIVADGARSTLGRTLGRQWHKETVYGVAIRGYIGTPRSD
EEWITSHLELRSPAGEVLPGYGWIFPLGNGEVNIGVGALATSKRPADAAL
RPLLNYYTGLRRAEWGFEGDPRAPLSALLPMGGAVSRVAGPNWMLIGDAA
ACVNPLNGEGIDYGLETGRLAVSLLGTGSFEASWPALLHEHYARGFSVAR
RLALLLTFPRFLPVAGPVAMRSSTLMKIAVRVMGNFVTDEDEDAVARVWR
GAGRLSGRIDERRPFV
145225826YP_001136504.1 heat shock protein HtpX [Mycobacterium gilvum PYR-GCK]MTWHPHANRAKTFLLLAVFSGLIVAVGAMFGRNIMFLAVLFALGMNAYVY
FNSDKLALRAMHAQPVNEMQAPVMYKIVRELATTARQPMPRLYISDTAAP
NAFATGRNPRNSAVCCTTGILQMLNERELRAVLGHELSHVYNRDILISCV
AGAMASVITALANLAFFASMFGGNRDGGTNPFAILLVSLLGPIAATVIRL
AVSRSREYQADQSGAELTGDPLALASALRKISSGVERAPLPPEPQLADQA
HLMIANPFRAGEKIGKLFATHPPMADRIARLEAMAGRGPGQY
145225824YP_001136502.1 hypothetical protein Mflv_5250 [Mycobacterium gilvum PYR-GCK]MVLSRSVVAAVCVAVAGVLNASGLAAAQPPPPPPPPPAPDINAYPPANPK
DFAVHQGSAYAFTTAGLTCMVQRSGPYGCSGVLPGAPNNANLVSGRSGTV
PGFGAAPQPIVGEPVNALPPNTRISFGTVSCGGDGTVTACVDSMNQAGFV
VSPDATWIVNAVNPLVARPEGTNPYFN
145225822YP_001136500.1 putative nucleotide-binding protein [Mycobacterium gilvum PYR-GCK]MADSSFDIVSKVDRQEVDNALNQAAKELATRFDFRGTDTTIEWQGEEGII
LVSSTEERVKAAVDVFKEKLIRRDISMKAFDAGDPQPSGKTYKVIGSIKQ
GISSEDAKKVTKLIRDEGPKGVKAQIQGEEIRVSSKKRDDLQAVQALLRG
ADLDFAVQFVNYR
145225820YP_001136498.1 fatty acid desaturase [Mycobacterium gilvum PYR-GCK]MTITAGSPLTRLSEQELEKLAKEFDAIHDEVFAELGDRDRQYIKTVISAQ
RQIVVAGRVLLLASRSRTALVLGTACLGLAKILENMELGHNILHGQWDWM
NDPDIHSSVWDWDTASSAKAWKHSHNYIHHTYTNILGKDKDLGYEIMRID
PNQKWRPSNLGQPFYNFLLTVLFEWGVAVHDTDVESLFRGEKKLKDLKED
FKSIGGKARQQIVKDYIGWPLVSAGAFGLAQLALRGRLDQPSHSRIGKLL
RRTTGNRRVGGVATLLDRYASGVESTYLRTLGADALANLIRNVWAHAIIF
CGHFPDQTWTFTEEEVENETRGGWYVRQLLGAANIEGSPLFHVLSGNLGY
QVEHHLFPDMPSSRYAEIAPKVKDICERYELPYNSGRFGKQWFTVHRTIF
RLALPGGTPRPKPGPYRSPERGRSPQGVSEAERFRSRVPAEHPAAGPEHE
SGGVAVAPPARGND
145225818YP_001136496.1 hypothetical protein Mflv_5244 [Mycobacterium gilvum PYR-GCK]MGKHRVTGRRRPRTERRGVKAAVSAAAVAAAAVGGAVVLGAAPTLSISPQ
LAASLHYLRGTNIGGIPTDQQYEDFITTVIDGSGVAATEGAYQKVPYNAG
FRPFSHGGFDDLSYDDSFEQGLELLAAQEPAPGDVIFGFSQGAVVASLYK
ATHTGNTYILVGNPSRPNGGVMQRFNGAKIPLLDVTFGGATPNNGVDGAP
GDLTIDVTRQYDGWADFPRYLWNPVAIANAIAGIALIHGATQFELTAEQL
EEAKASGDSDYYQFDADSNTHYYVIRTYPIPLLMPLDPFLSDSAMAALDA
PLRKFIETAYDRADYSEPARASLFKPWGADRSSAQTVDVVETTEPVAVEA
VEADEEDTARSAPRDSGKRSVDTESEESEGAEVADEALSPDPVEEQDTAA
DEDHAESPDTDTDSTSETAADSDSSDDGADTAA
145225816YP_001136494.1 helix-turn-helix domain-containing protein [Mycobacterium gilvum PYMDVLMSLLRPQAVLSKVITGAGSWGVRKPRYGDPAFCLMLEGSCVLDADG
LDSIALSQGDFLLLPETPEFTLSAGPEATPSFSALDHSPHTRHGDASAPV
TMRMLGGYFRFDPANAALLVALLPPVIHVRGGDPDAPRLTRLVELIAEEA
DADGACRDAILQRLVEVLLIEAARVQSAPDLAGPHRGLITGLADPVLAPA
LRALHADIAHGWTVEGLARTASVSRAVFAQKFTRAMGLTPMQYLLEWRVA
VAKDLMRSERLSIAQLAQRVGYQSATAFTTAFTRVAGAPPTEFARTLAPG
GV
145225814YP_001136492.1 D-isomer specific 2-hydroxyacid dehydrogenase [Mycobacterium gilvumMSSEGLPECNVGGSVLQVGPLMPSLVRKLADDYDARRLPSDPDERAAFLA
DHGAEFTVAVTSGGVGVDASLMQALPNLGAVVNFGVGYDTTDVEAAHARG
IGVSNTPDVLTDCTADTAVGLLIDTMRQLPAADRYVRAGRWPVDGMFPLT
RDVSNSTVGIIGLGRIGTAIAQRLKAFRCSIAYHNRHRVTDCPYPYFASP
VELAASVDVLVVAAAGGDSSRGLVSSEVIEALGPSGYLINIARGSVVDQD
ALVVALVEKRLAGAGLDVFADEPHVPEELFALDNVVLLPHVGSGTVQTRA
AMEELTVRNLHSFLTTGALVTPV
145225812YP_001136490.1 HxlR family transcriptional regulator [Mycobacterium gilvum PYR-GCKMGRLADVSRRTYGQYCGLAHALDVVGERWTLLIVRELASGPKRYTELADA
LAGIGTSLLATRVRQLETDGVVQRRLALDQPGSTVVYELSDAGRELAAAV
VPLAMWGARHQMADADVCHEAFRAEWLLSFLAADVRRDGPHDLDAVYEFH
IDDSTACLRLRDGGVTVTPGAPATPGDVVVRSRASTIAEIVGHKIAVADA
LADGSLEITGDADKISALVGVIEKRLAR
145225810YP_001136488.1 CsbD family protein [Mycobacterium gilvum PYR-GCK]MPDPRRSEMSQDDKAAQTRKSFAESVKGKAKELAGAVTGNDSLTAEGQLE
QAEAKERREASRKEAEADAEAAQAQAQAREARLEGAQERAAAEVRAAGVE
TQVSADQAAARQSVEEAGRRDVARAQTQAEAKVAQESARAQAEQREEIVE
AAEEYQEAAADYQEATSEAARAEAQAERLRQRANDSTPT
145225808YP_001136486.1 hypothetical protein Mflv_5234 [Mycobacterium gilvum PYR-GCK]MTAVPPDPDPFGTPGVDRAGGVRPGDTPPDSAQTKATANRDPAAGRNLTP
RAVIAFVVIGLFVVCFLAAGVYLVVQMFG
145225806YP_001136484.1 putative membrane transport protein [Mycobacterium gilvum PYR-GCK]MSRFLFTLGAASFRRRWLVLGTWLAVLLGVGLAFVGFRGEPSDNFTIPGT
ESQRAVEQLQQNLPDFSGAQTQITIAAPDGTTLTDPRIAAPIDGAVATLN
TLPDVAVAAGPAQTRQISEDGRVGLGTVQWTAPIGEVSDGALTELEKAMQ
PAIDAGATVEYAGAVFPGYKVAVPHTPEIIGIGVAFLILLITFGAVVAAG
LPILTAAIGVGIGALGIFVVAAFVDMPTASLSLALMLGLSCGIDYALFIL
NRYRNNLLLLMPRQEAAGLAVGTAGGAVVFAALTVIIALCGLSVVGIPFL
TYMGVAAAVAVLIAMLIALTLLPALLGFAGGRVAKFIEPPLQPHRPKEVA
QVAAYTPQRTMGAAWARFVVRFRKPLLVGGSAALIVIGLPALGMQLGLPS
GSSQPESNTSRQAYDLTAEHLGPGFNGPLLVVADLTRATDPNAAQIIASN
ISREDGVLAATPAGGDQRTAVIQVIPDTGPNDAATADLVAKIRADRDAIE
ADTGATFLVGGTTASNIDTSDKLATALPIFLVVVVGLAFILLTIAFRAAL
VPLTSIAGFLLSVFAALGVQVAIFQWGWGADLLGVTPGETISFLPIIALA
IIFGLSSDYQVFVVSRIKEELSKGDHGALDAVRSGVGLSARVVTAAALIM
FGVFIAFLAAGDPIIKSVGLTLAVGVFLDAFVVRLTLIPAAMAVLGDRMW
SRSKWFDRYVPDLDIEGTALEVEHRAPVTASA
145225804YP_001136482.1 peptidase S15 [Mycobacterium gilvum PYR-GCK]MGRIGGLAVALGVGAAVVAGAGSAYADDDGGSGTKDAPTSSATSTGESTA
SSSDTRTPSKPQVTGGERTAGTTPSGPSGDDEDASAADDAPERGSANKRG
EAADEATEATDAGAADEADTAAGEAVDADEPAASEAPDVPTADVPAAEPV
PAEVASSVPQKPSATTEPSPLPAQTVTAQFVDEPAGSAGPGDDSGDPALP
ALAALFSSVLSAGREATNESPTAVGAQVATSLAESASTQYPIPTGVTVEE
WTPPLEWLQRIPVLGPLLVTAIVGFIHVLPLVGDIIHPVIGFPIDHRAPA
GTPQARNYRVTSFDGTRIFVNFMPAKGLQAGETAPTILNGPGLGLPGSTA
LELPVDSFLPNDVIGVGTLRQNGYNVVTWDPRGEWRSEGVMHLNSPDLEG
RDMSHIISFLATLPEVALDAENDPRIGMTGASYGGGIQLATAAIDHRVDA
LVPTIAWNNLVDVLFPRDAVNSSWGTILPAVLALTFAREHPRIFPVAIQG
VLFGIAQQSDIDLVNSLSFGDQIKDITAPTLLIQGTVDTLFTLDQAHRNA
LDLIEAGTTTKVIWYCGGHGACLSDFNDGEFVIDRTLSWLDRYVKGNENA
DTGAQFEWVDQNGLWHSDDSYPAASGAPIVVTREEDSRVMPIIPALFGSG
PNPLIVTRGLIATLLGLPSAAAAYNAVNLQIPDATELTHVVGAPQVTMTY
TGEGTAEHMYAQIVDDETGLVLGNHATPIPVTLDGTTRTATFSLEPVAHT
LRPGQSVTVQIVTSTAKFINYYSWGAITVEELTVELPTRIPAGAGAGASR
EPLAVA
145225802YP_001136480.1 cold-shock DNA-binding domain-containing protein [Mycobacterium gilMAQGTVKWFNGDKGFGFIAPDNASEDVFVHYSSITGSGFKSLDENQRVEF
EIEQGAKGPQAVGVSAI
145225800YP_001136478.1 hypothetical protein Mflv_5225 [Mycobacterium gilvum PYR-GCK]MSADTSRIGWVPNYFEVTPADGGRLEWSGPFRPHDGGPLMSDKSPRQAMS
KKSGKSLKEKRADKHAKSDAKTSAAESIHEIKKR
145225798YP_001136476.1 NAD(P) transhydrogenase subunit alpha [Mycobacterium gilvum PYR-GCKMSEKAEPEQLSIGILATSRKADERRLPIHPAHLSRIGRAVGRRVFLEQGY
GSHFGATDDAVSDHVGGVRSRKELIAECDVILLPKVHAEDLAECRTGQII
WGWPHCVQDTGLTQVAIDRKLTLIAFEAMNHWRADGGFGLHVFHKNNELA
GYCSVLHATQLAGVTGTYGRRLSAAVLGFGATARGAVTALNALGVDDVHV
LTNRDTAAVGSPIHSTQISQMGPEPDAPDRIWADTPDGRIPVAQFLSDKD
IVVNCVLQDPNAPLTFVSEEDLSSFAPRSLIIDVSCDVGMGFSWARPTSF
ARPVVALPNGLLYYAVDHSPSYLWDSATWEISEALLPHLAPLLEGPATWD
TMPTLSRAIEIREGVVVNENILTFQHRASAYPHEVSVTAR
145225796YP_001136474.1 hypothetical protein Mflv_5221 [Mycobacterium gilvum PYR-GCK]MMASPQSFRTPYEKRVALVQDTIKDNSKLGDEDAGKLAVRVLHVLDAIPE
KMR
145225794YP_001136472.1 putative GAF sensor protein [Mycobacterium gilvum PYR-GCK]MNLKEEGDVTEHERQTQVLDVVGSFVDRLLVDFDVVDLLTELTESCAELL
DVAAAGFLLADAFGKLSLLAATTEQARDLEVLQLQAEQGPCLDCYATGEP
ISVADVHFAAARWPVFVPAAVNDGFSAVHAVPMRAAGDVLGTFGLFGVRP
GELTDGDRLIAQTLAHIACVAILQEQAPTPATIIPQLRNAFSSRVVVEQA
KGFLREILDVSIDEAFKVLRGYSRAHGEHLTDVARRLMTDRYTRPVLVAA
ITEFAAGSQR
145225792YP_001136470.1 long-chain-fatty-acid--CoA ligase [Mycobacterium gilvum PYR-GCK]MSQFTETMYANAHRSSKGLNTGEPHSPVRHTWEEVHQRARRIAGGLAAAG
VGHGDAVAMLAGAPVEIAPAAQGVWMRGASVTMVHQPTPRTDLIRWADET
TSVIDMISASAVVISDPFMAAAPLLSGMGMTVLSIADLLTAEPIDPVDTC
DDDIALMQLTSGSTGSPKAVQITHANIVANADAMTAGCDFDIDTDVIVSW
LPCFHDMGMTGYLTVPMYFGAELVKITPMDFLGDILLWPRLIHKYRGTMT
AAPNFAYNLLARRLRRQATPGEFDLSSLRWALSGAEQVDPDDVEDLCAAG
APFGLRPEAVIPAYGMAETTVAVSFSECGGGMVVDEVDADLLAVLHRAVP
AAKGHTRRLVALGRPLAGLEMRIVDEDGAALQPRGVGVIEVRGQSVTRGY
TTAAGFIAAQDDRGWYDTGDIGYLTEDGDVVVCGRLKDVIIMAGRNIFPA
DIERAASRVEGVRPGCAVAVRLDAGRSRESFAVAVESKHFDDEVEVRRVE
RQVAHEVFAEVDVRPRNVVVLEPGTIPKTPSGKLRRAHALSLVS
145225790YP_001136468.1 putative glycosyltransferase [Mycobacterium gilvum PYR-GCK]MTGEVPRPVFAHLLRMTDHRATFEHALLAEPRREHGYCTDDMARVLVVAA
REPESTGEVTRLATHALRFLNRAQFADGTFRNRMSADGHWTDAPSTDDHW
GRAIWGLGTAAAHSAVGMVRRLAVIQFERAAVARSPHSRAMAYAAIGAAE
ILSVDPGNVAALTLLADYAASAPRPAGDAEWYWPERRLTYNNAALAEAMI
AAGVALHHGELRQCGLDMLRWLLRVETSNGHLSPTPVGGRGPGDGAPGFD
QQPIEVASLAEACARAADTDPDPMWPEAVLAAAAWFQGDNDRGSPMWDPQ
TGGGFDGLHPDRVNLNQGAESTLAVIATLQHARTFAQVAS
145225788YP_001136466.1 fatty acid desaturase [Mycobacterium gilvum PYR-GCK]MAITDIAKYTHLSPEDIESLGRELDAIRSDIEESLGSRDAAYIRRTIAFQ
RTLDVAARALIATTRSTAGWLLGTAALGVAKSVENMEIGHNVSHGQWDWM
NDPAIHSSTWEWDMVAVSSQWRSSHNYRHHVFTNVLGEDDDLGFGVMRVT
PEQPWTKAHLLQPLQNLFLALTFEWGIALHGVDLGRTRPEKIAQVKAVVG
KVARQGVKDYALWPALSLRRWRRTLKANVVANLMRNLWAYVVIFCGHFPD
GTQKFMPEVLESETRAEWYLRQMLGTANFKAGRLLGFASGNLCYQIEHHL
FPDLPSNRLAEISRRVRPLCEKYDLPYFTGSLARQYASTLRTIHRLALPN
GVAAAAV
145225786YP_001136464.1 death-on-curing protein [Mycobacterium gilvum PYR-GCK]MTDFPTADEVLIVAEYACGFRPLVRDPGLFESCLMRPTATVFGIDAYPTD
WDKAAALLHSLVTTQSLADGNKRTGWAACWLLLGLNGHRLSSQLDVDAAE
EFVLAVAADRLTWEEIAVRLPAFAEPAQ
145225784YP_001136462.1 glycosyl transferase family protein [Mycobacterium gilvum PYR-GCK]MRDRRRAKVIAAGKLAGCVLIAGLLAAALMFPFVGGAGTVVMRVSVSATD
ESADLINGELPRVSTMVDAAGKPIAWLYEQRRWEVPSERIANTMKLAIVS
IEDKRFTEHNGVDWQGTLTGLAGYVRGDKGVRGGSTLEQQYVKNFNLLVR
AKTDAERRAAVAVTPARKLREIRAALAMDKLLSKTEILTRYLNLVAFGNG
AFGVQDAARTYFGIDAADLNWAQASLLAGMVRSTSLLDPYTNPDDALARR
NIVLDTMIDNLPEHADELRAAKAQPLGVLPRPAPLPQGCIAAGDRGFFCE
YAMRYLARAGLSMKDVARNGYLIRTTLDPKIQAGVKSAVDHYAEPTTPGV
ASVMSVILPGKDAHRVVAMADNRSYGLDLNAGQTVQPQPFTLAGDGAGSI
FKIFTTAAALEMGLGINATLDVPQTFRATGLGDSTEPGCPPKTWCVKNVS
GFSGQMNVTDALAKSPNTAFAKLISQIGVPRAVDMAVRLGLRSYAEPGSA
RVYDPETDESIADFVKRQNIGSFTLGPFELNALELTNVAATLASGGMWCL
PSPIDKVFDRHGNEVPLQTPPCEQAVPEGLANAMANALGKDHTGGTATGA
AGSVGWDLPMSGKTGTTESHRSSAFLGFTNRYAAANYIFDDSPSPSGLCS
YPLRKCGSGDLYGGTEPALTWYRAMKPIAEDFGPVSLPPTEPRYVDGGPN
SEVPSVTGMKFDAARNKLTENGFQVSPEPTAINSGAARGTVVGTSPRGKT
IPGSIVTILVSNGIPPVVYRPPPPPSAPPPPPPGDAPPPPPPPNVIEIPG
LPPIVLPWPAPPPPPPAPPPPPPA
145225782YP_001136460.1 hypothetical protein Mflv_5207 [Mycobacterium gilvum PYR-GCK]MILTGYTSVNTMVKSELFPAHVRALDMGIGYALANSIFGGIAPLISQAAK
EAGHVPLFGGLCVLPAEQVGDALVPGAGVGVYGRGAGPRCGAGRRDCGDG
R
145225780YP_001136458.1 hypothetical protein Mflv_5204 [Mycobacterium gilvum PYR-GCK]MRLELRNGEGNVVGTLKIADLPSRQDLTISARGDVALREAATYRYEISTD
ATNVEVEPRELFDPDDASWTRGRLRPGQAVGRLRIQVADRVTGLAGTADV
DVLAVKLDHETEYRQMLTDISSFAAEAVLQGFAPSMLDLAPSEMSPELLY
LRFAMIAAYLQDPAFEAAIARVTSQPHRTWVAEQEIRPVGSPFPAGGAFR
RAVCAPGRRVPWSGGAATLASLPAALIRDRAEASVDNSANQFVKFALKRW
RAVALELSDVLSLTSQKVESGPLRRGQQIAGEVGARLDEYLAHPLFREVS
SLRRMPTSDQVLLKRAGYREVFRTFAMTESGPTVHIDRGDMADVFAASQR
NIATLYEFWCFLAVVDSLGEYAGKTARRVPSPSQEMVSP
145225778YP_001136456.1 hypothetical protein Mflv_5202 [Mycobacterium gilvum PYR-GCK]MAFTDEQLQILIDRCEQFRNAEAPEGYRGSLALCIVDSVQSTGVRYASVV
KVVNAYRDYRRIQGGDPATDGVPELLQTFDELGGPEAWASKIGNQNKTST
RPNAPLKAVAIRDAAAALVSVEVTATQALRETAKDPDKLRFVEAAWRAVV
AQRSGITWHYMQMLAGIPGIKPDRMIIRFVADALGLPRTRVSPSFSSEIL
TEAASRMKVSPTDLDHGIWQWQRRGR
145225776YP_001136454.1 PilT domain-containing protein [Mycobacterium gilvum PYR-GCK]MPPRAKAEKCRSVRRWMTSGPNVIVVDASVLAVALGDDGADGRRARQRLT
GEALAAPELIDLEVASVWRRHVAAKLMTARRADAGVSDLEDLPLRRCSHR
PLLERIWALRRTVTPYDAAYAALAEALEVVLVTADARLARAPGLACDVEV
IGSSG
145225774YP_001136452.1 hypothetical protein Mflv_5198 [Mycobacterium gilvum PYR-GCK]MKRLDLVVGSNGAGKSTFIELTLAPLVPRSVYVNADEIAKRRWPDDPARH
SYEAARIAASTRARLIELGESFIAETVFSHPSKLELLDVAHAAGYTIILH
TVLIPEELAVQRVRHHMQAGGHDAPESKIRQRYQRLWDLVATAAGRADEA
TFYDNSAIRGPRIVAQLAAGIAVGSALWPNWTPAPLTRRVTEDSTAGKDP
IAGHVELHRLR
145225772YP_001136450.1 AbrB family transcriptional regulator [Mycobacterium gilvum PYR-GCKMEAVVDSSGRIVLPKQLRDALGLVPGSKVDISVYGGGLQVIPGDRTARIE
RAEDGRFVANADTVVTDEMMFAAIDSGRR
145225770YP_001136448.1 hypothetical protein Mflv_5194 [Mycobacterium gilvum PYR-GCK]MNPDVNAISPAEARRRFRDGLVTPTAGWSAGYAQANLIAVPRDYAFDLML
FAQRNPKPCPVLDVLEPGQYAGPLLAGGDIRTDIPAYRIYVDGELVTEVA
DATEYWTDDLVAFLIGCSFSFEAALLDSGVPVRHIEEDVNVPMYRTDRPC
RSAGRIGGPLVVSMRPLPPEQVADAVRITSRYPSVHGTPVHVGDPAGLGI
AHLSAPDYGDAVTIRPGEIPVFWACGVTPQAAVMQSRPPLAIGHAPGHML
ITDLRDSELVVP
145225768YP_001136446.1 peptidase S15 [Mycobacterium gilvum PYR-GCK]MSCRLSTASARLPEEPIAESLGISRNTLVTAEQHLDPEPVHPARRYHRTP
TASDRNPVSMISMRAGTYVGRVGGLAVALGIGAAVLVGAGAAAADDDTGS
SQSQSSQSANPATQESDPTSAANAAGDSSNESTDADSATASSDDDTETEE
TAATDTVVEDTVVEDTAVDDSDGDLANEESEAEEVATERHPAKVATAQLT
RDIAVVVDDTQAPETPAAPAITSLMTSVAAAGREATQEPAADRATTAEAP
QYDLPTDVVVTEWTPPLEWLQTIPLFGRFVMTPLVGLLHNIPLIGDILHP
VFGFPIDHNAPPGTPRARSFRVTSFDGTRIFVNFMPAKGLQAGESAPTIL
NGPGVSLPGSTTLELDVDSLLPDDVIGIGALRKAGYNVVTWDPRGEWRSE
GRMQLQSPDFEGRDVSHIISYLATLDEVQTVNGDPKIGMVGASYGGGIQL
STATIDHRIDAIVPTIAWNSLAHSLFPNGAVRNGWGTILSTALILTLARP
NERVLPATITGVLTGKVAQSDLDLFESLNFADRLANITAPTLLVQGTVDT
LLPLSQADLNAKALIEAGTTTKVVWYCGGHGACLSSVNNGDLVVDRTLDW
LDRHVKGEDIDTGAQFEWVDQNGDWYSSDTYPAAQDLTPITAQRTEDQSM
LFFPFVGGAGPNPLIITRGLIATLLGLPSGAPAVNAVNLTVTAPSDGAGT
THVVGAPEVTLTYSGTGTATHVWAQIVDDETGLVLGNHTTPIPVQLDGNS
HTVTVPLEQVAHTLMPGQSVTVQIVTSSFAFLNFYSGGAITIDELSVRLP
TLAAGQAAQTVAA
145225766YP_001136444.1 PilT domain-containing protein [Mycobacterium gilvum PYR-GCK]MALRPWLIDKSAYTRLAVSPDVELWMERIDRGLVRISTVTRLEIGYSFRT
AEQARSEVASPPLTLMPIEYMTPTVEDRAREVQLTLADRGMHRAPSIPDL
LVAATAEQAGLTVLHLHKDFDLIAGTTGQPVEALRMG
145225764YP_001136442.1 hypothetical protein Mflv_5188 [Mycobacterium gilvum PYR-GCK]MSEQPITELSVHIPCGGLRGPVQLRGRRYAPGEVRWQSCSDEVRPVRWAD
SDVSRECDLCVICLRATAGGRSRWSWLACENCRAVNSAVETGWGIRPFAL
GRHSVMNGITVRCGAPRHIRQQQIERVAWFADGFGRLREWRNDEFARLAR
RFDPEADVPLRLWQQEWPPGPRASRDAFARVIGPEFVPPPL
145225762YP_001136440.1 L-carnitine dehydratase/bile acid-inducible protein F [MycobacteriuMPSAGPLSGVKVVDLTAVVAGPYCTQIMADMGADVVKVEAPQGDNARYIS
VGPEPGLSGVFTNVNRGKRSVVLDLQTDAGKDALRTLVARADVFIHSMRA
AAIAKLGFDYAAVADLNPSIVYTNCYGYGRTGPYAARPAYDDTIQAECGL
AAVQEELTGTAGYVGSIMADKICGLTAVNATMMALFHRERTGEGQEVEVP
MFETMAAFMLVEHANGAMFDPPLGPALYPRTVARNRRPYQTSDGHIAALI
YNDKQWQAFIDAVKPAWATDRYATMAGRAADIDTVYGLIGDALRERTTAE
WLALFDELGIPASPLRSTGDLFTDPHLDAVGFFETVQTGHGPVRFPGVPT
GFSRTPGRVRGGAPRLGEHTAEVLADWGQEPVK
145225760YP_001136438.1 hypothetical protein Mflv_5184 [Mycobacterium gilvum PYR-GCK]MSDGFDGTPMVVCPHGHLNAWHYKFCGQCGSPIGAVAFPDDDPVEVERRP
RRRGLLIGGAVAAVVVIAAAVAVTVLMAGSSSDDVAVPQSGGFGAGPVDP
AGMVPACTTPPLVQAESVDMTGDGMTVDAAFMSRCAGGDTATAASVRITV
ADGQRDIAAGIFDFSAAPLTMKPGETARRTLVFPAGMYWRTTEMFSGAPQ
MVVHPGEQSDATTATASSGSDRLVAHAVAEPEHGSIDGVAEAVLRELRDA
DYGYVSTSIANRWVPQISAKKAGLVVDGATITSADVLRDHYGLRAKHSGV
RLVSSAQWTTFDSDDFWVTVVGAPKLSPAEANGWCDANRLGVDDCFAKFV
STLFGVEGTTAYRK
145225758YP_001136436.1 metallophosphoesterase [Mycobacterium gilvum PYR-GCK]MTDGGYDIIGDIHGCAEQLEKLLHTLGYRQDGRGGEYRHPQRRAVFVGDL
IDRGAGQVRTLEVVKAMVDGGSAYAVMGNHEFNALAYHTESPPGSGKYLR
AHDDPDDPRSAKNTDQHQAFLEQVRGAERSHYLRWFATLPLWLDLGGLRI
VHACWHDDSIAVVERECGSSAPFSDVRHLIAASTPGDPLYTAVETLLKGP
EISLVAHGQQPFKDKGGHPRKSARLRWWNGDARTLRELSEVAGNYTTVDD
KPYPPLPDLDVSAVSAPHLYTAQVPVFYGHYWRSGEPERGGDWTDYTACV
DFSAVMGGSLTAYRWSGEPTIRPEHYVGVPPRSGSAHPSTNDTPPARNSS
NE
145225756YP_001136434.1 NUDIX hydrolase [Mycobacterium gilvum PYR-GCK]MNAREYRDSSRKRLTDYPRPSVAVDSAVLTLDEQGGLVVLQVRRENRRGW
GLPGTFLHPGERLSDAVKRSLRVKANVEGLDPRQLYVFDDPDRDDRGWVL
SVAHVDVVRPERLADRFAESTRLMPVGSPGRLSFDHADIVARALSYLRDR
YARSPDPDHLLDDEFTIRELRLAHEAVAGEPLQRDWFRRAMEPQLVATGV
MTSRGRGRPAELFRRP
145225754YP_001136432.1 hypothetical protein Mflv_5178 [Mycobacterium gilvum PYR-GCK]MADHSSPGDGSVLVAIFVLLIIAGLVVRYIWWVVGAAALAGVVYLCVVLT
RKAEERRLRDEKLAAEREFERARLAERQHRWTMIGDSRAVYGEKSSAPTA
DITGTDSAPDTDEPIATLAATKAELDALIRDRPQGWEQALFASILMQRAA
PLASRLRDSELGYTEAGASGLMSAGELASTVVHMLDEMMRTIQQLDRFMM
APAFMAAFTAPDDVDEDGADPEAIAHIAHRVMDYHERLLELSERCRGISA
PAYYDDILADCARMLDAPLRSYREFIDEFAAVIRALPRVLPHASGPVDLG
SLGLYISIDNTLHSRILRRLDEITAPRRA
145225752YP_001136430.1 hypothetical protein Mflv_5176 [Mycobacterium gilvum PYR-GCK]MAITPDETPRLANNAERKVYQLLLDQLGDGDLVIPGKRVTDHLKDHEIDF
CIALEGAGVLCLEVKGGEVWHDGKGWRQLRGGREVSIEPVRQAREACYAL
RDFVEKDPRWSQHRLRWDHVVVLPNTELPQDFALPECPRWKVVDRTDLAD
LAARLRRILLDQELDRPLLTAAGIGQLTQVLDGRGLPQRSVVARALENED
AADVLTEQQSVILDAIKLLHRVEIRGGAGSGKTFLAMEQARRLARAGRRV
ALVCYSHGLASYLERITATWNRRHRPAYVGEFHDLGKQWGAPAGPDESVR
NDETVKFWEHDLPSQMTRLATQLDPGHRFDAIVVDEAQDFADAWWDPLLA
ALKDDETGGLYLFSDEGQRVFDRFGAPPVPLVPLILDHNLRNTRQIADAF
QPLVDHPMRALGADGPAVKYVPCSREDAMDTGDDEVELLLDQGWRPEDVA
LLTTGSRHPEQRERQAAGSAAYWDSFWDAEQVFYGHVLGFKGLERRVVVL
VVNEESAFERSRERLYVGLSRARDQLVVCGDPEFLRTVGGPDLARRLNIP
Q
145225750YP_001136428.1 PAS/PAC and GAF sensor-containing diguanylate cyclase/phosphodiesteMEGQPGIPADLVRTLLGVLRQRLGLDTAWLSSFHDDTQTIEVLDGDAASF
GLSPGLRTPLSESYCVRVIDGRLPSVVPDTSQNQTTHALPVTDEMGLGAY
IGVPVPGHAGTTSGMVCLVSQEPKPYLGDDDLRLVRQAAELIGTLIESPV
RQADSVDRRSAIRRVVSELDFEVVFQAIHDVASGRAVGVEALARFPCEPF
RPDAFFAEAAQLGIGIQLELAIVRRVLSLLPQLPDDVFVSINISPAAALV
APWSELLADVEPSRIVLEITEHDAVPNYGALDDVLEGCRAQGVRVAVDDV
GAGFASFSHVLELAPEFVKIDHSIIRHIDVDDARRRLAQAIAEFAGQFGA
MVIAEGVESQRELDAVRAAGIGCAQGFYLSRPKAHGHGFPAATATADPSE
PLPTAVDLLGERRFELALAHSPIGMAVVGLDGSFLRTNRALRAMLGYSRR
AMSELTFQDITHPDDLDLDLALVNECLEGRRRSYRIDKRYIAADGSIVWC
ALTAVIVHAPRDQPRCFVSQIVDVTADRLREAELVRRASTDPLTSIANRS
AAWTRLEQLDQSGEGYGVLFCDIERFKSVNDRHGHHAGDQLLVEVAQRLH
DTLDPFDLAARWGGDEFLVITRCVEEPALACLADRIIDRMDGTPITLPGG
AEESVAMTIGFAAHRPGDGRSVDDVLDLADHQMCEQRRRRPRVRRRLGVS
RPR
145225748YP_001136426.1 TetR family transcriptional regulator [Mycobacterium gilvum PYR-GCKMAERLAAGRHRLSRDEVAAHQKQRLFKALAVVMGTRGYNKTSVDDLIKHA
GVSRATFYELFDSKQDCFMAGFAGMQGHVIDAILAAPAGATPLERFGVML
DRYLGFMALDPPTARLYLVEVYSAGPDAMHRRAELQQQFVDGVAKIFKAR
SKADKFACKALVAAISALVTTALIDGDPAAILALKAPVLTFAERALRAGP
S
145225746YP_001136424.1 XRE family transcriptional regulator [Mycobacterium gilvum PYR-GCK]MDTRAQRRLALGEFLRARREAIRRADVGLPELPRARTGGLRREEVAVTAG
VSVTWYTWLEQGRDINPSKQVLDAVADALRLSPAEHEYVLALGGYAVDAA
VSRGPLPPHIQHFLDALEGYPAFAITPDWGIAAWNTTYAALYPNVERVPE
TDRNLLWLVFTDPYIHELLPNWDTDSRRFLAEFRADAGPRVGEPSYTALV
SRLSSESPHFAAAWQATSIERFTSRERLFRHPAAGELRLEHHQVAPVDVP
DIQIVAYLPVPDSVASERLRMLTGQADTAR
145225744YP_001136422.1 integral membrane protein TerC [Mycobacterium gilvum PYR-GCK]MLEISGLTWGVTIGVIVGLLAIDLILAALRPHRVGFREATAWSVFYIAVA
IGFGVWFAMTHGGDFGTEYFAGYIVEKSLSVDNLFVFVIIMTTFAVPEEH
QHKVLTFGIILALIMRAIFIAVGATLLSLFSFMFLLFGLLLIYTAIQLFR
HRDEDPDVENNIMIRATRKVLPISDDYDGGRLLTRREGRRMATPLLAVLI
AIGSVDLLFALDSIPAVFGVTNEPYIVFTANAFALLGLRALFFLVKGLLD
RLVYLSTGLSIILAFIGVKLILHWGHVDINPQIPEINTYLSLVVIIGILT
IVTVASLIKTRKDPTAKAHPGSLRASRKRPEEQRDATG
145225742YP_001136420.1 Fis family transcriptional regulator [Mycobacterium gilvum PYR-GCK]MNTSRLVPPVADDPHAMDGLRDEVRQFVAEQRDAGRIGRQVDSWLTGWDE
DFSRALAARGWLGMTVPEEYGGHGRSFLERFVVTEELLAAGAPVGAHWIA
DRQIVPSLLKYGTETQKRRYLPEIAAGRCYFGIGMSEPDSGSDLASVRTK
ASPVDGGWSVTGAKVWTSGAHRADAFICLARTEPVDPAHRHAGLSQFIVD
LRSPGVDIRPIVSMDGRHHFNEVLLDDVFVADDMVFGAIGDGWQQVTSEL
AFERSGPERFLSTFPLLAELAALMNDGLPRHNDLGRYVARVAGLHQMSTA
VAGALERHEPADTAAAVVKVLGTSTEGDIADFADLLTDACAPDHGGYRAM
LDDAVVQRPGFTLRGGTNEILRGVIARGLGMR
145225740YP_001136418.1 hypothetical protein Mflv_5164 [Mycobacterium gilvum PYR-GCK]MTTWELDPSDGELLLTTGVTGPAAKMGHRLTIAVQWRATVEWDGDRPVSV
EMTVDVGSLEVLGGEGGVTGLSGPEKALARANALKTLQAKRFPQIVFRTS
SIEPTDHGYLLHGTLDLHGRSRDRVLEVEVEDLGEQWQMGCRATVSHADH
GLKPYSMMMGAMKVADEVAVSFTARHPT
145225738YP_001136416.1 luciferase family protein [Mycobacterium gilvum PYR-GCK]MHVDVMTTPQPLRSTGDLARRTQGAGFDGMLFTETGRTAYLNVAAAALAA
PGLQLSTGVAVAFPRSPFVTAASAWELQEASGGNFRLGLGTQVRTHVVRR
YGVEFEHPGPRLRDYVLAVKACFGAFRTGTLDHHGDFYNLDFITPQWSAG
PIDAPDPKVDVAAVNPWMLRMAGEVADGVHVHPLGEPGYIARHVIPKVAE
GAQKSGRSPSEIALIVPVMTVVGDTDEERHRERELVRASMSFYGSTPNYA
FIWDEAGFEGTTARIREKQKAGDIKGMAAQITDEHIATFATESTWDGLAD
ALKAKYGGTATRIVLYNALANPERFERYGIVAQRLSNAQQA
145225736YP_001136414.1 secreted protein [Mycobacterium gilvum PYR-GCK]MAVHWTPNWTCATATGLTATLLLAGCSRGPDDEGATPIRERATAAVDFTL
PDAQRYHRLATYPVHLNKPATDPVDAETVAEISTVTPDGNTVIYTDAAGK
RIGFLDIRDPANPVGLGTLSLAELGHADDQPTSVAAVGEYVLVVVDTTGG
DFANPSGRVDVVRVADRTRVHSVDLGGQPDSIAVAHDGSFAAIAIENQRD
EEFTPPGAEEGDLPQPPTGFVQLLDLAGAPDTWVPRRVDFDVDAARAAGL
DTPEDLEPEYVSVNARGQVAVTLQENNGIAIIDGRTGAVQKISSAGTESV
TGIDTAEDGGVEQTGSITDTPREPDAIGWIDDTHVATANEGDWKGGTRGW
SIFDAGTGEVVWDAGNSVEQLAVRTGLHIESRAESKGPEPEGLAITEIGG
RPVALVASERSNFVAVYDVSDATNPQFRQMLPATPGPEGILPVPARDLLV
ISSESDDAEARVRATVTVYGFGERYAGAPPFPSIVSGDVDGTPIAWGALG
ALSADPADENRLYTAPDVAYGPSRILGVDLTQTPALIDTELPVTEAGEAV
TLDVEGVAARPDGGFVLAVEGEEGPGNQLVFVGADGAIERRVSLPSEVAA
GLGGQGFEGVALDGDAVWVAVQREVKTDPSGVARLGRYLPDSDTWEWFGY
PLESTDVDGDWIGLSEIQVHDGALLVLERDKLNGPDARVKAIYRVALPTG
AGATGAAAPPLLPKALARDLLPDLQATRGYTQEKVEGFAIAGNGSLYVVT
DNDGLDDANGETVFLDLGPAGDALR
145225734YP_001136412.1 hypothetical protein Mflv_5158 [Mycobacterium gilvum PYR-GCK]MTTESEADFAAFSALPEVDQTARPPHQRRPRFDGDVSELPDRACWALQHL
LTRRYISAESDADIYAWVLEYRSQLSTRLSELDLILRVVDGTDVAFVEQA
RYESAKGIKLLRREPLGTYDSILALHLAQMMRAAGGQSVLISREEMHGLF
SGVLNDTDRDAVTFAGRIDAAIARLAGLEILRKSRDDEDSYTISPVITAV
MTASVISELQQQFELLINGATAEAETHLD
145225732YP_001136410.1 2-nitropropane dioxygenase [Mycobacterium gilvum PYR-GCK]MDTLSTPWSAELGLDVPIVNAPMGGAAGGTLAAAVSRAGGLGMVGMGSSA
SAAQLRAQLAELGELKRPFGIGVIDWVIRKEPELLTTALDARPTALSVSF
GTEWDWVARARDAGCVSVTQVADVEAALRAVDAGVQVLVARGAEAGGHGT
PAVATLPLLAAILDRVEVPVLAAGGIASGRALAAVLAAGAAGAWIGTAFA
TCPESLFPDEARRALLTADATDTLTTRVFDVALGYPWPAHFPERVLRNAF
TAAWDGRTPDDDARARLAEAIADDDFRVAPVNAGQGVDDITAVEPAAMVI
ARLCDDARRLLAKPPTR
145225730YP_001136408.1 alcohol dehydrogenase [Mycobacterium gilvum PYR-GCK]MRAAVLEAVGQPPTVREFDEPTRDVVRVSLAGCNPVDLALASGEMGDPVI
PSVVGKEGIGRTADGTRVYFDSPISPFGSWAELTQLDPDLAFEVPDDVDD
DLAVALGIAGLAAWLPLTRHADVSAGQSVLILGATGIVGNIAIQAAKILG
AGRVVGAGRDAGALQKAQELGADAVVQLGTDDDAAALKSEVKDGYDVVVD
LIYGDPFLAALDATTVGATLITVGQGAGTPAIPFAKLMGRTHVGHMNNLL
PASVMRQAYAELVGLASEKRLTVETTRYSLDDAEKAWDAQADSPHVKIGI
AP
145225728YP_001136406.1 ATPase AAA [Mycobacterium gilvum PYR-GCK]MTELVLTEEFREALALLAGGRHVFLTGKAGTGKSTLIRRFMADTDRNVVV
VAPTGIAALNVDGYTIHRMFGFRSTTTLDDVRSGEYRPGRFTKTLAALQT
LIIDEASMVRADVFDMVAAALERFGPEPGTPFGGVQIVLVGDLYQLPPVV
REDEATYFSTTYGTPYFFSANAFHRDDFPTVSLTTVFRQLGDDRMTAILN
EIREGVLLGHAQEQLNARADKDFVPPEDEFWLTLAPTNRLVTARNRQQLE
RLPGEEFTHHAKASGDLAMFEAPVEETLRFKVGAQVMMLNNDQGNRWVNG
TVARVVGVGYDRYGAVVEVEFPDGTSADVSPFTWEVTRPVMSGSSLSREV
VGAYTQLPFKLAWAITIHKSQGQTLERVVVDLTGGMFSTGQLYVALSRCT
SLAGLVLKRPVLPKDLKTDRRVTRYLRTSSGAAGARRYCAIGMLTVGDEG
RMSRPRPVELAVAFDDGTAVTTLVNPQRDLADARKAFGITVSDVLLAPTL
REAWAVIAPMLAGATPVGPGVDETLGLLDFELKRLGFVTPMPLGVEVRGT
RAQGRTALERARSALQAHRAADAEDGSSTFDDPETVELSGLLVSRDASVP
TPVADHLPGLSALLRISRDVGSVLLGGTAPPRDDATGWEAGARQSVADQL
RVAANRVQLTDEVLSRLHAAEELLGVEILSGTELLDRPDVDGILAPGARI
CFTGTAQDPDGRVVERDEMERLATAAGLVPVKSVTKTRCDVLVTAEAGTQ
SGKARKALEYGKPVLCADDFFAWLAAHGP
145225726YP_001136404.1 hypothetical protein Mflv_5150 [Mycobacterium gilvum PYR-GCK]MSVTAGELTGTERAVLLVLMAASRPVPNRELAVLGPALDKTGRDKLNRLG
LIESERVGSRFVHELTDRGWRLCRELIDAGPPPRSTGPAKTLYTVLGALG
RYLDGAGLSLADVFGASHGGPARTEDRIRTVYTRLAGRPGGWVSLTALRA
ELDAPRAEVDAALAVLHRTPGVSVIPQEDQKLLTPEDRDAAVIIGDRPKH
LIAIED
145225724YP_001136402.1 short-chain dehydrogenase/reductase SDR [Mycobacterium gilvum PYR-GMDLGLSGKRFVVSGGTRGIGRAVVEGLLAEGASVAFCARTPAAVEQAQAE
LSANGAAVAGAVVDVGDAAAVEAWVTQAAGMFSGLDGVVANVSALAIPET
HENWRTTFEVDLMGTVGMVDAAMPYLLESDAGSIVTVSSVSGREVDFAAG
PYGTMKAAIIHYTQGLAFKYAGQGVRANTVSPGNTYFPGGVWTSIEENDP
QLFATALALNPTGRMATPQEVANAVVFLSSPAASFITGTNLLVDGALTRG
VQF
145225722YP_001136400.1 putative esterase [Mycobacterium gilvum PYR-GCK]MTFFARIAVAVLLAAGLLTVAPSPQAAAFSRPGLPIEQLDVPSPSMGRTI
RVEFQGGGPHSVLLLDGLRAQDDFNGWDINTSAFEWFYESGVSVIMPVGG
QSSFYADWYRPARNNNATLTYKWETFLTNELPTWLATHRGQDPFGNAVVG
LSMSGSAALTLAAWYPRQYKFAASLSGYLAPSQKFWPSLIDIAMQDAGGF
DSFDMWGKPGSPAWLRADPMLNINRLVANRTALWVYCGNGVASDLDTGTD
LGVNISAGSLETITIATNKEFRDKYLAAGGRNAIFNFPPNGTHSWGYWGA
QLQAMKPDIVRLLNPPPPPPPAPLPPGAPLPPPPAPPAPPAPR
145225720YP_001136398.1 glycogen/starch/alpha-glucan phosphorylase [Mycobacterium gilvum PYMNGSAVGPTGQTRSGMSADALRAAVRDHLVYSIARPAAVLTPEHYYRALS
LAVRDRMQKRWMATTQDWLDLSAKVTCYLSAEFLMGPQLGNNLLNLGIEK
QAREALSDLGQDLDEVLACEGEPGLGNGGLGRLAACYLDSLATLERPSIG
YGIRYEFGIFRQEISDGWQVEKTDNWLVRGNPWEIDKPDASYVVNWGGHT
EQYEDVTGRLRVRWVPQRVLQGVSYDTPVQGYGVNTCNTLTLWSARAVES
FALEAFNTGDFYKAVDEEVVSETVSKVLYPNDEPEAGKRLRLLQQYFFVT
CSLQDILSIHLKRAHLPLHRLPDKWAIQLNDTHPSIAVAELMRLLIDEHH
LAWDDAWDLTVRTFGYTNHTLLPEALETWPLRIFGEALPRHLELIYEIND
RFLDEVRARFPGDEERVSRMSLIGEDGGKSVRMAHLATVGSHAVNGVAAL
HSELLKQSVLKDFYEMWPERFGNVTNGVTPRRFLALSNPGLRALIDDTIG
PGWLTDLERLHGLESFVDDPAFRLRWREVKRANKSRLAEYVHSITGIELD
PTWMFDVQVKRIHEYKRQHLMVLHIIALYQRLKNNPGLTIPPRAFIFGGK
AAPGYFMAKRIIKLITAVGDTINADPEVNRCMKLVFLPNFNVKNAHLVYP
AANLSEQISTAGKEASGTGNMKFMINGAVTIGTLDGANVEIRQEAGAENF
FLFGLTESQVEKVKADGYRPLSHVENDAELAGVLELIARGEFTHGDTEVL
RPIVDNLVHHDPFLVLADYRSYVDCQDEVSRAWLDRDAWSRMSIRNTARS
GKFSSDRAIREYCDEIWGVRPMSVDLE
145225718YP_001136396.1 FAD-binding monooxygenase [Mycobacterium gilvum PYR-GCK]MIDLVVAGGGPAGLATAIHAARAGLETVVIEQRTGPIDKACGEGLMPHAV
RQLALLGAQPAGIAFRGISYFDADHAVTALFDSGHGLGVRRKTLHAALLT
EADRAGVKLVHAKAGPLTQDADSVSVNGFRARYLAAADGLHSPIRARLGL
ELPTAGTKRWGLKRHIAVAPWSDMVEVYWSDDPGSGEAYVTPVAPDCVGI
ALLTSRQGGFDEHMAAFPELRDRIAGFAHEPDRAAGPLRQRVRRRVAGRV
LLVGDAAGYVDALTGEGLGLAFAAARLLVDSVAADRPGDYEARWRRATRR
YRVMTAGVLRAGTSPLRSVIVPAACRLPPPAGVSRCGEPARRVKRRRP
145225716YP_001136394.1 chalcone/stilbene synthase domain-containing protein [MycobacteriumMTDVHTPVSVIAGVQGALPPHRYSQAEVTDAFLAAPAFAEVGDLLRSLHT
NAKVDARHLVLPLEQYPDLLDFGDANDLYIHHAVELGCQALTAALDEAGL
APSDLDVIMSTTVTGIAVPSLDARIAAKLGLRPDVRRVPLFGLGCVAGAA
GIARMHDYLRGAPGHVAALISVELCSLTRPALAPTIGSLVGSALFGDGAA
AVVAVGEERAGHIRASGPDVLDSRSRMYPDSLDIMGWSVNHNGFQLVLSP
ELPALIERYLPDDMASFLGEHDLGIGDIATWVSHPGGPKVLEAIASALDL
PDDALELSWRSLAEIGNLSSSSVLHILRDTIAKKPPAATPGLLMAMGPGF
CSELVLLRWH
145225714YP_001136392.1 hypothetical protein Mflv_5138 [Mycobacterium gilvum PYR-GCK]MAAAMTAVLVQCAPASSPAPPPPEPPPPPVRQLPPETFRTVAPPPPPPTE
IRPVTAAELGATWRPGCPAGPEELRLVELDHWGFDGQTHRGRLVVHRDVA
EAVVDVFARLLEMRYPIEKMRTVENYPGADDELSMRDNNTSAFNCRGIPG
SDSWSLHAYGRAIDVNPKLNPYVPRSGVHEPANAGPWVDRSRSEPGMLHD
GDAAVLAFTDRGWRWGGHWRSPLDYQHFEIG
145225712YP_001136390.1 alkanesulfonate monooxygenase [Mycobacterium gilvum PYR-GCK]MTHAIKLHWFLPTYGDSRHIVGGGHGTPAGSAHSDRDASIDYLASIVRAA
ETFGFTGALIPTGAWCEDAFITAALLARETSTLGFLVAFRPGLVSPTLSA
QMAATFARHAPGRLLLNVVVGGEAHEQRSFGDHLDKDGRYARADEFLDVV
RRLWDGQTVSLDGEHIRVENASLPTVPAPVPPLYFGGSSAAAGPVAARHA
DVYLTWGEPPAAVAEKVEWIRRAAAGQGRQLRFGIRLHVITRDTAGAAWA
EADRLVGALDDETVRNAQEGLGRSQSEGQRRMSALHQAHRANGSWHDART
LEVAPNLWTGVGLVRGGAGTALVGSHSEVADRIAEYAEVGIDEFIFSGYP
HLEELYWLGEGVVPLLRERGLFEAGPKQAASASIPFVGGTGRGRI
145225710YP_001136388.1 aminomethyltransferase [Mycobacterium gilvum PYR-GCK]MAPGSVTAVPVFGGDRFDIVDQYGRQPAELTVLAADPRAVADAPPDTAAT
VLRSLIPGSDENGYAAQRILSLLARHRVDQQEAVATRLFGHHSPAGSRAT
FTVDADAVVLVAAPASPMHPHSDDPNPPSEVRVAVYRADPGRPATPELPP
PLAEPLLDLRIDAETAASYEVREGQFIQIIDVAGRQCSDFLAFDARGLAD
GREYGLDATTTRTIGGAAYPRPGLRGKFYDARARPLVEVVRDTVGRHDTF
ALACTAKYYADLGYLGHVNCTDNFNGALARFGVDRRQGWPALNLFYNTAF
DAAHQLISDEPWSCAGDYVLFRASADLVCASSACPDDIDPANGWVPTDIH
VRVYDSSRRFSVAVGHRLTPDSEPVLTKSTAFARRTGALTTDFTEYNGYW
LPNRYANHGPHDEYWACREHVAVMDLSALRKFEVLGPDAEALLQATLTRD
IRRLSRGQVVYSAMCSESGGVVDDCTVLRLGDNNFRFIGGDPHGGVWLRT
QAERLGLHQVWIKDSTDQMHNLAVQGPASRAVLDGLIWTPPGQPALRDLG
WFRFLTGRLDGPDGAPLLVSRTGYTGELGYEVWVHPGDAETLWDRLWDAG
RPHGLTPLGLEALEMVRIEAGLAAGGHEFDDQTDPFEAGIGFTVPLKTKT
DDFVGRAALVERKAHPQRTLVGLRLDSNETTAHGDCVHLGRTQVGVVTSA
TRSPLLGASIALCRIAVQHSEPGTRVEIGKLDGHLKRIPATVTTIPFYDS
DKTRPRS
145225708YP_001136386.1 hypothetical protein Mflv_5132 [Mycobacterium gilvum PYR-GCK]MRVDGQDVAVSGSLLQPLTRRTNDIFRLSLAGIFLVVVVTSSLITRYEWE
ALEKSISGIVGVLSPTQSNTVYLIYGIAILGLPFFILIGLILARQWKLLG
AYGAAGVIAILALSITGNGIAAPRWHFDLTVRLDTVLSQFLDDPRWIAML
AAVLTVSGPWLPARWRRWWWALLLAFVPIHLVVSAVVPARSLLGLAVGWF
VGALVVLVSGTPALEVPLDGAVRALMRRGFPPAELRVLRPAGEGPLVLDA
TASCNSKADSKADSDTEPETALVELYGPHQRGVGFLRQFWGKLRLRDDET
APLQPSMRRAVEHRALMALAVGNLGMANTQPIAVATLDRGWTVYAHKPAR
GIPLADCADETPVARVWDSLGVLHSQQISHGDLRRGEITVVDGRPLFGGF
SRAEFGASDAHLHTDIAQLLVTTADLYGPPKAVAAAITVFGNDSVLAASR
RLTRAAVPKAVRDSVRDAGATMSKLRDEVKYQTGADQIKTETITRFTRNQ
VVQMVLLVALVYVAYPFISSAPVFFSELRSANWWWALVGLAVSALKYLGA
AAALWACADGMVRFRSLTVMQVANTFAATTTPAGVGGLALSTRFLQKGGL
GALRATTAVALQQSVQVITHITLLILFSAAAGASANLSRFVPSTTVLYLI
AGVVLGAIGVSLFVPKLRHWLATAVRPRLKEVLDDLMLLAREPKRLALII
LGCATTTLGAALALWASIEAFGGDASFITVTIVTMVGGTLASAAPTPGGV
GAVEAALIGGLAAFGVPAAVAVPAVLLYRILTCWLPVFVGWPIMRWLTRK
EMV
145225706YP_001136384.1 exodeoxyribonuclease V subunit beta [Mycobacterium gilvum PYR-GCK]MEPFDLLGALPEPRTTTVLEASAGTGKTFALAGLVTRYVAEGVATLDRML
LITFGRAASQELRERVRSQIVDALRAFDDPAAIGDNEVVRHLVTGDAEEC
DARRRRLRDALAGFDAATIATTHQFCQLVLRSLGVAGDTDSGVELVESLD
DLVAEIVDDLYLAHFGQDRDEPLLTHESALRLAHAVVGNAHTELRPRDPA
PGSDAAVRVEFAKAVCAELETRKRKLGILHYDDLLSRLADALEAPDSPAR
ARMQRRWSIVMVDEFQDTDPVQWQVIDRAFRGHATLILIGDPKQAIYAFR
GGDIVTYLHAAATAGVQRTLGTNYRSDAPLVEGLQAVMRDAQLGDPRIVV
RRVDAHHREHRLQGAPHNEPFRLRVCTRDQFRVRPDRMIPIDVLRNHIPK
DMAADIAALLNSGATHCGEKLAPGHIAVIVESHRDGHACFAALADAGIPA
VYTGDSDVFSSPAADDWMCLLEAFDQPHRSGLVRAAATTMFFGETAEALA
LQGDSLTDRIAETLRQWADFARERGVAAVFEAAQLRGMGARVLRWVDGER
HMTDLAHLTQLLHDTAHREQYSLPALRDWLRAQRDDRGGLRGTVERNRRL
DSDAAAVQIMTVWVSKGLQFPVVYLPFAFNRNVQPRDVVVFHEPATSDGA
GDIRCLHIGGESSPDFAAVAQQARLEAAGDDVRLTYVAMTRAQSQVVAWW
APSRDELNGGLSRLLRGRAPGDPVVPDRCDPARIDDAEAMARLRAWADEG
GPVLEESIIAERVEVELPAPPDTLAVRHFHRRIDPLWRRTSYSGLIRAAE
QESGVGSEPEVVELDDEVAELRAPDTEPATPDVDMASPMAGLPMGAKFGT
LVHAVLETADPFAVDLAAELEAAVVEHSLWWPVDVPPAELAAALVPLHDT
PLGPLAPGVTLRDIGLRDRLREMEFEFPLAGGDRRDDTPDITLADVGRLL
RAHLPADDPLAPYAARLTTGALAGQPLKGYLNGSLDAVLRVDGRYLVVDY
KTNWLGDPAGELTAADYAPARLAEAMLHSDYPLQALLYCVVLHRFLRWRQ
PGYSARRHIAGVLYLFVRGMCGPDTPVLDGHPAGVFSWQPPAALIEELSD
LLDAGAVPA
145225704YP_001136382.1 hypothetical protein Mflv_5128 [Mycobacterium gilvum PYR-GCK]MCQHLRMEPNGDPEARIRDLERPLADRARASELGTHPYGAPPVPPYQDVA
LPPMPPGVEHPAPVYGSPYYAPPQRVVHKRSNTALWLIPVVVVVVLAAGI
IGIVAYFSSGTPDSYTYTPPVSGGGGPLDAPLPPQVQTRTDSTEQVITVD
SGGFVSIGGVEKNQTIVCDEGTVSISGVNNTIEVTGRCGSVTVSGVDNTV
TVESAGTISASGFHNRVTFLAGDPQTSTSGSGNVIERQ
145225702YP_001136380.1 Mg2+ transporter protein- CorA family protein [Mycobacterium gilvumMTHVHGRIWRDGKTADDFEFSAISEYLATEGTLLWCDIYDPDHATLKSLA
EEIGLNEWAVEDAIADAERTKAVVYKTHTFFTVYDVWVKDPAPEDNSEST
LEIHRISGFVLPRGLITVRISPHVDMEKVSRRYDDLGGQEHGVGSLVHAL
LDVVVDGHFTAVQSLDDGIESLEDDLFAERPLRGRLQRRTFQLRKDLVAL
RRVVLPMREVVTAIQHRRLDARNAVELDAVYADLYDHVLRASEWTESLRD
MVTTVFETNLSLQDARLNIVMKKLTGWAAIIAVPTAITGFYGQNVDYPGI
DTVGGFVTSTSIIVVLVIVLYWTFKARDWL
145225700YP_001136378.1 hypothetical protein Mflv_5124 [Mycobacterium gilvum PYR-GCK]MKNIALCFDRDRDGVAESTNASVSAVLLQRSADQIVWSPTCPGHRRGAFG
AGHTALDAARAAVAGAYGFLVDEWAPGDRLFLFGAGRGAVSAYALARLLG
TVGVLNGDVPGWTTDDFREYALSTYALPRTPRDAADWRRIAGVVAGLSDR
DDVAVEVAFLGLWDCVAPAGFARAGAVGRLPTVRSARHAVAIDGGYPHPG
PQLLGGAAGGGVEEVWFRGTHGDVTGGRGARPWLAGVALDWVLDGAVRAG
AALRQCPERYATRGADALAGGVPAVTFRKVPEEATVHASVQCFLRAHPSY
WRRLPSRVVWADPDWDARSERLVPGSAAPPPAAEIPALVAAS
145225698YP_001136376.1 50S ribosomal protein L33 [Mycobacterium gilvum PYR-GCK]MASSTDVRPKITLACEVCKHRNYITKKNRRNDPDRLEIKKFCPNCGKHQA
HKESR
145225696YP_001136374.1 (3R)-hydroxyacyl-ACP dehydratase subunit HadB [Mycobacterium gilvumMALREFSSVKVGDLLPEKVIPLTRADLVNYAGVSGDLNPIHWDDEIAKQV
GLDTAIAHGMLTMGLGGGYVTEWVGDPAAVTEYNVRFTAVVPVPNDGKGA
EIVFNGRVKSVDPESRSVTIALSATSGGKKIFGRAVAIAKLA
145225694YP_001136372.1 preprotein translocase subunit SecE [Mycobacterium gilvum PYR-GCK]MSDERDGVSSADTDNGTETDDGDNRGQTAVVTRPQRPTGKRSRRAVEADD
DADESPETDSSGSGSKDDDGRGPKARKKTSKRPKDQPSRNPIAFVINYLK
EVLGELRKVIWPNRKEMIAYTTTVLFFLIFMVAMIGGVDLGLARLITWIF
A
145225692YP_001136370.1 50S ribosomal protein L11 [Mycobacterium gilvum PYR-GCK]MPPKKKVTGLIKLQIQAGQANPAPPVGPALGQHGVNIMEFCKAYNAATES
QRGNVIPVEITVYEDRSFTFALKTPPAAKLLLKAAGVPKGSGEPHKTKVA
KVTWDQVREIAETKKEDLNANDIDQAAKIIAGTARSMGITVE
145225690YP_001136368.1 hypothetical protein Mflv_5114 [Mycobacterium gilvum PYR-GCK]MGDGRSATNYLAEWYLADLAEATVDDITTRIRTATEVTTAEGAPIRLVAT
LAVPSDEVLYGVFDATSSDAVVAACLRAGFPQQRLSCDVLTRFASGAA
145225688YP_001136366.1 alpha/beta hydrolase fold protein [Mycobacterium gilvum PYR-GCK]MQVRTGTARSGELEIHYEDMGDPNDPAVLLIMGLGAQLLLWRKGFCEKLI
NQGLRVIRFDNRDVGLSSKLTGHHAGAPLLPRMARSLAGLPSPAAYTLED
MADDAAALLDHLDIDRAHVVGGSMGGMIAQVFAARHHPRTKTLGVIFSSN
NQAALPPPGPRQLAAILQRPKGSSRDEIVDNAVRVSRIIGSPGYPAPLDR
LRTDAIEGFDRSYYPAGVGRHFAAILGSGSLRRYDRQITAPTVVIHGRAD
KLMRPSGGRAIARAIPGARLVLFDGMGHDLPEPLWDDIVGELKTTFAEAP
145225686YP_001136364.1 hypothetical protein Mflv_5110 [Mycobacterium gilvum PYR-GCK]MFLPHQIVGDQLNKQFDANVRTNFFRGMDFAGPVGDPGWFGPGSAVWHVH
SHMPALVFGLQCAAFLERLDPSIYWMGVHHSRLVKPETKNNPMPEIDPQG
FWARLGHSVAFFTGTAYGSTPTAERLALAVRSMHHTIKGTRPDGARYDAD
DPEWLRWNYATVVWGIATAHELYHPQPLRGKKLDRYYGEFVRVGHALGGT
DLPATKQDTLDCLKSYLPRLAVTYGAAMATGPGLPIPLAALNWAVRDTMP
SWAKGLIQHRDPNIVERTARRATVWSIINGWHAAAGPLPEFAEATARVAD
GVDPDLAPHTVPAYQPGSDPVRTRTELEDAFA
145225684YP_001136362.1 hypothetical protein Mflv_5108 [Mycobacterium gilvum PYR-GCK]MPALPPPIADERAGLREYLAAQQYAFHAIAFGLTDEQARSTPSVSALSIG
GLIKHVTHCQRGWMERVAAAPELCESDRRPMEDQADEYGDEFVVREDETL
ADILAAFQRQNDETIRLLESVDLGAAVPIPQHVPWFPKDVPAWSVRWVFF
HMIEELARHAGQGDIVRESIDGATLYELVAGLEGWPETEWLTPFTPAEV
145225682YP_001136360.1 helix-turn-helix- type 11 domain-containing protein [Mycobacterium MSETTGRVLQLLGLLQSRRVWSGDELAARLRVTTRSVRRDIDRLRELGYP
VHASTGHGGGYQLGAGAALPPLLLDPDEAVAVAVCLRVAAGGSVAGVGES
ALRALSKLDQVMPSRLRSQVAAVHDTTVTLAGATDTPVEPEVLMTLARAS
RDHEHVTVGYTDVRGNVTSRRVEPYQLVTTGRRWYLMCFDRDRDDWRSLR
LDRMSDVRAVGTTFIPREAPDAASYVRRAISSSPYPYVARVRYRAPADVV
ARVFPAASVDVEPDGPDACIVTVGADDPQRMVPWLAMPGCEFEVLEPDEV
VDAVRVVAERIARAGAGGD
145225680YP_001136358.1 glycoside hydrolase family protein [Mycobacterium gilvum PYR-GCK]MDVLSAASTELFTGPPDAPMQVVRVTYRDCALPTPVRVEGAGLCTVGEPV
AEPGGVPVEVSVQVADPAPGRRRDATVVAGDTSAAFDFVDAEPGWTMFMV
SHFHYDPVWWNTQAAYTSVWTENPPGRCRQTNGFELVSAHLDMARRDPEY
TFVLAEVDYLKPFWDTHPWERADLRRLIAEGRVEIMGGTYNEPNTNLTSP
ETAIRNFVHGIGFQRDVLGAEPATAWQLDVFGHDPQFPGMAADAGLTSSS
WARGPHHQWGPMAEVDGRAGDPARMQFASEFEWIAPSGRGLLTHYMPAHY
AGGWWMDSSATLQEAEDATFELFTNLKKVALTRNVLLPVGTDYTPPNKWV
TDIHRDWNARYTWPRFVCALPREFFAAVRAELDARGGTASPQTRDMNPIY
TGKDVSYIDTKQANRAAENATLEAEQFAVFAGALTGATYPDAALAKAWVQ
LAYGAHHDAITGSESDQVYLDLLTGWRDAWQLGTTARDHALALLSDSVDA
SVVVWNPLSHNRCDMVTVRLEEPFTGGMIDRDGNAVPVLTEHGGRTVTWR
ARDVPSLGWQSYTFVPGDQGGGWEPSEGDEIANDRYRVRVDPARGGGVCS
LQADGRELVAEGRVGNELTVYAEYPAHPVAGEGPWHLLPRGPVTSSSQHP
ATAVRRYRSALGERLVIDGEIPGLFTYTQTLTLWHGVDRLDCRTTVDDFG
GSDRLLRLRWPCPITGAMPVSEVGDAVIGRGFALLHDPDSGESVDAAVHS
HTLDNPAFGWFGLSSALRVRFRGDAVRAVSVAEVISPSGCEPAVRKLVAA
LVRAGVTATCTAADAPRYGDLSIDSNLPDLRISVGGVDENAFTATILTGV
VGDPPRWIPAARPLREVWVPGADLRDPSTLPVLVVGADGDVDDAIAALID
DLADAQIRIDQDVDEHFESYTVAMINRGVPGFAVEADGTLNASLMRSCTG
WPSGTWIDPPRRTAPDGSNFQLQHWTHAFDYAVVAGEGDWRDLRMPSRAA
EFNQPLLPVPARHDPSRGGLPSWGSLLDVAPERDVRVAALKAHGNPTARG
SARRGGPHDGVTLRVVETLGRDAEVSVQSGLRHIDAPQRLNLIEEPLRET
RRTAHLAGYEIATLRTELNFPRIRNAEQMSLAPDAEPVQPLYARYWLHNR
GPAPLGGLPAVAHLHPHRLQAVGSEVVTLRLTVASDATDTALHGRVRLVA
PPGWDLGADELPFVVPPGEYLESTVEVRVPGDVMPGHYPVRAELALVGGE
IPAAWHQTVEDVAVISVGGHADPLLHWVAEPQAVHVDAGQVASLGVTVGS
AAHADLTVEAHLISPWGTWEWLRPNIVGGALPARGGLALHFEVAPPVGTA
PGRWWALIRVACAGELLYSPAVPVVVRR
145225678YP_001136356.1 ROK family protein [Mycobacterium gilvum PYR-GCK]MALSMSDLTLTLDIGGTKLAAGLVDADGNLVRRAQTPTPDGDAETIWDAV
ASLLAETRSAADSTIGAVGIASAGPVDVPAGTVSPINIAEWHRFPIVERV
EAATGLPVYLGGDGLCMAMGEWWRGAGRNRRFMLGMVVSTGIGGGLVLDG
APFHGRTGNAGHVGHVVVEPDGDACTCGGRGCVETVASGPHLARWARAHG
WEGADARELAEAAGRGEDVALRAFARGADAVARTIASVAAVCDLDLVVVG
GGVAKAGSLLFDPLHQALRTYAGLDFLTDLRVVPAELGGDAGLVGAAALA
AHHGRFG
145225676YP_001136354.1 50S ribosomal protein L7/L12 [Mycobacterium gilvum PYR-GCK]MAKLSTDELLDAFKEMTLLELSEFVKQFEETFDVTAAAPVAVAAAGPAAG
GGAAEAAEEQSEFDVILEGAGEKKIGVIKVVREIVSGLGLKEAKDLVDSA
PKPLLEKVNKEAAEDAKAKLEAAGASVTVK
145225674YP_001136352.1 hypothetical protein Mflv_5098 [Mycobacterium gilvum PYR-GCK]MVDRLSVLIGAGVLTAGMSAAVLTGAGVAIASPDTASSTSETSETSDTSG
SERVSEKPADPRGEKADETPDETEAPDSVEDVVQDLDDEPDETDDRDDAA
TEADLDTDVAVDADEADEVADVEEPQADVEVPAVEVPAVVDQPASTVAVE
EPVAAVLVPATTTTPIEAHVARASASEAATPPRRQTLLSVLGAVVFNIYS
VALRVLGGPPILPPNSTVTVRSSTLTIDCGDGYEVPADWYVPDGPTPTRL
IYFQHGFMAAGPFYSFTAARLAEATHSIVVTTSLTSNFLACDGCWVGGTP
MHRAVADLFGDGNSALGDSAVAAGYAGALLDGVDKVALIGHSAGGGLAAG
AAAAMTGTGAFDRLAGVVMLDGVGFGDVTPRALERLPLDFPIYNLAARSY
FWNMSGTTNTAMETWRPGGFNGVKLDDSSHGDAMTGGNVFVQVAMNLVTG
WPKPANARAAELISAGWLDDMFTATSASGFYGAPNATLSIETASGVATAR
VLPGPAEKLTFIDRLFTAGSMILFGIDFATCADTDAGPEAQIGESAGIGR
PNTALSLDGRAKAGQSIGQQCVHG
145225672YP_001136350.1 DNA-directed RNA polymerase subunit beta' [Mycobacterium gilvum PYRMLDVNFFDELRIGLATADDIRNWSFGEVKKPETINYRTLKPEKDGLFCEK
IFGPTRDWECYCGKYKRVRFKGIICERCGVEVTRAKVRRERMGHIELAAP
VTHIWYFKGVPSRLGYLLDLAPKDLEKIIYFAAYVITAVDDEMRHNELST
LEAEMVVEKKAIEDQRDADLEARAQKLEADMKELEEEGAKSDVRRKVRDG
GEREMRQLRDRAQRELDRLDEIWTTFTKLAPKQLIVDELLYRELQDRYGE
YFEGAMGAESIKKLIETFDIDAEADSLRDTIKNGKGQKKLRALKRLKVVA
AFQTNRNSPMGMVLDAVPVIPPELRPMVQLDGGRFATSDLNDLYRRVINR
NNRLKRLIDLGAPEIIVNNEKRMLQESVDALFDNGRRGRPVTGPGNRPLK
SLSDLLKGKQGRFRQNLLGKRVDYSGRSVIVVGPQLKLHQCGLPKLMALE
LFKPFVMKRLVDLNHAQNIKSAKRMVERQRPQVWDVLEEVISEHPVLLNR
APTLHRLGIQAFEPQLVEGKAIQLHPLVCEAFNADFDGDQMAVHLPLSAE
AQAEARILMLSSNNILSPASGRPLAMPRLDMVTGLYFLTTEIEGDKGEFT
PAAKDQPESGVYSSPAEAIMAMDRGALSVRAKIRVRLTQLRPPAEIEAER
FPDGWNMGDAWTAETTLGRVLFNELLPRGYPFVNKQMHKKVQAAIINDLA
ERYPMIVVAQTVDKLKDAGFYWATRSGVTVSMADVLVPPEKQEILERYEA
AADSIEKQYQRGKLDKGERNEALVKIWQDATEEVGQALRSHYPKDNPIIT
IVDSGATGNFTQTRTLAGMKGLVTNPKGEFIPRPIKSSFREGLTVLEYFI
NTHGARKGLADTALRTADSGYLTRRLVDVSQDVIVRETDCETERGITVTL
AELQGDQLLRDQHIETSAYARTLATDAVDANGNVVVERGHDLGDPAIDAL
LAAGITEVKVRSVLTCATGTGVCAMCYGRSMATGKLVDIGEAVGIVAAQS
IGEPGTQLTMRTFHQGGVTGGADIVGGLPRVQELFEARIPRNRAPIADVS
GRIRLEESDKFYKITIVPDDGGEEVVYDKLSRRQRLKVFKHDDGSERLLT
DGDHVEVGQQLLEGSADPHEVLRVQGPREVQIHLVKEVQEVYRAQGVSIH
DKHIEVIVRQMLRRVTIIDSGATEFLPGSLTERGEFETENRRVVAEGGEP
AAGRPVLMGITKASLATDSWLSAASFQETTRVLTDAAINCRSDKLQGLKE
NVIIGKLIPAGTGINRYRNIQVQPTEEARAAAYTIPSYEDQYYSPDFGQA
TGAAVPLDDYGYSDYR
145225670YP_001136348.1 hypothetical protein Mflv_5094 [Mycobacterium gilvum PYR-GCK]MTPAQVGDTSLLMSDLKREGYVQVPDAFGERCTAPIRDAVTLLSQRGIPL
PFAFVFDELWLAFQGLSTFLSTALGADYRALPDFWVWYVPPNENAAGWGP
HRDRVQPTLDPDNSPHTLTVWLPFTDATPLNGCMYVLPAHHDPRFVERRW
DGDGNNVVHNPQDIRALPATAGSLLAWNQAVLHWGSRGSRLGKVARISAA
FEFQRGDRAPFNNPLLDPARIPTFSERLGLIGKQVLQYRHMYPLSDEVAA
VATTLFDRYMPRTMITLRG
145225668YP_001136346.1 FkbM family methyltransferase [Mycobacterium gilvum PYR-GCK]MTTAFRDLLGPQRLTDVVDIGANPIDGEPPYSPMLTEGLCRVTGFEPQPE
ALHDLQSRKGPYERYLPYAVGDGSEHTLNICRGSGMTSLFEPDPATLGLF
EILGPYAEVVDRVALPTQRLDEVAEIEHLDFLKIDIQGGELAVFCNGREK
LADAVVIQTEVSFVTLYKDQPAMGAIDVELRSQGFIPHCFAAVKHWPIAP
YVVEGNPRQAVNQLLEADIVYVRDFSRPDSLSDEQLKHLALIAHHCYGSV
DLALRCVMLLEDRGSIEVGARQRYSEILTAS
145225666YP_001136344.1 formyltetrahydrofolate deformylase [Mycobacterium gilvum PYR-GCK]MVEHTDADIHGPKDIGRLLLRCADRPGLIAAVSGFLTQTGANIISLDQHS
TEPVGGTFMQRTIFHLPGLTAARDGLEREFAEKVAEPFGIDFRLTEAAKP
KRVAIMASREDHCLLDLLWRNRRGELDMSVVMVIANHPDLADAVRPFGVP
FIHVPARTEIRDEAEQRQLDLLRGNVDLVVLARYMQILTPGFIEQVGCPL
INIHHSFLPAFIGASPYRRAKERGVKLVGATAHYVTDDLDEGPIIEQDVV
RVDHRHSVDDLVRLGADVERAVLSRAVLWHCEDRVIRHGNQTICL
145225664YP_001136342.1 type 12 methyltransferase [Mycobacterium gilvum PYR-GCK]MSIDTAYMRDALTRRLLRRGVSGGTITLPAVPAMVDEYVSMCNKIFAALG
RRFNADELSHLRSLLAKELANAFDGSNRSNIVISYDAPIGNVLNYHIQPQ
WTSLADTYDNWVATRKPPLFGTHPDARVTTLAAEIADPTTARVLDIGAGT
GRNALALAKKGHPVDAVELTPKFADILREEAYKHLLGVRVIDRDIFETLD
DLQKDYSLIILSEVTPDFRSPEQIRAVFELAAQCLAPGGRLVFNVFMPRP
GFMSDDAVNELADSARQLAQQVYSAIFFGDEIDTAGAGLPLRLMSNDSVY
EFEKENLPPGAWPHTGWYAEWVSGQDIFDVPREQSPVEMRWLVYQKTG
145225662YP_001136340.1 acyl-CoA dehydrogenase domain-containing protein [Mycobacterium gilMQDTHVVTNQVPPLVDFNPAASPVLAESLVREGGGWGADEVADLGALAGS
DRAQRWGDLADRHRPVLHTHDRYGHRVDEVEYDPAYHELMSVAVAHGLHA
APWADDRAGAHVVRAAKTSVWTPEPGHMCPISMTYAVVPALRHNPELAAI
YEPLLTSRDYDPELKLPTTKAGITAGMSMTEKQGGSDVRAGTTQATPNGD
GSYSLRGHKWFTSAPMCDVFLVLAQAAGRGERSDGGSGGLSCFFLPRILP
DGTRNRMFLQRLKDKLGNHANASSEVEYDGATAWLVGEEGRGVATIIEMV
NLTRLDCTLGSATSMRNGLMRAAHHAQHRSAFGAYLIDQPLMRNVLADLA
VEAEAATMLAMRMAGATDHAVRGDERETLLRRIGLAAAKYWVCKRATPHA
AEAMECFGGNGYVEDSGMPRLYREAPLMGIWEGSGNVSALDTLRAMATRP
ECVDVLFDELGIATGHDPRLDRHVAGLRPQFDDLESIQYRARQVAEDISL
ALQGSLLVRHGHPAVAEAFLASRLDGQWGGAFGTLPTGLDLAPILDRALV
KA
145225660YP_001136338.1 enoyl-CoA hydratase [Mycobacterium gilvum PYR-GCK]MTIRVEKNGAVTTVIMDRPQARNAVDGPTALALHAAFDEFDKDDSASVAV
LWGDHGTFCAGADLKAMGTADSNPVHRTGPGPMGPTRMVLSKPVIAAISG
YAVAGGLELALWCDLRIVEQDAVLGVFCRRWGVPLIDGGTVRLPRLIGHG
RAMDLILTGRAVDADEAKSIGLANRVVPSGAARQEAEDLAAELAALPQQC
LRSDRMSALNQWGKSESDAMDVEFGSLSRVAAESLEGAARFSAGTGRHGA
KT
145225658YP_001136336.1 hypothetical protein Mflv_5082 [Mycobacterium gilvum PYR-GCK]MSTSPLASAENGDTHVTGVGVVRTVDCRDSTLFVNGNGNQVFAIGNCYAV
TVQGSSNLVVADNVVNDITVYGWDQKVFYKNGAPFVWDRGRELGMTNQIN
RVSA
145225656YP_001136334.1 hypothetical protein Mflv_5080 [Mycobacterium gilvum PYR-GCK]MTAGSAARLAAALSLGALLAGCGAPDRPVTPPSSPAAPGDGFESADCNGV
TDADVARAAGPGMFAPAVVSDVGCFWQEDTMIEDVGAGMGITTWWYRGSD
MDTERDLEQLAGRTLTEWSIDDNEGFKAFDDSACSIYVAKGGDVITWSIQ
TMNSATMPDLCPVVEQLAQLSQQRVN
145225653YP_001136331.1 30S ribosomal protein S7 [Mycobacterium gilvum PYR-GCK]MPRKGPAPKRPLVNDPVYGSQLVTQLVNKVLLDGKKSLAERIVYGALEQA
REKTGTDPVVTLKRAMDNVKPSLEVRSRRVGGATYQVPVEVRPDRSVTLA
LRWLVSFSKARREKTMIERLANEILDASNGLGAAVKRREDTHKMAEANRA
FAHYRW
145225651YP_001136329.1 elongation factor Tu [Mycobacterium gilvum PYR-GCK]MAKAKFERTKPHVNIGTIGHVDHGKTTLTAAITKVLHDQYPDLNESRAFD
QIDNAPEERQRGITINISHVEYQTEKRHYAHVDAPGHADYIKNMITGAAQ
MDGAILVVAATDGPMPQTREHVLLARQVGVPYILVALNKADMVDDEELIE
LVEMEVRELLAAQDFDEDAPVVKVSALKALEGDEKWVKSVQELMAAVDES
IPDPVRETDKPFLMPVEDVFTITGRGTVVTGRVERGVINVNEEVEIVGIR
PTVTKTTVTGVEMFRKLLDQGQAGDNVGLLVRGIKREDVERGQVVVKPGT
TTPHTEFEGSVYILSKDEGGRHTPFFNNYRPQFYFRTTDVTGVVTLPEGT
EMVMPGDNTDIAVKLIQPVAMDEGLRFAIREGGRTVGAGRVTKIIK
145225649YP_001136327.1 hypothetical protein Mflv_5073 [Mycobacterium gilvum PYR-GCK]MSTFWRYVKIQAFVLLCGIVGPIFLVIYFATGADPLLAWMFWTGLLITAA
DVLIALAITGFGARSAAKKQALEATGVLALGQIVGIHETNTRINDQPLVK
IDLQVSGPGITPFSTQDQVVASVSRLPMITNRQLAMLVDPITNDYQIDWE
RSALVSGMMPATFTISEDNQTYDLTGQTEPLMEILQVLKSHGIGVDHMID
LRSNPAARQQVQAIVRRAVAQQAPPPPVPAGAPYLAAAPEPTTAQRLQEL
ETLRATGSITDDEYAAKRAEIIAEL
145225647YP_001136325.1 ornithine aminotransferase [Mycobacterium gilvum PYR-GCK]MTAVHASTDALIAAEARHVAHNYSPLPVVAASAQGAWITDVEGRRHLDCL
AAYSAVNFGHRNPEIIAAAHAQLDAVTLVSRAFHSDQLGPFAEALAGLCG
KDMVLPMNSGAEAVESGIKVARKWGTDVKGVSDSTIIVARNNFHGRTTTI
ISFSDDDTARRGFGPYTPGFRSVPFGDADALEQAIDGNTVAVLLEPIQGE
AGIIVPPDDYLPRVRALCTEHDVLMIADEIQSGLARTGRTFACDHWGVVP
DVYLLGKALGGGVVPLSAVVADRDVLGVLHPGEHGSTFGGNPLAAAIGRT
VVDILERGEFQQRATELGAHLQARLSTLTGRGVVAVRGKGLWAGVDIDPA
HGTGKQISLRLAERGVLVKDTHGSTLRFAPPLVITADEIDWAVARLEEVL
T
145225645YP_001136323.1 AsnC family transcriptional regulator [Mycobacterium gilvum PYR-GCKMFCCFRRMMDRLDDTDERILAELADNARATFAEIGQHVNLSAPAVKRRVD
RMLDNGVIRGFTTVIDRSALGWTTEAYVQVFCHGTIAPAELRAAWKDIPE
VVGAATVTGTADAMLHVLARDMRHLEEALERIRSSADIERSESIVVLSNI
IERSPG
145225643YP_001136321.1 hypothetical protein Mflv_5067 [Mycobacterium gilvum PYR-GCK]MKNLTIATTAAAALSAAFLGLAAPARAAPTGGDAQATISSLEAQGNRVIV
HKLADVDLDDASVVGINRGPAIRGTVQDYANDRTYQNTVTGRVYYVNVK
145225641YP_001136319.1 hypothetical protein Mflv_5065 [Mycobacterium gilvum PYR-GCK]MFDTMHRGLGEADLLAAIEQAAREEAQAGARRLAAIAELVDLTVDEDDER
GMWAFDPWKNAACHIGAALSISERRASAQMCIATALRYRLPQIAALYVQG
RLSTRLISEITWRTGLVADDVIATVDAALAGKAEKWGPLSEDKLIDAINT
VIARHDPDAVRRTKEALKKRDVHIGAHEDTDDVTTIWGLLLPPDAAAYTA
RIAALVKGLCDADPRSAGERRSDAMGAIGRGENQLACRCGSPNCTASGPS
TSPVVITVIADQAAVDTAQQLIADQDAEQQNTTATTAEPTCTKDPGSALL
PGAQILPIPVLAEAIRSGAKITPLWLPGPDPEPHYRPSAKLAAFIRSRDL
FCRFPGCDVSADRCDIDHVVPYPFGPTHASNMHCKCRSHHLMKTFWGGPD
GWRERQLPDGTVLWTTPAGTTYTTTPGSRLFFPAWDTTTAELPPMTTPPP
GAGREIQMPKRQRSRTADRAARIKAEREHNGTQRNLEERPRRGQPPPDYG
NDPPPF
145225639YP_001136317.1 ECF subfamily RNA polymerase sigma-24 factor [Mycobacterium gilvum MSADSEGAASEGAVPEGLDAPSALLALYDEALPAVYGYFVRRCGDRGTAE
DLTSETFLAAMDAARKPSPPDLSVRWLIGVARHKLADHYRRRWDRFATPV
AELPEPADPADEWDAELDRIVAEQVLTRLSDPHRAVLVLRYMDGCSVPEC
AELIGRTVHATEALLVRARRAFRAMYPEPEGGLS
145225637YP_001136315.1 hypothetical protein Mflv_5061 [Mycobacterium gilvum PYR-GCK]MAAPTITFDADRNWRLHPQVAVRPEPFGALLYHFGTRKLSFLKNRTIVEV
INSLSDHPDARSACRAAGIDDSQLAPYLHALGVLVQSNMLVAGENR
145225635YP_001136313.1 (S)-2-hydroxy-acid oxidase [Mycobacterium gilvum PYR-GCK]MARDTWFETVAIAQQRAKKRLPKSAYSSLISASEKGVSVSDNVEAFAELG
FAPHVVGATDKRDMATTVMGQDIPLPVIISPTGVQAVHPDGEVAVARAAA
ARGTAMGLSSFASKPMEEVTAVNDKIFFQIYWLGSRDAIAARMERARAAG
AKGLILTTDWSFSHGRDWGSPKIPEQMDLKTILKMSPEVLTKPRWFFSFA
KTLRPPDLRVPNQGRPGEPGPTFFEAYGEWMGTPPPTWEDVAWLREQWGG
PFLLKGLVRVDDAKRAVDAGVSAITVSNHGGNNLDGTPAAIRCLPAIADA
VGDQVEVLLDGGIRRGSDVVKAVALGARAVMIGRAYLWGLAANGQAGVEN
VLDILSGGIDSALRGLGKSSIQELTPEDILVPEGFTRTLGV
145225633YP_001136311.1 glycosyl transferase family protein [Mycobacterium gilvum PYR-GCK]MTGPRLPDGFAVQVDRRVRVLGEGAALLGGSPTRLLRLAPAAQTMLHGGR
LEVHDAVSAQLARTLLDATVAHPRPLSGPSHRDVTVVIPVHNNATGLTRL
VAALRGLKVVIVDDGSSRPVNEADFASAACDIRVLRHSRRKGPSAARNAG
LAVCATDFVAFLDSDVVPRKGWLEALLGHFCDPAVALVAPRIVAHEPSDN
VVARYEAVRSSLDLGLREAPVIPFGTVSYVPSAAIICRRSAILEIGGFDE
TLVSGEDVDLCWRLNESGARLRYEPIAMVGHDHRTELRKWFARKSFYGGS
AAPLTIRHPGKTAPLVISGWMLVVWMLVAVGSGIGYAASVAVAAVTGRRI
AKSLSTVQTEPMEVAVVAAHGLWSAALQLASALCRHYWPIALVASVLSKR
CRRVVVVAAVLDGVFDWVTRNGNADEDTKRVGILTYILLKRLDDIAYGLG
LWSGVVRERHAGALKPQIRA
145225631YP_001136309.1 major facilitator transporter [Mycobacterium gilvum PYR-GCK]MVDTLPRSDQDIDAAVMTLSKRRRIWLLAVASIDVLMVISSMVALNAALP
DIALQTSATQTQLTWIVDGYTLALACLLLPAGALGDRYGRRGALLVGLAI
FALASLAPVFLDSPTQIIVARAVAGVGAALIMPATLSLLTSAFPKSERNK
AVGIWAGVAGSGAVFGFLGTGVLLHFFSWQSIFYMFAAGALLMFIATCTI
GSSRDETATPIDWVGGALIGTAIAVFVLGVVEAPARGWTDPVVLGCLAAG
VVLAVAFAMVQLRREHPLLDVRLFTRPDFATGAVGITFLFMANFGFFFIE
MQFMQLVMGYSALETAFALAPLAFPVLVLGGTLHLYLPKVGLRFAVTGGL
LLLAGGLFLMRFLDADATFLDIMWPLLLAASGIGLCTAPTTSAIMNAAPD
EKQGVASAVNDATREIGAALGIAVAGSILAAVYHRSLASRLADFPEQIRT
TATDSLAHALSISEQMGPQGARLSELAQDAFIHAADRALLVLSLLLLVAA
VFVAIWSPGRDGRQWSVVRRLRKN
145225629YP_001136307.1 cytochrome P450 [Mycobacterium gilvum PYR-GCK]MSTPTMDRDSQEAAKVLADPKAYADDDRLHSALSYLRANDPVVWVDHPPY
RPFWAITKHADIMAIERANDLFLSAPRPLLVTAEADDLGKSQQEAGIGLR
TLIHMDDPHHRKVRAIGADWFRPKAMRDLKVRVDELAKRYVDRMRDIGPE
CDFVTEIAVNFPLYVILSLLGLPEEDFGRMHMLTQEMFGGDDEYKRGTTP
EEQLAVLTDFFNYFAALTASRREHPTEDLASAIANGLVDGEPMSDMDTLS
YYVIVASAGHDTTKDAISGGLHALIENPGELARLKGDLSLMPTAVEEMIR
WSTPVKEFMRTAAEDTTVRGVPIAKGESVYLAYVSANRDEEVFADPFRFD
VGRDPNKHLAFGYGVHFCLGAALARMEINSLFTELLPRLDSIELAGEAEL
SATTFVGGLKHLPVRYSLR
145225627YP_001136305.1 type B carboxylesterase [Mycobacterium gilvum PYR-GCK]MLVALVVAVACGSQASPQPAPDPAVVQTSTGPVRGTVADDHRLFAGIPYA
APPVGALRWQGPRPAPKWDGVRDATAYGPRCMQDLDGDLELGRQTDEDCL
NLNVWTPPVAGDRPEPKPVMVWIHGGSFVAGSSGVYDSRRLVARGDIIVV
TVNYRLGALGFLAHPALGPPGAVGNYGLADQQAALRWVRDNIANFGGDPA
RVTVAGESAGAMSVCDHLVAPGSDGLFDAAIVMSGLCQSQADLPTAEKRS
LDYAAQAGCGGPVPAECLRGLDANALRTPVWYYDIGDDRLSGPVTGSAVL
PTAPPVAFGDGKAARVPVLMGTTRDEWTLFVALQHLRDGKDYAPQEYPRL
LADTFGADAPAVEAHYPLTAFSSVALAYAATVTDGVFACAGRRWAGDLAE
TAPVYFYEFNDRDAPAPDPLRTVPFPVGASHSLELRYLFDTGGAPPPSPA
QVRLGEQMIDYWASFVKTGDPGFPGIDSGVMSLQPDGSRMIEDFDRVHQC
VFWDGLG
145225625YP_001136303.1 50S ribosomal protein L3 [Mycobacterium gilvum PYR-GCK]MARKGILGTKLGMTQVFDENNKVVPVTVVKAGPNVVTRIRTTERDGYSAV
QLAYGEISPRKVNKPVTGQFAAAGVNPRRHLAELRLADNEDAGALYEVGQ
ELTAEIFADGAYVDVTGTSKGKGFAGTMKRHGFKGQGASHGAQAVHRRPG
SIGGCATPGRVFKGTRMSGRMGSDRVTTQNLKVHKVDAENGVLLIKGAIP
GRNGGLVVVRSAIKRGEK
145225623YP_001136301.1 50S ribosomal protein L23 [Mycobacterium gilvum PYR-GCK]MANVVDPRDIILSPVISEKSYGLIEDNVYTFIVHPDSNKTQIKIAIEKIF
KVKVDSVNTANRPGKRKRTRTGYGQRKATKRAIVTLAAGSKPIDLFGAPA
145225621YP_001136299.1 30S ribosomal protein S19 [Mycobacterium gilvum PYR-GCK]MPRSLKKGPFVDDHLLKKVDVQNEKNTKQVIKTWSRRSTIIPDFIGHTFA
VHDGRKHVPVFVTEAMVGHKLGEFAPTRTFKGHIKDDRKAKRR
145225619YP_001136297.1 30S ribosomal protein S3 [Mycobacterium gilvum PYR-GCK]MGQKINPHGFRLGITTDWKSRWYADKQYADYIKEDVAIRKLLATGLERAG
IADVEIERTRDRVRVDIHTARPGIVIGRRGTEADRIRADLEKLTKKQVQL
NILEVKNPESRAQLVAQGVAEQLSNRVAFRRAMRKAIQSAMRQPNVKGIR
VQCSGRLGGAEMSRSEFYREGRVPLHTLRADIDYGLYEAKTTFGRIGVKV
WIYKGDIVGGKRELAAAAPAGADRPRRERPSGTRPRRSGASGTTATSTDA
GRAATEEAPATDAAATAPAAGQPETTES
145225617YP_001136295.1 50S ribosomal protein L29 [Mycobacterium gilvum PYR-GCK]MAVGTTTGELRELSDDELTDKLRESKEELFNLRFQMATGQLANNRRLRVV
RQEIARVYTVLRERELGLAAGPGGEDS
145225615YP_001136293.1 sulfatase [Mycobacterium gilvum PYR-GCK]MTTEFNGKIALDIRDSEPDWGPFAAPTAQPEAPNVLYLVWDDIGIATWDC
FGGLVDMPAMSRIAERGVRLSQFHTTALCSPTRASLLTGRNATTVGMATI
EEFTDGFPNCNGRIPFDTALLSEVLSENGYNTYCIGKWHLTPLEESNLAA
TKRHWPLSRGFERFYGFMGGETDQWYPDLMYDNHPVAPPATPEEGYHLSK
DLADKTIEFIRDSKVIAPDKPWFSYVCPGAGHAPHHVFKEWADRYAGRFD
MGYEAYREIVLENQKRLGLVPPDTELSAVNPYLDVKGPDGQDWPAQDTVR
PWDSLSEDEKRLFARMAEVFAGFLSYTDAQIGRVLDYLEESGQLDNTVIV
VISDNGASGEGGPNGSVNEVKFFNGYIDSAEESLKVFDELGGPQTYNHYP
IGWAMAFNTPYKLFKRYASHEGGIADTAIISWPKGIAAHGEIRDNYVNVA
DITPTVYDLLDITPPATVRGVAQKPLDGVSFKVALENPNAPTGKETQFYT
MLGTRGIWHRGWFANTVHAASPAGWSHFDDDRWELYHVDADRSQVHDLAA
EYPEKLDELKALWFSEAQKYNGLPLGDLDIFETMSRWRPTLSGERSAYVY
YPGTADVGIGAVVELRGRSFAVLAEVEVDPGGANGVVVKHGGAHGGYVMY
LQGGRLHFCYNFLGEYEQTLAAPDPVPPGLHTLGFTYTVTGTAEGSHTPI
GDAELFLDTERVASLAEMRSQPGTFGLAGASLSVGRNNGSPVSEAYHPPF
AFAGGRIARVNIDTSGAPYVDLERDFARAFARD
145225613YP_001136291.1 50S ribosomal protein L14 [Mycobacterium gilvum PYR-GCK]MIQQESRLKVADNTGAKEILCIRVLGGSGRRYAGIGDVIVATVKDAIPGG
NVKRGDVVKAVIVRTVKERRRADGSYIRFDENAAVIIKNDNDPRGTRIFG
PVGRELREKKFMKIVSLAPEVL
145225611YP_001136289.1 50S ribosomal protein L5 [Mycobacterium gilvum PYR-GCK]MTSTETKTLPRLKQRYREEIREQLLKEFGYANVMQIPGVVKVVVNMGVGD
AARDAKLINGAVNDLMLITGQKPEIRKARKSIAQFKLREGMPIGARVTLR
GDRMWEFLDRLISISLPRIRDFRGLSGKQFDGTGNYTFGLTEQSVFHEID
VDSIDRPRGMDITVVTSATNDDEGRALLRALGFPFKEN
145225609YP_001136287.1 30S ribosomal protein S8 [Mycobacterium gilvum PYR-GCK]MTMTDPIADFLTRLRNANSAYHDEVTLPHSKIKANIAEILKSEGYISDYR
TEDARVGKSLVVQLKYGPSRERSIAGLRRVSKPGLRVYAKSTNLPRVLGG
LGVAIISTSSGLRTDRQASREGVGGEVLAYVW
145225607YP_001136285.1 50S ribosomal protein L18 [Mycobacterium gilvum PYR-GCK]MATKTNTKETGHSPVGKNISETRRTSRLRRHARLRKKVSGTAERPRLVVN
RSSRHIHVQLVDDLAGVTLAAASSIEGDVRATDGDKKAASARVGQLIAER
AKAAGIEEVVFDRGGYTYGGRIAALADAARESGLKF
145225605YP_001136283.1 50S ribosomal protein L30 [Mycobacterium gilvum PYR-GCK]MAELKITQVRSTIGARWKQRESLRTLGLRKIRQSVVREDNAQTRGLIKTV
HHLVEVEEVKA
145225603YP_001136281.1 hypothetical protein Mflv_5027 [Mycobacterium gilvum PYR-GCK]MIRHRRTIVAMVAAGLTMFGGAATAQAETPDERFANVVTTLGIPHTPDED
LSVVGKRVCDMLTGSLTGNPNPVPAVRGVVSTLSSNANITKQQAVGLMQA
STYIYCPQWARFTGR
145225601YP_001136279.1 putative methyltransferase [Mycobacterium gilvum PYR-GCK]MARTPDDSWDLASSVGATATMVAAGRAVASADPDPLINDPYAEPLVRAVG
LDFFTRMLDGELDLSVFPDSSPERAQAMIDGMAVRTRFFDDCCLAAASAG
VRQVVILAAGLDARTYRLPWPDGTVVYELDQPDVIAFKTQTLRNLGAEPA
ATQRPVPVDLREDWPAALRAAGFDATRPTAWLAEGLLIYLPPEAQDALFD
TVTALSAPGSTLATEYVPGIVDFDGAKARALSEPLREHGLDIDMPSLVYT
GARTPVMDHLRGAGWQVSGTARAELFARFGRPLPQDADGTDPLGEIVYVS
ATLAADA
145225599YP_001136277.1 putative methyltransferase [Mycobacterium gilvum PYR-GCK]MPRTENDTWDLASSVGATATMVAAARAVATRAEDPVIDDPYAEPLVRAVG
IDFFAKLASGELTPEDLDVSGDESPVGMSRFADGMAARTRFFDDFFTDAC
AAGVRQAVILASGLDARGYRLTWPEGMTLFEIDQPEVIEFKRTTLAGLGA
TPSTHLATVAIDLREDWPTALRDAGFDPSVPTAWIAEGLLGYLPPDAQDR
LLDTIGELSASGSRLAVESVPSQQSADQDEMREKMKDSTDRWRSHGFDLD
FSELVFLGERANVPDYLRERGWAVTATPTNDLLTRYGLAPLDTDEGFAEV
VYVNAAR
145225597YP_001136275.1 adenylate kinase [Mycobacterium gilvum PYR-GCK]MREGPKLRIVLLGPPGAGKGTQAQKLAEKLAIPHISTGDLFRYNISNNTE
LGIEAKKYLDAGDLVPATLTNALVDDRLDDEDAAQGFILDGFPRSVEQAK
ALAEMLEKRGLTLDAVVEFRVPEEELVSRLKGRGREDDTEDVIRNRFKVY
RDETAPLLDFYSADLKTVDAVGELDEVFDRALTALGR
145225595YP_001136273.1 RNA polymerase sigma factor SigL [Mycobacterium gilvum PYR-GCK]MEDADAAMMRVLYDEHAAALWRYALRLTGDRARSEDVVQETLLRAWRHPG
VIADVDRPARAWLFTVARNMIIDERRSARFRHETGVPDPEHVAEPASPDE
ADPTLDRILLGTALRQLSDEHRAVVRRAYYQGWTTGQIAADLQIPEGTVK
SRLHYAVRALKLGLQEMGVTR
145225593YP_001136271.1 MarR family transcriptional regulator [Mycobacterium gilvum PYR-GCKMVIHTAGAPVRYERCVASDRPDPIATARDNWERSGWHDVADGMVAVTSVM
RAHQILLARVETALRPYDLSFSRYELLRLLAFSRTGALPITKASDRLQVH
VTSVTHAIRRLEADGLVERLPHPTDGRTTLVRITDLGRSTVEDATVTLNK
DVFGDIGISGEQSRALADAIETLRRSAGDF
145225591YP_001136269.1 GAF sensor signal transduction histidine kinase [Mycobacterium gilvMTRPLLTADRELALLRELIQAASSGPGVEPLAAASARMITASTDSDVCFV
HVLDDTERSLTLAGATPPFDSEVGKIRLPLGQGISGWVASHRQPVVIRRD
KESDPRYLPFQSLRGRDFTSMVSVPMETDPGGLVGVLNVHTVAERDFTDR
DVELLLVIGRLIAGAMHQARLHRQLVARERAHENFVEQVIEAQELERRRL
AGDIHDGISQRLVTLSYRLDAAAQAAKSPADHAALTEQLDRARELADLTL
QEARAAISGLRPPVLDDLGLAGGLASLARSIPQIGIETDLDDTRLADHIE
LALYRIAQECLQNVVKHARASAARLTFAVDDNTARLEIADDGVGFDTFEH
PLGSDEMGGYGLLSMAERAEIVGGRLNIRSRPGSGTTVTATIPLHQGGA
145225589YP_001136267.1 hydrolase [Mycobacterium gilvum PYR-GCK]MRSVQSTQQKAWRAGRFWWDWSETGEPDGRSLTTLSAVIFDLDALADVER
TGHRLAFNAAFAELGLDISWSETRYRQLQELPDERRRVAAELRKRGVSTE
CDVLAELLVDEICATKEMILGETILDADITARPGMAELIAEAYGAGIAVG
LVSCGSHTWVEPLVRQLVGEGMVGAIVTVDDAPREDLFRAALAELGAPAH
GSLAFAGSQGSRRAAVAAGLPTVLVDGAETAPLRIADCQRIHDSWYETHP
RPTAA
145225587YP_001136265.1 acyl-CoA dehydrogenase domain-containing protein [Mycobacterium gilMDYFGLDDDDRVIAETAAAFAEKRLAPHALEWDETHHFPVDVLREAAELG
MAAIYCGEDAGGSGLRRIDAVRIFEKLSTADPTVAAFLSIHNMCAWMVDS
FGTEEQRKLWVPKLASMDAIASYCLTEPGAGSDASALRTKAVRSGDEYVL
DGVKQFISGAGTSDVYIVMARTGSDGPKGISAFVVPKDTPGLSFGTDEVK
MGWNAQPTRQVILEGARVPADALLGGPDGEGTGFGIAMKGLNGGRINIAA
CSLGGAQAAYDKTVSYLADRQAFGGSLLDEPTIRFTLADMATGLETSRAL
LWRAATALDNDHPDRVELCAMAKRYVTDACFEVADQALQLHGGYGYLREY
GLEKIVRDLRVHRILEGTNEIMRVVIGRSAASRARAS
145225585YP_001136263.1 FAD-binding monooxygenase [Mycobacterium gilvum PYR-GCK]MPGAHRSDVVVVGAGPTGLTLACCLRLHGVSVRVLDAAAGPATTSRANFL
HARGSEVLDRMGALGTLPQESLRALRITNYLGDRPLATLEFGDPGMRTAA
PPMVVSQAKVEAALRARLADLDVEPEWGRKVIDVREDADGVVADLADGAR
VRGQWLVGCDGTTSVVRRQTGIEFPGVRLSERFLLADIHLDWAVDRAGTT
GWIHPDGVVGAMPMPSTDGRDDLWRLFVYDPSLDRKPTDSEILDRISELV
PYRTGRRVKIGDAEWLSMFTVHRRLADTYRRGRVLIAGDAAHVHAPFGGQ
GMLTGIGDAENVGFKLALVVRGLAADDLLDTYEAERRPLATQVLRGTSAI
TRVNVAGNPIVRFLRDRVAPRVFGLPAVQRWTTYTASQLWVSYRNGPLGG
RGSKPRPGDRIDDAPCSRPDGTATRLHGELGGRWALLLPRGVPAVGAAAV
RGPAGYLADHVVTLHHDRDDVMLVRPDAHLAWRGAHDDPTGLDRWLATAL
HPGGTQ
145225583YP_001136261.1 dTDP-glucose 4-6-dehydratase [Mycobacterium gilvum PYR-GCK]MRLLVTGGAGFIGANFVLATVRDRPDVRVTVLDSLTYAGSRESLAGVDTQ
IRLVQGDITDADLVGRLVGESDAVVHFAAETHVDNALADPEPFVRSNIVG
TFTILEAVRHAAASRPVRLHHVSTDEVYGDLELGDPAKFTESTPYNPSSP
YSSTKAASDMLVRAWVRSYRLTATLSNCSNNYGPFQHVEKFIPRQITNIL
TGRRPKLYGTGANVRDWIHVEDHNSAVWKILTHGAVGRTYLIGADGECDN
LTVMRTILRLMDRSPDDFDHVTDRAGHDLRYAIDATALRDELGWRPAHSD
FEAGLRDTIDWYSANESWWGPIKDAVEAGYQSRGQ
145225581YP_001136259.1 hypothetical protein Mflv_5005 [Mycobacterium gilvum PYR-GCK]MSDVTPDLGRFGSFGRGVTPEQAQQIEALGYGAVWVGGSPPAELDWVEPL
LAATTTLQVATGIVNIWTADAGPVAESFHRIESAHPGRFLLGIGVGHPEA
HQQYRRPIDALVEYLDKLDEYGVPRGRRVVAALGPKVLKLSADRAAGAHP
YLTTPEHTARARELIGPEAFLAPEHKVVLTTDERSREEHVTDPDRAREVG
RKALEIYLDLANYLNSWKRLGFSDEDVAKPGSDRLVDAVVAYGTAEQIAA
RLREHLDAGADHVPVQVLTGSDKLVPALAELAGPLGLESTEEQR
145225579YP_001136257.1 response regulator receiver modulated FAD-dependent pyridine nucleoMTGPEHQPRKPVILTVDDDPAVSRAVARDLRRHYGEKYRIMRAESGPDAL
ETLNELKLRGETVAVFVADYRMPQMSGIEFLEAAMDIFPLARRVLLTAYA
DTHAAIDAINVVDLDHYLLKPWDPPQEKLYPVIDALLDAWRSTGDRAIPH
TKIIGHPWNARSSEVREFLARNRLYYTWFRSDEPKGAALLEAAGQDGMTL
PVIITEQGETLVDPTDAELGSTLGLTTTPSGDFYDLVVIGGGPAGLAAAV
YGASEGLRTVLIERTATGGQAGQSSRIENYLGFPDGLSGAQLAERARRQA
EKFEAELITAAEVTRLEVDGNARTVHLSDGRTIGTRAVILAMGVEYRQLP
ADGCADLTGAGVYYGATASVAADCDDDEVYVIGGANSAGQAAMHLARTAK
TVTIVSRRTLEDSMSHYLIQQIRAQDNIRELPHTVVHAVKGDGHLEGICL
ENTQTGQRDEVTCGRMFIFIGAEPRTEWLDGVVVRDDHGFIPAGPDLRDV
SGWTLDRPPHHLESSVPGVFVAGDVRADSAKRVAAAVGEGSMAVMLVHRY
LAET
145225577YP_001136255.1 hypothetical protein Mflv_5001 [Mycobacterium gilvum PYR-GCK]MRPRGLREGDGMTKRMIRAAVAAAALYGARRYFRDWGTTKGESSSVLAGD
ELLGPPVLQATEGVSIDAPVEAVWPWVVQIGQDRGGLYSFETLENAAGLD
YHNADLIHPEWQHLAVGDSVRLVPRKWFGLADGVEMTVARMTAPQSIVLR
AAPPGLPWEMVWSFHLIPRGDDQCRLLIRSRLALRHPGEVVAAELVGPAR
AFVTRGILLGIKRRAEKAVKMPPVQGFTPAHTAEDLRP
145225575YP_001136253.1 UspA domain-containing protein [Mycobacterium gilvum PYR-GCK]MTLPTNRPYGVVAAVDGSPSSLAAAQWAAREASLRDVPVTLVHVKPTDEI
GPWLDMPVVPEYTAAIDRRCAEIVAEAVKVVSAALQDRRQVPVKEVTLSG
RVKPMLVEASGEADLLVVGCRGLSGLGRLLLGSTTAAMLHHARCPVAVIH
DEEVEEAASSDPVVVGVDASPASEPAVALAFDEASRRGVGLVAVHTWMNS
ADFYVDVSVIDVAAQAEEELAQRLAGWGEQYPDVEVRRVVAQDNPTHRLI
DESRRAQLLVVGSHGRGGFTGMLLGSVSSAVAQAARLPVIVVRGAG
145225573YP_001136251.1 alcohol dehydrogenase [Mycobacterium gilvum PYR-GCK]MQAMVYTGPGQRSWQTVPDPVLVDATDAIVRVDTVTICGTDLHILKGDVP
EVESGRILGHEAVGTVTAIGSAVQTLSVGDRVLVSCISSCGACRYCRQGH
YGQCLGGGGWILGHLIDGTQAEYVRVPFADNSTHKVPAGVSDEQMIVLAD
ILPTSYEVGVLAGRVGPGDVVAIVGAGPIGLAAVLTAKLYSPSHIVVIDV
ADTRLEAAKKLGADVTVNSRSRRPRDVIDELTGGLGADVVMEAVGLPETF
EESVDLVRPCGHVANIGVHGAPATLHLERIWIKNLTITTGLVDTHSTPTL
ISLVANGRLDAATMITHRYPMDEFDTAYQVFGDAANSGALKVVLTATS
145225571YP_001136249.1 UspA domain-containing protein [Mycobacterium gilvum PYR-GCK]MVRSSAVLVGVDGSATGAAAAAWAVKEAASRDLPLRLVHAVTATGDGRVD
AQDLARAGRIVHNAVTAVEALGAPVRIESQIICGATAPALSAASHDAAML
CLGFTNGASGRHRARRSTAAEIASSARCPVAIIHPAANHSPGARWVVAEA
GASPSDDATSTRAVDEALLRGAPLRIVAAWPSRYPDMYDDHAVARKNRLV
KARWERWLAPRRRQHPDLDAHVTAAPGSILNYLARHRKGIRLAVLSHERA
DDVAELLAPCVDCEFDILICDAPPGRRHDRTSSSEQSG
145225569YP_001136247.1 heavy metal translocating P-type ATPase [Mycobacterium gilvum PYR-GMAGSGHTRWRPLLEPALTILTVGALGAGAVAWLSGADRIADMCWAAGTAV
AIVPAVAWVILALRSGRLGVDLIAVLSLGGTLLVGEYLAGALIAVMLAGG
RALDAAASRRASRDLTALLERAPRFARRRTGTEVQTVPIAEVAVDDVLVI
APGDVVPVDGRVVDAVAVLDESALTGESLQVEHPVGEAIRSGVVNAGDVF
ELRVTATSENSTYAGIVRLAQQAGAESAPLVRLADRYAAYFLPLALAMAG
IAWLASGSAVRAVAVLVVATPCPLLLAAPVAIVSGLSRASRSGVVIRSGG
ALENLGRATTLVMDKTGTLTMGQPRVVDVVTGPGTDAAEVLRLAASVDQV
SPHVLADAIVTEAVNRGLRLTLPTEAAEEPGRGVSAVLDGRRVTVGKLGD
DAAQSAWAQGAVNRARLDSAALAWVCVDDRPVGAVLLRDPLRRQAPRTMR
RLREAGFDRLVMLTGDRPEPAREVATVLGLDEVYAQQTPADKVAAVRDER
ERAVTVMVGDGINDAPALAAATVGVAMGARGATASSEAADIVLTTDRLDR
LADAMDIARWSRRIAVQSAVAGMSLSLVAMAAAAMGWLPPAVGALLQEAI
DVAVIVNALRALRHDPRTKVDLTAGTESMLQGFAAEHDELRDALGQIRDS
ADLLAGSAARPGAAAFDSVKQSYALLTERILPHERAEETELYPALAVPLR
SGEATATMSRMHAEIQRLSDRIGTHVHLAESSGGIQPYQVDDLLACLYGL
HALLRLHFVQEEENYFTLVQTDPDR
145225567YP_001136245.1 UspA domain-containing protein [Mycobacterium gilvum PYR-GCK]MATANSDMPVVAGIDGSAAALGAALWAVDEAAARGATLRLVYVTKPSDRS
AAEYAGDVRHGRQSLREAQVLVQSTGESVNVETEIVDGPPAQALVALSEH
AQMVCVGSVGIGRYARSILGSTAADVAAAARCPVAVIRPESRVGVDTPNW
IIVAVNDRPHNGAVVEHALQEAALRHAAVLVLGDSRTAASAEVLEQRIRP
WHERYPQVHVYPIANRADVAHFLRKHDEPVLLAVLGDDEADEVAQIVGHG
RSALRHGASSALVVRS
145225565YP_001136243.1 HAD family hydrolase [Mycobacterium gilvum PYR-GCK]MPVFIDPRHHDAVIFEVDDPVADEVALSASQGDLARRLTAAGIGVGCAES
AMLRETARRLGVHPGRCVVVAGGEAGVRTARAGGFALIVGIDRAERAEDL
RSCGADVVVPDLVAVTVRDGYRRMSELADALQSYGEIVPLAETRTPVVLL
DFDGTLSDIVGDPDTAALVPGARSVLDALAARCPVAVVSGRALADIRDRI
GVPGIWYAGSHGFELCSPDGGIQENEAGLEIVRVLAGALAEVRERVGAVD
GVLIEDKRFSIAVHYRNVAAESVDEVVTAVRNIAQCNGLRADGGRRVVEL
KPDTGWHKGRAVEWILDRIDGDELLLPVYIGDDLTDEDGFDAVRLRGIGV
AVRSAESGDRRSAARFALDSPAAVCAFLARLSDQLAVEQDLTNDPWTLTF
GGYLPEDERLREALCTLGNGYLATRGAAPECDASRLHYPATYVAGIYNRL
FDEIAGTTVDNESLVNLPNWLPVTFRVDGGAWFDIDAVEFTSYVTTLDLR
RATLTREFVMRDQAGRITRIRQRRLVAMHRPHVAAMATTVRAENWSGRLQ
LRSVLDGGVENLGVERYRALSSRHLTVDAMRELSRDAVLLQTHTGESQIQ
IAVAARHRVTGGEPESVDQRVFRDDCRIGHDIEVVVTAGQAVTLEKVIAV
YTGRDHGMSGPVTAAEREIAGADTFDRLEDGHRLAWAHLWERFNIDMGHD
PNLLRLVRLHQLHLLQTLSPHTADLDVGVPARGLHGEAYRGHVFWDELFV
FPVLNMRLPKVTRSLLLYRYRRLPEARRAAAEAGYAGAMFPWQSGSDGRE
ESQRLHLNPRSGRWNPDASARAHHVGLAIAFNIWQHYQVTGDIGFLIDYG
AEMLVEITKFWVSAANLDPHRDRYVIRGVIGPDEFHSGYPGREYDGVDNN
AYTNLMAVWVIVRTLEALERLPLSYRLALLETVGVGDEDLAHWEDVSRRM
FVPFHDGVITQFEGYDRLRELDWEAYRNRYDDLQRLDRILEAEGDSVNNY
RAGKQADTLMLFYLLSADELYELFDRLGYNFAPEQIPATIDYYQKRTSHG
STLSAVVHSWVLARGDRREAMHYFRRVLASDVVDIQRGTTAEGIHLAAMA
GSIDLLQRCFTGLELRRDRIVVGPMWPEPLGRLAFTFRYRGHRLRLTVLG
RSSTLSAEPSEASPILVECRGQAQTLVAGGTVEFTR
145225563YP_001136241.1 ribokinase-like domain-containing protein [Mycobacterium gilvum PYRMSGTAAIVTLTMNTALDVTADADNVVPTEKIRCRAERYDAGGGGVNVARF
AHALGAPVSAVFTAGGSTGARVIDLVHATGVCEIPVLIEGGTRESFTVND
RASGRQYRFVLPGPVLSLGEQARCLEALRRAAGTAGIVVASGSLPPGVPP
DFYQRVADICSDVGAMLVLDTSGGGLRHVTSGVHLLKPSIRELRECLDRP
LHTEPEQIAAARELIDRGAAKVVVVSLGADGALLVTPDDSERLSAVPMTS
VSCVGAGDALVAGVAVGLARRWPLGRAVRFGIAAASAKLQTPGTAAFHRD
DVERYFVTQAAHSEA
145225561YP_001136239.1 UspA domain-containing protein [Mycobacterium gilvum PYR-GCK]MTDEAAPYGIVVGADGSPSSLSAVRWAATEAGLRHLRLTVAHVHEGSGAD
EADSVLDEATAEARNAAGVDGPDVEGRRLTGQPAAELVELSGDAQLVVVG
SRGRTGRSPGSVGLGLLHHARCPVVVVHDDLAPRNRPGRRPVLVGIDGSK
TSLHAAAIAFEEASRRSVDLLALHVCKDADTGGPHDHRMTILEEEAADFL
RETLADLQQRFPEVVVRPLIRFANPTRQLLVQAERSQLVVVGSHGRGAIA
GRLLGSVSAAVAEGCRIPVIVARRT
145225559YP_001136237.1 acetyl-CoA synthetase [Mycobacterium gilvum PYR-GCK]MTVIHKSPEDWRVTPNLVDYENTCTTFRWDAAPDVCAGMGDGLCNIAYAA
VDRHAGGSAGGRTALRFVSESALTGETSVRDLEYSELASLSSRFTAVLRA
LGVGKGDRVFTLLGRCPELYVTILGALRNGSVVSPLFSAFGPEPVATRLR
LGDAHVLVTTRAMYRKKVADSRSALTSLKHVLLIDEDIDDDIGEEEGATA
TGFWRWMEATPDGAPIEPTTADDPALLLLRDQVDLDSMDWLNFLVGIHKR
LHVDIPEADYRKLRTLADVVGYVGSREAPS
145225557YP_001136235.1 hypothetical protein Mflv_4981 [Mycobacterium gilvum PYR-GCK]MPIARPTVGLAVEALRDEVVLFGLRARRPLSDPASFERIHDEVVAALDFY
GGRGCLADPARFFTTPDALADVEVTPVRRRNHTYARLRWESGYHPLAGEP
GGDRWMTYTANRRGYALMLRHPEPRPWLMCIHGTEMGRAALDLALFRAWY
LHEELGLNVMLPVLPMHGPRGRGLPKGAVFPGEDVLDDIHATAHAVWDIR
ALLGWIRAENPGADIGVYGLSLGGFIAGLLAGLDDGLTCAVLGVPVADLI
DLLSRHSGLGRDDPRRRTILLAAPLGRMISPLSLPPPVPMSGRFIYAGLA
DQVVHPREQVVRLWEHWGRPNIEWYHGGHTGFFQSRPVQHFVTDALVRSG
LVTGIGRPQSPDAATG
145225555YP_001136233.1 hypothetical protein Mflv_4979 [Mycobacterium gilvum PYR-GCK]MDGYWLDLALVAVLVLVNGLLSGSEAAFISLGEGQLREMERRGTRRDRIV
VDLAREPNRFLATIQLGITLAGFLASATAAVSLAEPVESRLQFLGGAAAA
VSIAAVTIVVTASTLVFGELAPKRLGMQYARRWAGLVAPLLRFLAIVTKP
VIWGLGQSTDIAVRVVGGDPDVGKKEPTFGELRELIAGHSGLNPEQRTII
SGALEIHERALREIVVPRPRVFRLRADLPVPQALHALAASGHTRAPVVPA
GELDDAIGVVHLRDLLGSAGTVADVARPALLLPDSLRVTAALSRLMDEHE
QFALVIGERGGVSGIVALEDLLEEVVGEIYDEQDKDIRAARLLPDGSRIL
PGSFPVHDLGDVGVDGSRLPRGNHTTVAGLILDSLGRMPEGPGDRIEIGG
YRWEVTAVDAHAITEVRVVPSPH
145225553YP_001136231.1 hypothetical protein Mflv_4977 [Mycobacterium gilvum PYR-GCK]MERMTAFDAGFLDAEDADRHVSLAVGAVSVVDGPMPDFDEIVAAIGEKIV
TIPRLRQVVRRQPLDLSAPEWVEDPTLDLAHHIRRAALPHPGDDDALFRF
TAEAMEPRLDRERPLWQAWIIEGLADDRWAILMKVHHCIADGIAAMHMLA
GLSDDGEGETYAGAIRAAHEAGASRPALPSPTLNPVRWARAGWNATTAVA
ATAAMTVEGAIGILSGLVRNAESSLNGPVTTMRRYSAVQVPLATVASVCQ
AFDVTLNDVALAAITDSFRSALKRRGEEPRRDSLRTLVPVSVRSDDARDR
LDNRVSVMLPHLPVDEPDPVEQLRTVHRRLNRAKSSGQRQAGTAAVAAVK
LIPFALATRAIRAVTSLPQHGVVTLATNVPGPQHRLQVMGREVVRMFPVP
PMALRLRTAVAILSYGDDLVFGITTDFDAFPDVDELAAGIGAAVDTLAAA
ARPL
145225551YP_001136229.1 sulfate transporter [Mycobacterium gilvum PYR-GCK]MTSNFGELRSYRRSALRDDTQAGLSVAAYLVPQALAYATLAGLSPAAGLW
AALPPLLVYAILGSSRQLSVGPESTTALMTAAVLAPVVGGDDPVRYAASA
AVLAILVGLVCLGAGMLRLGYLANMLSKPVLVGYMLGVALAMVAGQLGRI
AGVEVTGDTVPAQLAAFAAAVDGVHWPTAGLALGVLVLVLTMERVAPTLP
APLIGVVVATVVTWAGELTRFGVAVVGDVPVGLPAPALPWLTVDQIQALI
VPAIGISVVAFSDNILTARAFASRAGQNIDPNTELRALGVSNLAVGFLRG
FPVSSSASRTALAAAAGARTQMYSLVVLAVVAVVVVFGGGLVSHVPAAAL
GGLIVYAALKLVDVRSFRALARFRRSEVVLAALTAIAVTVFGLLYGVVIA
VALSVLDLLRRLSHAHDSVQGLVPGLAGMHDVDDYPDARIVPGLVVYRYD
APLCFANAEDFRRRALEAIDQMDQPTRWFVLNAEANVEVDMTAIEALDQV
RQDCLRRGIVFAMARVKQDLREALAAGGVLDEIGQDRLYMTLPTAVAAYQ
AWVASGNKG
145225549YP_001136227.1 30S ribosomal protein S13 [Mycobacterium gilvum PYR-GCK]MARLMGVDLPRDKRMEIALTYIYGVGRTRSQEILEATGISRDQRTKDLTD
DQVSQLRDYIEGNLKVEGDLRREVQADIRRKIEIGCYQGLRHRRGLPVRG
QRTKTNARTRKGPKRTIAGKKKAR
145225547YP_001136225.1 30S ribosomal protein S4 [Mycobacterium gilvum PYR-GCK]MARYTGPVTRKSRRLGVDLVGGDQSFEKRPYPPGQHGRARIKESEYRTQL
QEKQKARFTYGVMEKQFRRYYEEANRLPGKTGDNLLRILESRLDNVVYRA
GLARTRRMARQLVSHGHFTVNGVKVDVPSYRVSQYDIIDVKDKSINTLPF
EVARQTAGERPIPGWLQVVGERQRILVHQLPERAQIDVPLTEQLIVELYS
K
145225545YP_001136223.1 50S ribosomal protein L17 [Mycobacterium gilvum PYR-GCK]MPKPTKGPRLGGSSSHQKALLANLATALFEHGRIKTTEPKARALRPYAEK
LITHAKKGTLHNRREVMKKIRDKDIVHVLFAEIGPFYSDRNGGYTRIIKV
ENRKGDNAPMAVIELVREKTVTSEANRARRADAAQKVAAAAAPQAAVEPE
VTEGPSADEAEAVAETPIADEAQVEVEGTESVSEAEADEAKADSEDEAK
145225543YP_001136221.1 cutinase [Mycobacterium gilvum PYR-GCK]MIRQLRNLRVPYLVVALLFGAASLILPPAASAQACPQAELIFARGRIESP
GAGVIGNALASALRNKTGRDIDLYAVKYPADTEVDIGANDMSQRIQYMAR
NCPDTRLVLGGYSLGAAVTDIVIAVPIAAFGFKNPLPDGVDRHIAAVALF
GNGSQWVGPIANFTNPALRDRIVELCHGDDPICNPTAPENWQDNWPAHLA
SAYVGAGMVNQAADFIVGRL
145225541YP_001136219.1 cutinase [Mycobacterium gilvum PYR-GCK]MKIDLEVVTRGVRALVAAAVAAGVLVVAPAVAAPRSLPAAGAQGCTDIQV
VFARGTDEPPGLGRVGSAFVESLRGRVGGRSVGSYAVAYPATFDFLAAAG
GANDASNHIQWMMANCPSTRLVLGGYSQGAAVIDVIAAVPFPAVGFDRPL
PPNAPDFIAAIALFGNPTTKVGLPITASPVWGTRSIDLCNGADPVCSAGD
DIAAHSNYGPAGFTDQAAAFVAGLV
145225539YP_001136217.1 hypothetical protein Mflv_4963 [Mycobacterium gilvum PYR-GCK]MLFTYDTELTLRAASVLINTDRVDGEQLADLAALDEYLDHFGWTGRRDHD
AAELKSVHQLRDRLGRIWAAADDEERAVGHVNALLSDTRASPWLTRHPEM
PEWHLHLASIHDPLWQRMGAEMAMALADLIRAGELRRLKLCAAPDCEASL
IDLSRNRSGKFCDTGNCGNRQHVAAYRERRSNK
145225537YP_001136215.1 peptidase S8/S53 subtilisin kexin sedolisin [Mycobacterium gilvum PMTRTWRVAAVTAIALMHTTPTAAAIGPPPVDTLRLPTADPPAPAQPTVQF
TDCVAAPPAAGSAPGQLAGMDLPTVWALTRGAGQTVAVIDTGTARHRRLP
HLVPGGDYVSHRDGTDDCDGHGTLVAGIIGASPDAADPGGFTGIAPDVSL
LSIRQSSNKFRAVDDPGGSGVGDVETLAAAVRTAADLGATVINISTVACL
PVAAGLDDRTLGAALSYAVEAKNVVVVTAAGNVGGPGQCQDPNPRDVGAA
DQVRTVASPAWYDDYVLTVGSVGTDGSPSEFSLAGPWVDVAATGEGVVSL
AATGDGLADRSPSDAALTGTSYAVPVVSAVAALVRARFPEMTARQVMQRI
EDTARPSSAEWDPVVGHGVVDALAAVSGPGSHPAALPAAPPVDAPTPAPA
RVQRQGATAVRGALICVALTVCVALVSAVIARSRRHG
145225535YP_001136213.1 cell division protein FtsK [Mycobacterium gilvum PYR-GCK]MVTVPCGTFSACGWNGAGVPCVYSYVDAGRIVLDAPPTPPAPTHTNVLAR
LMPVAMVAAMGGMTALYLTSTDATSRNPMFLFFPAMMAVSLIGTLAYGSR
GAGRSGELAAQRAEYLRYLDTVDGALARAGEDLHRYLHAAHPAPAVLWTL
AGTPRMWERAEDDPEFGMIRIGIGERAGATAVAAPGWVPGDDADPVTTEA
VQRLLAHRETVGDVPVTLSLRSVRTLAICGEPAAARSVARALLCQIATLH
HPDTMSISAAPVTDWDWLKWLPHQRSSQEGRHHVVVADEGVSARDGTTLI
ILTAGSGAPTVTADGVPVAAVCDQMSEAEAAACARRIARHRPRRPSRSLR
RDWPALMGIDDPDALDVDVRWSRDLGSDLLRVPIGVADDGSVVELDIKEA
AAHGMGPHGLCVGATGSGKSEFLRTLVLGMVCAHPPGLLNLVLVDFKGGA
TFLGLEAVHHVSAVITNLADEAPLVSRMRDALSGEITRRQEMLRAAGNLT
NITQYAQARARDDTLAPLPALLVIVDEFSELLTQHPDFSEVFVAIGRLGR
SLGIHLLLATQRLDEGRLRGLETHLSYRVCLKTFSAGESRAVLGVPDAYS
LSSQPGAAYLKTASGVLTRFQTAYVSGGYTPASRPRSQPLTVRPFTSSDH
DVASESTVSQRPLLGAVLTRLAGRGAPAHRVWLPPLTSAPRLADLLHGTP
GRRLQVPIGVVDCPFEQQQMRHVVDLSGPAGNLAVAGAPRSGKSTVLSTV
MTALAATHDAAAVQFYCLDFGGGELTGLQHLPHVGSVASRHEGELCRRIV
AHVESVVRHRESATDETWNGHVFLVVDGWATLRQDFDGLEPAITALAGRG
LAYGVHVMIAASRWADLRPALKDQIGSRIELRLGDPAESEMDRRRARDLA
DRPPGRALTREGREMAIALADQRLPVRRDGPGAAPVELLPAHVDRSAIAA
PVPRRGEVLLGLGERELSAVSLDLTEHSHLMVLGENQCGKTASLRLLCAE
LVAAPQEARLEIVDFRRTLLGAVDSDRLTGYAVTPAAVTSRVAAITGVLA
DRMPGEDVTQRQLRDRSWWHGPEIYVVIDDYDLVAGATGNPLTPLADFLP
HARDLGLHVVVARRSGGAARAMFDPLLARMRDMGCAGLMMSANAEDGVLL
GAVRPGRLPPGRGTLIARGRPDELLQVAWTDPP
145225533YP_001136211.1 hypothetical protein Mflv_4957 [Mycobacterium gilvum PYR-GCK]MSTPSGAHGSALATDFDLMVSVAGRTEARNDEIRSMLSSFIGAMSSVPPS
VWGGVAAVRFREVVERWNAESVKLHSALQRIAETIRDNERLLRDVAEGHS
QRIASAGTGL
145225531YP_001136209.1 putative GAF sensor protein [Mycobacterium gilvum PYR-GCK]MAASKPSARRASPPPPTPPSASRLQAVHELFVAGEVDTGYLNSHAVRPVV
AQSWERSRAGGVDPDIGAARSAAAAAAVDRLRETHPLAPALPVIRRLLVE
DAIGSGVVVAVSAADGTLLWVEGDPGACRRAEAMNFVPGADWSERSAGTN
APGTALTLGREMQIHGSEHFSRVVQPWSCTAAPVHDPTTGALLGAIDLTG
GGQVATSQTLALVRATAVAVENHLALLRLAGAGAEPAARKPHLVVLGGDR
PRWVTTDSVGHLQITHLTGRHADILVLLSRHPEGLSADHLAVLLDDKDLD
VVTVRAEMSRLRKVIGAENLGSRPYRLLTSITSDLGEVYEALDAADVETA
LDRYPGPLLTQSVSPAIARLRTQLSATLRAAVLAESAQGRTDLLRRWLEQ
PEGRDDRDGWQALRDSAGLTPVARARARGHLAGLDFELG
145225529YP_001136207.1 TetR family transcriptional regulator [Mycobacterium gilvum PYR-GCKMSTLVDAAAQVFSREGLTATTNRIADRAGLSIGTLYQYFPDKLALLRAVA
ERHVRDADRELTAVFAALRTEAPPFDATMRAVLGAVVAVHAGGGRLHALL
HRMVPADARDLETVQALEDRICDEVAFHLKRCDRGGDDVEMTARTLVHAV
DAQLHRVLSRDGFDVGDATDTLMVTVDRLAPPHG
145225527YP_001136205.1 alcohol dehydrogenase [Mycobacterium gilvum PYR-GCK]MQAAVVTAFGEPLVVEERDLPAPGPGEALVKLVTSGVCHTDLHAAHGDWP
VKPSPPFIPGHEGYGTVVAVGDGVDDLSVGDMVGNAWLWSSCGRCEYCRT
GWETLCEQQRNGGYSVDGSFGTYMLVDAAYAARIPDGVDPVEVAPILCAG
VTVYKGLKVTDTRPGQWVAISGIGGLGHVAVQYARAMGLRVVAIDVDDSK
LDLATGLGAEVVVNARTADVVAEVHRATGGVHGVLVTAVHRDAFGQAIGL
ARRGGTIVFVGLPPGDFPAPIFDIVLKGLTIRGSIVGTRQDMVEAIDFFA
RGLVHPTVHTTRLDDINDVFDRMERGQIDGRVVIDYR
145225525YP_001136203.1 30S ribosomal protein S9 [Mycobacterium gilvum PYR-GCK]MTETEFTDTEGTEVAEAVETQVAETETETAADEYAAPREPVIIDRPIQTV
GRRKEAVVRVRLVPGTGQFHLDGRSLESYFPNKVHQQLIKAPLVLVDRLE
QFDIYAHLDGGGPSGQAGALRLAIARALILVQPEDRPALKRAGFLTRDPR
AIERKKYGLKKARKAPQYSKR
145225523YP_001136201.1 phosphoglucosamine mutase [Mycobacterium gilvum PYR-GCK]MARLFGTDGVRGVANRELTPELAMALGSAAARRLGRAGATRRRVAVVGRD
PRASGEMLEAAVIAGIAGEGVDTLRVGILPTPAVAYLTSAYDADFGVMIS
ASHNPMPDNGIKIFGPGGHKLDDATEDRIEELVHQGPGERPTGAGIGRVV
DAEDALERYLRHVGKAATTRLDPLTVVVDCAHGAASVAAPRAYRAAGANV
IPIHADPDGLNINDGCGSTHMESLRSAVVSYGADLGLAHDGDADRCLAVD
AHGRVIDGDAIMVVLALAMQQSGELVSDTLVATVMSNMGLHLAMRSADIE
VRTTGVGDRYVLEELRAGQFSLGGEQSGHIVLPSFGTTGDGIVTGLRLMA
RMAQTGRSLADLAQPMQTLPQVLINVEVADKTTVADAPSVRDAVAQVEAE
LGDTGRILLRPSGTEQVVRVMVEAADEDTARQMAVRVADSVSAES
145225521YP_001136199.1 hypothetical protein Mflv_4945 [Mycobacterium gilvum PYR-GCK]MPDDFDVGARLAQGRPAADTLQRYVAACRQLGYEHRDLTLHPAQVTDWYG
TEDGMDLAALHRCCVALDGVGRAAQEALAVQERQLGELSAAWEGAGGDAA
RMFLARHGDSSAVATAAVRTAAEALVSLREELWRVVGGKVDSTVSAEGRA
AGAQAQWSAAATSVTTGTGDTATAGEIVEHAVKPFVDTVIRDEWLPAMQD
AVAAVTAAYDGATAEIAAERTPTFDVPGDLGPDCPEPRPSCDDEGQSGRA
DVAASPPAAAMSAAWSPPAGMPAGTPAATAPSAWSPPVPPAPVPSAPVAP
APLAAPAPEAPLPSPGSLGSGMPGLGGGPSGFGQHFADALSGLLGGGLGG
DALESPDLDLEEPALDEPGVEEPELEEENEEDAELEEDDEAEEKPESVVA
ADPVLPEEPCDPPPEPAATVAAPEPPAPPPPAEPVPAAEPASDEQTPCEI
AAGEVPQVGESAG
145225519YP_001136197.1 acyl-CoA dehydrogenase domain-containing protein [Mycobacterium gilMPVDRLLPTDDARDLVELARQIADKVLDPIVDRHEKDETYPEGVFATLGE
AGLLSLPYPEEWGGGGQPYEVYLQVLEELAARWAAVAVAVSVHSLSCHPL
MSFGSDEQRQRWLPDMLGGSTIGAYSLSEPQAGSDAAALTCRATAVDGGY
RITGSKAWITHGGIADFYNLFARTGEGSQGISCFLVPRDTEGLTFGKPEE
KMGLHAVPTTAAHYDDANLDSDRRIGTEGQGLQIAFSALDSGRLGIAAVA
VGLAQAALDEAVAYSQERTTFGRKIIDHQGLAFLLADMAAAVDSARATYL
DAARRRDAGLPYSRHASVAKLVATDAAMKVTTDAVQVLGGAGYTRDYRVE
RYMREAKITQIFEGTNQIQRLVISRHLTRG
145225517YP_001136195.1 luciferase family protein [Mycobacterium gilvum PYR-GCK]MRTGIFLSYAGGFLEAVDEVVECEKLGVDIALVAEAYSYDAISQLGFLAA
RTSRIELGTGVVPIYTRTPALMAMTAAGVDYVSDGRFRLGLGTSGPQVIE
GFHGLPFDAPLGRTREVVEICRKVWRRERVSYDGKYYQLPLPAERGTGLG
KPLKLINHPVRENIPITIAALGPKNVELTAEIAEGWQPVFFYPEKADEVW
GDALRAGASRRDPALGPLDVMVSATLAIGDDVDDRLSWGKPQLALYIGGM
GARGKNFYHNLATRYGFGEVADHIQDLYLAGKKAEAIDAVPDELVRQVSL
VGPAGFVKERLAAFAEAGVTTLLVHPMGVDAAERVRFVEQLQGLL
145225515YP_001136193.1 glucosamine--fructose-6-phosphate aminotransferase [Mycobacterium gMAMCGIVGYVGQRPACDIVVDALRRMEYRGYDSSGVALVDGHGGLTVRRK
AGRLANLEAALAEAGAESPAGATGLGHTRWATHGRPTDRNAHPHRDSSGK
LAVVHNGIIENFAALRAELEAVGVEFASDTDTEVAVHLVAREYTHGDTAG
DFPASVFAVLPRLEGHFTLVFAHADDPGTIVAARRSTPLVLGVGDGEMFV
GSDVAAFIEHTREAVELGQDQAVVVTADGYRVTDFHGNDDAASARPFHID
WDLSAAEKGGYEYFMLKEIAEQPAAVSDTLLGHFVDNRIVLDEQRLSDQE
LRDIDKVFVVACGTAYHSGLLAKYAIEHWTRLPVEVELASEFRYRDPVLD
SHTLVVAISQSGETADTLEAVRHAKEQKAKVLAICNTNGSQIPRECDAVL
YTRAGPEIGVASTKTFLAQVAANYLVGLALAQARGTKYPDEVAREYHDLE
AMPDLISRVLASSEPVVALAKQFATSQTVLFLGRHVGYPVALEGALKLKE
LAYMHAEGFAAGELKHGPIALIEDDLPVIVVMPSPKNSATLHSKLLSNIR
EIQARGAVTIVIAEEGDETVRPYADHLIEIPAVSTLFQPLLSTIPMQLFS
AGVAQARGYDVDKPRNLAKSVTVE
145225513YP_001136191.1 hypothetical protein Mflv_4937 [Mycobacterium gilvum PYR-GCK]MALRDELLELEHAGWKSLCDGTGDTFYGDLMTDDAVMVLANGMVMDRQTV
VSALGQSPPWARYDIDDVRVIEIDDATAALVYTGTGWRDGLDEPFVGAMS
SVYHRTADGWALALYQQSQKS
145225511YP_001136189.1 glutamate decarboxylase [Mycobacterium gilvum PYR-GCK]MPNVSRHSSLAPAYTGRMSMSPVPALRLPDESMEPEQAYRFIHDELMLDG
SSRLNLATFVTTWMDPEAGQLMSETFDKNMIDKDEYPVTAAIEQRCVCMV
ADLFHAENLRDDDPSTAIGVSTVGSSEAVMLAGLAMKWRWRDKFAGKDGD
GWKGRTPNLVMGSNVQVVWEKFCRYFDVEARYLPMEKGRYVITPEQVLDA
VDEDTIGVVAILGTTFTGELEPVAEICAALDALAAGGGCDVPVHVDAASG
GFVVPFLNPLLVWDFRLPRVVSINVSGHKYGLTYPGIGFVVWRNAEHLPE
DLVFRVNYLGGDMPTFTLNFSRPGNQVVGQYYNFLRLGRDGYTQVMHALA
DTAQWLARELEGMTGSDHKPVFEVITDGSAIPVVAFRLTEGAKFTVFDIS
ALLRSYGWQVPAYTMPEDATDIAVLRIVVREGFSANLARALRDDLREVLG
KLDKVGIGGFSDEEHFAH
145225509YP_001136187.1 alpha/beta hydrolase fold protein [Mycobacterium gilvum PYR-GCK]MSRGAGWLAGAAGVAAVGSAAGVSMARSLRRRVTDEDPHRDEDFELLDAD
RSCVVTTSDGVPLAVREVGPEDAPLTVVFAHGFCLRMGSFHFQRVRLTEH
WGAQVRMVFFDQRGHGQSGDAPPETYTVEQLGRDLEAVLAVMAPKGPVVL
VGHSMGGMAVLSHARQYPQRYPTRVVGAALISSAAEGVARSPVGEILKNP
ALEAVRFTARYAPKLVHRGRGAARSVIGPILRAASYGDEKISPSVVAFSE
RMMHDTPIATLVEFLHALEVHDETAGLETLRRVPTLVACGDRDLLTPKEY
SQEMADVLAKSELVIVPGAGHLVQLECPEVINDALVRLVERATPSKLTAL
TRRVTQRVRSDD
145225507YP_001136185.1 peptidase M22- glycoprotease [Mycobacterium gilvum PYR-GCK]MSRLVLAVDTATPAVTAGIVRVDGDAIEVLAEQVTVDARAHAEQLTPNIV
AALGDAGIDASRLDAVVVGCGPGPFTGLRVGMATAAAFGHALGVPVHGVC
SLDAIAAGTTGDVLVVTDARRREVYWARYRDGRRVDGPAVNSAVDVPAGA
AAVAGSPEHTALFELPRLAPVYPSAAGLVAAVRDWDTDPAPLVPLYLRRP
DAKPSQAVKR
145225505YP_001136183.1 putative DNA-binding/iron metalloprotein/AP endonuclease [MycobacteMIILAIESSCDETGVGIAELGDDGSVTLLADEVASSVDEHARFGGVVPEI
ASRAHLEALGPTMRRALATAGVDKPDVVAATIGPGLAGALLVGVAAAKAY
AAAWQVPFYAVNHLGGHLAADVFDHGPLPESIGLLVSGGHTHLLHVRSLG
EPIIELGSTVDDAAGEAYDKIARLLGLGYPGGRVLDELAREGDPKAITFP
RGMTGPRDEPYAFSFSGLKTAVARYVESHPEASQADVAAGFQEAVADVLT
AKAVRAAGDLGVSTLLIAGGVAANSRLRELAAQRCEAAGMTLRIPRPRLC
TDNGAMIASFAAHLIAAGAAPSPLDAASDPGLPVVQGQVA
145225503YP_001136181.1 hypothetical protein Mflv_4927 [Mycobacterium gilvum PYR-GCK]MFDGSLPDPGRLARLSDGELIDAVTGWARASAAAEARKVAAIAELHQRLC
TDAAATHAFWVCDDCDALAAQLSCALTINHGRALSQIELATAMRHRFPKV
GAKFLAGDIPISTVTSILARTELVTDERALAQLDSKLSERAVAWGSLTKY
SLEKALDVWVDRFDPDAVKRTRSSSRGCYFTVGSGSDNADGTTTVHGRVS
NADAAIMEQRIASMARNVCEDDPRTLDQRRSAAIGAIHAGSMFLACACDN
PDCTAKVDDGRGSTFVINVIADRESLDAPQDPLLHGDDVKDGETAEDRGP
AKHTKTTEHTETTTEPRRKAALIPAARNAILPPAMLAELIAQGATIRFVG
DPTGAEDHYRPSTALQRFIRSRDITCRFPGCDRPAAHADIDHTTAWPCGV
THSANCKCYCRLHHLIKTFWPGFSDAQHPDGTVVVTTPTGHAYSTKPLSG
LIFPGWDTAAESPPPPAQATQRSVGRHLKMPTRRRSRAQNRAARIKAERM
RNAALRASQVRPVASRQTYRAENSHDEHTFRPAGHEPDYGNDPPPF
145225501YP_001136179.1 co-chaperonin GroES [Mycobacterium gilvum PYR-GCK]MASVNIKPLEDKILVQANEAETTTASGLVIPDTAKEKPQEGTVVAVGPGR
WDEDGEKRIPLDVSEGDVVIYSKYGGTEIKYNGEEYLILSARDVLAVVSK
145225499YP_001136177.1 hypothetical protein Mflv_4923 [Mycobacterium gilvum PYR-GCK]MAKTAEKNTITEVPSDLAERAADLSDDVLTSLESGQRNAIDAVRKFVGTV
EESLPGHDGDGPSRRETIVDAALDMADQLVKTQYEFIRSIVSSAGDALKK
QGDEKSPPQ
145225497YP_001136175.1 hypothetical protein Mflv_4921 [Mycobacterium gilvum PYR-GCK]MAQPRLPHAAAGLVAVTAAVSFGPPAGAEPVNPIPGNGIFLVGQDIAPGL
YRTDGTASVFGVWINDVPTQDSMCLWFTYSTPDTNKDNVVATNMSIGPMY
ANINATVKAFESRNCAPWARVT
145225495YP_001136173.1 phospho-2-dehydro-3-deoxyheptonate aldolase [Mycobacterium gilvum PMTLAQTATSQETSDRRIRRFSEIPSPHDVLTEFPLGARRAERVARDREEI
ADILAGRDDRLLVVVGPCSVHDPAAALDYASRLVKVADDLGDRLKVVMRV
YFEKPRTTTGWKGLINDPGMDGSFDVARGLRTARQLLLDIIDIGLPVGCE
FLEPTSPQYIADAVAWGAIGARTTESQVHRQLASGLSMPVGFKNGTDGNI
QVAVDGVKAAAAPHVFFGMTDMGRGALVSTTGNQDCHVILRGGTDGPNCD
AASVTVTAEKLVTAGLPGRVVIDCSHANSGKDHIRQVQVAKDVAQLVRDG
LPISGVMLESFLVAGAQAPEAQPLTYGQSVTDKCMDWGATDLVLRELANH
G
145225493YP_001136171.1 hypothetical protein Mflv_4917 [Mycobacterium gilvum PYR-GCK]MTSSPDRVAALDHIVERNQVWPRMAAKYGVENPVPPWKTSLDGFCDALDH
ASCTAAVPTFKERRDEEDALAATLYADLPYPENQLVALAHSLLARGVIDE
ETLARRMAAVRARLGA
145225491YP_001136169.1 hypothetical protein Mflv_4915 [Mycobacterium gilvum PYR-GCK]MSTAAERAAQLDLVARLKSAFPELPDAPTPDLLDHARITAYLKPVHDVGG
EPDAPMKYENKQYEQWEEMTYVICEVLAWRGIWLSEERRRIGNVDVGRAE
YLGLPYYGRWLLSVARVLVEKHHIGLTELSERMAEVAARYPDGLAGRKLE
AQPKSVGDGADVRRNAHHLHAVGKGDPQVYAGRAGEPRFAVGDAVVVREL
PVLFYTRTPEYVRGAVGEIDTVAYESPAAEDETWDRPDATPEWFYIVKFM
MADLWHGYTGPSTDILRTEIPQRWLEAAH
145225489YP_001136167.1 hypothetical protein Mflv_4913 [Mycobacterium gilvum PYR-GCK]MDTTPAVSANDLSTAAFGGDPGLWPLPPASGAHDLWVRAVVAGGQGRYAS
GFADLDRLERLPRSATTSSLALSTRASFLRQLGWHTVARGWDGRAAAVAA
GSAEPGAADAGADALIGLAADALGVGRFAASARALEGAAELIGAAATSRP
AVRMGWVSSELAMFRGDGPTAVAHARRAVDLAAGFGSVRHRVKSHVVLAA
ALCSSGDLDAARQEGDLALADATRSGLVPLQWAVACLLADIGSQAYPAAR
IRAVRDASAEAVTRWGGVWRPR
145225487YP_001136165.1 hypothetical protein Mflv_4911 [Mycobacterium gilvum PYR-GCK]MPDFGRRDPGGGDPSLTDINRTDQFLDALAAQQQPFVTDRDDVELAQLLA
GWRDDIRETPMGHVVTPLQAEAALDRVTRPAAPRRRFSLAVVGSAAAAVL
AIGGFGAVVAGSGPGDALYGLRTMLFGEQVQMRDDAVILAAQTEMQQVQQ
LIEQGDWQQAQAKLEAVTTTVATVDDVAQKEELIAQWQELTVKVEAQDPV
ATVPPGAPLPTFPELPAAVLDQATTSSETTAGTTSDTTAPSSETTAPSSE
TTGPSSETTTAPSETTGPAPTTTAPTSAPTTTAPAPSTTPTTSVGQTRSS
AAPSTPPSSAPTSTTVVLQSTTTSAAAPTTSAAPTTAAPTTAAPTTAVPT
TPSAVETTPAVEEETPPSPVAPVTTTTPVLPLPGE
145225485YP_001136163.1 inosine 5'-monophosphate dehydrogenase [Mycobacterium gilvum PYR-GCMSIAESSIPIAVPVPTGGDDPTKIAMLGLTFDDVLLLPAASDVIPATADT
SSQLTRRIRLKVPLVSSAMDTVTESRMAIAMARAGGMGVLHRNLPVAEQA
GQVETVKRSEAGMVTDPVTCSPENTLAEVDAMCARFRISGLPVVDDKGSL
VGIITNRDMRFEVDQSKPVAEVMTKAPLITAQEGVSAEAALGLLRRNKIE
KLPIVDGHGKLTGLITVKDFVKTEQFPLSTKDSDGRLLVGAAVGVGEDAW
TRAMTLADAGADVLIVDTAHAHNRGVLDMVHRLKRAVGERVDVVGGNVAT
RAAAAALVDAGADAVKVGVGPGSICTTRVVAGVGAPQITAILEAVAACAP
HGVPVIADGGLQYSGDIAKALAAGASTAMLGSLLAGTAESPGDLIFVNGK
QFKSYRGMGSLGAMQGRGATGNLRGSYSKDRYFQDDVLSEDKLVPEGIEG
RVPFRGPLSTVIHQLTGGLRAAMGYTGSASIEALQQAQFVQITAAGLKES
HPHDITMTVEAPNYTTR
145225483YP_001136161.1 TetR family transcriptional regulator [Mycobacterium gilvum PYR-GCKMADGITAREAKRLQTRERLLGAAIAEFKRAGMAEADVSTIVGAAGVAHGT
FFFHFPTKEHVLLELERREEDRIAKRFATFTKTHHDLSAVLREAADLVLG
LERRLGVVLFKDFLALHFSPTRPPAEHGGDHPVVVLVAAQIEHARQRGET
AADVTPMNSAIYFLLGLYALLVTTDESTGRSVLVTDYLTRTLRSLQ
145225481YP_001136159.1 Signal transduction histidine kinase-like protein [Mycobacterium giMATNGGGAEPTARHQLMTRAAGVGLLMRSTINLGVSLIALADPLSTALPA
GRWLLAVLAVWSLYRLATRSHATALLAVDYGLVLAVCLAVPLLVPVTDFH
TFNTAPQAIAGTAVISFSVAVRVAACVPMAVGIAAAYAAGAASVIGWENV
LSVMALYYFAVQCGTASIIRFMLLRVAGAIDQARRERAEAEVAERVTDAV
RDYEREQLALLHDTAASTLMMVGQGVSLPPERMAAQARRDLHLLRAGSWE
APPPRVELVAALRDCTARLSTPVEFDGRERLWVAGATANPVIAAAREAMN
NVDRHARAELLRITVTETCVRLADDGIGFDLGHPRTGHGVDDSIIGRMAR
AGGDAHITSSPGAGTVVEMSWAPSAPSAITPPAVDPDRLIDRTRTRYGLA
LTAYSLVNLAITVPTSDAVLGILATLTSLAAIPGIMWQRWLFAWPAMLAA
LIVAIGQPAMLPQDHLLGYPHWAQGAIGWCVLPLMLALPTRTGAALVMAY
WACNSLVLVIRDPSPLILVNIGYGTASILGIQLFALVFNGLMRDAATAVE
SENAARQRLLTRDRVSQALRAEYQRRYATIVAGVVPLLEALTRGEKIDTA
MQLRARAECRRLRALFDQASTFDHPLMQRIRPLIDAAEGRRVDVAIDVSG
TLPDLDDEQISALATPVTEVLNRASTSARIVVTGADGQVEISVVIDIADT
ADTPPADVDGAEVIVSGRELWCLIVSGVQKG
145225479YP_001136157.1 GMP synthase [Mycobacterium gilvum PYR-GCK]MESAHPRPVLIVDFGAQYAQLIARRVREARVFSEVIPHTASIEEIKARDP
RAVVLSGGPSSVYADGAPQLDPALFDLDIPVFGICYGFQAMAQALGGTVA
RTGTSEYGRTELKVAGGELHSDLPEVQPVWMSHGDAVTEAPSGFEVVATS
VGAPVAAFENRARRLAGVQYHPEVMHSPHGQQVLSRFLHEFAGIDAAWTP
ANIAEALVEQVRNQIGDGRAICGLSGGVDSAVAAALVQRAIGDRLTCVFV
DHGLLRAGERAQVQRDFVAATGANLVTVDVADRFLEALSGVTNPEGKRKI
IGREFIRAFEGAVRDTVERSDGSDVPVEFLVQGTLYPDVVESGGGSGTAN
IKSHHNVGGLPDDLKFALVEPLRLLFKDEVRAVGRELGLPEEIVARQPFP
GPGLGIRIIGEVTSDRLDTLRRADVIAREELTAAGLDHQIWQCPVVLLAD
VRSVGVQGDGRTYGHPIVLRPVSSEDAMTADWTRVPYEVLERISTRITNE
VPEVNRVVLDITSKPPGTIEWE
145225477YP_001136155.1 flavin-binding monooxygenase [Mycobacterium gilvum PYR-GCK]MPPRALRGVDTYRGRRIDAENWSDHHDFAGRRVAVIGIDSLTVRIIPELV
EHAGFVKVFQDVPRWVLPQLLAEVPAPQAIIARLAKAYLRTQVRDPWLRR
QLTPDAAPERTHTLVSGGYYAALQRDNCKLIDWPIATLSPVGVRTSDGVE
HHLDALVFGRTIGFGDDAACHDRQYVR
145225475YP_001136153.1 hypothetical protein Mflv_4899 [Mycobacterium gilvum PYR-GCK]MGRCSVTRAEQVEQLRKQMAAVSGKVGGSRRAVAPVPQPTPVSETPDSLL
PMPDSLAELLPDSLPRGTVAVVSGARSLQLSMVAAVTAQGGHVAIIGQPD
VGLLAAAEMGADLSRVAVIPEPGADPVEVAAVLMDGMDLVVLGLGGRTVP
ATRARSVVARARQRGCTLLVTDGDWQGASARLDAHVSGYEIAGGQGGVPT
PGCGRIGRVRLAMRARGRSVGPSARVVGG
145225473YP_001136151.1 inosine/uridine-preferring nucleoside hydrolase [Mycobacterium gilvMSGDSHPVFLDVDTGVDDAMALVYLLASPEADVVGIASTAGNVGVDDVCR
NNLALLELCGTTGIPVSRGSATPLVAPLRTAEDTHGPRGLGYARLPEPTT
TLTDHDAAQAWVRAARDHPGELIGIATGPLTNLALALRAESALPRLLKRL
VIMGGAFDYRGNTTPVAEWNVSVDPESAAETFSAWSRSGAGHLPIVLGLN
LTEHAEMTPELLRRLAEAAGSTSTQMSVSDVRGTASTASNPLIRVLEDAM
RFYFEFHHDQGEGYLAHVHDPLAAAVALDTTLVRYRSAPVDVELTGTLTR
GMTIADWSGHWGREPNALIGVEVDPAVFFDRFIARVGAFAAALDHS
145225471YP_001136149.1 dehydratase [Mycobacterium gilvum PYR-GCK]MPIDPGALGASTPPAIFRWTDRDTLLYALGVGAGTDDLAFTTENSHDVTQ
QVLPTYAVIACSPFAAITKIGSFDFSRLLHGSQRIRVFSPLPAAGALSVV
SEVADIQDKGEGKNAVVMLKGTGRDPDTGAVVAETLTTLVLRGEGGFGGQ
PGSRPTAPPVPDREPDARVSLPTREDQALIYRLSGDRNPLHSDPWFAQLA
GFRRPILHGLCTYGVAGRALVSELGGGDATRITAIAARFVAPVLPGDTLT
TSIWRVESGRGVFRTEAANADGSDSRSVLEDGEVEFVDNQR
145225469YP_001136147.1 error-prone DNA polymerase [Mycobacterium gilvum PYR-GCK]MRRVLEGKPRRAGWPIDAQVGDGGDSPAWSSKRGQYRAPESRGPATGRSM
PYAELHAHSAYSFLDGASTPEELVEEASRLGLRALALTDHDGLYGVVRFA
EAAKELDVDTVFGAELSLGGGTRTDVPDPPGPHLLVLARGPEGYRRLSRQ
LAAAHLAGGEKGVLRYDFDALTEAAGGHWQILTGCRKGHVRQALLRGGDS
AAEAALADLVDRFGRERVTVELTHHGHPLDDERNAALAALAPRFGLTVIA
TTAAHFAEPSRGRLAMAMGAIRARNSIDEAAGYLAPLGGSHLRSGEEMAR
VFAHCPEVVTAAADLGEQCAFGLALIAPQLPPFEVPAGHTENSWLRHLVM
QGARERYGPPERASRAYAQIEHELRVIEQLNFPGYFLVVHDITRFCRENA
ILSQGRGSAANSAVCYALKVTNVDPIANGLLFERFLSPARDGPPDIDIDI
ESDLREKAIQYVYERYGREYAAQVANVITYRGRSAVRDMARALGFSQGQQ
DAWSKQISQWGNLADATHVEDIPEPVIDLAMQISHLPRHMGIHSGGMVIC
DRPIADVCPVEWARMENRSVLQWDKDDCAAIGLVKFDLLGLGMLSALHYA
IDLVAEHKGLEVDLAKLDLSEPAVYEMLQRADSVGVFQVESRAQMATLPR
LKPRMFYDLVVEVALIRPGPIQGGSVHPYIKRRNGQEPVTYEHPSMERAL
RKTLGVPLFQEQLMQLAVDCAGFSAAEADQLRRAMGSKRSTEKMRRLRGR
FFEGMAELHGISGDVARRIYEKLEAFANFGFPESHSLSFASLVFYSSWFK
LHHPAAFCAALLRAQPMGFYSPQTLVADARRHGVDVHGPDVNASLAHATL
ENHGLDVRLGLGSIRHIGDELAQRLVEDRKLNGPFVSLTDLTRRVQLTVP
QTEALATAGALGCFGITRREGLWAAGAAATERPDRLPGVGSSSQVPSLPG
MTELELTAADVWATGVSPDRYPTEFLREDLDAMGVVPADRLLSVRDGTRV
LVAGAVTHRQRPATAQGVTFLNLEDETGMVNVLCSQGIWARHRKLAQTAS
ALVVRGIVQNATGAVTVVADRMGPINMKVASKSRDFR
145225467YP_001136145.1 tRNA/rRNA methyltransferase SpoU [Mycobacterium gilvum PYR-GCK]MFNVLFYSPRIAPNTGNAIRMVAGTGCALHLVEPLGFDLSEPKLRRAGLD
YHDLASVTVHADLGAAWSVLMPARVFAFTAHAATSFAGVGYEPGDVLMFG
PEPTGLDEATLADPHITGQVRIPMLSGRRSLNLSNAAAVAVYEAWRQHGF
AGAV
145225465YP_001136143.1 integral membrane sensor signal transduction histidine kinase [MycoMARSLRPDQRPSRWAPPNWPVRVKVLALVTVPLVLACVFGGLRISASTVE
ARELAHAADRAQMVPAVVDYMAALQNAMVTAGGGGNPAAALGEFDFRKAE
LSRVLEGADVDDSVRLATNTLLEYGQNLLDRIGAAEMNLRTQVMTFGPLL
ITAQTALTGSVGSDEDSVRTEADVLSRAVGARGQMAMQDMLVTRGGELPE
PLLRSAMVTLAGTEPATVTAMGTFLGGASDRADALRSQMVRRMSLLSDPA
VVLVGNPELLMSQKITADIAQSLINRIADEIPARVSRQADDARTAAIRDS
VLVGAAILVALILVLWVARSLVRPLRTLRDSALRVAHDDLGREVERVRDD
GKEFAVDPIPVHTTEEVGQVAHAVDELHQQALVLAGAQARLQLQVTDMFE
TLSRRNRSLVEQQLSLIDGLERDEEDPDRLQSLFQLDHLAARMRRNGANL
LVLAGARISHDRAEPVAVAAIVNAAASEVEEYPRIVTGDLPDSEVAASAA
GDLVHLLAELLDNGLRYSPPHTQVRVSAVPTDNNGLVIEVSDTGLGMTEA
DLRVANMRLESGGEVNPYTARHMGLFVVSRLAAQHGLVARLRSTVAGQPD
SGTTAGVYIPARLLVRRAAPPVQARDVRPAAPAPAPTPAPAPAPPPPPAP
VVPPADVLPQRRPEPPPPVEPPPPVETPPPVETPRPGHADIDHDDTIYQK
MLSEWLVDPHELSHSSDLNWKSVWDNGWSAAEAADAAPVRHRTPEGLPVR
RPGARLIPGHADTENGHPLPVRDPDAVRASLGGHFGGVHAGRRHAREAAG
DDR
145225463YP_001136141.1 hypothetical protein Mflv_4887 [Mycobacterium gilvum PYR-GCK]MGAHERKDPAPSLVRPYTLTSGRTESGVTLPLEAPVGLAKSAPPPGWPAG
DVRSRIVALCDARPSVAEIAAHLSVPLGVARVLVGDLVLQGYLQVHATLG
EAATPDERRALIGRTLRGLRAL
145225461YP_001136139.1 pentapeptide repeat-containing protein [Mycobacterium gilvum PYR-GCMDSTHPREADREFDGHDFCDADLSGLRTERVVYTECDFTGADLSDSDHTG
SAFRNCTFRRTSLWHSTFRHCSFLGSTFTECRLRPLTLVEVDFTLAVLAG
VDLRKTDLSDCRLRETSLVGTDLREAVLAHADLTGARVQDAKFDGADLRG
ARVDPTFWTTARLRAAKVDLPQALAFAAAHGLDIGG
145225459YP_001136137.1 TetR family transcriptional regulator [Mycobacterium gilvum PYR-GCKMSDNDESRRAAAIEAALDEVQQWGVDRFRLEGVAHRAKLSPDYVRQIWGS
ETELIAEALLSYSQAMMELPDTGSLHGDLTGLALALADYLNEPVGRRISR
MLVIDSKSQAVDRDTRARFWTVRRAIVEDIFRRAAERGELRDDVRHIVAL
QLLTSPLHTFALYSEDPIPPEYCRLIADLVTRAIRAD
145225457YP_001136135.1 TetR family transcriptional regulator [Mycobacterium gilvum PYR-GCKMPRPARYTVDVLLDAAAELLAAEGPAAVTMSAVARSTGAPSGSVYHRFPT
RAALCGELWVRTEERFQEELLEALSGDGDPQNRCVAGALRNMQWCRENPV
EAHVLLAGPDQLDMGEWPDTVAGRRKRLQRKLRKVLAEIAGDHGRIDGRV
DGRVAAAVMDVPAAIVRRHLRARQSIPAAADDIVADCARALICPN
145225455YP_001136133.1 bifunctional 5-10-methylene-tetrahydrofolate dehydrogenase/ 5-10-meMMRVGAITLDGKATRDEIFVDLRERVARLAAAGRTPGLATVLVGDDPGSH
AYVRGKHADCAKVGINSIRRDLPADISQAVLDETIDELNANPECTGYIVQ
LPLPKHLNENAALERIDPSKDADGLHPTNLGRLVLNEPAPLPCTPRGIVH
LLRRFEVEIAGAHVAVLGRGVTVGRPLGLLLTRRSENATVTLCHTATRHL
PEITREADIIVAAAGVPHMVTADMVRPGAAVVDVGVSRDDAGKLVGDVHP
GVWDVAGHVSPNPGGVGPLTRAFLLTNVVERAEANL
145225453YP_001136131.1 type 11 methyltransferase [Mycobacterium gilvum PYR-GCK]MTAESDRRSLSFGAEAAAYERGRPSYPPEAIDWLLADSGSRRLEVLDLGA
GTGKLTTRLVERGLDVVAVDPIPEMLDLLRTSLPDTPALLGTAEEIPLPD
DSVDAVLVAQAWHWFDETRAVKEIARVLRPGGSLGLVWNNRDERLGWVKD
LGDIIGHEGDPWSQSVELPAPFTGVERHHVEWTSYLTPQALIDLVASRSY
CITSPERVRARTLDRVRELLTTHPALANSSGLALPYVTVCVRATLA
145225451YP_001136129.1 O-acetylhomoserine aminocarboxypropyltransferase [Mycobacterium gilMTDPDLTAGWAFETKQVHAGQTPDSATNARALPIYQTTSYIFDSTDHAAA
LFGLAEPGNIYTRIMNPTQDVVEQRIAALEGGVAALFLSSGQAAETLAIL
NIAGAGDHIVSSPRLYGGTYNLFHYTLPKLGIEVSFVEDPDDLESWRAAS
RPNTKAFFAETISNPKIDVLDIPGVSGVAHDIGVPLIVDNTIATPYLIQP
LSHGADIVVHSATKYLGGHGTAIAGVIVDGGTFDWTASGRFPGFTEPDPS
YHGVVFAELGPPAYALKARVQLLRDLGSAAAPFNAFLIAQGLETLSLRIE
RHVQNAQRVAEFLEAHPDVVSVNYAGLPSSPWYGLGKKLAPKGTGAVLAF
ELSGGIDAGKAFVNALSLHSHVANIGDVRSLVIHPASTTHQQLSPEEQLA
SGVTPGLVRLAVGIEGIDDILADLELGFAAAKPSAAATDPNAVASF
145225449YP_001136127.1 exodeoxyribonuclease III Xth [Mycobacterium gilvum PYR-GCK]MTRPVTVSTINVNGIRAAIKQRSPENLGMLPWFKETAADVVCLQETRADD
AQLAEALAPVLADGWHLASAEPSMKGRNGVAVLSRDPIDEFRIGCGAEEF
ATHGRYLEADTAGVTVASVYFPTGEAETDRQREKERFMAAVAARMAALLQ
RSVVDGHESVLCGDWNIAHTENDIKNWKGNVKKAGFLPQERQWLTEVLGT
GWVDVVRQAHPDVAGPYAWWSWRGKAFDNDAGWRIDYHLATPGLAARATS
VLTERPAAYALRWSDHCPVTVHYA
145225447YP_001136125.1 tryptophanyl-tRNA synthetase [Mycobacterium gilvum PYR-GCK]MSNTTRPVVFSGAQPTSDSLHLGNALGAVSQWVSLQDGYDAYFCVVDLHA
ITVAQDPATLRRRTLVTAAQYLALGIDPSRATVFVQSHVPSHAELAWVLG
CFTGFGQASRMTQFKDKSQKQGAEATTVGLFTYPVLMAADVLLYDTELVP
VGEDQRQHLELARDVAQRINARFPDTFVVPEAMIPKATAKIFDLQDPTAK
MSKSAESDAGLISLLDDPAKTAKKIRSAVTDSEREIRFDREAKPGVSNLL
TIQSAVTGTDIDKLVEGYAGRGYGDLKKETAEAVVEFVTPIKSTVDDLLG
DPAELEAVLARGAERAREVSGQTLRRVYDRLGFLASR
145225445YP_001136123.1 Serine-type D-Ala-D-Ala carboxypeptidase [Mycobacterium gilvum PYR-MATLRTTLLRASALVTASMLALAPAAAAQPAPAADPCPYRVTTPPAVDAS
EVPKPGDPTPGPLPVPAKPMGGDALSGCGVITAPGTPPVPGDVSAEAWLV
ADLDSGDVIAARDPHGRHRPASIIKVLTAMQALRDLPLMKTVPGTPEDAA
QEGTKVGVGEGGVYTVNDLLHGLLMYSGNDAAHALAMQMGGMDTALNKIN
VLAQKLGARDTRVATPSGLDGPGMSTSVYDMGLFYRYAWHNPVFADIVAT
RATQFPGREGAGYPIENDNKLLANYPGALGGKTGYTDDAGQTFVGAAERD
GRRLVAVLMRGTRQPIAPWEQAARLLDYGFATAPGTKVGTLIEPDPSLGV
DRADPAVAALTKTNANANAVLPDVDAMPVRIGVGVIGAVIVLTLIMGARA
LNSRPAR
145225443YP_001136121.1 AMP-binding domain-containing protein [Mycobacterium gilvum PYR-GCKMTGSYDAGPTDVAILEETIGANFARIARTHPGRDALVDVAGGRRWTYAEL
DAEIDTVARGLMAIGVERGDRVGIWAPNCPEWVIVQYATAKIGAILVNIN
PAYRTHELRYVLEQSGVATLISATQFKTSDYVAMVDEVRPDVPALQRVLF
IGTADWDTLRAAGSGVDDADLRRRSGALSNRDPINIQYTSGTTGFPKGAT
LSHRNILNNGFFVTEQIRLQPGDRLCIPVPFYHCFGMVMGNLGCTTHGAT
IVIPAPAFDPGLTLRAIETERCTAVYGVPTMFIAMQNHPDFAERDLSTLR
TGIMAGAVCPVEVMKRCVEEMHLTEMSIAYGMTETSPVSCQTLIDDDLER
RTSTIGRVHPHVEIKIVDPETGEIVERGTPGEFCTRGYSVMLGYWREDEK
TAQAIDADGWMHTGDLAVMRPDGYCNIVGRIKDVVIRGGENIYPREIEEF
LYTHPDVEDAHVIGVPDDRYGEEVCAWIRMRPGRTALDAAAVREFATDKL
AHYKIPRYVHVVDEFPMTVTGKIRKVEMREVSARLLGL
145225441YP_001136119.1 response regulator receiver protein [Mycobacterium gilvum PYR-GCK]MSAASPLLRPRDGDALRAELRRVAALGGVPVLFGGEIHEDTLLISEYYGL
RTAGLRGLAVRSSSGLGGASMVAGRPLAVADYRNASSITHDYDGPVLSEG
IRSVLAVPVLVDGRARAMLYGAYRTGAPFGGRAADLVVESARRLSEEFRI
RDEVDRRLRMRDAQAAGGQVSDEQIREVHAELRLLAVTAPPPLQNRLRAL
ADTLSGTGTEPGAGPDAATLAPRELDVLAQVALGCTNAEAAQRLSLKPET
VKSYLRSAATKLGTRTRYESVSKARRLHLIP
145225439YP_001136117.1 strictosidine synthase [Mycobacterium gilvum PYR-GCK]MPRFKRPIDPVRWQAPPVDPLPEFGSAALTLTPIPGGEPEDVVVDARGYL
WTGALDGSIVRLRPDGTAPEVVANTGGRPLGLAFARDGRLLVCDSPRGLL
ALDVDTGAIETLVTSIDGRPLLFCSNVTETSDGTVYFTESTSAFTIDQYL
GAILEARGRGALHRLDPDGRVTTVVDGLYFANGVTPTADGSALVFAETQG
RRLSKYWLTGPNAGSVTPLAVNLPAMPDNLSTGAEGRIWCAMVTPANPVA
DRLAAGPPVLRKLVWRLPARLQPKPEAVAWAVAFDPDSGDAVAGFRTTHP
EFRMATGLVESGGRLWLGSIGGPYLASVDLAATAP
145225437YP_001136115.1 AsnC family transcriptional regulator [Mycobacterium gilvum PYR-GCKMANPGLPHAVGPVSFRVNESRPGAAFQLDELSKAIIEKLQQDGRRSYAGI
GKAVGLSEAAVRQRVQRMVDAGVMQIVAVTDPMQLGFARQAMIGIKCTGD
TTKVAQKLAELPSVDYVVLTAGSFDAIVEVVCEDDDSLLELLNTQIRALP
GVIATETLVYLKLVKQQYNWGTR
145225435YP_001136113.1 hypothetical protein Mflv_4857 [Mycobacterium gilvum PYR-GCK]MRIRMLSLGPARSTTSRAAREARAGRRDDLAVTRAAVPDAPNIESQLADG
IRLESTRKKLKSNDGDLFVADSPRFAAPKRIFLGSTASRILAGVDVPGDC
GAARGLSFVCERALTVVGSAWPLP
145225433YP_001136111.1 YVTN beta-propeller repeat-containing protein [Mycobacterium gilvumMGYSKYVGRVGALALALGIGTAVATPAWAESPSTSESASSESKAPQKPSS
RRSTPATSGDSANGGDSAGKSGSDGSTASAGGNDNDSPVEDEADIEVAPE
PEAAEDAPPLVDEVVEESDAHDGNSASAAPEVDSPSTAVPSDATGVSEAE
APAHETLASLSPDQDPEPVDTEIADAPTPLGYALAVTAPPVEPAPAPLVR
QPRGPVGVILGGPAAMIDIAAKALQMLFNPGPTVPGDPPLLLGVLAFVRR
EIQRTFFNSSPTAVADTTSTSEGLPTRISVLDNDTDPNIDDVLTVTDFTQ
AANGVVELNADGSFTYTPTTGYSGTDTFTYTISDEASEWHGHVAGFVRGH
TSTATVSVTVLPPPVNESPSAAGDSATTAEDTPAVIDVKANDSDPNGDDI
SIASVGTAQHGAVAVLDGKITYTPESNFHGTDTFDYTITDGDLSDTATVT
VTVTPVNDAPVAVHDAITVAGSSVANVINVLGNDTDPDTEVTLTVAEVGA
PNHGGTVTIVDGNAIAYTPAAGFSGTETFSYTVSDGELTDTATVTVSVEQ
VVPSNIAPSAYDNVSYYTTNENTTLNVFANDGLIEWDAFDPDGDALTAGL
ATGPAHGTLDLNPDGSFTYTPDFGFIGDDSFRYTVTDGASSSNIATVGIS
VTPAGSSNTGNNRPPRAFDDFANIRENTTLTVPAGQGLLSTRSAHDADGD
SLTVDLVTATTNGHVSVDADGSYTYAPNDGYVGEDSFTYTISDGQATSSA
ATVTILVHAASEQTAPEAYGDDQIVVQDSSLTVSTENGLTSRFNAYDNEG
DALTAALATGPSNGQVTVNSDGSYTYTPNDGYIGEDSFTYTVSDGQLVSA
AATVYIDVQSNAYNMETGITIGPDGKVYVLHGTTRSNPDGTTGGSFHLAS
RNSDGSLTDLVQLSGASADSLPTGLAAGSDGRIYVADHLTGSITVYDRSG
GYSPTLIASIPAAAGIALDSKGRIYVTTVDYTDPDRAVGQLWILDSTGTQ
IGRPIDLAGPAAGVAVASNGDVYVAGLSGGLSVYSHRVLQTNITAEDLPG
FLHGLAIGPDGTAYIANWEAVSSSGELLDGAINIVNPADPTNIKQLPGVS
DPWGVVYANGLLYVTSTATQSVITLDPANATPFVNPNENAGGGALDPYTY
DVKTGIALGPTGDTFVIRGSVTYSPADGSSESTFYLARQNEDGSFSDLAE
IDGSPTSLAVGPDGRLFVTDNETGIVTMYDPSDGYSARAVAAIPNAAGIA
VDASGRIFVTTVTSDESGEPTGQLWILDATGSQIGQPVDLRLPSAGVAVA
SNGNVYAAGLFGGLAIFDPATELLETISSTDLPGFLHGIAVGPDGTAYIG
TWEGSNAYGDLLNGAIIIVKPGEPTTIKQVTGVSQPWGIAFANGMILAVS
ADTQTVVTLNPADATTFIKPSSDNGSDGAGSAEFASASTAVTMSATAAHT
AAVSTSISVSTKTATTAPAMASTANTANSSYGTHVTIDLDGTPTNVTLSA
NGTRGYVVVGNQVKIIELGASAPVIVDSVNVGVNPNMVAVNSFGTVAYVT
NSGDGTVSIIDKARPTPLTVTVGSNPTGIALSANGTRAYVSNTNSNTVSI
IDYGGGVLQLPKVVANVPVGSRPTSIAVNSTGTVAYVTNEGGDTVSIIRY
NGSGSPSVSTVNVSAQPQSVKTDDTGTKAIVYSRGGIVTIINGSGSVPTA
TTVPGRHFSYADYPGFVAISSDGRTAFVTEHDSPRRVTIIDTANPGVTPR
FVDLPDYSHSIVSLPDGTRAFTVAHDALWVIESKTGQATPVYVPADNNFS
QHQRIAISSDGRRVIAADNFGSLTAFYLSGGGSVKPPNLDWLRNSPTASS
TAVTTDSLLTKIPTSTPDTIRIQKSTDGGTTRVVVYISGVKEPSLQAAGS
YWAVLRAKQGITDENMRDTINKAISDIEKDGTTVSEIMLVGFSKGGMTAQ
NYASKRSFLGIDIYNETYGDKVKAVITFASPLVRKADEYGYGVDVVHLAA
QNDYLPRDEFFGGVLGWVDGQQVTQASNRGVRETFINERSDWKTIYTYDT
KSFSKDPITRHSVDNYHLVAKNYDANASRWIQSKLVTSAITRFFKGTINE
IDLDPNSPKTTKTF
145225431YP_001136109.1 amino acid permease-associated protein [Mycobacterium gilvum PYR-GCMVIGLGAVAPAYSLAATLGYVVLNVQEKAPSMFVLAFIPMLLVAFAYKEL
SQDTPDCGTTFTWATKAFGPWIGWIGGWGLAVSAIIVLANVSEIAAIYLY
NFLGLTSLAESVPATVALGCFFIIAMTLVSARGIVVSERVQNVLIAIQFG
VLITVSIIALVRVFSGTAGAQAVMPEVSWLWPSGLDVSSIAAAVILCIFI
YWGWDACLAVGEETKDPGKTPGIAALITTVILVCTYVLVAYALQSFAGFS
EVGIGLNNPNNTDDVLTVLGEPVAGAIAASALLLTVSVSALSSTQTTILP
TARGTLSMAVYEAIPRRFASVHPRYMTPAFGTIVMGISALFFYLVLKMLS
ENALLDSVASLGLAVAFYYGITAFACVWYFRRTLFSSARNLFFRGVFPLL
GGLSMLAAFAISAKDMIQPDYGHTAFGSIGGVFVLGVGMLVLGIPLMLAC
FAFGTKRFFRGETLNADTAVKVPDTF
145225429YP_001136107.1 hypothetical protein Mflv_4851 [Mycobacterium gilvum PYR-GCK]MTTTTRIEPVSPQRASLMTRLLWRYAKRRFGEVPEPFTIYAHHPGVMLAG
AMHEGMLERASTALPANVRELAVYWVARQIGCSWCVDFGAMLMRLDGLDL
ARLTHIDDYATSTSFTDDERAAIDYAAAMTTDPHTVSDEQVADLRRRFGD
KGLMELTYQVGVENMRARMNAALGITEQGFSSGDACRVPWTQ
145225427YP_001136105.1 hypothetical protein Mflv_4849 [Mycobacterium gilvum PYR-GCK]MDVGVASADDEAFLLDLLNTTPVVEGVPTDVLADKATAAEWMSSHGVGAT
DKARRVLIDARSALQAVVRGKATPDVLQRFLEGVHLTPTATDGGVDWTLA
GTDGAARAVLAWDGLRITSPGRLRPCANTECQLFLIDRSKPNNARWCSMA
ICGNRMKARRHYQRSRG
145225425YP_001136103.1 succinate dehydrogenase iron-sulfur subunit [Mycobacterium gilvum PMSAPVLDKQDTPPVPEGAVMVTLKIARFNPESPDDAGWQSFRVPCLPSDR
LLNLLHYVKWYLDGTLTFRRSCAHGVCGSDAMRINGVNRLACKVLMRDML
PKNPNKQLTITIEPIRGLPVEKDLVVDMEPFFDAFRAVKPYLITSGNQPT
RERIQSQTDRARYDDTTKCILCACCTTSCPVYWSEGSYFGPAAIVNAHRF
IFDSRDEAAAERLDILNDIDGVWRCRTTFNCTEACPRGIQVTKAIQEVKR
ALMFAR
145225423YP_001136101.1 putative succinate dehydrogenase [Mycobacterium gilvum PYR-GCK]MTQASRPASGRAENAYDHISDRGGPAPVMQRSFDRPAGLDNPRAPRRSGG
MPNFEKYTWLFMRFSGIVLVFLALGHLFIMLMWENGVYRIDFNYVAQRWS
SPFWQTWDLLLLWLAQLHGGNGMRTIIADYTRKDSTKFWLNTLLALSMAF
TLVLGTYVLLTFDASIS
145225421YP_001136099.1 cytidine deaminase [Mycobacterium gilvum PYR-GCK]MTGEIDWNLLRRKAIDVSQHAYAPYSGFRVGAAALVDDRRMVAGCNVENV
SYGLGLCAECAVVCALHSSGGGRLVALTCVGPDGEVLMPCGRCRQVLFEH
GGGDLLIDHPLGPKPLGELLPDAFGPADLDRRPYPVEETP
145225419YP_001136097.1 adenosine deaminase [Mycobacterium gilvum PYR-GCK]MTTPLTLENIRRAPKALLHDHLDGGLRPSTVLELAEQYGYDDLPAHDADE
LAEFFRTAAHSGSLVRYLEPFAHTVGVMQNHDALHRVARECVEDLADDNV
VYAEIRFAPELHIDGGLSLDAVVEAVLAGFADGEKAAAAAGRTITVRCLV
TAMRHAARSREIAALAIRFRDQGVVGFDIAGAEAGYPPSRHLDAFEYMRS
NNARFTIHAGEAFGLPSIHEAIAFCGADRLGHGVRIVDDIDMDAEGGPKL
GRLAALLRDKRIPFEMCPSSNVQTGAVASIAEHPFDRLARLRFRVTVNTD
NRLMSDTTMSLEMLRLVEAFGYGWSDLERFTINAMKSAFISFPERLAIID
EVIKPRYAVLVG
145225417YP_001136095.1 luciferase family protein [Mycobacterium gilvum PYR-GCK]MIDAVAASAERSGFETLWFGDQVVMADEDGPHHPYRDDGEIPASAQTDWL
DPLIALSFAAAATNRIELATGVLVLPERNPVVTAKQAASLDRMTGGRLTL
GVGIGISPQEYDALGVPFASRGARLAEYVGAMRTLWRDDDASFAGRYVAF
DGVRANPKPQGRSIPVVLGGNSDAALRRVAEWGDGWYGFDLADVEEAAFR
ASKLRSMCREFGRDPTELKLSVALHDPVPADAVRLADAGIDELVLVAGPP
ADPIAAEAWIADLAGQWMRVRT
145225415YP_001136093.1 hypothetical protein Mflv_4837 [Mycobacterium gilvum PYR-GCK]MLAHLSVETGLVHDYGVACATHAADLDAAAARLRGVGVGAAAAFGPVGAP
FLASLTRAAAAQSASLGRLSTSVDAGRAAATSCAQAYDLSDGDAASRLAG
SI
145225413YP_001136091.1 ectoine hydroxylase [Mycobacterium gilvum PYR-GCK]MSAPATLVPEDRYPTRLPEPRDPIRREEPTVWGDTFSGPLAESDLQSMSD
RGYLVRPGTMPEAWLPTLTAELGRMAGEVAPDDPRVIRERDGGIRSVFEP
HILSDVLAEVLTMDTVLPVARQLLGSDVYVHQARINMMPGFTGGGFYWHS
DFETWHAEDGMPAMRAVSCSIALTENFPFNGSLMVMPGSHRTFYPCVGAT
PRNNHASSLVRQEIGVPSRQTLTDAAAQHGIDQVTGPAGTALWFDCNIMH
GSGSNITPYPRSNIFVVFNSVQNQLVSPYRAETPRPEYLAARTFRPFNEP
VLT
145225411YP_001136089.1 diaminobutyrate--2-oxoglutarate aminotransferase [Mycobacterium gilMTATVVTPPTTDPVRENALPDVYDRVESEVRSYCRNWPATMASARGSWMT
DTSGRQYLDFFAGAGALNYGHNNPVLKAPLIDYLSQDSIVHSLDMATAAK
TEFLETFERLILRPRSLDYKVQFPGPTGANAVESALKLARKVTGRESIIN
FTNAFHGMTLGALSVTGNSMKRAGAGIPLVHATPMPYDNYFGGITEDFHW
FERVLDDSGGGLNHPAAVIVETVQGEGGLNVARMEWLRALAELCQRRDIL
LIVDDVQMGCGRTGAFFSFEEAGIVPDIVTLSKSISGYGLPMALTLFRRD
LDVWAPGEHNGTFRGHNPAFVTATKALETYWKSATFAENTAAKGQHVRDR
LESIAAAHEGISARGRGMAQGLKCEEKDLAAAICATAFERGVLMETSGPS
DEVIKLLPPLTTSTEDLDAGLDILAEAVATTVS
145225409YP_001136087.1 phosphoglucomutase/phosphomannomutase alpha/beta/subunit [MycobacteMHTAVEEWLAHDPDPESAAELAACDDDELAERFAHTLTFGTAGLRGPLRA
GPNGMNLAVVIRATWAVARVLTDRSPASSQVVVGYDARHRSAEFGRAAAE
VFAAQGFTVQLMSGPVPTPAVAFAVRHLGAAAGVQITASHNPPTDNGYKV
YVTGGLQIVSPTDREIEAAIAAAPPADEIPRAPVEVPAADELRAYLERAA
SVRHAAGAARIALTPMHGVGGEFALDALALAGFADVHVVEEQFAPDPDFP
TVAFPNPEEPGASDALLALAAGVDAEIAIALDPDADRCAIGVPTPTGWRM
LSGDETGWLLGDYVLSHADPTHAVVASTVVSSRMLASIAAAHGARHVETL
TGFKWLARADEGLDATLVYAYEEAIGHCVDPGAVRDKDGISAAVLACDLV
VSLREQGRTLLDALDDLARRHGVHTTTAVTRRVRSPQDAAAMMSRLRAAP
PEEIAGFAVTVTDLMPRTDALIFSGGDSATSVRVVMRPSGTEPKLKSYIE
IRCTGEVATGRSHAADVQDAVAAAIATWR
145225407YP_001136085.1 putative ammonia monooxygenase [Mycobacterium gilvum PYR-GCK]MKWWRSILRWTCLLAVTGAVTVPLTRVGVPSAALFAALAVGIVFALTVGG
PARVPRRLGIAAQGVLGVYIGTMVHRDALSALKGDWVIVLAVAVGTLLLS
VLAGALLGMRRDVTPLTGSLALVAGGASGLVAIARELGGDDRVVAVVQYL
RVALVTASMPVVVTLIYHADRSRATTQIAETPAAPWYLSVAIMAALVVVG
AVGGRLIRLPGAGLLGPLALTVALEVSGLSFGLSVPMLLVQAGYMLIGWQ
AGLAFTRASLRSVGRLLPTALALIVFIGVATAGLGVLLARVAGLTPLEGY
LATSPGGVYAVLATAVETGSNVTFVIAAQVVRILLMLFTAPLLARAVVWA
SRKLSPDQSPAMTADSREPIRVAD
145225405YP_001136083.1 amidohydrolase [Mycobacterium gilvum PYR-GCK]MSSAAASTSVEDAVNRRRSDLIELSHSIHAEPELAFAEHRSCAKTQALAA
ERGFEVSEVAGLDTAFRAVYGSGPLVIGVCAEYDALPGIGHACGHNIIAA
SAVGTALALAEVADELGLTVVLLGTPAEELGGGKALMLDAGAFDDIAAAV
MLHPGPLDIAAARSLALSEVTIGYTGRESHAAVAPHLGVNAGDAVTVTQV
AIGLLRQQLAPGQMVHGIVTDGGQASNVIPAHTELRYTMRATNSESLHEL
ESRMAGCFASGAVATGCEHVVSETAPAYAELAPDPWLAERVRAEMLRRGR
TPVPAELEAEFPLGSTDMGNVTQVMPGIHPIVGIDAGGASIHQPAFTAAA
VNASADAAVVDGAIMLARTVVALAESDVERDRVLDLWRKRAS
145225403YP_001136081.1 transporter [Mycobacterium gilvum PYR-GCK]MCRRATGSAITTFGRNNFGFNNFGLNAVEDRTVHGDKPHFYGIARVIRAA
SIPIILIWVAIAAFLNVSVPQLEEVGKLRSVSMSPDDAPAVISMQRIGEV
FEEYESNSSVMIVLEGQEPLGDDTRAYYSELIADLEADTKHVEHIQDLWS
DPLTAAGAQSADGMSTYFQVYLAGNQGEALANESVRAVQELVAESQPPDG
VAAYVTGASALAAEQEEAGHSSMRFVEALTFLVITIMLVLFFRSIVTTLL
ILVMVGLSLMTVRGAVAFLGFHDIIGLSTFATSLLVTLAIAIAVDYAIFL
IGRYQEAKGTGATSEEAYYTMFGGTAHVIVGSGLTIAGATFCLSFTRLPY
FQSLGVPLALGMLVLIAVAMTFGPAVVTVASKFGLLAPKRDMRVRGWRKV
GAATVRWPGAILVASVAVSLIGLLALPGYQTSYNDRKYLPADIQSNIGYA
AAERHFSPARLNPEVLMVETDHDLRNPADFIVIEKIAKALFAVEGIGRVQ
TITRPDGKPIESTSIPYIMSRQNTTQQLNEKYMLDRMDDMRAQADSLQTT
INVMERMQALMTQMSAITTSMVGKTRTMTADITQLRDHIADLDDFVRPIR
NYFYWEPHCYNIPVCHSMRSLFDLIDGTNLLTENTQELLPDLERMAAIMP
ELIALMPSQIESMKSQRDNMLTQYQTQNSQLEAGAEMSVDSGAMGDAFND
AWNADTFYLPPEAFENKDFQSGIEQFISPNGHAVRFIIAHEDDPLSPAGI
EKIDGLKTAAKEAIKGTPLEGARVYLGGTAATFKDMADGTRYDLLIAGIA
AIGLIFIIMLILTRAVIAAAVIVGTVVLSLGASFGLSVLVWQHFVGIELH
WMVLPMAVIILLAVGADYNLLVVSRLKEEIQAGVGTGLIRTMGGSGSVVT
AAGMVFALTMMTMAVSDLTIIGQVGTTIGMGLIFDTLVIRSFMTPSIAAL
LGRWFWWPQKIRTRPVPVPWGAGASGGGDGDGDGDGDDGGGGAPRARASA
Q
145225401YP_001136079.1 hypothetical protein Mflv_4823 [Mycobacterium gilvum PYR-GCK]MPIYAAYGSNMDPDQMLERAPHSPMAGTGWLHGWRLTFGGADIAWEGALA
TIVEDPTSKVFVVLYDVTKEDEENLDRWEGSELGFHKKIRCRVHRTSSDT
TTDPVLAWLYVLDAWEGGIPSARYLGVMADAAEIAGAPPEYVHDLRTRPA
GNVGPGS
145225399YP_001136077.1 FAD dependent oxidoreductase [Mycobacterium gilvum PYR-GCK]MSDPIPAPGNGETFLGPDERARAWQRLGSEQFDVIVIGGGIVGAGAALDA
ATRGLKVALVEARDFASGTSSRSSKMFHGGLRYLEQLEFGLVREALHERE
LSLTTLAPHLVKPLPFLFPLTNRVWERPYIAAGIFLYDQLGGAKSVPPQK
HLTRAGALRLSPGLKRSSLIGGIRYYDTVVDDARHTMTVARTAAHYGAVV
RTSTQVVALLREGDRVTGVQVRDSEDGRVTDVRGHVVVNATGVWTDEIQA
LSKQRGRFRVRASKGVHIVVPRDRIVSEVAIILRTEKSVLFVIPWGTHWI
IGTTDTDWNLDLAHPAATKADIDYILGHVNKVLATPLTHDDIDGVYAGLR
PLLAGESEETSKLSREHAVAVPSPGLVAIAGGKYTTYRVMAEDAIDAAAE
FIPTRVAPSITEKVPLMGADGYFALINQTQSVGTYYDLHPYRVRHLLDRY
GSLIGEVLKLAEDNPDLLNPITEAPVYLKVEAAYAAAAEGALHLEDILAR
RMRISIEYPHRGVDCAREVAEVVAPILGWSPEDVDREVSTYLARVEAEVQ
SQTQPDDASADALRAAAPEARAEILEPVPLN
145225397YP_001136075.1 hypothetical protein Mflv_4819 [Mycobacterium gilvum PYR-GCK]MRWLRILPAKAHCLLRPDAVQMSRGPASRALYSKSACRCAGTYWAVGPRA
VRVGCHNHHSCLRISGVALRGSVIVASAAMFVAGALGVAPAGHAAVCGSV
GGVHVDVSGCADPLYELNDALAPPPPPPPPPPPPPGAPPPPPPPPPPPPP
PVYIPPPLPNVNVCADVGRRINVSGCI
145225395YP_001136073.1 enoyl-CoA hydratase/isomerase [Mycobacterium gilvum PYR-GCK]MSSVLEVARPTPEIAVLTLNRPDKLNALSYELVEALHAELDALARDNACR
AVVLTGAGRGFCSGLDLSAPNPEETGGGTEFPRSGMRWQERIADLTAKIH
RLRQPVIAAVQGVAYGGGLGIAAACDIRVAAPTARFCTQFIKLGLGGCDI
GVSYTLPRIVGAGVAFDMILTARTVAADEALRLGLVSRVSDTPVDEALAI
AETLCNYGKFGVESTKQVLWANLVASSLEAALHLENRSQILASTSGEMRE
LAAKILRKG
145225393YP_001136071.1 oxidoreductase FAD-binding subunit [Mycobacterium gilvum PYR-GCK]MFTEVLTKRSRRFALLDLLTGPHGVDRYTELVDPTWTRGNARAKVVGVRR
STPRSVTLTLAPNRAFDGFRAGQHINVSVEIDGRRRTRPYSPANAEGEAN
IELTIGRHDGGLVSTYLFDHARRGMVVGLDSVGGDFVLPARPAENILFVS
GGSGITPVMSMLRTLRARRHAGQVTFVHYARSADEACYRAELAVIAREMP
NVTVLHGYTRVATDSDLDGRFGAGQLPAGVTHADAVYACGPPALVDAVRE
LHPHAESESFVPPVFTADESGGGTVSFTTAGVDVVDDGRPLLNQAEDAGL
APESGCRMGICFSCTRRKTSGVVRNVVTGAVSSTEEEDVQICVSAAVGDV
DIDL
145225391YP_001136069.1 hypothetical protein Mflv_4813 [Mycobacterium gilvum PYR-GCK]MGVAWAQPPVPSAGELTSELQQVLNTGTPTEVRAAKLAGGDAAVPTADNI
ANRLNTYGGMINWRVENPVLNGDQLDAQIAVTIPIWGTKTHNIYWVEQDG
AWKLSNPSACVIARDVAGVDCTV
145225389YP_001136067.1 formamidopyrimidine-DNA glycosylase [Mycobacterium gilvum PYR-GCK]MPEGDTVYRTAAKLRDALEGRELTRCDIRVPRYAAVDLSGQVVDEVLSRG
KHLFIRVGQASIHSHLKMDGAWVIGRVRVPTYKIRIVLETANSRASGVDL
GVLEVLDRATDMEAVEHLGPDLLGEDWSAEVAAANLVADPERPLAETLLD
QRVMAGVGNVFANELSFVFGLRPGTPVGELTDPLRVANRAQQMLWLNRLR
VNRTTTGNTRPGQDVWVYGRAGLPCRRCGTPIETDKNTERVTYWCPTCQR
145225387YP_001136065.1 regulatory protein LuxR [Mycobacterium gilvum PYR-GCK]MGRPRIADRVVPRPDLLKRLESSAGGDLVVLTAPAGYGKTTVTAMWDAED
RRQFAWARIDHLDDDPGHLLLHIATAVVRLGAGDDHLLNYLRGPGREPEH
LLPAVVRLLEEFGPIVVILDDVHKLSTPQSISALHAFVDAAPLTTTVALL
GRFLLPLDIARRRLAGNLVEVDQDALRLTAEETVAALESVRGPSDDATVA
TVIDLCEGWAAGVILTAMALRDGTAPEALAGRNNLVVEYVVEEVIDRVDD
DTRSFLLESAMLDRFTAEHLDAVLGRVDAAWMLEQLATSGNPFLISLDSQ
GDSFRYHHLFGDVLRARLRASEPARFRELASRAADLLEREGDIDGALVHA
LEAGDRARAAALVGREAVRLGFDGRAGVLARRLGMLDARTFAEQPDAAVA
RAWLGVTTADAELIQRSLMLALHSDHGGPLADGTPSVSVAVALISSLVGV
GGVAEVIRHADTVRAAGDNLVNPWWGAATVMKGAAEAMRGQGGRARLLLE
SALPVIEDLPGFHAAALAHLALLDLAAGDDEAAVERCDAARTLADKYDLS
DVVPMIVVYSTSAVMSARVGDVPAALHAVQITQTLLERLGNLSARTALLG
HGLLAWTAAALQDRALLSRHLTAAERVRHREPDAVALVQRVERVKAMAVG
GTRPLTAAELRLLPHLATHLSLQRIAEELVIGRETAKSQATSIYRKLGVS
SRGQAVSEAIRIGLLAD
145225385YP_001136063.1 Dyp-type peroxidase family protein [Mycobacterium gilvum PYR-GCK]MTLDLDDIQHILLTRTPAITGRYEFLTFDRADGGRAWLTELLDRVQSASD
AVATMDASQRWITLAFTWTGLRALGVPDDALATFPDEFREGMAARADILG
DTGPNAPQNWVDGLAGDDVHAIAILFARDDDEHRRCVGEHDKLVARCDGV
RTVSYLDLNASPPFNYAHDHFGFRDRLSQPVIKGSGEEPTPGSGAPLEPG
EFILGYPDEFTATPEIPQPDELARNGSYMAYRRLQEHIGAFRSYLADHAG
TPDEQELLAAKFMGRWRSGAPLVLSPDVDDPELGADPLRNNNFNYKEMDP
FGYACPLGSHARRLNPRDTAHNMNRRRMIRRGATYGPALPDGAPEDGTDR
GIAAFIICASLVRQFEFAQNVWINDTTFHELGNEHDPICGTQDGTLDFTV
PKRPIRTVHKGIPAFTTLRGGAYFFLPGIKALRYLAGGLR
145225383YP_001136061.1 hypothetical protein Mflv_4805 [Mycobacterium gilvum PYR-GCK]MHMIAVVMTPVVSLATVVAVAAPAAADCTTAGATTICSQGDVRGTNSGTG
PVGSSGPYVPYPCDWNYYNCNEWWDVDFDVDLDPGRPGIGGPGGPGGPGI
GAPGGPGRPGGGFGGGGGRGGGGRR
145225381YP_001136059.1 hypothetical protein Mflv_4803 [Mycobacterium gilvum PYR-GCK]MLSLSMRRMLAAALGTGAALIAVAVPAQAQPAPPNCTAADLAGVATGVSA
ATSAYLFTRPAVNEFFTSLFAMDAEQRKAAVTAYMDANPQVASELRGIRQ
PLADLRHRCGFRHHPHHE
145225379YP_001136057.1 cytochrome P450 [Mycobacterium gilvum PYR-GCK]MVDHRQPFPPLPHPPRRVPVVGDVFGFSADILTRPPSDPGLGPVFEFRFL
GARYVVAASADAVAEVNDERRFCKHVGPDIDALRIMGGDGLFTAYNEEPN
WQRAHDLLMPAFSQQAMRGYHSAMLDAADGLVARWDGKARTGASVDVPAD
ATRVTLETIGQCAAGHPFGCFDTEDPHPFVEHMVAGLKGSDWVGVLRETV
LPNFFARRAERRVRRHAVQMHRIADEIVSERLRDGLGHHDDLLELMLTSD
LDPANIRYQLINFLVAGHETTSGALSFALYFLSRHPEVADRARAEVAEVW
GDDERPGFELIAKLRYVRRVLDEALRLQPTVPGYYREAREDTVLAGVHPM
RQGDWVLAMTMALHRDPRWGGDPDAFDPDRFAPDRVRARPAGLYKPFGTG
PRSCIGRQFALHEAVLLLAVLLRRYDLVPEPGYQLQVAQRLTLMPKDFRL
TLRRRRSE
145225377YP_001136055.1 aldehyde dehydrogenase [Mycobacterium gilvum PYR-GCK]MSTAVTALPTAEKLRTRVRDALAAVGARIALGVPTAHGLPASTPITGDVL
FTVPASSAADVDAAVGEAADAFSTWRTTPAPVRGTLVARLGQLLVEHKSA
LASLVTIEAGKITSEALGEVQEMIDICEFAVGLSRQLYGRTIASERPGHR
LMENWHPLGVVGVITAFNFPVAVWAWNTAVALVCGNTVVWKPSELTPLTA
VACQALLERACADVGAPPAVGRLVLGEREVGEKLVDDPRVSLVSATGSVR
MGREVGPRVAARFGRVLLELGGNNAAVVTPAADLDLAVRGIVFSAAGTAG
QRCTTLRRLIVHSSIADELVSRIVKANEQLPVGDPFRGGTLVGPLIHTRA
YRDMVGALQQAQAEGGEVIGGERVDVGDEGAFYVTPAVVRMPEQSAVVHQ
ETFAPILYVLTYDTLDEAIALNNAVPQGLSSSIFTLDMREAERFLAADGS
DCGIANVNIGTSGAEIGGAFGGEKETGGGRESGSDSWKAYMRRATNTVNY
SSDLPLAQGVEFG
145225375YP_001136053.1 AsnC family transcriptional regulator [Mycobacterium gilvum PYR-GCKMTVPDDPQPPAPLDEIDRVLARELVADGRATLAHLAATAGLSVSAVQSRV
RRLESRGIVTGYTARIDPEALGSKLSAFVAITPLDPSQPDDAPARLEHIP
EIEACYSVAGEDNYMLIVHVESARALEGLLQKIRTAADVKTRSTIILHKF
YSERRYVPE
145225373YP_001136051.1 restriction endonuclease [Mycobacterium gilvum PYR-GCK]MTTLRWRLYAALAIAAGATAHLSGAGWLWTVLAGLLAPVLVVAAPSFVRS
VVAGAATPGPRENPVDADMSGTEFEDYVARIARTCGVPVIMTSMTGDWGV
DLIVGHRPHRLAVQCKRLSRPVGAGAVQEVVAGAPMQDCTQTMVVTNHEF
TPAARKLAELHGCTLVGGADLPRLRSTIRRLTRPAEPPSSSAPRPPP
145225371YP_001136049.1 hypothetical protein Mflv_4793 [Mycobacterium gilvum PYR-GCK]MRGPSDPVDHVRTTRPHAGESMKDNKIMPGLVVIGLSLVSFVAMLSAFAT
SHHDVGVMLGAIAAAGFVLGGGWLFIEHQRVRRLEERWYAEHPGAWRQRP
NS
145225369YP_001136047.1 hypothetical protein Mflv_4791 [Mycobacterium gilvum PYR-GCK]MTEKNSGPQEGIKGVVEDVKGKAKETIGTVAGRDDMVQEGKAQQDKADAQ
REVAEKEAEAESARAGAKAAEKRQEANQ
145225367YP_001136045.1 RNA polymerase sigma factor SigF [Mycobacterium gilvum PYR-GCK]MTRSSSQGSSRSNSEYSDVADMFRELAELEEGSAAFQRQRDRIVERCLPL
ADHIARRFDGRGEPRDDLVQVARVGLVNAVIRFDVTAGSDFVSFAVPTIM
GEVRRHFRDNSWSVKVPRRLKELHLRLGAATAELSQRLGRAPTPSELAAE
LEMDRDEVVEGLVAGSSYNTLSIDSGGGSGNEDAPAIADTLGDVDLTLDQ
IENREALRPLLAALPERERTVLVLRFFESMTQTQIAERVGISQMHVSRLL
AKSLTRLRDQLE
145225365YP_001136043.1 hypothetical protein Mflv_4787 [Mycobacterium gilvum PYR-GCK]MTGVVLAAGAGTRFGMPKVLADGGEWLRRSVAAVSDGGCDDVVVVLGAAV
VDVPAPARAVVADDWRDGLSASVRAGVRAASGADFVVLTTVDTPDVGAAA
VRRVLTAARESASGLVRARYGGRPGHPVVIARRHLPQLLDSLSGDDGAGP
FLKARADVVAVECGDLSSGRDIDTR
145225363YP_001136041.1 hypothetical protein Mflv_4785 [Mycobacterium gilvum PYR-GCK]MEPVEINAGAWYLRALRADDRVDDRPALADLGEHDAGYVNRRAAHWDSGT
LYSWAVCEPTTGELLAEVTLDPATGAIATRSRPGHERAAGTGADAVGRFA
AAMLG
145225361YP_001136039.1 diguanylate cyclase [Mycobacterium gilvum PYR-GCK]MPRQLSVVAGLRHWWRQADHYDWFADYLSARGLVGLARVITAVTAAGLAL
VGATVMFCPGGPTGTLDVTLGWAAVALAFGCAIVRWSIWPSKRQSVVLIL
ALNLAIALFCQVQTDQLIGVVGATAFATTGISIACLHSAKYMLYNVVVAA
YIGGLQAVRAMDETDGHLILAALGLVLIINISVPFSVQSLVHALGGDVVQ
SDRDPLTGLCHRRALFRQLNALLLSHREHADFLAVTMIDLDKFKVLNDTY
GHSAGDDALVAVGEALLTAANGRALVGRVGGEEFMVAELCETARDTGLSE
RLRAAIAALPHHITGSVGTAVASINDVPTDDFQDLVVTLFRRSDRAMYEA
KRAGGNQIRHTVIDLPAIPVSGADNLPAGNRPARRTSD
145225359YP_001136037.1 Fe-S metabolism associated SufE [Mycobacterium gilvum PYR-GCK]MSMPAALAEVVSDFKDVDGQDKLALLLEFADELPPLPAELEEAAMEPVPE
CQSPLFLHVDADDRDHVRLFFSAPAEAPTTRGFAAILATGLDGQSAADIL
AVPDDFYTDLGLAKLISPLRLRGMSAMLTRIKKRLT
145225357YP_001136035.1 acyltransferase 3 [Mycobacterium gilvum PYR-GCK]MVTRVDQWREASARRRRRAERANHRLDVQGLRAVAVLGVFAHFLTGWPRG
GFVGIDIFFVIAGFFVTESLLRTAADTGSPSLRTFYVGRVRRILPAATAV
LILTVAATALVMPDDLRDVGVDALFAFFFVANWHFAASGVDAASAAESAS
PLLHYWPLAVEEQFFIVWPVLILGITAIAVRKAWTDERWRAHLAVAVGVV
VIASLAWAAVQTASSPSWAYFDTFARVWELGVGALLALAVGTLSRIPDPI
RPILSWTGLTLIGAAFVLVDGGSGFPVPWALLPVAGAALVIAAGVGREPE
LQGFLRNRVSTYLGDISFALYLVHWPVIVLLAAVMDRSVFYYASVVTLAF
GLALAVHHFVENPARDATVQGLRQAREDRRHGLHHTELSTKIAGVAALIL
ITFSVISYAMSPEAIDDPAPIAPTAPSP
145225355YP_001136033.1 hypothetical protein Mflv_4777 [Mycobacterium gilvum PYR-GCK]MERKGFKKIAAGTASFGMLLTGVLVAAPTAGAQTSTWTMPALRGEVLERA
VNSVEGAAGSAPIRFNIYDSVNNQVVYNYTNWVVCGQSPRAEATVKVGAK
PQTVTFALKRRQAGC
145225353YP_001136031.1 hypothetical protein Mflv_4775 [Mycobacterium gilvum PYR-GCK]MNHDADIVEVSDPRDMTIDDPPAPDPHFQVVKGDPSPEEIAALVTVLASA
GGGAAADPGPQELNLWGHPVDKLRYDTTSWQRTTLWERMHMRK
145225351YP_001136029.1 hypothetical protein Mflv_4773 [Mycobacterium gilvum PYR-GCK]MNAIATKFKVTAAAAAIAASAAVAPVAANAAPAVELPAAPAIGHLAEQPA
GLFGVFVVQFTGAVTRTSTYWTRITITNYESLLEARPDSIFAPFYQARID
RLNAQLARYGEVEMTSCVGGRSTSIVAGSYGGVTTGTC
145225349YP_001136027.1 lipopolysaccharide biosynthesis [Mycobacterium gilvum PYR-GCK]MNLQDFVKLLRSRWMTVCVTMVFAVMGAIAYTLLITPQYQASTRLFVSTS
SSSSVSEIYQGNRFSQERVVSYAELLMGETLAQRTIDKLGLDMSASSLRE
NISASAKPDTVLIDVAVRDPSPVRARDIANTLSDEFVAMVRELETPDGGA
TPDARVVVEQRATIPEHPVVPNTTRNIAMGLALGVLLGVAIAVVRDLLDN
TVKDRETLEGITGAGIVGSVPLDKERRKQAAVAFDRDNSGIAEAFRKLRT
NLQFLAVDNPPRVIVVTSSMPSEGKSTTAINIALALAEGEHSVVLVDGDM
RRPSLHKYLGLVGPVGFSTVLSGGTSLSEALQKTRFPGLTVLTSGAVPPN
PSELLGSQSARKLLSELRAEFDYVIVDSTPLLAVTDAAILGAGADGVLVM
ARFGQTKRDQLAHAVGSLVDVGAPLLGAVFTMVPTRGSSSYSYSYSYYGS
ESAPQQARQDVPVAPTKPAALDAAPSQTGAEPPDPDSSLPRADATPGASR
RRRRQVSE
145225347YP_001136025.1 acylneuraminate cytidylyltransferase [Mycobacterium gilvum PYR-GCK]MSRTVAIVPMRHNSERVPGKNYRPLAGIPLYHHVIRTLTLVSEIDLIVID
TDSELIIEDCAQSFPQVRVLVRPENLRDGGIAMNDVLLNTLDQVDADIVL
QTHSTNPFLKPETVSAALQLFHQPDREFDSLFSVTRLQARLWDEHNRPVN
HDPSVLLRTQDLAPLFVENSCFFIFTPELLRERGNRIGVQPLMVEMAPLE
AIDIDVEEDFALAEAIAGRNGTNT
145225345YP_001136023.1 short-chain dehydrogenase/reductase SDR [Mycobacterium gilvum PYR-GMTKAVIVTGAAGGIGAALCERVRKDGYLAVGIDRSPAPAADADIRLDLSE
SEQLVDVGRELGEKYELKAVVHNAAAQPIAGAGDTPLADWVEALRVNVIA
VDALMSGTRVNLAANDGSVIVISSAHARATTGGVTAYATTKAALEGWVRS
AALDLGPGVRVNAVAPGAIDTAKLREGFARWGEESAEARKAILRQRTALR
RIGEPSDVAGAVSFLIGDDARFITGTVLVVDGGATARLGSE
145225343YP_001136021.1 glycosyl transferase family protein [Mycobacterium gilvum PYR-GCK]MNGPQPVRLSIVTVCWNDLENVQRTMSSLNRQTERHGWEHVLIDGASSDG
TADWYRSAHFDFPHHALSEPDDGLFDAMNKSLDVVKGDYVVFMNAGDTYA
DDGAVRRVLHRIQTNPPWGYSRARVVDNSGRKVRPHVGRIPYSRTMHLLG
RATICHQAVVMRTDLLRDLKGFDKRLGTAADYHLLIRAALRQVPDTWAEV
DVDFLAGGVSDSGIYEHLWNRHRARVDALALKSVGSRVDSAWTALQVVRI
WARKKLKPIFGPLYLRLRK
145225341YP_001136019.1 integrase catalytic subunit [Mycobacterium gilvum PYR-GCK]MPASGDHRVDVAPLDCPVRRHESQRGQTAQGTRSRERPAQEAGRQPGPRH
RHAQGDFGGKLLTPNRKRSAVIALRERFGVSERRACTVVGLHRSTMRLTP
APVTTEEAELRAWLRRFSTDRPRWGWRRAAKMARRAGWKANNKRIRRLWR
EEGLRVPQRRRKKRLTGIGVAVGAMSPIRPNVIWAMDFQFDTTADGRTLK
MLNVIDEFTREALAIEVDRAINADGVVDVLDRLALTYGAPHYVRFDNGPE
FVANAVADWCRFNSAGSLFIDPGSPWQNAWIESFNGRLRDELLNLWRFDS
LLEARVIIEDWRRDYNANRPHSAHGELTPAEFALQWTTTHQPQVA
145225339YP_001136017.1 hypothetical protein Mflv_4761 [Mycobacterium gilvum PYR-GCK]MPQSRSPRPATRYNWRRGYGGVDTDAVKIPRSCASRTPLKRLLAEAETVQ
RCSAGGLEGDPDPSAKCRAGDMLTTTLGMSERLACKPLG
145225337YP_001136015.1 SMP-30/gluconolaconase/LRE domain-containing protein [MycobacteriumMTRCAERLTPRAAHHGEGPFWDRRSGRLLFMDVLAGVVGAIESTGKVLRY
DVPADVATVIRRRASGGFVIATGHDLMCADDDLANFTHLTHVASDPHVRT
NDGGCDPTGGFVIGTMAYDERTGGGAVYRVAPDCHATTLLAPVSISNGIQ
WSADGTRVFYIDTPTRRIDVFDVDLDTGRWSNRRVHIDMNNSIGYPDGMA
IDVDQGLWVAMWGGGAVNHYDAFGQLVETIEVPGVTQVSSCAFGGGSLDE
LFITTSRQGLPNDSEPSAGAIFSTKTTTRGAALLEFAG
145225335YP_001136013.1 protein tyrosine phosphatase [Mycobacterium gilvum PYR-GCK]MCTGNICRSPIAERLAAAHGTLVGLPGFQASSAGTRAVIGHPIHQEAADV
LENMGGVASDFAARQLTRRIVFDADLVLAMTKAHRDKVLELAPHKLSSTF
ALAEAAALASMGDNNRNIADLAALRPHVAAHDWSDVPDPIGQSRAVFEAV
GSQIAELLTPVLDFCQRACADSPY
145225333YP_001136011.1 undecaprenyl-phosphate galactose phosphotransferase [Mycobacterium MTAINDRLDVAANIVSLPTKAPTWQQGYSRRLIVLDLVGVVLAVGLAHWL
RFGSETETISTYRAVDYTMVSVAIAVLWLAALAINHSRSTRVIGSGAEEY
RRVILATLAVFGAVAIVSMLFKLEIARGFLVIALPVGVVVLVVLRWLARK
VVVTVRRKYGRCITRVLVVGSPTAVRDLTMSLHREAASEYEVVGACTPGI
TPHSEIDVSGVGAIPTFGDESNVVGAVTATRSHAVAVTATERLGGRGIRD
LSWELEKLDIDLLVAPGVVDIAGPRLQMRPVAGLPLIHVEKPQYHGAKKF
QKRLFDVAFSSAVLLCGLPILLVVALAVKLSSKGPVFYRQERVGLDGRPF
EMIKFRTMVDGADGMLGKVAALNESEGGVLFKIREDPRVTPVGKFLRKYS
VDELPQFVNVLKRDMSVVGPRPPLATEVNSYDDYARRRLLVRPGITGLWQ
VSGRSDLSWEDSVRLDMFYVENWSMVSDLLIALKTVKAMLGHSGAY
145225331YP_001136009.1 NAD-dependent epimerase/dehydratase [Mycobacterium gilvum PYR-GCK]MTASEIVSPRELDRAATFYVAGHRGLVGSAIVRRLRVAGFDNIVGKTSAE
LDLKNRDAVFDFMSEIKPRYVVLAAAKVGGILANSNYPVDFLSDNIRIQV
NVLDAARDCGVERLLFLGSSCIYPKFAEQPIREDSLLTGHLEPTNDAYAI
AKIAGILHVQAVRRQYGLPWISAMPTNLYGPNDNYSPTGSHVLPALIRRY
DEAVASRAVSVTNWGTGSPRREFLHSDDMADACLHLLENYDGPEQVNVGS
GTDVTIREIAESVAAAVGFSGETHWDTTKPDGTPQKLLDVSKLTQAGWTS
KISLQEGIERTVAWYREHVGALRG
145225329YP_001136007.1 di-trans-poly-cis-decaprenylcistransferase [Mycobacterium gilvum PYMFVAMSLSILPCPQAGRQSRITTGPLRRAHLIRTVSVYNLSRANLARPAA
ELAAVYNASIYFFSELIPTHFDPADCTIRLHGDRSLLPLDYVAAAEALEG
AAPRGDFCINILAAYDAFDELRGAHFRAQQQGCDIATAFDIPPVDLVIRT
TAEPLLSGFLPLQCQYAELTFLATPLNELTATDIDAVIAEHRRFPQRRGR
145225327YP_001136005.1 membrane-flanked domain-containing protein [Mycobacterium gilvum PYMLNPQYSAAVGYPENVLAKDEHVVLHRHPHWGRLVLPAVFLIIASAAAAF
IAGYVNTLNWEQAAKTIVFGVIAAIWLVLVGWLAVWPFLNWWTTHFVITD
RRVMYRHGLITRSGIDIPLARINSVEFRHGLVDRIFRTGTLIIESAAQDP
LEFQDIPRVEYVHSLLYHEVFDTLGSEESPS
145225325YP_001136003.1 phosphoribosylaminoimidazole carboxylase ATPase subunit [MycobacterMPHPAVTAGQRCGVGHDTMYAVSRRPSSPPVVAMIGGGQLARMTAQAAIA
LGQTLRVLAVRSDESAAQVTPDVVLGSHTDLDALRRVADGATAFTFDHEH
VPTEHLDVLIAEGVNVAPPPEALIHAQDKLLMRRRLSELGAPVPRFSAVS
SVEDAVAFSEQVGGPAVIKTVRGGYDGRGVVIASDTDEVRSAVEGYLADG
VPVMIEERVAMRRELAALVARSPFGQGAAWPVVETVQRDGICVTVLAPAP
DISDELGSAASELALHIASSLGVVGVLAVELFETVDGGLLVNELAMRPHN
SGHWTMDGARTSQFEQHLRAVLDYPLGDTSALAPTVMGNVLGAPETPAMS
MDERVHHLFARMPDAKVHLYGKEERPGRKIGHVNIVGGPSEPVESLRERA
ERAAHWLSHAQWTDGWDSHA
145225323YP_001136001.1 putative GAF sensor protein [Mycobacterium gilvum PYR-GCK]MSISLPGFDTWLTDRLEECAGDSGEPVDTYVARAVASQMVTDCERVDRAS
AGRLKAHLSLTGLSGEATADGLSSVLADPTRLRALNATGLTDTSPDATYA
RLTRTTADALSVPAAALVLIAVDRQFVISAVGSIPPADQTGLTESFGKYV
VANGSLVSVDDARQHPLFKKYAAVARGRVVAYLGTPVADGAGNTVGALSV
SDTAARRWTSGEMQILGDLAAVAVARIFGS
145225321YP_001135999.1 butyryl-CoA dehydrogenase [Mycobacterium gilvum PYR-GCK]MQAEKSVPRNSLPAATALKLPTSSKEMLMASWAGNPSFDLFQLPEEHQEL
RAAIRALAEKEIAPHAADVDENARFPQEALDALVANGFNAVHVPEEYGGQ
GADSVAACIVIEEVARVDASASLIPAVNKLGTMGLILRGSDELKQKVLPS
LAAGESMASYALSEREAGSDAASMRTRAKADGDDWILNGAKCWITNGGKS
DWYTVMAVNDPDKGANGISAFMVHVDDEGFSIGPKERKLGIKGSPTTELY
FENCRIPGDRIIGEPGTGFKTALATLDHTRPTIGAQAVGIAQGALDAAIE
YTKDRKQFGKSISDFQAVQFMLADMAMKVEAARLMVYSAAARAERGEGNL
GFISAASKCLASDVAMEVTTDAVQLFGGAGYTVDFPVERMMRDAKITQIY
EGTNQIQRVVMSRALLK
145225319YP_001135997.1 biotin--acetyl-CoA-carboxylase ligase [Mycobacterium gilvum PYR-GCKMPTPERPALNVDVLRSAITGTEWHRVDVVDETGSTNADLIARADRGEDIA
GAVLLAEHQTAGRGRHGRTWSAPPRSQISMSFGVDTTGVPPAGWGWLPLL
TGLAVAHTLRESYGVNAGVKWPNDVMVGPRKLAGILAEVSGPVIVVGLGL
NVEMTVDELPDPNAMSLSMLNHHADRTQLTASLLQEFSSRLRRWRLAGGA
DAGLATDYRERSTTIGTRVRALLPGDSEIIGVATGIDDAGRLLIDTEGTT
VTVSAADITHLRPAQD
145225317YP_001135995.1 hypothetical protein Mflv_4739 [Mycobacterium gilvum PYR-GCK]MSSTIVAIAVIIASCAVHARARRHAGWTASARGRFLMLLGYPSSAVAAYW
LTTASTGWEWVLGVGWAVAAAACFTAGVAALRCVTVDHAARAVAMETIEP
ATGALRF
145225315YP_001135993.1 cell envelope-related transcriptional attenuator [Mycobacterium gilMPAAHMLRAVSVALAVAIVIGTGVAWGKIRSFEAGINHINPIALGGEGED
GAIDILLVGSDSRTDAHGNPLSDQERAMLRAGDEVSTNTDTIILIRIPNN
GESATAISIPRDSYVEAPGIGKMKINGVYGSVHLEEMKELVEQQGVDPAE
AEPEAQAAGREELIKTVANLTGVTVDHYAEIGLLGFALITDALGGVDVCL
NAPVYEPLSGADFPAGWQKLNGTQALSFVRQRHDLPRGDLDRVARQQAAM
ASMAHEVISSKTLSSPSTLSALESAVQRSVVLSEGWDIMDFVEQLQKLAA
GNVAFATIPILEEAGWSDDGMQSVVRVDPKEVKDWVTSLLNDQDQGKTEE
LAYSNDKTTVEVYNDSDVNGLAAAVAHVLTGKGFTQGNVGNNEGPKVTGS
QVRAAKVDDMGAQAVALDLGGLEVVEDSSVPPDTVRVVLADDYTGPGAGL
DGSDVTLMGADPSTSGVVSDTGAAVPAPSPIITAGSDDPKCVN
145225313YP_001135991.1 glycosyl transferase family protein [Mycobacterium gilvum PYR-GCK]MSDELFVVTVTYSPGPHLERFLATLAHATDRPVTVIIADNGSTDGAPEEA
VERHPNARLFRTGGNLGYGTAVNRAVTEYGLASSTDFFIVANPDVQWGPH
SIDLLCEAAQRWPQAGSLGPLIRDPDGAIYPSARHQPSIIRGGMHAVVAP
VWPSNPWTAAYRQDRAEPSERTVGWLSGSCLLLRTAAFAQIDGFNERYFM
YMEDVDLGDRLETAGWQNVYVPSAEVLHAKGHATGRDPARNLAAHHVSTY
TFLADRYPKWWQAPLRWAFRTALGARASLVVRRSRRKSRQS
145225311YP_001135989.1 hypothetical protein Mflv_4733 [Mycobacterium gilvum PYR-GCK]MGTILIGTEAVAEGLVTPGQLRYGYRRLFPDVYVPKAQPQSLADDAIGAW
LWSGRRGIVTVRAAASLHGARWVNSETPVELIYDCRRRPNGIIARNERID
WDEIVDNGQLSLATVERTAVDLGRHLPLGRAVAHLDALANATGLTAESVY
PLVDRYSGARGMKTLRKALDLMDGGAESPKETWLRLLLMREFPRPQTQIP
LVDEWGMPLIRLDMGWEAAKIAVEYDGAHHQENRSQYVTDERRLRLIQAR
DWLYVKVIKEDKPAEILARVRRAWALRETATTVAKRAS
145225309YP_001135987.1 F420-0--gamma-glutamyl ligase [Mycobacterium gilvum PYR-GCK]MTDHGTSARVEVLPVPGLPEFRPGDDLAAAIADAAPWLRDDDVVVVTSKV
LSKTEGRMVEAPTDPDERDALRRKLIDGEAVRVLARKGRTLITENALGLV
QAAAGVDGSNVDSNELALLPVDPDGSAAELVAALHERLGVRVAVVVTDTM
GRAWRTGQTDVAIGAAGLTVLHAYAGEHDQHGNELIVTEIAVADEIAAAA
DLVKGKLTAVPVAVVRGLAVRDDGSSARNLVRAGEEDLFWLGTDEALALG
RSQAQLLRRSVRQFSPEPVDGALIGAAVGEALTAPAPHHTRPVRFVWVQD
GALRVGLLDEMKERWRADLLADGRDAESVERRVSRGQILYDAPELIIPFM
VPDGAHSYPDERRTAAEHTMFTVAAGAAVQGLLVALAVRGVGSCWIGSTI
FAPELVRAALEVPGDWEPLGAIAIGYGTDPVTPREPVPTDGLLVRR
145225307YP_001135985.1 transcription factor WhiB [Mycobacterium gilvum PYR-GCK]MAFEQADFGDSIRFDSRLLGSVGSAPHIQTGPAPSGTNGRPQLSLVPERI
DSFGDDSGVLDEDQWQERALCAQTDPEAFFPEKGGSTREAKRICLGCEVK
DACLEYALANDERFGIWGGLSERERRRLKRGII
145225305YP_001135983.1 hypothetical protein Mflv_4727 [Mycobacterium gilvum PYR-GCK]MLAPGHGHDRNGWASAAPWLRVSGVMQAIVHANLLLVNVPRRCCRPGCPH
YAVATLTFVYADSTAVVGPLATVSEPHSWDLCVMHAGRITAPRGWELVRH
AGPLPTHPDDDDLVALADAVREGREVPGAGVTAGFSAGLNTGFTDPVSGA
HGGALMAPPARRPETNGRRRGHLRVLPDPAE
145225303YP_001135981.1 hypothetical protein Mflv_4725 [Mycobacterium gilvum PYR-GCK]MTSPASAAEVDLDDGEGLLAADRHGLLRAASMAGAQVRATAAALTEGDLD
AVRSDSPPRTVVWVAGPGTAEAAGMMLAAILGGSVGAPIVVAAEAPPWIG
ALDVVVLAGDDPARPELVTAAATAVRRGARIVVVAPYEGPLRDATAGRSV
SIPPRLPVPDDFALVRYFAAGLAVLHVVLPGFSVDLPAIADALDEEAFRN
SAGRELFTNPAKVLAERMRDHDVVLAGDSAATISLARHACTVMLRVGHQV
VASAGLSDALVAIGTGWGRAGGGEASIFHDEELDGPLPQQGRTVVLTTDA
ERHNVSARLRGFDDVYVVNANDVPDVAAPGGNSEPGSATTPGSARPEQQL
ALLAVRLEMAAVYRRLVRG
145225301YP_001135979.1 hypothetical protein Mflv_4723 [Mycobacterium gilvum PYR-GCK]MGRKHAIVIGASLGGLCAARVLSSAFDDVTVFERDPLPEGPANRPAVPQG
RHVHLLMARGAAEFETLFPGLLDDMVACGVPILENRPDCIHFGAAGHLLG
TTHRLQDEFTAYVPSRPHLEWQIRRRVLALDNVRLIDCGVDEPVYDGHRV
TGVRTADGATVDADFVVDATGRGTRLPTWLSQWGFERPREDTVDVGISYA
THQLRIPDGLIDEKVIVVGASRTQPRGLGMLYYEDGTWGLTTFGVGKVPA
PTDFNEMRELAEELLPAHIGAALYQTHPLGDVALHKYPTSRWRRFDELDR
YPRGILPFGDAVASFNPTFGQGMTMTSLQAGHLQRALQEPEPEATFLAAT
AKSTWPVWTMNAIGDLTMHGADGPAPWWYRPVGALFDQFLGAAESDPVLA
EWFLRRFSLLDSLYMVPSARLIGRTVRHNMTLWARSRRSPGTASSAPAR
145225299YP_001135977.1 alkane 1-monooxygenase [Mycobacterium gilvum PYR-GCK]MTTHDMLDKPDALQWRDKKRYLWLMGLIAPTALFVVLPLVWALNALGWHA
AAQVPLWIGPILLYVLLPTLDRFFGPDGQNPPDEVMERLENDKYYRYCTY
LYIPFQYASVIFGAYLFTASDLGWLGFDGALPWPAKIGLALSVGLLGGVG
INTAHEMGHKKESLERWLAKITLAQTLYGHFYIEHNRGHHVRVATPEDPA
SARFGETFWEFLPRSVFGSLKSAWELEAKRLERAGKPTWHWSNDVLNAWA
MSVVFYGALIAVFGWALVPYILISAIFGFTLLETVNYLEHYGLLRQKLPS
GRYERCAPVHSWNSDHIVTNLFLYHLQRHSDHHANPTRRYQTLRSMEGAP
NLPSGYASMIALTYFPPVWRMVMDHRVVDHYDGDLTRINIHPRVRDKVLA
RYGVRGGVDA
145225297YP_001135975.1 rubredoxin-type Fe(Cys)4 protein [Mycobacterium gilvum PYR-GCK]MSDYKLFVCVQCGFEYDEAKGWPEDGIAPGTRWDDIPEDWSCPDCGAAKT
DFEMVEVARP
145225295YP_001135973.1 S-adenosyl-L-homocysteine hydrolase [Mycobacterium gilvum PYR-GCK]MTALTADVRNGIDYKVADLSLAEFGRKEIRLAEHEMPGLMELRREYHDVQ
PLKGARISGSLHMTVQTAVLIETLTALGAEVRWASCNIFSTQDHAAAAVV
VGPNGTPEEPKGTPVFAWKGETLEEYWWAAEQMLTWPGEPANMILDDGGD
ATMLVLRGAQYEKAGVVPPAEDDDSAEWKVFLELCRKGYEQSKDKWTKIA
ESVQGVTEETTTGVLRLYQFAAAGELAFPAINVNDSVTKSKFDNKYGTRH
SLIDGINRGTDALIGGKKVLICGYGDVGKGCAESLAGQGARVQVTEIDPI
NALQALMDGYDVVTVEQAIGDADIVITSTGNKDIITLDHMKAMKDHSILG
NIGHFDNEIDIAALERSGATRINIKPQVDEWTFGETGKSIILLSEGRLLN
LGNATGHPSFVMSNSFSNQVIAQIELWTKNDEYDNEVYRLAKHLDEKVAK
IHVEALGGTLTRLTKDQAEYIGVDVEGPYKPEHYRY
145225293YP_001135971.1 alpha/beta hydrolase domain-containing protein [Mycobacterium gilvuMASADDSESTGSGSVTTSKTEARVSAKPAPARSDAPDGVGDENSTSDESA
DVSSSPLTRIRGRDGDDTQREPREAVADRDAPEDVEEVVEEVVPDPSPAP
PAAAPMADAPRHRYDAAAQNAVVFTDEPTLFDQVVVGSLYVMRAVSTALG
IDLYGVIGKILENDDPPWFVRAGLDVRRTEYPSSGEKPWDVWEFRPPNPT
GKTVIAVHGGGFIVEPLVTHWLDYAQMARQTGATVLVPMYPLATTPAGTA
VTAVPVMAQFIADQIASRGAHNVSIYADSAGPSLAMAAVRELILTGRPVP
ASLVLLSFAPDASLSNPAICDVRDPIIDVRTLDFYTRENHWSDGLDPQDP
LLSPLFFEDAVFAALPPSTIYVGELEYALPDTLLLHEKWSAAGGVVSTVV
GVGQFHDWALGGLPVNSQAPKVRPAVYRQLGLNDVASGPDTITTGPPTYS
DRLVADILRTLRWLNETTGITILSGLAGASIITDPPPLLMHGLTVTEREF
NGWTVWEIAAPRRSGEYVVALHGGGFESEANILHWSDYAQMARDTAATVL
VPIYPLAPPKNTGTAATLVPPMADYVSQLIAEHGVDNVSLYGDSSGGSYA
VLVVRELLRRCAIEVACVPSQAGPSRMVLISPALHLTLRGPEVDAIDDPI
LPRHAPGEGPRFNGDWSLDDPRVNPIAGDNLSGLPPTTVYIGTQEKLYPG
AIAFRDKVLAQDPAADLTVVIGDGQLHGWALGGIVVNSQAQIWRPNVYRQ
LGLLPTNSARYVTLTVA
145225291YP_001135969.1 hypothetical protein Mflv_4713 [Mycobacterium gilvum PYR-GCK]MLVESRIRSTSLPTLDQLLARIAAANQSFDQGRHTEATVLAGYLRAVLYG
SGGSDALHGMKETLTWVDTAGVPNPKTTACLTAGLTLMRIRSRHHGCGEY
VPKLAMYPPAPIRTHSGEQILSGSRIPFQDWWTNPVIQDVDGTHFSRKQL
VLALAPGEDREARAARRALARSRSLGEVVGGAMPADRLCASPVIASVRQI
GYEVLQSIAEQRDILEAAA
145225289YP_001135967.1 integral membrane sensor signal transduction histidine kinase [MycoMIFGSRRRIHRRSAPLIRGLAALGRALSLAWRRSLQLRVVTLTLGLSLAV
ILVLGFVLTSQITDRILEVKVGAATEEIERARTTVSGIVGGEETRSLDSS
LQLARNTLIDRKADAGAGLAGTFDAVLVVAGDGPRAATAAGPADQVPAAL
RDFVKAGQVSYQYATVHTDGFSGPALIVGSPTSSPVTNLELYLIFPLNSE
DSTIALVRGTMATGGVVLLGLLAAIALLVARQIVLPVRSASRIAERFAEG
HLTERMPVRGEDDMARLAVSFNDMAESLHRQITQLEEFGNLQRRFTSDVS
HELRTPLTTVRMAADLIHDHIHDSPDDLDPALRRSTELMVNELDRFESLL
NDLLEISRHDAGVAELAVEAVDLRSIVQRALDNVGHLAEGADVEMDVEMP
PDDVIAEVDPRRVERILRNLIANAIDHAEHKPVQIRMAADVDTVAVTVRD
FGVGLRPGEEKLVFSRFWRADPSRVRRSGGTGLGLAISIEDARLHQGRLE
AWGEPGKGACFRLTLPLVRGHKVTSSPLPVKPIETAAGAGRRVREPAGES
V
145225287YP_001135965.1 Rieske (2Fe-2S) domain-containing protein [Mycobacterium gilvum PYRMWRWRSPGRQCSSARASASPRSRWRHAREVRTRRDRRRGHLRRRARSWRR
RPTSDVPVGSGTIVGEVVVTQPVAGEFKAFSAVCTHTGCLVNKVADGTID
CPCHGSRFSLDGAVVNGPAEKPLQPVAVRVQGDSIVAD
145225285YP_001135963.1 hypothetical protein Mflv_4707 [Mycobacterium gilvum PYR-GCK]MLDLILPKQCGGCGAVATGWCDACTDDLTVADDQPHLITPRLDPGVPVLS
LGRYAGARRNAIVAVKEHGRTDLRRPLADALRAGLDHLLTWGVLAAPLTL
VPAPTRRTAARRRGGDPVTHIATQAARPPDQSVATVLRFRAFTRDSVGLS
SAARQRNVAGRVVLTRPVAGPVVVVDDVVTTGATVTESVRVLQTAGIDVV
AVLALANA
145225283YP_001135961.1 preprotein translocase subunit SecA [Mycobacterium gilvum PYR-GCK]MLSKLLRIGEGRMVKRLKGVSDYVNTLSDDMEKLSDADLRAKTDEFRRRL
ADGKEDLDDLMPEAFAVAREAAWRVLNQKHFDVQVMGGAALHFGNVAEMK
TGEGKTLTSVLPAYLNALTGKGVHIVTVNEYLAKRDAEQMGRVHRFLGLD
VDVILGTLTPDQRRAAYNADITYGTNWELGFDYLRDNMALRLEDCVQRGH
NFAIVDEVDSILIDEARTPLIISGPADGGSNWYTEFARLAPLMEKDVHYE
VDIKKRVVGINEIGVEFVEDQLGIENLYEAANSPLISYLNNAIKAKELFE
RDKHYIVRNGEVFIVDEFTGRMLVGRRYNEGLHQAIEAKEHVEIKAENQT
VAQITLQNYFRMYNKLAGMTGTAETEAAELHEIYKLGVVPIPTNRPMIRA
DQSDLIYKTEEAKYIAVVDDVVERYEKGQPVLIGTTSVERSEFLSRQFEK
RRIPHNVLNAKFHEQEAGIIAEAGRLGAITVATNMAGRGTDIVLGGNVDY
LLDRRLRQRGLDPIETPDEYEKGWHEELPHIKEQVAEEAKDVIAAGGLYV
LGTERHESRRIDNQLRGRSGRQGDPGESRFYLSLADELMRRFNGATLETL
LTRLNLPDDVPIEAKMVSRAIKSAQTQVEQQNFDIRKEVLKYDEVMNQQR
KVIYAERRRILEGENLRDQAEQMLVDVVTAYVDGATSEGYSEDWDLEKLW
EGLRQLYPVGIDHRDLIDSDAIGEPGELTRAELLEALVNDAKSAYSVREA
EIEQIAGEGAMRQLERNVLLNVLDRKWREHLYEMDYLREGIGLRGLAQQR
PEVEYAREGYDMFIGMLDGMKEESVGFLFNVQVEPVAAPTVAAQAAPSGL
AEFAAAAAQQGSVATKERPTGGLRAKGIDDQSRPLTYTGPSEDGTPEVKR
SENAPAASTGMTRKERREAARQQQKAGRHAKRG
145225281YP_001135959.1 hypothetical protein Mflv_4703 [Mycobacterium gilvum PYR-GCK]MVTRLSASDASFYRLENSSTPMYVGSLQILRRPRSGLSYETLLATVEQRL
PQIPRYRQKVREVTLGLARPVWVDDRDFDITYHIRRSALPSPGSDTQLHD
LVARLGSRPLDKTRPLWEMYLAEGLAKNRVAIYTKSHQALVNGMAALEIG
HVIADRTQKPPEFGEDIWIPGREPSDRQLLLGAVGEWITRPTQQAAAVRS
AVTETVSSTAQIVDLGRRVADVARTVARGTAPSSPLNTTVSRNRRFSVAS
GSLDEFRVVRARYDCDVNDVVLAMVAGALRNWLLSRGEPVRATTTVRAMA
PMSVYPDAEIDSTGPGQAISEVAPFLVDLPVGESNPVVRLSQISHATESH
PTAPSLVDARTIVTLSGFAPPTLHAMGIRVATSFSARQFNLLITNVPGAQ
SQMYIAGTKLLETYSVPPLLHNQTLAIGVTSYNGMLYFGINADRDAMSDV
DMLPSLLREALDELVEAAR
145225279YP_001135957.1 hypothetical protein Mflv_4701 [Mycobacterium gilvum PYR-GCK]MADKAQRKADKPGKKTKKSKLPGDVYEAELFRLQTELVKLQEWVRATGAR
VVVVFEGRDAAGKGGAIKRVTEYLSPRVATIAALPAPTERERGQWYFQRY
IQHLPTSGEIVLFDRSWYNRAGVEKVMGFCTPAEHALFLRQAPIFEQMLI
EDGIILRKYWFSVSGEEQLRRFKSRHSDPVRRWKLSPMDLESVYRWEDYS
RAKDEMMAHTDTPLSPWYVVESDIKKHARLNMIAHLLSTIDYYDVEAPKV
TLPKKVVCSADYQRPPREASTYVDDHVASLMGDRE
145225277YP_001135955.1 ferredoxin [Mycobacterium gilvum PYR-GCK]MAKSTIKNTAKVADTVRPAVAGAKERPLWHALRTVAGRITTPLLPDDYLQ
LANPLWSARELRGRVLEVRRETVDSATLVIKPGWGFSFDYEAGQYIGIGL
LVEGRWRWRSYSLTSPPAERPARSARTITITVKAMPEGFLSTHLVGGVEP
GAIVRLAAPQGNFVMPDPAPASVLFLTAGSGITPVMSMLRTLVRRDAIGA
PGHIVHVHSAPTEADIMFAAELAELARSHEGYRLELRATRTQGRLDVGRL
DDVVPDWRDRQTWACGPEAMLEDAERTWKSAGVGERLHQERFAVSRAPVH
GSGGTVTFARSDRTVTVDAATSLMDAGEDAGVQMPFGCRMGICQSCVVGL
VEGHVRDLRTGIEHEPGSRVQTCVTAASGDCVLDV
145225275YP_001135953.1 2-5-didehydrogluconate reductase [Mycobacterium gilvum PYR-GCK]MTHVPAIELNDGASIPQLGFGVYQISPEDTADVVRQALEVGYRHIDTAQM
YQNEKGVGQGIRNSGIDRGDVFVTSKLNNGFHTPEDARRAFDETLKALEF
DYVDLFLIHWPLPTLYDGDFVSTWKTLEEFTKDGRARSIGVSNFQVAHLQ
RLADETDTVPAVNQIEVHPYFANDEVRAYGTEHGIATEAWSPIAQGKVLD
DPVVTRIAEATGKTPAQVVLRWHIQRGDIVFPKSVTLQRIKDNFALFDFE
LGAEDFDAVSGLDKGEAGRIGPNPDTFDYVPS
145225273YP_001135951.1 3-phosphoshikimate 1-carboxyvinyltransferase [Mycobacterium gilvum MVGVSNWAAPSTATPVHATVTVPGSKSQTNRALVLAALAAREGSSRISGA
LRSRDTDLMIGALETLGLSVAASDSDPADLTVSGTLAPAAEARVDCGLAG
TVLRFVPPIAALSAQTVTFDGDEQARSRPIAPLLDGLRTLGVDIDGDGLP
FAVRGTGTVAGGTVEIDASGSSQFVSGLLLSGAAFTDGLTIVHTGDSVPS
APHIAMTVSMLRDAGVEVDDSAPDRWRVSPGPIGARDWVIEPDLSNSVPF
LAAAVVSGGAVRITGWPTVSIQPADTILKILAGLNGEVRKGSSYLEVQGA
TNYGGIDVDLRDVGELAPSVAAMAALADPGSVSRLRGIAHLRGHETDRLA
ALSTEINGIGGQCEETEDGLVITAREMHGGTWSSYADHRMATAGAIIGLR
VPGIEVEDIGTTAKTLPDFPQLWADMLGGQTDDLQQGPSARETPGR
145225271YP_001135949.1 methyltransferase small [Mycobacterium gilvum PYR-GCK]MTGPLHAGSVVDAIAADMRSANYTTDGVADLLGADAGAAFSRGLWWSALR
ATDWAAADRQRLATLIRLFLLGTDEPRDRVGRAVPTSDVDALIDNGVLEQ
TPDGALRAALDIRPTSDGAADFLVVSDQDAALRAGPVRRDHVLGIGGASV
SLAHAVVRDPVGRALDLGTGCGIQALHLEAHCDEIVATDTNPRALALAAA
TARLNGMSWDLRCGSMFEPVAGERFDLIVSNPPFVVGTGSLDYIYRDSGM
AGDGLCQNLIAQVRDHLRPGGTAQIMANWIVRDPQNWQERVHGWLADTGL
HAWVVQREFADPVSYVSLWTSDAGESPEQAARRGGEWLDWFDAEGIAGVG
MGMITLRAPRDGETRSPDQVVEEITGAGEALTGPEVGAFFARREYLDRTG
DEQLLAAKLSTAPVFLEEQSLPGPDGWQVVGSAVRRPGGPAAVIGVDEVS
RALFAGCRGEVPLGTLIELLAGYHGVDADALADAAMPVVREAIGRGILYE
AG
145225269YP_001135947.1 short chain dehydrogenase [Mycobacterium gilvum PYR-GCK]MSLAGKTMFISGASRGIGLAIAKRAAADGANIALVAKTAEPHPKLPGTVY
TAAEEIEEAGGQALPIVGDVRDGDSVVAAVAQAVEKFGGIDICVNNASAI
NLGSIEDVPLKRFDLMNGIQVRGTYAVSQACIPHMKGRDNPHILTLSPPI
LLESKWLRPTPYMMAKFGMTLCALGIAEELRDARVASNTLWPRTMVATAA
VQNLLGGDESMARSRKPEVYSDAAYAILTKPSSFTGNTLLCEDVLLEAGV
TDLSVYDCVPGSELGVDFWVDSANPPGYTGP
145225267YP_001135945.1 ECF subfamily RNA polymerase sigma-24 factor [Mycobacterium gilvum MVPVMAMKAPSRSVFVLDVIGGAATEGTVFPTMTDTNGLAASPAPADAGE
AREETDAELTARFERDAIPLLDQLYGGALRMTRNPADAEDLLQETMVKAY
SGFRSFREGTNLKAWLYRILTNTYINSYRKKQRQPAEYPTEEITDWQLAA
NAEHTSTGLRSAEVEALELLPDSEIKEALQALPEDFRMAVYYADVEGFPY
KEIAEIMETPIGTVMSRLHRGRRQLRELLAGVARDRGFIRGEQLEAPEEV
TS
145225265YP_001135943.1 putative acetyl-CoA carboxylase biotin carboxyl carrier protein subMAEDVRAEIVASVLEVVVHEGDQIGEGDTLVLLESMKMEIPVLAEVAGTV
SKVSVSVGDVIQAGDLIAVIS
145225263YP_001135941.1 transcription factor WhiB [Mycobacterium gilvum PYR-GCK]MDWRHKAICRDEDPELFFPVGNSGPALAQIADAKLVCNRCPVTAECLSWA
LESGQDAGVWGGMSEDERRALKRRNARTKARTNV
145225261YP_001135939.1 3-dehydroquinate dehydratase [Mycobacterium gilvum PYR-GCK]MTERRLLLLNGPNLNLLGTRQPEVYGSTTLAEIEAKVAEVAKDAGLQVRA
VQSNHEGVLVDAIHAARTECVGIIINPAAYSHTSVAIADALRSVGLPVAE
VHLSNIHAREEFRHHSYVSAVADMVVAGAGPLGYEMAVQYLADRLGP
145225259YP_001135937.1 N-acetyltransferase GCN5 [Mycobacterium gilvum PYR-GCK]MIHELAEFEHAAEECTVTESRLAKALFGPEPAVYGHIVEVDGQAAATALW
FRNYSTWDGVAGIYLEDLFVRPQFRRRGLARKLLATLARECVDNGYSRLS
WAVLDWNVNAIALYDGVGGKPQTEWITYRVSGPGLSELASRDVPGSGS
145225257YP_001135935.1 acid phosphatase [Mycobacterium gilvum PYR-GCK]MALPCACSPARSCDKPRRTAESDSVGLLQHRLILLRHGETEWSKSGKHTS
STELELTEHGRAQARAAADTLKQMELDDPYVVSSPRVRATTTADLAGLTV
DEVSPLVSEWDYGDYEGTTTADIRKAVPNWLVWTHGCPGGETSAQVCARA
DQAIDVALGHMESRDVVFVGHGHFSRAVITRWIEQPVYEGIRFAMPAASI
AVCGFEHGVRQLSALAQTGLPNPAVST
145225255YP_001135933.1 hypothetical protein Mflv_4677 [Mycobacterium gilvum PYR-GCK]MAAVVWWTSDARATRSTPAAEPLPSLKPAVAVPDSLTQLWAARSGETTRP
LVVGGAVVTGDGQAMQGREPATGDVVWSYARDLDLCGVTWVYNYAVAVYP
DARGCGQVSTVDAKTGRRGPARTSYADRHVTLSGDGSTVLSQGETRLEMW
RSDMVRMLSYGALDAPIKPGVPATPLCRFVSAGASSDSVSVLEACESQDL
RLTLLRPSDEEDSPEAKYVQQTGVADGTGARVVAVSDTYTALYVPTPKPR
LDLIDDTGATVDTTIVDGPPSPEATMSKAGDLVTWWTGDALMVFSGNDLR
YKYTVAATGPDAPVGPATIMAGKLLVPVTTGYDVFDPETGTGEKHIPVQR
PPVDGPVVPAVAGTTVLELRGDDLVALG
145225253YP_001135931.1 hypothetical protein Mflv_4675 [Mycobacterium gilvum PYR-GCK]MNSTPSEAAASAPTGELGSLSGHADAPPISLDHAGITELFALLAYGEVAA
FYRLAEEARMAPNLSGRINMAAMAAAEMQHYEVLRDALGRRGVDVVPAMT
RYASALENYHRLTTPSTWLEALVKTYVGDAMAADFYLQIADVMPDEAAEV
VRSVLAETGHSQFVVAEVRAAVTASDRQRHRLALWSRRLLGEAITQAQFV
MADHDELVDLVMAGGGLSQMTEFFDRLQNTHNARMQELGLG
145225251YP_001135929.1 hypothetical protein Mflv_4673 [Mycobacterium gilvum PYR-GCK]MEVKIGVTDSPRELVFASAQTPAEVEKLVADALSGEPGVLGLTDEKGRRF
LVQSTRIAYVEIGAADSRRVGFGVGAVGSEAV
145225249YP_001135927.1 hypothetical protein Mflv_4671 [Mycobacterium gilvum PYR-GCK]MTVLPLADPTPQDGARPRPHAGTPRARTSVARRTFTSLDLCHPVSVTYDP
GRGRVPVLRDEWREPLRAQRDPLAEHPGRVRSNRDEHRRWRKQTWIGRFV
STYGWRAYALPLLVVLTAVVIYQTITGTSAPQAVEDEGPVQGPPTIGVPS
TSIVGAPPKGLTEFDANLPTGILPQGGPFTEAGAGTWHIVPGALPQVGQG
TTKVFTYTVEVEDGVDTTTFGGDEGFARMVSETLANPKSWTHNAQFGFTR
VDAAAGVVPDFRVSLTSPMTIRQGCGYDIQLEASCYNPAFGGQPRVFINE
ARWVRGAVPFQGDIGSYRQYVINHEVGHAIGYQRHEQCTENGALAPIMMQ
QTFSTNNNDAARFDPGTVTPDGLSCRFNPWPYPIA
145225247YP_001135925.1 hypothetical protein Mflv_4669 [Mycobacterium gilvum PYR-GCK]MAVTAERPPEHVLAAFGLSGVQPAPLGSSWEGGWRCGEVVLSMVADHARA
AWSAKVRETLFVDGVRLARPVRSTDGRYVVAGWRADTYVAGTPEPRHDEV
VSAAVRLHEAMAKLERPRFLTQPPIAPWGDVDVFIAADRAAWEERPLHSL
PPGARVGPGAADGQKSIELLNQLATLRRPTKSPSQVVHGDLYGTVLFAGT
AAPGITDITPYWRPPAWAAGVVVVDALSWGEADDALIERWAQLPEWPQML
LRALMFRLAVHALHPRSTAAAFPGLARSASLIRLTL
145225245YP_001135923.1 alpha/beta hydrolase fold protein [Mycobacterium gilvum PYR-GCK]MTEQLCTYRFGPAGPARVLAIHGLTGHGKRWESLFTRHLSDIPAVAPDLV
GHGRSSWDAPWTIEANVAALTALLDAEAEGPVVVVGHSFGGAIALNLAAA
RPDLIAGLVLLDPAVGLDGRWMREIADEMYTSPDYTDREEARQEKIGGSW
GEVAEDELDRELDEHLVASAGGRVGWRISIPAMLCYWSELTRPAVIPRDG
TPTTLVRATRTDPPYAGDELVAALDAGLGPNFTLLEWDCDHMVPLARPTE
TARLIRDLLP
145225243YP_001135921.1 UvrD/REP helicase [Mycobacterium gilvum PYR-GCK]MSTPLYSPAELSRALGLFEPTEEQAAVIAAPPGPLVVIAGAGAGKTETMA
ARVVWLVANGYATPGEVLGLTFTRKAAGQLLRRVRSRLARLAGAGLTIPA
AGADLADDPVTIGTYHAFAGTLLREFGLMLPVEPDTRLLGETELWQLAFR
VVCEHPAALDTDKSPASITAMVLRLAGQLSEHLVDTEQLRDTHVELDRLV
HTLPAGRYQRDRGPSQWLLRMLATQTERTMLVPLIDALHRRMREERVMDF
GMQMASAARLASTHPAVGEQLRQRYRVVLLDEYQDTGHAQRVALSSLFGG
GADDGLALTAVGDPIQSIYGWRGASATNLPRFTTDFPLSDGTPAPTLELR
TSWRNPPEVLHLANAASVDARRRSVEVRSLQPRPNAEPGSVRAALLSDVE
AERDWVADQVAHRWHGGLAASGTAPTAAVLVRRNADAAPMADALSRRGVP
VEVVGLAGLLAVPEVADVVAMLRVAVDPTAGAAAVRVLTGPRWRLGARDL
TALWRRAVTLVDTGPSASDAVSATAEIVAKLEPDADDACLADAVCDPGPA
AAYSPTGYARIVALGRELTALRAHLSSPLPDLVAEIRRTLGIDAEVRAAQ
PISAGWSGTEHLDRFGDVVAEFASRGTPTASGLLAYLDTAEQVENGLAPA
EVTVSSDRVQILTVHAAKGLEWQIVAVPHLVGRVFPSTASPRTWLTDAAD
LPPLLRGDCATVSAHGVPVLDTSDVSDRKGLSDKIAAHKSSLDQRRTDEE
RRLLYVAITRAEHTLLVSGHHWGATESKPRGPSTFLTEIKDVIDASIEEG
RPCGSIAVWADAPADGETNPIRDRVVEAVWPVDPVAGRRGPVDRGAHLVA
EALSGECPEVGSDDDHGWVADVDALLAERDLAAQRAVPSLPAQLSVSAMV
ELGRDPEAVAHRLQRRLPRRPDSHALLGTAFHEWVQRYFQAEKLFDLDDL
PGAVDADRQDRGELDELQTAFAVSPWAARTPIDVEVPFDMMLAGRIVRGR
IDAIFADGDGSFTVVDWKTGEMPTDPEVLAHNALQLAVYRLAWARLHGCP
TSAVRAAFHYVRSGRTVMPDALPEEDDLIALLADRDDEDAA
145225241YP_001135919.1 TrkA domain-containing protein [Mycobacterium gilvum PYR-GCK]MAEGRLRRRLRRFDQSLADMPVHALTDRVQIPTETVSPARRITVRVIYAL
GALFAAVLIVYLDRDGYRDSQENPLSFLDCLYYATVSLSTTGYGDITPIT
PEARLINVLVITPLRVAFLIVLIGTTVETLTTQSRQVYQIQRWRSRLRNH
IIIVGYGTKGRTAAAAMVGDEIAPGDIVVVDEDTSALDRAKSAGLVTVRG
TATDSEVLRLAGAQHAKTIIVAANRDDTAVLVTLTARELAPRAQIIAAVR
ETDNEHLLKQSGADSTVVTSETAGRLLGIAVQTPSVVEMMEDLLTPDRGF
AIAEREVSPKEAGGSPRHQTDIVLGVVRNKKLIRVDDPEVDALELGDRLL
YIRSADEDR
145225239YP_001135917.1 glutaredoxin-like protein [Mycobacterium gilvum PYR-GCK]MSTDVPAVTMYTTSWCGYCVRLKKVLKNEGITFAEVNIEEDPAAAEFVGS
VNGGNHVVPTLKFADGSTLTNPTGAQVKAKLAS
145225237YP_001135915.1 transcription factor WhiB [Mycobacterium gilvum PYR-GCK]MSSPTCEMTPSSETRQPAVPCHVEDPDLWFAEDPRDLERAKALCADCPLQ
RACLNAALERQEPWGVWGGEILDRGSVIARKRPRGRPRKDSKSPVAA
145225235YP_001135913.1 hypothetical protein Mflv_4657 [Mycobacterium gilvum PYR-GCK]MTRCRTMTRYALSPATPVLSRPDGTVQVGWDPRKAVVVRPPAGLPGSVLA
ELLRALQGVATAPQLQRLAAGHGVDAPVVDGLVAHLVTRGVVTEAPRTPV
RSVAVRVHGDGPLADLLISSLRHANVRVSHSTRPNASSGRPDLVVLTDYL
VADPRLVRDLCDARVPHLPVRVRDGTGLVGPLVIPSVTSCLRCADLHRSD
RDAAWPAIAAQLSRTVGNADRATVLATAALALNEIDHIVRSLRPDHPGAV
AASPETLDTTLEFDVAAGTVQARRWTRHPDCSC
145225233YP_001135911.1 PDZ/DHR/GLGF [Mycobacterium gilvum PYR-GCK]MNRRISTLVVALAPILIFGILLSAVTVPYVALGPGPTFDTLGEVDGKEVV
DIEGADVHATSGHLNMTTVSQRDGLTLGQALIFWASGRDQLLPRDLVYPP
DKTREEIDEANSQDFRQSEDSAEYAALHHLKYPMAVTVESIDEEGPSKGK
LQGGDAIDGVNGKPVATLDQFQELLKAYKPGDTIAVDYRRKNAPMGTAEI
TLGKHPDRDQGILGVNVLDAPWAPFTIDFNLANIGGPSAGLMFSLAVVDK
LTTGDVTGGKFVAGSGTISGDGKVGSIGGITHKVTAAQEAGATVFLVPAD
NCAEARTADADGIELLKVETLEQAVDGLRTLSAGGEPPRC
145225231YP_001135909.1 transcriptional regulator [Mycobacterium gilvum PYR-GCK]MRYRLLGPLQVVHGEAAVDIGPRKQRSVLAALLLAQGRVVSTDRLVDVVW
GDDVPASATASLQVYISNLRRALRSGAGDRTVSSVAQPIVRQPPGYFLDA
GPDESDIAVFTAACARAAAAIDGERWDEALAEADTALSLVRGELLEDIGD
ADWIREDAARFAEMRTECLAGKVMSLLALGKIPAALTAASQLGALDPLAD
RGCRLQMLALYRAGRTADALEVYTRYARRLDAELGLEPGPELRDLQTAVL
RQAPELSGWPRSPGWTGAAAVTATEAVPVRLDTVESASHRAPLVGRRREL
AAAADVLDRVTAGAARWLVLSGPPGIGKTRLAEEIAGLVAAGDGDVVWVN
CPDERGTPPWWPMRQLVRALGADADEVLEIPPHADPDTARFLVYERIQRL
LESAPRLLAVVVDDVQWADTTSAACLAYIAGTLRDRPVLVVVTVRDGEHP
AEVSRLLSTVARGEANRLIEVPALSSEDVATLANEVAEEVVTAAEAAELA
DRTGGNPFFVSEYARLPREERAGNEIPRAVRSVLDRRLAALDPAVMQVLR
AAAVIADVLDSVTVPLLARTTALDLDTLADYLDEAADERIIVNSHTGDGY
VFAHGLLREQLLTGMPALRRQRVHAKVADVLADSALPDAPTWRAQHLVAA
QPLVEPTVVVPACRLAAEQATQQWSSDIAAGWWQAALDAYDRLPASERDD
ADRDALTVELLEAHSRAGRGQLVLDSVTRYLGEALRTGRAASAGRVASAL
LRASGGWPWLAPGNDPGELLTLLSRAATLSEGEPASAARVLPALAVGHCY
HPDPTIAPELLDRAERLAEATGDPDVIADVLIGRLITFSGVATLSAQSLE
WVQRLNALRHSRSREDAVIAHSVATMAAMNLGDVDGARRHVQAGIAGSEE
LQLPVLRAQLRWMEAVLAVWHGDFAEAGRHHAIAAHVHEQTELYEAGSGL
LARATLLRERGGPVDPSWTDLNAQQAGGLGMVGVVRTGVLTLLSGPKARA
EALATLRHWAQHTDRAHIWTTLGHHTLLAHLAVDHDLPDFAEPLLAQLDP
YRDRIAVIGQVGMAGPVALATARLHALRGDKAAALADLALARSIAERSAG
VPTLLRCRLLECELTEESPGRSTAASTLAAEAADLGMAAVAEAASRLL
145225229YP_001135907.1 FAD linked oxidase domain-containing protein [Mycobacterium gilvum MTVPTDLRRDEALRSLRDQVATPVALPGEPGYERCRPWNVVAPVEPAAVV
LATSPEDVAGTVRFAAAHGFRVTVQATGHGAVGVGPDTILIQTSAMRHVS
VDVVNGTARVGAGARWQDVLDVATPHGLAPLCGSAPGVGVIGYLTGGGIG
PLVRTYGLSSDHVRSFDVVTGGGRLLRAAPDENADLFWGLRGGKATLGIV
TSAEIDLLPVPEFYGGAVYFAADDVADVLRAWAAWCVDLPETINTSIAIQ
QLPPLPEVPEPLAGRMTVAVRYAAVGDVDEAEQALAPMRAVATPVLDTVG
VLPYAAIGAVHADPVDPMPINEDQALLRELPPEAVEALLAAAGPESGSPQ
AIVELRHLGGALAREATHRSAFCHRNAAFSLAVIGVPAPEIADMVIAHAG
AVTGAVAPWSTGGQMPNFAPSYDPARPSRVYTDDTLHWLAGLADRYDPAR
TLATGQVIRTVV
145225227YP_001135905.1 hypothetical protein Mflv_4649 [Mycobacterium gilvum PYR-GCK]MDNNRTGRPGPQRPHDYFYSVPDHTDTLPDYTMRARETGERIAVTRPLAH
NGRVFWKLTDTDSEELVWLAFTRPDARSALARRKVWTLIPHLQEFLANWF
VSVDHVRTDQRQWVHTNIDVDEARELALLAPQPQAEDIKRITRPEAVLTI
DDIDRLKVTTVLGRGTAQALKARR
145225225YP_001135903.1 putative transposase [Mycobacterium gilvum PYR-GCK]MPKKIDPNVRERCVRQVLDTLSQYPSVTAACEAVARREGVGKESVRRWVV
QAQIDGGQRHGATSEELAEIKELKAKVRRLEEDNE
145225223YP_001135901.1 phage integrase family protein [Mycobacterium gilvum PYR-GCK]MTIQHQLRLQAGTDVAWVLSGPGCGKYALVNEYLRYLADRNYSPRTLRAY
GYDLLAFCRWLGSVDVELSSVTTETVLDFMRHCRQTPIAGRPTNVVSMTG
TRLDRYSSTTINHRLAALTGLFTFRELRDPGLRTPIPSGREARRVSAEER
NGLLGHLVRPKRRSALRLREPRRLPRALNRRETAELLSSLRTWRDRALAG
LMLLSGLRSGELLTLDVTDVDIGARWVKVMGKGAKERRVPLDVEVAGLIQ
TYLLVERPESDSNRLFLVAKGPHRGQPLTAAGLRTIFRYHRIKSGVLAGH
PHALRHTFGTAMAEAGVDLAVMQALLGHAHIDTTARYIHLAPTHVKAEYD
AARTRLRSHT
145225221YP_001135899.1 transposase IS3/IS911 family protein [Mycobacterium gilvum PYR-GCK]MAKKYQKFSPEFREETARLVVDGQKSIAEVAREHGLSDTTVGNWVRKYRE
THATDEPPLELSERARLRELERENREMAMELAFLKKAAAYFAKEPR
145225219YP_001135897.1 hypothetical protein Mflv_4641 [Mycobacterium gilvum PYR-GCK]MATEVAHLRTAVEALAAGVKRHEEQIASSPNHPDDEPFRPTPRVHEPGLA
GQSFDNALAESVNSSYKTELIDHQPPYPGAAELSLATAEWVAFYNRQRPN
GYCQDLTPDREDVPSSVELRWRSGEHQAALT
145225217YP_001135895.1 hypothetical protein Mflv_4639 [Mycobacterium gilvum PYR-GCK]MVGIGRSAKNSYSKGTTMKKSNQIQSVDVSASAVPERVSVAMSEIAENMS
EGLLALAVGAGLQVMAALMEADVTALAGPKGRHDQARTAVRHGRERGSVT
LGGRRVPVTRPRVRAADGTGEFGGRVL
145225215YP_001135893.1 transposase- mutator type [Mycobacterium gilvum PYR-GCK]MVGIGRSAKNSYSKGTTMKKSNQIQSVDVSASAVPERVSVAMSEIAENMS
EGLLALAVGAGLQVMAALMEADVTALAGPKGRHDQARTAVRHGRERGSVT
LGGRRVPVTRPRVRAADGTGELAVASYELFSSTEILGRLAMEKMLAGLST
RRYPVGLEPVGVQITEKATATSKSAVSRRFVAMTETALAELLSRDLSGLD
LVALMIDGVHFAESCCVVALGIDIEGTKHPLALVEGSTENATLVTELLVD
LRERGLDVTRAMLVGLDGSKALRKAVLDVLDHPVIQRCQLHKVRNVKDHL
PQRLRTTVGRRMTDAYHAGSALEAEAALLALAKELDRTHPSAAASLREGL
DETLTVLRLGVPPTLARTLRSTNCIESMISVCREHAGNVKRWRDGQMALR
WCAAGMVEAGKQFRRVNGHLHLPALRAALEREVAEHVVPVVHNDQVSAA
145225213YP_001135891.1 MMPL domain-containing protein [Mycobacterium gilvum PYR-GCK]MPFILSSRTLFGPQSGEQRARQPLLQQLSATAPAVDQAIQSGPGLRPLAN
QAQNAITQLDPLVGALNTSPWCATTPQCAQIRDQVKILVTLRDSGFFTQI
ADLGDRYDPATNATVGGTLANVQNAVASLDKAFGALGDPADLATNLRRLQ
DGIGQLASGAQALATGVRTLADSNIEMLSGMSQIATQLQNSSRAAADSDS
SSGFYLPANAFENRQFTDVAEQFLSPDGKTARFMIESSHDPYSVEAMDLA
SRITDTANTARPNTSLADATVSVAGFPAVNSDIQRFLWADFAQLAIATII
IVGVILVLLLRALLAPLYLLGTVVLNYLASLGIGVVVFQWGLGHEIAWPV
PLLAFIILVAVGADYNMLLVSRLREESGTNIRVGVLRTVANTGAVITSAG
LIFAASMFGLMVGSVAIMIQAGLIIGFGLLLDTFLVRTLTVPAIATLLRE
ASWWPTKATNPRRGDPKQKA
145225211YP_001135889.1 integrase catalytic subunit [Mycobacterium gilvum PYR-GCK]MSQKYAFIAAEHADGATFAGMAPTIVQMLKWLGVSKSGFYEWWGRPASAA
MCRREELKLKIAALFTSFGAVYGYRRIHAELVRAGERVGPELVRTLMREL
NLVALQPKPYKRTTIAGESATAVPDLVARDFTADRPGVKLVGDITYIRTW
AGWLYLATVIDCFNKEVIGYAMADHMRTELATGALEMAARNHALEPGCIM
HTDRGTQYTSTDYAIKIADLDMRASLGRTGICWDNALAESFFAALKNERV
HHMVYPTRKKARADIARYIELFYNRRRLHSALGYRTPHEVRIEYMNSQLA
A
145225209YP_001135887.1 TetR family transcriptional regulator [Mycobacterium gilvum PYR-GCKMGADATKVLRPTVVCQDGHVRTRSKRWGGRTGAERRAERRQRLIDAATEI
WSESGWAAVTMRGVCAKTGLNDRYFYEDFKTRDELLVAAWDGVRNEMLGE
VSATLAERIGQPPMETIRVTIAAVVDRIAEDPGRAKILLAQHVGSSPLQD
RRAVALQEATHLVIAASEPHLRPEADETALRMDTLVAVGGFVELITAWHA
GLLDVIQGEIVEHTSRLAETLAERYLVDDAGL
145225207YP_001135885.1 metal-dependent hydrolase [Mycobacterium gilvum PYR-GCK]MSDDSSTRPTTRVVPKPRRVRFDMPAETSRQHFVDGDLVMSHFVSTLSAT
FPEGEDFFIRSVREYRDHISDADLKEAVKGFIAQEATHRHQHRLLNDRLQ
AMGYPTEGIDRHIKKLVGRLEKRFSPKMRLAVTAALEHYTATFAEIILTS
DEAQELIGYTEVRPILLWHALEECEHKAVAFDVYETVGGSERTRVWGMRI
ASLLLFTELVIQTTRSLAGDRAAYNPVRLLRSLRAFRHNPLFSRAAIERF
RSYTHAGFHPDDWDSAEILERWTKELFDADGGQQLRSNV
145225205YP_001135883.1 carboxymuconolactone decarboxylase [Mycobacterium gilvum PYR-GCK]MLALTDARERAAQCGIPDAMAELSVFRIALHQPPVAVALHGMLEALLWKG
ALDARLRELIIMRIGWVTDSVYEWTQHWRVARLLDVPERDLLGVRDWQNA
GHFGEAERAVLAATDETLRDGTISDETWAECQRALHGDPAVLVELVAAIG
NWRLFSALLRSLHVPLEDGLEGWPPDGVRPSVD
145225203YP_001135881.1 acetyl-CoA acetyltransferase [Mycobacterium gilvum PYR-GCK]MIPRDNPASRIAEATGLTPDHRISCPVGGNTPQYLVEVLGRRIWRGVSDA
ALIVGAESGASARKVASGSALLEPKPIAAQDESLGDTRPGLSEAEVGAGL
HWPHEVYPIFESAIAARSGRTFDEQRRWLGDLMAPFTVEASRHLEQAWFP
RARSADELSTVSPANRMVCEPYPKLLNSIIAVDMAAAFVIMAAEVAEELG
VPSDRWVFPWSSATCNDVYFPVQRPDLGRSAGIRAAGKAVLAASGLHIDD
IRWFDFYSCFPSAVEAAIDALDLDPADDRGFTVTGGLPYHGGPGNNYVSH
SIVEMVRRCRSDPDAVGLVSGLGWYITKHSLGLWSATPPPTGWQTPDMAD
AQSAIDGTSLPVASPADASGEATIDGYTVVHDRDQGPSWVPIFARMTDGR
RVAARSDDAEVAVAMSRDMCVGHQVAVRQADGHVEFELS
145225201YP_001135879.1 thioesterase superfamily protein [Mycobacterium gilvum PYR-GCK]MDFPQFNKQIAEELQHAGGTSGGLAKYLDFRHIEFSAGRLVVEMDARADL
LTPFGTLHGGCLSAMVDHCLGVVFYPVIPPGSWVATTEFKLNLLRPVSSG
VCVAVADIIALGKRSGVARIDITNTGRPVCAAQGTVTVVAQSAS
145225199YP_001135877.1 hypothetical protein Mflv_4621 [Mycobacterium gilvum PYR-GCK]MLDSSEVQDTPGHAVHHLFRDLGDLVRELPESIHGLLIEQVAELAADQQL
KELLSDTVAANVDTWFSVVRHSIPFDRMESPTAALEHARRMAQREVPVNA
LLRAYRLGHQYGLNLIIAGLRSADLPPEEKLALIEHITRVSFRYIDWMSE
QVLETYQTERAEWDERRRSLRAQAIRDILNGRDVDLTEASSAMRYFLGAT
HVALMVWLDRDAGADTDEFIAMERFMQHAVSATGAKQSVYFSIDRLVGCA
WMTVHRPSDYLSQLRDFVRAQPDGPRLSVGEPLPGIEGFRRTYRQAEQAR
VVAVAADGSSRHRIVAARDPGVALASMLMTDDATLKEWIHDVLGPLAQNT
ASDQRLRDTLRVFLRAGSSFKAAANELQIHANTVKYRVNRALERRGRPIA
AERLDVEVALLMCYWLGEVALNPTQALGRS
145225197YP_001135875.1 transposase IS3/IS911 family protein [Mycobacterium gilvum PYR-GCK]MAKKYQKFSPEFREETARLVVDGQKSIAEVAREHGLSDTTVGNWVRKYRE
THATDEPPLELSERARLRELERENREMAMELAFLKKAAAYFAKEPR
145225195YP_001135873.1 TnpC protein [Mycobacterium gilvum PYR-GCK]MFSTHLSAQLGKALPVQVSHRFAASSAVFDDERLVSCAGLVPVMALAEQT
GLSSSLADKVRFSCERVKSGAANPSPKLTTLIAGMCTGADSIDDLDVVRS
GGMKTLFGEVYAPSTIGTLLREFTFGHARQLESVLSEHVGALCERVDLLP
GADGRVFIDIDSLLRPVYGQAKQGASYGHTKIAGKQILRKGLSPLVTTIS
TEHCAPVITGARLRAGKTNSGKGAARMIAQAVATARGAGVTGRILVRGDS
AYGNSSVVTACRRAGARFSLVLTKTAAVVAAIADINDTAWIPVCYPAAIP
TPVPGSPMPKSPKPPAPLSVPRRLRSRHG
145225193YP_001135871.1 acyl-CoA dehydrogenase domain-containing protein [Mycobacterium gilMELHETEERRALRKAVSEIAKDFGHDYYVAKSLGGEKSSELWHAVGEQGF
LGINIAEEYGGGGGGIYDMQIVGEELAAAGCPLLMTVVSPTICGTIIQAF
GSDELKARWLPGIASGEVIMAFAITEPDAGSNSHNISTYAKRVGGDWILN
GTKYYISGVDEAEAILVVTRTATDDRGRGRLSLLVVPTDAPGLTKTLIPV
QAVTPEKQFTLFFDDVRVPAENLIGAENDGLRQVFMGLNPERIMGAALGN
GIGRYALDKASAYARERKVWDVPIGAHQGLSHPLAHAKIQLELARLMTQR
AASLHDADDPGSAEASNMAKYAAAEAGILALDQAIQTHGGNGLATEYGLA
TLWGPARLMRTAPISREMILNYVAQHSLNLPRSY
145225191YP_001135869.1 carboxyl transferase [Mycobacterium gilvum PYR-GCK]MSPGGKLIDVLPDRVDTRAPVYLENREGLIAQLHALAEQLALANGGGGEK
YVARHRSRGKMLARERVELLLDPDTAFLELCPFAAWGTKFPVGGSVVVGI
GIVEGVESMIIAHDPTVRGGASNPYTFRKVFRGMAVARENRLPIINVVES
GGADLPTQAEIFVPGGQLFNDLTQHSALGLPTLALVFGNSTAGGAYIPGM
CDYVVMVRNRSKVFLGGPPLVKMATGEVSDDESLGGADMHARTSGLADYM
AEDEQDAIRIGRRIMARLNWRKLGPGPTQPPTPPLRDPDQLLGIASVDPK
VPFDPRDVIARIVDGSTFDEFKPLYGTSLVTGWASIHGYPVGILANARGI
LFSEEAEKAAQFIQLANQIDTPLVFLQNTTGYMVGAEYEQGGIIKDGAKM
INAVSNSAVPHLTIVMGASYGAGNYGMCGRSYSPRFLFTWPNSRSAVMGP
AQLAGVLSIVARESAADRGLPFDEEADAQMRAAVEGQIERESLALANSGR
LYDDGIIDPRDTRTVLGFCLSVVHNSEIRGQRGYGVFRM
145225189YP_001135867.1 TetR family transcriptional regulator [Mycobacterium gilvum PYR-GCKMRRSCLCQDVFVRTKAARWGGRTGAERRADRRRRLVNAATEIWTESGWAA
VTMRGVCSRAALNDRYFYEEFKTRDELLVAAWDNVRDEMLGEVSATFAER
VGQPPIETIRAAISIVVLRIAQDAGRAQILLTQHVGSSTLQDRRAVALQE
ATQLVMAASKPHLKPDADEMALRMDTFVAVGGFVELISAWHAGLLVDVSQ
VDIVEHTSRLAETLARRYVVDKFG
145225187YP_001135865.1 hypothetical protein Mflv_4609 [Mycobacterium gilvum PYR-GCK]MAFKYSDMLETIKNRQWALADIDWDAPGADKITDEQRPELKQFMADVVWI
EHVGARAFAAMAPKAPFEALGDIYRYFHAEEQRHANAELALMQRWGMLEE
GEIPVPNKNIRLVIEWIDRYAEALPLTVIGAAIPALETALDGALLKFLLD
EVQDPLCAEVFNKVNNDESRHLAVGFQVLNDLGASPMRIHATQTMGALID
PRILLGGVLYVPLLTRMLTNLNAMGLSEEKLYNAVMRYENVGDRSEFTRR
VPGYHILKAHMSASIKRSQPLHFISQRLGTAIDHFPTEVLGKSPTWTEEL
TYEPVAR
145225185YP_001135863.1 cyclohexanone monooxygenase [Mycobacterium gilvum PYR-GCK]MSVHVAGDENAPTSGAPTYEVPTHEILVIGAGFSGIGVGIKLLKEGFSDF
LIVDEAQGVGGTWYWNTYPGIAVDIPSYSYQFSFEKRPSWSRTYAPGIEL
KNYAKHCVKKYGLASRIRFGVTVVRAEFDEESTLWRLFTSTDEELTARFV
INASGVLTRPKSPDIPGVGDFGGVTMHTSRWDHQQTLTGKRVAVIGTGAS
AVQLIPSIAKDVDTLTVFQRTPIWCLPKFDFAVPRPLSALLRLAPGAQIA
ARGASQAFVELTFPVAAHFHTAIPLASAIERAAISYMRRQVTDPVVREKL
TPRYALGCKRPSFHNEYLKTFNRENVLLETNPITRVDETAVITADGVRHE
IDVLVLATGFKVMESDSMPTYSLRGVAGRDQAQWWDENRLQAYEGVSVPG
FPNHFSVFGPYGYNGSSYFALIEAQAGHILRCLRHARTADSNYVEVREEA
NQRFFAEMLARRHTQVFWQDSCAGANSYYFDKHGDVPLRPTTTVESIWRS
RRFDLADYRFERRPAKKADTAPQKVDTAG
145225183YP_001135861.1 FAD dependent oxidoreductase [Mycobacterium gilvum PYR-GCK]MKPVKREPTQDNPPGNPSIVIIGAGFAGITLALRLKRAGFDRVLIVEKGD
GVGGVWRENTYPGAACDVPSQLYSISSAPNPRWGRRYAEQGDILAYLRRV
ADESGLLSLLRTKTEIAKAAFDERTNTWRLTTTTSQELECDVVISAVGQL
SRPSVPDIPGISGFAGPSFHSANWDHDLNLSGKRLAVVGTGASSVQFVPV
VAAGAEHLDVFQRSAPWVLPKFDRQYGGRHHQLLRKLPILRLSERLMIWT
IFEFLALALVDAKPVARVLGVIALRHLGRQVSDARLRSHLTPDYAPGCKR
ILFSSDYYPALARPNVLLVTDDIQAVEPGGIRTVNGDFHAADVIIYGTGF
SATEFLSPMEVYGRSDRKLSDVWADGAHAYYGLSVPEFPNFLMMYGPNTN
VGSGSIVYMLESQARHIVRLMKVLRAHPGSVIEVRADVEKRFNDRLSRRL
DRSVWTMCTSWYRSARGSISTNWPSPTFLYRLRARRPKRRAYVLSRPAPA
NSSRRGTPEPANTHLADMPYAPSGADSVD
145225181YP_001135859.1 short-chain dehydrogenase/reductase SDR [Mycobacterium gilvum PYR-GMVMLEPSTAVVTGAGRGIGLEIARQLAAAGHKVLLTDVDGDAAERAATEV
GGGAWSATHDVRDPSGHREVAAQALAAGPLAVWVNNAGILLAGNSWSHSD
AEIASILDVNVRGVVAGSHAAVVAMGAGGGAILNIASLSALAPIPGLAMY
AATKAAVLSFTTSLQGDLDHAGLPIHARALCPDVVSTKMVTDRVADPGAA
LLFAGPRPMDAAAVARAGLELLESRQIFRVVPRWRGVVARTSDAAPSLGL
KAFALMRGVGERRQRNHR
145225179YP_001135857.1 acyl-CoA dehydrogenase domain-containing protein [Mycobacterium gilMAANRSSWMDDDLDALRDLARTFCEKEVAPHSARFIEQHHVDRDLWTRAG
DLGLLCMSIPEQYGGGGGTFAHEAVLIEEQARIGDSAWGAPLHSGIVAHY
LLEYGTDEQKERFLPRLATGEMVGAIAMTEPGTGSDLQSVTTKASRVGDE
YVVNGSKTFITNGAQADLIIVVAKTDPSAGANGISLVLVEGDRPGFRRGR
VLDKVGQRGQDTSELYFEDVHIPVENLLGTTEGQGFIQLMQQLPQERLIL
ALGAVTVLETALEFTVEYTKDRHAFGKPVFAFQNTKFKLAEVATDAHISR
VFIDDCVARHLRGELDIPTVAMAKWWTTERAMVALDDCLQLHGGYGYMTE
YPIGRMWADARVQKIYGGTNEIMKEIIARSL
145225177YP_001135855.1 TetR family transcriptional regulator [Mycobacterium gilvum PYR-GCKMNKVVVAGRTRVGGERRERILASATELIAERGYHAVSMADIGVASGVVGP
AIYRHFNSKSDLLAALFERVVDKLLKRATAIVEQSRDEAEALTLLVSDQV
ALVMDQRELAMVYYREVHNLSDQHQSRLRRKQRLYLEEWVHLVGELRPAV
DEIELRAMVHGAIGAIQSILHYRGTGLAPEQTSALLVAMGHAVLGVPASS
HQVRGVNTEPSCPRPGTPQH
145225175YP_001135853.1 wyosine base formation [Mycobacterium gilvum PYR-GCK]MAVPMESLITDIGAETAELWSLIAELPEGQAGWDAPTPAAGWAVRDQISH
LAFFDDAAVRSATDPEGFTAEVLPMLADGRISPDTIAERYRPMPTAELLS
WFDGARRALVAAFAAIDPSMRVPWFGLPMSAASSLTARIMETWAHGQDIA
DALGVTRVPSARLRHVAHIGVGARAFSYMANGLEVPEEPVRVELTAPGGT
LWTWGPDGVPNRVTGTAHDFCLLVTQRRHRDDTALHVTGPLADQWLSIAQ
AFAGPPGGGRTAGQFDGGVS
145225173YP_001135851.1 type B carboxylesterase [Mycobacterium gilvum PYR-GCK]MPAKTVRTELTSGAIEGFTRDGVNRWRSIPYAKPPVGALRFKAPQPVEAW
DGVRPCHRFRYCAPQPRRYTIVGPGKFQPMSEDCLTLNVVAPDGGSDRPL
PVMFFIHGGAYFLGSSATPIYDGASLARSGCVYVSANYRLGALGAVDLSS
LSTADIHIDDNLYLRDLVSALRWVRENIAAFGGDPDNVTIFGESAGAHAV
TTLLAVPAAKGLFAQAISQSPAGALSRSQELAAEFAAKFASILCADEREP
ARLLLAARPAQLVNAFDRLLTTSASDLAGGYPVGCTFGTDYLPSEPIQAM
RDGKAYRVPLIVGTNADEGRLFTRFLKLLPTNEAKIEALLAGAEPTCRER
ITAAYPEYPAPDACIRLGADFTFGSTLWQLADSHSRHAPTYLYRYDFAPR
TLQWAGLGATHATELLAVFDAYRTPLGRLLSAGADRRSALRVSDDMQGRW
DAFARTGVPGDGWPRYTSDARPVLVFNRASRVDNDPHADRRKAWEGFQVL
GR
145225171YP_001135849.1 ferredoxin [Mycobacterium gilvum PYR-GCK]MAVVTFVSHDGDKHQVPLDEGQSLMQVATNNAVPGIDGDCGGEAACGTCH
VVVDPQWSDQVGSSGVGEEEMLAMNPERQPTSRLSCQMTASEAWDGLIVH
LPEFQM
145225169YP_001135847.1 FAD-dependent pyridine nucleotide-disulfide oxidoreductase [MycobacMTLHRAVIVGASHAGAQLAASLRQEGWDGEIVLVGNESALPYHRPPLSKA
YLAGKCTVDELAIRNAEFYTKQRIKLMDATVEVLDRSAGHLSLTTGDALP
YDKLALCTGARPRRLSIPGADLPGVCYLRTAADVAMIRERTSPGRRAVIV
GGGYIGLEAAASLRALGLEVTVLEATERVLERVTAPAVSAFFDRIHREEG
VDIQTDALVDAMSGDGRVREVILASGESIPADLVIVGIGVEPNTDLAAAA
GLAIDNGVVIDDQARTTDPDIVAAGDCTSHHMARYGRRIRLESVPGAGEQ
AKVAAATICGKSKKVAALPWFWSDQYDVKLQIAGLNTGYDEVVLSGDPTR
DRDFTCFYLRAGELIAADCINRPRDFVFSKRVITQQVPIERAELMLAGPA
145225167YP_001135845.1 long-chain-fatty-acid--CoA ligase [Mycobacterium gilvum PYR-GCK]MQDVALTVPAIVAHAAAVHGDREVLTARGPQQISGVSYHELGQRAARLAN
ALREIGVRGDERVATLQWSNQEHLDCYAAVPSMGAVLHTLNLRLPPEQLT
WIANHAEDQVIIVDGTVLNLLAGALPSMTSVHTVLVTGTGDLAAVQGCGK
DVLRYDDVVGAQSSTFDWPDVDEQSAAAMCYTSGTTGRPKGVVYSHRSTW
LHSQAACTSNALGIGHDDTVLAIVPMFHANAWGLPYAAMMAGAQLLLPDR
FLQAGPLVEMIEAARPTMAGAVPTIWTDVLHYLRDNPGHDLSSLKMVACG
GSAVPRSLMTAYDELGIRIVQAWGMTETSPLAAVALPRDTDTPERSLYLR
GTQGRVVAGVQARIVDDSGAEQPWDGKSVGEIQIRGPWITQSYYEYDSPA
VSPDGWLCTGDVGTISADAFITLTDRAKDVIKSGGEWISSVELENELAAH
PAVRTATVIGVPDDKWQERPLAVVVLAADCTATAAELTEFLRARVAKWWL
PERWAFVADVPLTSTGKFDKKKLRSQHADGDLAVETLA
145225165YP_001135843.1 hypothetical protein Mflv_4587 [Mycobacterium gilvum PYR-GCK]MAKVQIPYRHRMGGHCGSGALRDLSEWAELGWGTEALSEGLVFALGGALD
FSYVRSAQLFPQVYLVGRGSDLERDYLTRVGANFVVQSTDDPHEGWAFVT
DEIDEGRPVMVWADIGELPYLRVRLQMSRHDIVIVGYDDEQRVAYVVDND
RDTTQLVPYDALRRARSSVGFPTPTRHTTYHVDWPDQMPDLRPIAGAALA
ASAAFMRGDAAGAPLLRVEAADVESSGLNGVHDFAADLRRWPTLFDDDAL
AAALFGLGAFIEKAGTGGGLFRTLQAQGCQSIADQLHDAAAADAAAAAKH
ASEAWSALAAAATNVDAPLRSRSLATADVAAMIPEAEVRLVEALEKASRS
VSAVEIDIESN
145225163YP_001135841.1 thioesterase superfamily protein [Mycobacterium gilvum PYR-GCK]MAWWHDFKSRAVVEDGDDLQQHHPWCLGCGKDNPHGHGLRARRRGNGVIA
RHVFDGRHRGAPGIAHGGAVITVLDDMVGMLLYVVGEMAVTRKLNTEFFA
PVLLHTQYLVSADLVSRTGRRLEVRAELREETTQKLVASADGLFVVVTLV
HFTDAAGKGPPARNGENDDSREAMGNRHP
145225161YP_001135839.1 luciferase family protein [Mycobacterium gilvum PYR-GCK]MSTYGLSVLGADLKSLAQTAQAADAAGFDAVWASEFYSRSGSISMAAMAN
STQNCRIGSSILYGVGRSPLVLATEARDLDELSNRRLVLGIGNGTKRMMS
DWHGVPDTSAPALRMEELVMLLRRIWNLHEGPIHHEGRFYRMNLTPTGDV
GPPSRPIPIVTAGVRPRMCEAAGRVADGLAGHPLFTTTYVEEIVRPAIAR
GAARTGRDPNDVEIISMVMCAIHDDAEVARRELAQQIAFYSSVKSYETVL
DVNGFASEGRTIREAFAKGDFPAMFAAVSEEMIDTMGVAGTAHEVREQLR
RYDGVLDHIMLYSPSVGIAAERVQQNLDSIIGECSPASMSPGQSGPGST
145225159YP_001135837.1 TetR family transcriptional regulator [Mycobacterium gilvum PYR-GCKMTFPQARSHGKTLPSEANSVATEKRAANASRSRASARRRETILDAALTVA
AAGGYEAVQMRTVAERVGIAVGTLYRYFPAKTHLLVAALTREFRRLDSAG
DWASGEGPPLERLERLTAHLHDRWQRDPRLTTAMTRAFAVADTRAAAELD
RAADEIQILLARTLRGGEPTPTDLHVAGVISDIWLANLVAFSGHRATAAD
TRERIDRATRRVVTSAARPTANR
145225157YP_001135835.1 TetR family transcriptional regulator [Mycobacterium gilvum PYR-GCKMSDSQSVPVPDDDVDPRRIRSRTRLLDAAATLLSTGGVEAVTIDAVTKAS
KVARTTLYRHFHSSSHLLAATFERLLPQVTTPAPTSGPLREQLIELLSRQ
AALFNDAPLHVTTLAWLSLGPTGSNNEADDRHTSVALRARVVDQYRQPFD
AILTSPKAQAELDDFDRELALCQLVGPLAFARMTGIRTITHNDCANIVDD
FLTAHRKTDSDAKESKIATKQTGRPARLAR
145225155YP_001135833.1 phosphoglycerate mutase [Mycobacterium gilvum PYR-GCK]MPDPRTCRVRRILIAALSAVLLVLVSAIPSWAMTLTFVRHAESLANEAGI
IDTRVPGPGLSEAGELQARAIAPVLAGMGFDGIYVSSMLRTQLTAQPMLD
LLPGSSYQVLPGLREISAGIFEGSSENEGLGRLGYALAPVTWMLGARFVP
VPGGEDGNAFDARVDGAIAEIADNGDENAVAFAHGATIMFWVMMNVDNPD
LLLMLRHQLDNVESVVVEGSPEEGWTLVSWAGQAVSADPSLATKLLVNVR
DLVVAPQTALYNVGTAFSSGDFETLVNAVRDGLIEVTRAVVRFIPDTVRD
IVDEFRPSVTEDSLDVTELHRAVVTAAPQDDDEAEPQSVAVAEAETRNGS
GVAPAGSTPPSGDEVTGSTDDDEATASDVVLEDTVDVDTIDVDTVEEDTG
ASDHAVGNHPDAEADDAAPANGSAKSSDDDGDSDDDASERAAA
145225153YP_001135831.1 cytochrome c oxidase subunit III [Mycobacterium gilvum PYR-GCK]MTGLGVAEAHETPRKAKGRGHLPGEPSMWFFVIGDLIIFGVYFVVYMYYR
GQDHQLFLESQARLNTDIGAVNTVVLLTSSLFVALGTSALRTGKVADAHR
LFLMALVAGSVFPVLKAFEYVPEVASGLTPGTNLFFMFYYVMTGMHLCHV
LLGLAILYFVVRDLRGPAEPRLSLAATGATYWHMVDLLWIILFALLYLMR
145225151YP_001135829.1 hypothetical protein Mflv_4573 [Mycobacterium gilvum PYR-GCK]MTTTTAAPSAAMNTRGQRILLWTVPPAAALFVLAYFLFPVFSAPLSPTMT
PEQVAAFFADNVTGILGVAILCNLIACSLVPLFAVTAVQISRIGTSSNVF
TYAYMLCVGVGLTAFILADYCWAMAAFRTDRDPQLISLLNDMAWFFFIAP
VGTIVVANLCLAVSIYLDARPEPVFARWVAHFNVATAVLLVPSAFSLLYK
SGPLAWDGAVSFDLRMIVLAVYVAVMFVVLVGVVNRQGAERDETV
145225149YP_001135827.1 diguanylate phosphodiesterase [Mycobacterium gilvum PYR-GCK]MRGLRPTVPGLSGGNIVRDLVGELIASIDPQSLLQRIVEQVCVRMPTASG
ASVALKTPGDFLEVLATYGATGTLKGRVVPIDDTFQVYPLGSGRPEIVDD
TATDARITPQVRELSQQLGVRSCLSIPLISEGSAIGTLSVVAHEPYAFGA
SDVAPVSAVAEFLGVLISASTQLAALLKDLLGAGSIRVDSRAAADLLASV
LLPELSERDELRRVIDDVVMAGEIVPVFQPIFDLITGEVIGFEGLSRFRC
EPTRSPDKWIALAHNVRRGIDVELKALRALLKGALSIPDKYLVSVNLSPL
ALADPIIQQELLSYPRGVVVELTEREPAPELLGESVEPLRQSGIRLAIDD
AGSGFAGLTTILRLRPDIIKLDRELTVGIDTDPSRRALATALTHFAREID
AYTVAEGIETEVQMQLLRDIGIRYGQGYFLGRPQPVDVFEESLFSRA
145225147YP_001135825.1 flavin reductase domain-containing protein [Mycobacterium gilvum PYMTTHPELLVPDPATMRHVLGHFCTGIAVITGHDGVRPLGFACQSVTSVSL
EPPYVSFCPASTSATWPLIRSTGKLAVNVLAREQRELCAQFATSGGDKFR
GVSWSPGHNGSPVLDGTVATIEAEVEYEHGAGDHTIVVAHVTGLRAARDT
EPLLYFRGAYGGLDASAP
145225144YP_001135822.1 Rieske (2Fe-2S) domain-containing protein [Mycobacterium gilvum PYRMGMTVQPPADEVRLIEADAAPTRFARGWHCLGLIRDFGDGTPHQVNAFGQ
KLVVFRAEDGSINVLDSYCRHMGGDLSQGTVKGNEIACPFHDWRWGGDGR
CKQVPYAKRVPRLARTQTWPTLEQDGMLFVWNDPQRKPPPDDVTIPRIEG
ATSDEWTDWHWYTTVVHTNCREIIDNVVDMAHFFYIHGSLPTQFKNIFEG
HTATQFMSSGGRPDLGQAEGGVKLLGTTSLAAYHGPSFMIDDLTYHYEHG
DTKTVLINCHYPIDANSFVLQYGIVVQKSADLPEDLAVQTAVALGDFVKM
GFEQDVQIWRNKARIDNPLLVEEDGPVYQLRRWYEQFYVDVEDVTPDMVD
RFEFEIDTTRPRESWMKEVEDNIAAGRIPKLASGTT
145225142YP_001135820.1 hypothetical protein Mflv_4564 [Mycobacterium gilvum PYR-GCK]MAEYDVIVVGFGAAGAAAAIEAADRGARVLALDRGYGGGATALSGGIIYA
GAGTAEQHAGGHTDSVDNLRAYLTQEVGDAVGEDTLTRFCAESPGLIAWL
KAQGVEFRGGPVSSYKTSYPTDDFYLYYSGNEKAYPYAQHAAPAPRGHRV
LAPGMSSGRVLYERLRDSAKAKGVTVIPLARVHGLITDAGRVVGVRYRVL
DQGHPNAHRHRVLTRATAKLGTWMPGLVNGVVARAERLWAEAAVQTEARA
PSVILAAGGFIFNREWVQAHAPKFTKISPLGTAGDDGNGIALGLDAGGFT
DKMGNVAAWRFLAPLSAFLEGLTVGADGRRITNEDLYGATHSNVMMREFG
GTGWAIYDARTWAKIRGQVRTQTQLFQRLQLIYLFTTGHRKSSTLEGLAR
KNGIDPAGLRRTVDAYNSGIVSGTGDPAHKDPGLCAPMTTGPFYSIDISA
ASSMFYPVPGLTLGGLVVDEKTGEVMHRAGGTVAGLYAVGRTAVGICSNS
YVSGLSLSDCVFSGRRAGAHAAG
145225140YP_001135818.1 alpha/beta hydrolase domain-containing protein [Mycobacterium gilvuMPGPTLDPDAAARVASFGPIPPMHERGLDAVRAGVENTPVPDDMPAMASI
EERCAPGPDGPIPLRIYRPTDATDASVVVYFHGGGMVMGSNRSFEPLARA
LAAGSTATVVSVDYRLAPEHPAPAQFVDCSAVTTWVAENATSLGVDPARL
AVAGDSAGGSLAAAVTLAARDCGGPVICAQVLMYPGLDRDMAAPSMVAMP
DAPLLSRADIDYMHELADDGVGAPHDAYRIPAYAEDLSGLPPAIVVTGEC
DPIRDWGERYAQRLRDARVQTTLTRYPGMYHGFLMRPDGTARGRLAMAEI
GALLRAKFAEPLPF
145225138YP_001135816.1 hypothetical protein Mflv_4560 [Mycobacterium gilvum PYR-GCK]MSNEITLPEVQEFIAGFWYHYDQGHFEELASRIGDEMEYVSRSDSGNCPF
EELLAAELHGGEQTLAWLTQHRNENPYPLRHHATNIFRTGVSGEVTTARF
YLYVNQVTNNVPFDVSSGVVDVGIRRGEGGLVFTSMSVVLDAEDSIPFAE
YRTKNSAAVVSGS
145225136YP_001135814.1 acyl-CoA dehydrogenase domain-containing protein [Mycobacterium gilMRRVHYTDDHLAFGELARDFAAKAVAPHYEAWEDAGIIPRDVFTEAGALG
LLGFAAPEQYGGVGTADFRYNQILVERFMDAGCGGVGLSFAVHNDICLPY
LADLTTPEQKKRWLPGFVSGRLIAAIGMTEPGAGSDLSGIRTSAVDKGDH
FLVNGAKTFITNGQNADLVITAVRTSPDRHRGLTLLVMERGLDGFERGRN
LDKLGLHCQDTSELTFTDVKVPKENVLGEVGDGFAHMMRNLAQERMQIAV
GSLGRIRAALDWTVTYVRERTAFGKPIGALQNTRFSLADVATQLAVTQAF
IDNCVIELNEGRLTAADAAMAKLWASETEFRCLDACQQLFGGYGYMREYP
IARAAIDARITRVYGGTSEIMREIIGRDLRLDRSPSAKEATHA
145225134YP_001135812.1 short-chain dehydrogenase/reductase SDR [Mycobacterium gilvum PYR-GMTGLLTGRTALVTGSSRGIGRAIAQRLAAEGATVAVTARAHQPSESVRAG
VSAALPGTIDETIALIEQSGGTAFGLAADLENSEDRAALVDRVVERTGRV
DILVNNAGFADYSVVADMSMATFERTVEHYVRTPFVLTQAAVPHMKTQGQ
GWIVNIGSVTGLAPARPYREYNKTSGDVIYASMKAALHRFTQGVAAELLD
ADIAVNAVGPSSAVRTPGAAALIPDSFPTEPVEYLAETVLAMCHRPAAER
TGLVAFSLHYPWSQKLPVHSLDGATVLPPLEPPATANPNILPAGL
145225132YP_001135810.1 hypothetical protein Mflv_4554 [Mycobacterium gilvum PYR-GCK]MASSRWPGTDREAGSSGAYPHDMAEVFVVDRVITRPGCARKFVDRYLAEY
APGALTRGMVLRDILVSPPIWFEDQPNIVTATWVLSGPQAWWEMTWKGRP
DPTLGPWWDSVGEFISERQRSVAAAAAHVDGLCDV
145225130YP_001135808.1 alpha/beta hydrolase domain-containing protein [Mycobacterium gilvuMRLDPQIAALIDALDGGFPAVHTMTGAQARATIRSRFTPAAEPEPVHSVH
DMAVPVDDGEVPVRVYRPAGPAPLPALVFAHGGGFVFCDLDSHDGLCRNL
SNRLGAVVISVGYRLAPEHRWPTAAEDMYAVTRWVSGDADALGVDPARIA
VGGDSAGGNLAAVTALMARDRGGPALRAQLLLYPVIAADFDTESYRLFGH
GFYNPEPALRWYWDQYVPALSDRQHPYASPLHGELTGLPPAVMVMTGHDP
LRDEAVAYAQALTDAGVPVVRCEFDGAVHGFMTMPMLDIAHEARRRSCQE
LTALLHG
145225128YP_001135806.1 hypothetical protein Mflv_4550 [Mycobacterium gilvum PYR-GCK]MSVAPIPASSVSSWDDEADVVIAGYGIAGAAAAVEASRAGADALVLEHTG
SWGGAAAMAGGFIYLGGGTATQKACGFDDSAVNMAAFLNTALGPGADERR
IADYCENSVAHYDWLVGCGVVFKPEFFDEPGWEPMGDQGLMYSGGENSYP
FNTIATPVPRGHVPQMQNKKQGEASAGFMLMKPLVETATAAGARARYDVR
VQALVVDDGRVVGIRARQYGTDVFIRARRGVVLAMGSFAYNDAMVAQYAP
RIAGRPAASVEQHDGQAIRMAQALGADLAHMDATEVAIFIDPQQLVRGIL
VNERGQRYVAEDTYPGRIGQLTLYHQNNTAYLIIDGDAQDEAMASLSPRL
MMRPATWVADSVADLESEIGLPPGSLQSTVTAYNDAAVRGEDPLLGKKTQ
WVRPIGAPLGAIDLRESTGGFTLGGLHTTLDAEVLHVDGHPIPGLYAAGR
CAAGLAAWGYASGISLGDGSFYGRRAGRTATH
145225126YP_001135804.1 acyl-CoA dehydrogenase type 2 [Mycobacterium gilvum PYR-GCK]MSERVLDRLNELAGQFKEQAVEAEKLGKLPDATVKSMKSIGSIRLLQPKK
HGGLEVHPREFAETVMATAALDPAAGWVNGVVGVHPYQLAYADPKVGEEI
WADDIDTWVASPYAPQGVAVPTDGGYIFTGRWQFSSGTDACDWIILGAMV
GDAKGVPLMPPQMLHMILPRKDYQIVDDSWDVVGLRGTGSKDVIVDGAFV
PTYRTMDGMKVMDGSAQIEAGMTEPLYKMPWSTMFPLGISSATIGICEGA
LAAHLDYQRERVGANGTAIKDDPYVMYAIGDAAAEIEASRNTLLSNVDRV
YDIVDSGREVTFETRAAVRRSQIKAVWRAVAAVDQIFARSGGNALRMDKP
LQRYWRDAHAGVAHAIHVPGTVYHASALSSLGVDPQGPLRAMI
145225124YP_001135802.1 FAD dependent oxidoreductase [Mycobacterium gilvum PYR-GCK]MGAGFAGLYALHKLRSQGLVVRVFEAAPEVGGTWYFNRYPGARCDVESVD
YSYSFSEELEQEWTWTEKYATQGEILRYINWVADKLDLRPGITFDTRVVS
ATLDEKTLRWTVVTDAGETVTARFVIMATGPLSAALTPAFPGLDTFAGEV
YHTAHWPHEPVDFSGKRVAVIGTGSSGIQSIPLIAEQAEQLYVFQRTPNY
SVPAGNRPLTDTDVAEVKSNYAERRAMSWRSGGGSPHIAHPKLTMEATPE
ERRAAFERRWELGGVLFSKTFSDQMIDPVANEEARRFYEEKVRAVIDDPE
VADLLIPDDHPIGTKRICTDTNYFQTFNRPNVRLLSVRKTPIESIDATGI
TTSDAHYDIDALVLATGFDAMTGALAKIDIVGRGGQSLREDWAEGPRTYL
GLGVDGFPNLFLVSGPGAPAVLANMVLHAEAHVNWIADAITHLDSHGHTA
LEATAESVDNWIAECNRRAEATLFPRANSWYMGANVPGKPRVFMLFIGGF
GVYLDICAEVAAAGYKGFQILDAS
145225122YP_001135800.1 luciferase family protein [Mycobacterium gilvum PYR-GCK]MRIGLSTPVVVQTPAAASPWEAGAGIGDIARIAETADDLGFDYLTCSEHV
AVPVGDAAVRGATYWDPLATLGFLAARTARIRLATSVLVLGYHHPLEIAK
RYGTLDRVSGGRLILGVGVGSLQPEFDLLGAPWEERGARADDAIRALRSS
LSVAEPSYDGDFYTFGGMVVEPHAEQPRVPIWVGGRSRRSLRRAVGLADG
WMPFGLRTMQIADMLATVDIPDGFDIVLPAGPLDPREPSGCLTRLRALRD
VGATAVTCSVAADSTDHYCAQLASLRGIVDEL
145225120YP_001135798.1 hypothetical protein Mflv_4542 [Mycobacterium gilvum PYR-GCK]MKLRTAAAVLVSAGTVMSAPPAHAEPFFANYSLNIQGRYDFHTWTWAVTY
CTPAATDCARIKAIPMPTAKAFEYSGDARLADGRYTLAVDVPDGLRCGNV
YYGPVIPTHDVYEWDAATLQGTMTSSFAHGCDGAPGGAFTYPFTLVRL
145225118YP_001135796.1 hypothetical protein Mflv_4540 [Mycobacterium gilvum PYR-GCK]MVNKAADRWSTGLPGLRSGMSTPMQGIGGLLSMSADAVKFLFRRPFQTSE
FLLQSWFVARVSLAPTLLVAIPFTVLVSFTLNILLSELGAADLSGAGAAF
GAVTQVGPMVTVLIVAGAGATAMCADLGSRTIREEIDALEVLGINPVQRL
VTPRMLASGLVALLLNSLVVIIGIVGGYVFSIFVQGVNPGAFAAGITLLT
GVPEVIISCVKAALFGLIAGLVACYRGLSISTGGAKAVGNAVNETVVYAF
MALFVVNVVVTAIGIQMTSG
145225116YP_001135794.1 virulence factor Mce family protein [Mycobacterium gilvum PYR-GCK]MTTRPGRPLIGLATVLALAAVIAVAVGLFRGSFTSTVPVTVLSQRAGLVM
DADAKVKWHGAQVGSVESIESLPDGRASIQLAMDPSYMGIIPSDVRVDIA
SSTVFGSKYVELVPPAEPSTQALRAGQVLTADHVTVEINTVFEQLSHVLG
KIEPAKLNQTLGALGTALDGRGDQIGQTMVDFDAFLAQIEPSLPALEREL
ALAPTVVGTYAEVAPQLVDTLDAATTISDTLVAEQGNLDSLLVSVIGLSD
IGNEVVGGNRQAITDVMELLIPTTDLLNQYHQALNCGIGGAVQLAKAPGT
PVPGGLLLQTVVLGQERYRYPQNLPKVAAKGGPQCTDLPRVPFEKHPPFV
ITDVNANPAQYGNQGIILNSDGLKQMLFGPIDGPPRNGGQIGHPG
145225114YP_001135792.1 virulence factor Mce family protein [Mycobacterium gilvum PYR-GCK]MQKYRGASLVRAGFLGAVLIALVIVVGLQPQQLWAMATSVRYQAVFAEAG
GLAAGNEVKVSGVTVGSVSDVALDRGSALVTFSVDSAVRVGDATTATVGI
STVLGERVLVLKPDGSRSLGSMGVIPLTRTGSPYSLTDAVGEFTTNTEGT
DTAAINQSLDTLSETIERVAPQLGPTFDGVSRLSKSLNSRNESLGALLDA
AADVTGVLSERSAQVNTLLLNANDLLAVLQDRRYAIVNLLASTTAVAQEL
SGMVEDNEQELAPTLEKLNTVSEMLERNRDNISASLKGLAKYQVTQGEAV
NNGFFYNGFASNLLPGPAIQPFLDYALGFRRGVNAGQPPDNAGPRAEFPW
PYNGIPGGSR
145225112YP_001135790.1 virulence factor Mce family protein [Mycobacterium gilvum PYR-GCK]MTRPTVRRTRRWAAAACCVALTATGCSFDGLNSLPLPGTVGTGSDAVTYR
VQLANVGSLESNSPVMLDDVVVGAVGKMTFEDWHAAVDISVRPDVVVPAN
AVATVGQTSLLGSMHVALDPPVGETPTGRLAPGANLPLNRTSTYPSTEQT
LSSLSVVVNGGGLTQIGDIISNFSAALDGRQGQIRSLLTRMNDVVGILDD
QRDNINATISALYRLSETFAGQREVLSAALKRIPEALAVLNQQRPRIVTA
MRKLGDFSDTATQLIDESQEDIVGNLRNLEPAVRALADVGPDLATALSYL
PTYPYTQEFIDRGIRGDYMNQFIVFDFTIPRLKSGILLGTRWGEPGASMV
PAPGDPWYSMYTRDPLQAPITPIPAEVATIPPLVDLPPAPAGEPAGGGS
145225110YP_001135788.1 hypothetical protein Mflv_4532 [Mycobacterium gilvum PYR-GCK]MIRVPSAAGAVAAVVICGAAWGAPPAAADNPEWGLNGTYIATSNGEWARK
NEVFYDQASLRSTWTVSTQCSYPGECTGTVDSEWGWSAPIYQKSGVWYVK
HTVENWIPCPDGTSAPGLQVFRFKAMNAEGAMADPTATTLVGEDVTTGVS
GACGVSRSVYINMPFKLVKVG
145225108YP_001135786.1 hypothetical protein Mflv_4530 [Mycobacterium gilvum PYR-GCK]MTGRAPAVASAMLLAAVLSAPAAAADPPAPRLVTYTVTADRHVSADIYYR
DTDPPTWADYSHNPYQFSPRARVDVGPGQPWVRSLVLADPQRWAMVSATS
GPLPVESGFRCELAVDGEVVATGDGPRGALCSLRHW
145225106YP_001135784.1 hypothetical protein Mflv_4528 [Mycobacterium gilvum PYR-GCK]MRIGGAVASRWRIVAVSLLLIASGALLATLYVTQYRIDSQTDGAAAEAAV
EAASSATATLLSYTPETIDADMAAARSVMTGEFATYYGGFTSEVVAPAAR
DRGVKAQAHVIDSALMDIQPDQAKVLVFLKQETASRERPEAAVTASSVAV
TVTKVDGTWLISAFDPV
145225104YP_001135782.1 hypothetical protein Mflv_4526 [Mycobacterium gilvum PYR-GCK]MTVLPAVENWWRTDESGDTYLIGGKCTGCGTYVFPPRENNCPNPGCASDE
LALVPLSRRGTLWSYTENRYAPPPPYPSPDPFEPFAVAAVELAAEGLIVL
GKVVEGTLAADLHVGMEMELTTMTLYVDDDGVTRTTHAWRIAK
145225102YP_001135780.1 major facilitator transporter [Mycobacterium gilvum PYR-GCK]MTTATPSDPATLRRVALSSLLGTAIEYYDFLVYGTMSALVFGRVFFPDSD
PAVATIAAFGTLAAGYVARPVGGILFGHFGDRLGRKRMLVLTMGLMGAAS
FAIGLLPTFAAVGVTAPLLLVALRVIQGIAIGGEWGGATLMVTEHAEPHR
RGFWNGVMQMGSPIGSLLSVTVVTAITLLPDEAFVSWGWRVPFLLSVVLL
AIGVYVRVSITESPVFEQAKPKVVESRRIPLIEVLRRPRNLVLACAVGIG
PFALTALISTHMISYATSIGYHRTDVMTSLVFTSLSALIAIPVFSALSDR
VGRRPVMLVGGVAIICYAWPFYWLVDMRAMAWLVVAMMVAQIVQSLMYAP
LGALYSEMFGTTVRYTGASMGYQLAALVGAGFTPMIASSLLVDEVTSVPL
VVLAMGCGAVTVLAVWRIRETQGVDLAGIDSGRNAVRTP
145225100YP_001135778.1 extracellular solute-binding protein [Mycobacterium gilvum PYR-GCK]MVNARRRALLTVILMVAGMVTASGLAGPAAAQPSAVTVAVAPVTPFVINN
DGIWSGFTVELWQAIASRERWTTDWLAVDTLDQQLAAVAEGRADVAAGAI
SVTADRRQQFDFSQPILDAGMQIIVPDHDPQPSSPGLREFLRLVFSGTMV
TWLAAALAITILPAHLLWLIERRHADPAVSKSYFPGIVEAFGWGLGTLAA
SDAASPRHWVGRAMGIGWAFIGIIFVAFYTANLTAALTVEKLDAQINGPN
DLYGKSVCTEAKTTSAAYLTRIDVKPVLVPVIEQCYDGLRDDTYEAVVFD
APVLRYYVTHDGNGIAGMTGPVFHDEDYGLAMPVGSPLRARIDQALLELR
EDGTYDLIEEKWFGDDQDTEAGSGR
145225098YP_001135776.1 anti-sigma-factor antagonist [Mycobacterium gilvum PYR-GCK]MPTFLTFDTVRAADGREVRLIAAGEIDLSNVDDLKSALSAAIGETAAAGA
VLVVDFAAVEYVDSAAINVLSADSEMIHKIVVHPFLLTTFRVSGLTELVT
VEAAAI
145225096YP_001135774.1 hypothetical protein Mflv_4518 [Mycobacterium gilvum PYR-GCK]MRKTGVVCGTVFASAALALSSSSLGQAANTALVIGGISTPSMADALMSPL
LGGKFKDQQRVSVKWPAQAGPMTGKGDLTLGASIAQGATNLNAQIDAALA
QLKSGEKVTVVGLSAGSLVVNEILRELDESADAPGKDKITFVVVADSSRQ
KVISRTRYNANLDYTYQTAPETKYDIIVVTGEYDGMADFPDRLNLLAIVN
AVAGGIFVHIPVMYADLSKVPARNISVEMNSEGGTTTHYLVPAEKLPLVR
LFPSLANREAELKAKIDAAYSRNDVVAVSAPKAAVFAAAPAPAAPTAVVQ
TPSAAQVPGSVAASLRTAKADAAVEDAVVSEDAAVEDAVVSEEAAVSEEV
DVKGADSADADIEETDTADQADIDSGAEKEAAQEDSDAGAQSGDDADKDG
SVSSDSGASTDRSPSKPSATSDS
145225094YP_001135772.1 amine oxidase [Mycobacterium gilvum PYR-GCK]MWLAELGYRVTLLESNGSLGGRTIGLTSGHGDAIENGQHVFAGSYENIFR
YLDSIGTRHLLEFPDQFGVRYPGGHAEKFGLRLANLRRMMLGRVRGLGLP
TLLRASPAWARLMRDVIRFDDSLDDITVDEWFDRVGFPPEVRRVVLNSMV
IGLLNEQPHLASAHAFAALLRTGADRVRSFGGSAVRIGYPTVDLDTLYLD
GARRVMAERGVDVRLRTRAVTVTTDAGRATGVTLSDGATVAADAVVLAVP
SWNLRSLLDDVPSSEDARLSAKKLEPIPIMNAYVLLDRPLGTVAPWESLL
DSDIGWVFDRDRMHGPRDDGNHLYALTTCAAYDLMPLKNSEVADRLVRAL
RDSYPAAADAEVLDVTVVPWPRATFSSRVGMSTIRPQNRTALPNLALAGD
WTHNDWPTTMEGAAQSASHAVDLVHAELGGSG
145225092YP_001135770.1 acyl-CoA dehydrogenase domain-containing protein [Mycobacterium gilMSTTTAPATKAVYAPLELFDTARLLEQDEREIAATVRKFVDSELKPNVED
WFESATLPKELGKRFGELGLLGMHLQGYGCAGTNAVSYGLACMELEAGDS
GFRSFVSVQGSLSMFSIHRYGSEEQKNEWLPRLASGDAIGCFGLTEPDFG
SNPAGMRTRGKRDGSGENADWILNGTKMWITNGNLADVATVWAQTDEGIR
GFLVPTDTPGFTANAIHRKLSLRASITSELVLDNVRLPASAQLPEAVGLS
APLSCLNEARFGIVFGALGAARDSLETTIAYTQTREVFDRPLAGYQLTQE
KLANMTVELGKGMLLAIHLGRIKDAEGVRPEQVSLGKLNNVREAIAIARE
CRTLLGGSGITLEYSPLRHANNLESVLTYEGTSEMHLLSIGKALTGHAAF
RA
145225090YP_001135768.1 isochorismatase hydrolase [Mycobacterium gilvum PYR-GCK]MDISSAMSETALLVIDMFNTYDHPDAEPLADNVAAIVDPLTELIRRSNER
DDVAVVYVNDNYGDFAAEPSDIVEAAVNGARPELVRPLVPGPEARFLTKV
RHSAFYATSLDYLLTRLDTRRIILTGQVTEQCVLYTALDGYVRHYDVVVP
PDTVAHIDDKLGTAALEMMERNMKAELPESTASLP
145225088YP_001135766.1 hypothetical protein Mflv_4509 [Mycobacterium gilvum PYR-GCK]MEVLRSVVVLLHIVGFAVIFGAWAAEAAARRFRTTRLMDYGVLVSLLTGL
ALAAPWPAGIELNYPKIGIKLVILVVLGGVLGMSNARQRKTGQDVARPLF
YSVGALAFTAAAIAVLW
145225086YP_001135764.1 alpha/beta hydrolase fold protein [Mycobacterium gilvum PYR-GCK]MTETLGAPEPFLTDGHGGIVIAADRRGEPTARAVVFLHGGGQTRRSWDRA
AAAVAQRGWQSVTVDMRGHGESDWSPDGDYRVASFAADVREILAQLPPRP
VLVGASLGGITAMLLAGELARGIASAVVLVDIVPDMDPTGAERIHAFMAD
KMVDGFASLDEVADMIAEYNPHRPKPTDLDGLRKNLRHKGGRWYWHWDPR
FIDGTAPHPPMEVTDTDRLHAAVGRIVDDGVPVLLVRGQVSDLVSRDRAA
AFLSRFPQIDFVDVDGAGHMVAGDRNDLFADAVLSFLTRREVAKP
145225084YP_001135762.1 short-chain dehydrogenase/reductase SDR [Mycobacterium gilvum PYR-GMTGRLAGKVALISGAARGMGASHARVMAGHGAKVVCGDILDSDGEAVAAE
LGDAARYVHLDVTSPDDWDRAVAAAVADFGGLDVLVNNAGILNIGTVEDY
ELSEWHRILDVNLTGVFLGIRAATPTMKAAGRGSIINIASIEGMAGTVGC
HGYTATKFAVRGLTKSTALELGPFGIRVNSVHPGLVKTPMADWVPEDIFQ
SALGRIAQPHEVSNLVVYLASDESSYSTGAEFVVDGGTLAGLAHKDFSAV
DVDQQPEWIT
145225082YP_001135760.1 alcohol dehydrogenase [Mycobacterium gilvum PYR-GCK]MRAIQIAELSGPGAARLVEIDEPAADDGTVLVEVHAAGVAFPDALQSRGL
YQYKPEMPYTPGAEVAGVVRSAPAGAHVKAGDRVAGLTMLCGAMAEVVAL
QPERVFALPDSVSFEAGAGILFNDLTVQFALRTRGRLAAGETVLVHGAAG
GIGTSTLRLAPAFGASRTIAVVSTEEKADVARAAGATDVVLADGFKDAVK
ELTGGRGVDIVVDPVGGDRFTDSLRSLAPGGRLLVVGFTGGDIPTVKVNR
LLLNNVDAVGVGWGAWTMTHPGYLQEQWAELEPLLASGTVPAPEPVVYPL
ERAAEAIASLEDRSARGKVVVAVR
145225080YP_001135758.1 amine oxidase [Mycobacterium gilvum PYR-GCK]MAEVVVVGAGFAGLAAARELSRLGRDVVVVEGRDRVGGRSYTGSVGGVPV
DFGATFVGPTQDAVLALAAELGVESVPTYGEGKNLIRWRGRVRSYRSTIP
RLSILELLDVSRIQWRFDRISKRVPVDQPWASPLAGQLDDISLDAWLRSV
HAGASTRDLMAIMARVTWGAEPGDVSMLHAVRYVNAAGGLNRMLDVEGGA
QQDRFPAGTQKIADLMAAELGDRVVVGAPVRRITRNPDRTVTVTTAGAEY
QAGAVIVAVPPEHRSGIEFDPPLPAEHRELSRHWPQGRLSKAYAAYETPF
WRADGHSGESLSDEGPVFITFDCSPGDDGPGVLLGFTDPRSFDPLPGEQR
REIALAGFSALFGAAAAHPIDYVDHCWGAEPFSPGGPTAAVPPGAWTAHG
RWLRAPVDGIFWAGTETADSWTGFLDGAVRSGLRAADEAHRELARA
145225078YP_001135756.1 FAD dependent oxidoreductase [Mycobacterium gilvum PYR-GCK]MDQLYPETESTDVLIVGAGISGIGAAYRIQERNPQLTYTVLERRSRIGGT
WDLHRYPGIRSDSDIFTLSFPWEPWDRPENVADGEDIRQYLVDAARKHGI
DRHIHFDTRVLSADWDSTADVWTVRTECNGVPRTYRTRFLFFGTGYYDYD
NPYRPEFPGLESFEGPVVHPQHWPEDLDCTGKKVAVIGSGATAISMIPAL
AESAERVTMVQRSPTYLLSGQRINPVVNLLRKVPPRKLGYRLAWLYNVLF
IVAVYGVARKAPRISRRLIRAVAKHYLPEGYPVDTHFKPRYDPWDQRLCL
ILSGDFYDAIARGRAEVVTDEIDHIDAHGLVLKSGRRIDADVLVTATGLQ
LQALGGIEISIDGTEVKPADRFVYKEHLLEDVPNLAWCVGYINASWTLRA
DLTARAVAKLLAHMDSHGYTHAYPHLGGVPMEEKPAWNINAGYVHRAPHV
LPKSGTHRPWNVRHNYVLDAVDQRFDRIDESMVFGRVSPKLHSSSEMSSE
DLLERNFGA
145225076YP_001135754.1 aminoglycoside phosphotransferase [Mycobacterium gilvum PYR-GCK]MTSEPAVDNVDRLQRSSRDLSDVPAALSRWLSTKLPGVTPDAPVDITVED
GIDANGMSSETILLRGRWSDGGDPVEHRWVARVAPTDADIPVFEHYRLDH
QHEVMRLVAESTDVAVPAVRWLEDTGDVLGRPFFLMDRVDGVVPPDVMPY
TFGDNWLYDASPEQQRALQDRTVEVLAALHSIPDAQRTFGFLQEIDPPGE
TALHRHFGWLTRWYAFSSADLGSSPLVERAISWLEEHFPHDVAASEPVLV
WGDSRIGNVIYRDFRPVAVLDWEMATIGPREFDLAWISFAHMVFQELTKL
AGLPGMPDFLREDDVRDTYRKLTGVEVGDLHWFHVYSAVVWCCVFMRTGT
RRVHFGEIERPDDIESLFYHASLLKRLIGEAD
145225074YP_001135752.1 enoyl-CoA hydratase [Mycobacterium gilvum PYR-GCK]MTEDLVLTADHDGVRVITLNRPAARNALSRDLIRATYTALTSADDDDAVR
AVVLTGADPAFCAGVDLKEAARDGLSYFAEFRTQSCIAAVAAMRTPVVGA
INGATFTGGLEMALGCDFMIASERAVFADTHARVGILPGGGMTARLPQLV
GAAMARRLSMTGEVVDAARAERIGLVTEVVAHQHLLQRAIDLAHQIAEVP
RPTMRGLKEIYTAGASAVVDPALAAEERIAFAQHRDLEGLGDRFSAVSQR
NRDQIGGA
145225072YP_001135750.1 NADH dehydrogenase subunit M [Mycobacterium gilvum PYR-GCK]MVGAVAVLLLPAAARHLAKWTALVVSLVVLAVTGVIAVGFDPAGDQFQFV
ENYRWIPSFGTGYILGIDGIALALVVLTAVLLPLLIIAGWNDAGDRLSWG
GRSTHIYFALTLAVEGMVLISLVSLDILLFYVFFEAMLIPMYFLIGGFGG
EHRGRAAVKFLLYNLVGGLIMLAAVVGLYVATATSDAFDAGTFDFRAIVA
AVSSGEFAVDPVVMHLLFGGFMFAFAIKAPLWPLHRWLPDSAVEATPASA
VLMMAIMDKVGTFGMIRYCLPLFPDSATLFGPAIITLAVIGIVYGAVVAI
GQTDVMRLIAYTSISHFGFIILGIFVMTSQGQSGSTLYMVNHGISTAALF
LIAGFLVSRRGSRLISAYGGVQKVAPVLAGTFLIAGLATLSLPGLAPFIS
EFLVLIGTFTRYPVFAVLAASALVLSAIYILWMYQRMMTGPVPPSLSEGE
NRIRDLVPRELVVVTPLIALLLLLGIYPKPALDIIDPAVAHTLTTVEQTD
PAPRMAEGPVR
145225070YP_001135748.1 NADH dehydrogenase subunit K [Mycobacterium gilvum PYR-GCK]MNPDNYLYLSALLFTIGAAGVLLRRNAIVMFMCVELMLNAGNLAFVTFAR
VHGNLDGQVVAFFTMVVAACEVVIGLAIIMTIFRTRRSANVDAASLLRH
145225068YP_001135746.1 NADH dehydrogenase subunit I [Mycobacterium gilvum PYR-GCK]MPKFLDAVAGFGVTFGSMFKKPVTEEYPEKPGPVAKRYHGRHQLNRYADG
LEKCIGCELCAWACPADAIFVEGADNTEAERYSPGERYGRVYQINYLRCI
GCGLCIEACPTRALTMTNDYEMADDNRADLIYGKDKLLAPLEPGMGAPPH
AMAPGATDEDYYRGTVSPSAEADAR
145225066YP_001135744.1 NADH dehydrogenase subunit G [Mycobacterium gilvum PYR-GCK]MTIAERASDAPPVEMVTLTIDDQPVTVPKGTLVIRAAELIGVQIPRFCDH
PLLDPVGACRQCLVEVEGQRKPLASCTTTVSPDMVVHTQHSSAVADKAQQ
GVMELLLINHPLDCPVCDKGGECPLQNQAMAHGRAETRFTDVKRTFPKPI
NISSQVLLDRERCVLCARCTRFSDQIAGDRFIDLLERGAQQQVGIAPGVP
FQSYFSGNTVQICPVGALTGTAYRFRARPFDLVSNPSVCEHCASGCAQRT
DHRRGKVLRRLAGDDPEVNEEWNCDKGRWAFTYATAGDRLTTPLVRDEDG
TLRAASWSEALTVAGAGLAASRGRTGVLVGGRSTLEEAYAYAKFARIVLA
TNDIDFRSRPHSAEEAAFLAAYVAGRPKSVTYADLENAPAVLLAGFEPEE
ESPIVYLRLRKAVRKNGVQVMSVAPLRTRSLDKLSARLITAAPGAEAGVL
DGLADDELLTMPGAVILVGERLATSPGALSAAGRLATATGARLAWVPRRA
GDRGAVEAGALPHLLPGGRPVDDVGARAQTALAWHVDELPAHPGRDGTGI
LDAARTGELGALLVGGVELADLPDPDHAAAALDAVPFVVSLEVRRSAVTD
RADVVFPVAPVVEKGGAFVNWEGRIRPFEPSLHTNSVTDLRVLSLLADEI
GVDLGVPTSVAAAEEHARLGLWAGDRPAPPQTEEHRAPAAHGEAVLAGWR
MLLDAGRLQDGEPHLAGTARTPTVRLSERTAADIGARGGDVVTVSTDRGA
ITLPLTVTDMADGVVWLPMNSPGSQVHQTLGVTTGARVSIGCAEQREPA
145225064YP_001135742.1 NADH dehydrogenase subunit E [Mycobacterium gilvum PYR-GCK]MFLELGQRPDEPGPPIHGPATYPAAVHERLTADAATIIARYPQTRSALLP
LLHLVQAQDGCLTPAGIAFCADRLGLTDAEVTAVATFYSMYRRTPTGEYL
VGVCTNTLCAVMGGDAILESLEQHLDIAPGQTTADGRITLEHVECNAACD
FAPVVMVNWDFFDNQTPASARELVDGLRSGQTPAPSRGGSLCTFRETSRI
LAGLDGPDSATAGTVGEATLAGLRFAREHRMAAPAAGSPSDTTAGGGGQE
QAVAAESVKNEPAPAPEADVPARSGTAETDPEATDAP
145225062YP_001135740.1 NADH dehydrogenase subunit C [Mycobacterium gilvum PYR-GCK]MTEPTGDQTPEIIGVRRGMFGAKGSGDTSGYGRLVRPVALPGGSPRPYGG
YFDEVVDRLAEAVGDDAFTESIERVVIHRDELTLEVHRDRLVEVAQALRD
DPALRFELCLGVSGVHYPDDTGRELHAAYPLMSITHNRRIRLEVAVPDDD
PHIPSLFGVYPTVDWHERETYDFFGIIFDGHPSLTRIEMPDDWVGHPQRK
DYPLGGIPVEYHGAEIPPPDQRRAYN
145225060YP_001135738.1 NADH-ubiquinone/plastoquinone oxidoreductase- chain 3 [MycobacteriuMNLYTPILVLGAIAAVFAVGSVGIALLIGPRRFNRAKLEAYECGIEPMDA
SDPAVAATAQRFPMRYYLTAMLFIVFDIEIVFLYPWAVAFDSLGMFALIE
MLLFMVVVFVAYAYVWRRGGLQWD
145225058YP_001135736.1 regulatory protein LuxR [Mycobacterium gilvum PYR-GCK]MTAGLGLARTQVESAIVASRLRAVLVGAAGVGKTSMARKLARDYARKHPR
LTSHWVSATASARDIPFAAFSHLIDVSGGEEPTTLLRAARESLRSAHGLL
LVVDDAHHLDTLSATLVHQLAVTDNAHIMLTVREGEPVPDAVTALWKDSI
LSRHDIAPFDRRESGLLLEQILGGTVEDVSTVRMFEISQGNPLYLRHLVD
AALGTGSLRQVEGVWQLRGEMTLSPQLTTLIDAHLTNLPEPVRSVLEFLA
IDDPLSVDDLAALTGIDAVDAAETCGVVTITDRAGALYAHPFHPIYTERV
RSSLGLLAMRRLRKLLAGRMSVRAPGNLSTRLRMAALAMGTDEPPSADEL
VGLSWEAMRLGDLALGERLARAALDQADGLAARLPLAHSLSWQGRGRDAD
DVLNPVDPDTLTQWDLMAWTLPKAANRFWMLSESEEAVEYLRQMRARITE
RGALHTIDALAATFAMNAGDPAEAVTVAKGILAADDAQDLAVAWASAAAT
LSSARMGRFAEVDGLAQRGLDAAHPGLLRFTLGLGQTLALIMNADVASAE
HLARHYLSFSEFQQPGRAIGEVLLGHTLLASGRFGDAVTLLRQAAAALTY
TGYSWGPLALTGLAQALGQQGRAADASAVLTRAEASHGMRSALYAPDLAL
ARAWTLAAARDLRGAVASARDAVHAAVQSGQDAVALRALQDCARLGDTHG
LATAVRLSDRIGCVTGPLCVAHLRALAAGDGAALDAVSADLETAGLPAAA
ADAAAQATFAHQRRGDRAGEVASRSRASRLSQVCGAPATPALEQVLNPMP
LTGREREVAVMVSQGLTNKAIAQRLSVSVRTVEGHVYRACMKFGVPDRAA
LASTVGGMHGREGTA
145225056YP_001135734.1 hypothetical protein Mflv_4477 [Mycobacterium gilvum PYR-GCK]MMPKVSLVCHVGLLLVLSILVFPGMFGGDVPRAVPLAVVALVLAVVLAVT
EVFSGLRWVALVALAAAVAGLIATVCDDPVSGAALWGWGLAWMAVVVWFA
VLASRARSNR
145225054YP_001135732.1 GMC oxidoreductase [Mycobacterium gilvum PYR-GCK]MELQNGPCVDEVNYLIIGSGFGGSVMAAELATRRRGVCLFERGKAYPPGS
FPRRVKEIDDSIWAPGSGKHGMFDLWSFDGIDAVTASGLGGGSLIYANVM
LEKPAQWFTQPVPDGNGKTETWSFTHRDLRDHYRAVREVLQVQEIPRSLH
EEHSKKTTKFLDAGSVLAPLAVRFDGAEGPAKGAPLPPADYPNIHGDDVE
RTTCTMCGECDVGCNRGAKSSLDHTYLSVAAHHGAQICVRTEVREIAPCT
DDSDYLFEVAYVVHPECRNKSEPVERVIRAKRVILAAGTLGSTYLMLRSK
KLGLSDCAALGKRFCGNGDLLGFALPDGDDDELLPSGGPVITTYRSFDAG
DRRILLQDGGLPNLATWGWGPDDLREALAKLSVPRFASAWLWRLRWPLPL
LGMGADIPDGQLCLKDSDDTKMTCTWKKHTSDNHFQDVARRMEALTKDLG
AGFLPNFLWDFINEVITVHPLGGCPADTSAEEGVVDSYGRVRGVPGLWIA
DGSVMPGPVGANPSLTIAAFARRAAHELRKEDLATPSLPAPFIPQPYGDS
DRSG
145225052YP_001135730.1 hypothetical protein Mflv_4473 [Mycobacterium gilvum PYR-GCK]MPTFLAEWQRSTFSDPTISKFVTLLESCAAQIAAPESPVRLIMVLAVAAD
LGVCAVFEADSAQTVLRVCRNAGAMPQRLTPDVEARILASESASS
145225050YP_001135728.1 type 11 methyltransferase [Mycobacterium gilvum PYR-GCK]MDMDQTPTLSRFDDFYKDEDKTPPWVIGEPQPAVVDIERAGLITGRVLDV
GCGTGERTILLTAAGYDVLGVDGAPSAVEQARHNAKTRVVDARFDVADAL
DLGDEPAYDTIIDSALFHIFDDADREKYVRSLGRATAPGSVVHLLALSDT
GRGFGPEVSEETIRAAFADPGWDIEALTTTYYRGVITAPHADAMGLDVGT
VVDEPAWLARIRRL
145225048YP_001135726.1 aminoglycoside phosphotransferase [Mycobacterium gilvum PYR-GCK]MSDDLARALEDVLRPVLGDTTVEDLQRLTGGASRTTWAFTSRSDGRSRHL
ILRTGARDDIHASMELEAKVQQRAAAAGAPVPHILAADNSPDAVGEPYLI
CDAIAGETIVRKIFRMLDDTGRARLLTQCATALAAIHRADPDGVGLAAPD
ELAGWRTRLDEIGDTTATFEWTFRRLADERPDPSPMRLVHGDFRMGNLIV
DDSGLAAVLDWELTHIGEIYEDLSWFCIRAWRFGAAESLGAGGLGSVETF
LQAYESAAQIVLDRSTFRWWLTVATLRWGVICRHQAERHLSGEARSVELA
AIGRRVSETEWDLLDLLSGKGPQ
145225046YP_001135724.1 TetR family transcriptional regulator [Mycobacterium gilvum PYR-GCKMPPGSSDALSAKGRQTRDALAQAARKLFAERGFHGTTLSDITSAAGKSPA
AFYRYFSDKEDLLAALAESFLHEVVAPSGLSVPLPESPDDDAFFTAVVTG
YWTMFKQNIGIMIAVAQLAATQPRFTLVQNEFRRFGMDIVAASVRRAQEQ
GYGTELNPEHTAAAIALLFENFTTVFVGASGLGVQMTDQDAIATLSRIWK
KTLYGY
145225044YP_001135722.1 formyl-CoA transferase [Mycobacterium gilvum PYR-GCK]MTTGPLDGIRVIEVGTLISGPFAGRLLGDMGAEVIKVEPPGAPDPLRTWG
QAELDGHHFFWTVHARNKKAVTLNLRVPEGRDLFLDLVERSDVIVENFRP
GTLEKWNLGYDVLRERNRGIILVRVSGYGQTGPDAHKAGYASVAEAASGL
RHMNGFPGGPPPRLALSLGDSLAGMFAAQGALAALYRRSVTGEGQIVDAA
LTESCLAVQESTIPDYDVGGVVRGPSGTRLEGIAPSNIYPTADGSWVVIA
ANQDTVFRRLCAAMGQPELATDERFADHVARGRNQDEIDKIIGGWAAQRQ
PDEIISTLSEAGVISGPINTVAEVVEDPQLQARGMIADHWDERIGRNVKG
PGVVPVLSETPGTIRSAGSARPGQHNDEIYRDLLGRSAAELDKLQEEGVL
145225042YP_001135720.1 homogentisate 1-2-dioxygenase [Mycobacterium gilvum PYR-GCK]MESFVHLRKGKTPKRIHADLDGLKDDELGRGGFVGRTANMYRRNDPTAYR
TVGPLRPTDVLSSELKPSDATDPRGGPLLMFSNADCQVLLSRRTEEMPFF
VRYVDGDLLSFVHRGSGSLETEFGPLTYRQGDWIYIPKACTWRQIPDPGP
TGTTTLLMVQATEEFRVPPAGTLGRHFPFDPAQAVIPEPQPIDDDGRDEY
EVRLIHEGGPTSLFYKHHPLDVEGWRGDNFPFTFNIDDYTVITSDSVHLP
PTVHLFMQATGVYIMNFLPKPAESVPGTERTPWYHRNVDFDEIAFFHDGS
LYGIPMPPGLVSHAPQGVHHGAPEKARERARRKFDDYDRVDWSVIAVDTR
RRLIPSPEILANDLGQH
145225040YP_001135718.1 acyl-CoA dehydrogenase type 2 [Mycobacterium gilvum PYR-GCK]MSSKVTAPAAVTDQFIADLSDRADDAERLRRLPAETLTDASASGLFDLLV
PSRYGGQEAPFPAILEPVRRMAHGCASSAWTLGFYTLHNWMLALFSEEAQ
QEGFAARPFLAPAPLAPTGHGVACEGGIRVTGRWSWATGVMDGNWIMVGA
LCERTAGDPSTLYPVLALLPIDEARIEDVWHTDGMRATGSNDVIIDGAFV
PSHRIVKVTDIYTGAAPGAALHDADTYRWPMVPALALLAAMPALGSAERA
VEIYTERLSQRFLAYEGVMQKDKPVASIHLGSASVRLRALDALLADTVGE
IENIIAAGDPVERPVRAHARLAAAHIVHESRAVIGELLGASGASAHFLDN
PLQRVKRDVDVIAGHVVFDYDTSRELAGAVTMGAPIPRTAMV
145225038YP_001135716.1 putative esterase [Mycobacterium gilvum PYR-GCK]MRLLDRIRGPWARRLGIATLAALLLPGVVGLTGGSVTAGAFSRPGLPVEY
LMVPSPSMGRDIKVQFQSGGPNSPALYLLDGLRAQDDFNGWDINTQAFEW
YLDSGISVVMPVGGQSSFYSNWYKPACGKNGCLTYNWETFLTQELPAWLQ
ANRDVRPTNNAAVGLSMAGGSSLVLAAHHPGQFSYAGSMSGFLNPSEGWW
PGLINISMGDAGGYKANDMWGPAETDPAWQYNDPMVQIPNLVANNSRIWV
YCGNGTPNELGGGDLPATFLEGLTIRTNRTFQDNYLAAGGKNGVFNFPNN
GTHNWAYWGRELQAMKPDLQAHLLG
145225036YP_001135714.1 molydopterin dinucleotide-binding region [Mycobacterium gilvum PYR-MEHRVTCPLCEAMCGLKITVSDGVATSARGNADDVWSRGHLCPKGASLHQ
IHHDPDRLRLPLVRSRSGEHVQVSWDDAFTETERVLRPVIDRYGARAVTV
YLGNPVAHNLGLQTYIGALVGMAGAVGMPAYYTPGTVDQWPLNVVSALLF
GGMWNAPIPDLDRTDHLMMLGANPSASQGSMLSAPDIMGRLAAIRARGGT
VVVVDPRRTPTARRASEWVPVHPGTDALLLFAILHTLAERGWIRRPPHLQ
DLVAGLDDVVGLAARFSPERVEVATGVPAGTVRRLAADLAAAERPVLYSR
IGACTQEFGTLATWLVFVLNVALGSVDAPGGALFPKAAVWSPMFMKPPDQ
DGPGWRFGRFHSRVRRVPEVLGQFPVSCLAEEIDTPGDGQIRGLITVAGN
PVISAPGSRRLDAALSGLDAMISVDNWLNETSRHAHVVLPGLSPLERAHC
DDLYWMYSVASCVKWTEPVFPTRPDRPQEWEILLRLAGAVLGTAVPDVDV
RAMDDLYSQGIIHTACQADDTPLSGRDPGEVFEALDGVGPERMTDLGIRV
GPWGDDLGRRPGGLTLDEVRRHPDGLRLAELEGGRLPDVLTTPSRRIELL
HPLLEADIPRLVSRIDRGRDDLVLTSRRHLRSNNSWMHNVAALMRGKDRC
TLLIHPDDALRHDVADGGQVEVSTTEGSIVVVAEVSDEMMPGVVCLPHGW
GHGIDGTRLAVANAHPGVNSNLLSPPALVDVPSNTQVVNGVPCRLRSRRE
PPHASAR
145225034YP_001135712.1 acyl-CoA dehydrogenase domain-containing protein [Mycobacterium gilMTNTLPPKRGDRESAVGLQKHRRTAIDVGMALLTPLMGQEFLDKYNLRDP
LNRGLKYGVKHGFSAAGAATRQFKRVQGIGKPATRLTENRPKGSDYFDLT
PDDDQKMIVQTVEEFAEEILRPAAHDADDAATYPPDLIAKAAELGITAIN
IPEDFDGIAEHRSTVTNALVAEALAYGDMGLALPILAPGGVASALTHWGS
ADQQATYLREFAGESVPQACLAIAEPHPLFDPTALRTTAVRTPSGYRLDG
VKSLVPAAADAELFIIAAALGGKPALFLVEASTPGLTVTADPSMGIRAAA
LGRVELAKVTVPLSARLGEEDASAADTAQIYSDAIALSRLGWAALAVGTS
HAVLDYVIPYVKEREAFGEPIARRQSVAFMCANIAIELDGLRLITWRGAS
RAEQGLSFAREAALAKKLGADKGMQIGLDGVQLLGGHGYTKEHPVERWYR
DLRAIGVAEGVVVL
145225032YP_001135710.1 hypothetical protein Mflv_4453 [Mycobacterium gilvum PYR-GCK]MFEFAMILLLVGALVLLARPLLARRRGVGNGWVPGTLLVTGVSPRPDGVS
GEQFVTITGVINGPTVNEYTVYTRMTSDVNSWPTMGQLIDVMYNPGNPEK
WAFGSRPEPLPPTDPPPPAPPAPYN
145225030YP_001135708.1 peptide chain release factor 2 [Mycobacterium gilvum PYR-GCK]MDPDRQSDIAALDTTLTTVERVVNVDGLRGRIQQLESDASDPKLWDDQAR
AQKVTSDLSHAQNELRRVEELRSRLDDLPVLYELAAEEEGAGSSEAFAEA
DAELAKLREDIAGMEVRTLLSGEYDEREALVNIRSGAGGVDAADWAEMLM
RMYIRWAEQHDYPVEVFDTSYAEEAGIKSATFAVHAPYAYGNLSVEQGTH
RLVRISPFDNQSRRQTSFADVEVLPVVETTDHIDIPEGDVRVDVYRSSGP
GGQSVNTTDSAVRLTHIPTGIVVTCQNEKSQLQNKVSAMRVLQAKLLERK
RLEERAEMDALKGDGGSSWGNQMRSYVLHPYQMVKDLRTEYEVGNPAAVL
DGDIDGFLEAGIRWRNQKVDDE
145225028YP_001135706.1 hypothetical protein Mflv_4449 [Mycobacterium gilvum PYR-GCK]MTLPSFLQRLQPKNRHSRAYLFGGRMRVSTVGLVLVFFALYWVNQNYQPE
PPAPAMDPAQQVVPPGFVPDPNYTWVPRTNVETRAPEPTTTTTTTTTTPT
TTTTTTPSPTPDTPTTSPETSTPPPAGPLFPSEPTTTVIDPDGPGPLAPQ
TFTQAPPVLTPTTVAPPGPVLPPTPPQP
145225026YP_001135704.1 hypothetical protein Mflv_4447 [Mycobacterium gilvum PYR-GCK]MRFGFLVNEVLTGLRRNVTMTVAMILTTAISIGLFGGGMLVVRLADQSRA
IYLDRVESQVFLTPDASADDPTCDNDPCKALRQTIEDRDDVRSVRFLNRD
EAYEDAIRKFPQYKDVAGRDAFPASFVVKLDDPEQHQNFDEAMVGQPGVQ
SVLNQKDLIDRLFAVLDGISNVAFAVALVQAIGAVLLIANMVQVAAYTRR
TEIGIMRLVGATRWYTQLPFLVEAMLAAFIGVVLAIVGLILVRALFLEKA
LDQFYQANLIAQVDYADILYYSAPWMLFLGLAMSGITAYVTLRLYVRR
145225024YP_001135702.1 hypothetical protein Mflv_4445 [Mycobacterium gilvum PYR-GCK]MAALGYGVSDFVGGIASRRVAALRVVVISYPVALLLLVLAAVPFGGQLST
AAILWGLSAGIVQAFGVWWFYAALGSGPISVVSPLTAILVAGIPVLAGLA
FGERPGTLAGVGVVLALIAVVLVSRDSAGDAEAARTGARFTAKVAWLTVG
AGVAFGLNFVILHRIPKEAQLWPLVFGRAAAVVVVLIAAVATANLVIERG
VPLRLAVLAGGLDTVANIATLVALQSSLLSLAGVLIALYPAATVVLAIAV
LRERVSRSQCVGMVLALAAVGMIAAG
145225022YP_001135700.1 hypothetical protein Mflv_4443 [Mycobacterium gilvum PYR-GCK]MGARTATFGPIRRHWGAAGYPSARLGAMTESGASRVAVYLDFDNIVLSRY
DQVNGRNSFQRDKAKGFDEVRDKLDRATVDVGAIIDFASSFGTLVLTRAY
ADWSAEINARYRGQLVGRAVDLVQLFPAAAYGKNGADIRLAVDAVEDMFR
LPDLTHVVIVAGDSDYIALAQRCKRLGRYVVGIGVAGSSSRMLAAACDEF
VTYDTLPGVPVFEPEPVADEKPAPKRRSTRAKATSEEAATETPEEPEQPD
PQTSATGLLTRALRIGLEKDDADWLHNSAVKAQMKRMDPSFSEKSLGFKS
FSDFLRSRSDVVELDESSTIRMVRLRENA
145225020YP_001135698.1 putative short chain dehydrogenase [Mycobacterium gilvum PYR-GCK]MSAIDPDKLSTCLQVLADIEALPPEHPDAVAVRRATASIFKSVRKARRHA
KRDAVAAADRAVIAATATGAPGRIDDETAGLPLVSTADGATAGTLQRSRA
CYVCKTHHTVVDAFYHQLCPSCAALNRAKRDARTDLTGRRALLTGGRAKI
GMYIALRLLRDGAHTTITTRFPNDAVRRFAAMPDSADWLHRLRIVGIDLR
DPAQVVALADTVAAQGPLDILINNAAQTVRRSPGSYAALVEAERAAPAEL
GLVDVISFDRVSDAHPAALAGSLAEQHTPHAVTELALAARSASPERIAAG
TAIDAGGLLPDTAPVNSWTQRVHEVDAMELLEVQLCNQTAPFILVSRLRP
AMAASSARRKYVVNVSAMEGQFSRAYKGPGHPHTNMAKAALNMLTRTSAG
EMLEQDGILMTAVDTGWITDERPHPTKLRLADEGFHAPLDLVDGAARVYD
PIVRGEAGEDLYGCFLKDYSPGNW
145225018YP_001135696.1 cutinase [Mycobacterium gilvum PYR-GCK]MGLSECLSGVTAPGLALAAGLLLAPHAFAQPALTPAPGPAPPPIAAPAPE
PLAAPVAGCPDVEIVFARGTTEAPGLGAMGQAFVEDLRSRLGGKTVGVYA
VDYPASPDFPTAVEGIADASTHVQQIAMNCPDTKLVLGGYSQGAAVMGFV
TTELIPDGVSLSEVPAPMPPDIADHVAAVALLGAPSDRFMDMIKQPPVTI
GALYQPKTLELCVPGDFVCSPGNDLGAHARYISDGLVVQAADFAVGKLAE
TPAESGGAPA
145225016YP_001135694.1 cupin domain-containing protein [Mycobacterium gilvum PYR-GCK]MTTSVTRSRHTTSLHDGEIVEESDLGSMRRVTADNLPILQGLSIKRVLLN
PGAMRTPHWHANADELTYCVSGTALVSILDDHSSFSSFVVTAGQMFHAAS
RSLHHIENIGEDVAEFIIAFRNERPEDFGLGATLGAFSDAVLGNTYDLPA
SDFATIRRDTGTRASGPATDRRLAARIGDPEIPSCAHFNDPHKFDVEAQA
PGLNYVTGNARFARNQFWPALKNMSMYSLRVSESGMREPHWHPVTAEMGY
VKHGDARMTVMNPDGSWTRGR
145225014YP_001135692.1 hypothetical protein Mflv_4435 [Mycobacterium gilvum PYR-GCK]MTNPRDPETRRLPRPGGPDAPTEQIRARRPDAAPTERIRRPVPPSSLPLP
PPSPPALRDNRGGRGLFTRRTSRLLAVIAVAALAGGLAGAELYARHRADA
VLVGIAECVVEDGTTISYGVNPPFLWQHITGRYTNISVRTAGDRVQSADG
MTADVTLEDVRLSGSGDSKGTIGALHATLTWTAAGIKDTVAANLPGVGAL
VTDVTTDPSAGTLEMAAGSASVIAKPVVVEGNLNLEVLDVTGPFPKDAVQ
SALDDLTRKLNDNYPLGIRADSVEVTDAAVVGSFSSRDASIPDGESDPCF
ARL
145225012YP_001135690.1 indolepyruvate ferredoxin oxidoreductase [Mycobacterium gilvum PYR-MTDLDVRPPDPHPYDLDNRYRAGSDAVLLTGVQAIARALVEQHERDARAG
RRVATFVSGYQGSPLGGVDRMLYGMPDVLQAHDIVFVPGLNEELAATSVW
GSQAELPAGTPTHDGVVGVWYGKGPGLDRATDALRHANMYGANARGGMVL
LVGDDPASKSSTVPAVSERSLAALGIPVLFPRNAREIVTLFLHGVALSRA
SGCVVAVKIVADVADGAWTVDADDLDLEIVDPEVEWQGKPFVYRQRPMAA
PADSLLAEADLYGPRAEMVQAYSSANRLDVVEIDPPDARIGIAAAGTTFD
SLRQALTDLGADDSALRAAGVRLLRIGMVSPLCADTVLGFASGLDEILVV
EDKTAFVEAQMREILYGATNPPRMMGKKDAAGRSLIPADGELTAGRLLAP
LRRVLGDRLELRKPPPPALPLEVLPTRRTAYFCSGCPHNRSTAVPEGSLA
GGGIGCHTMVTMSGRADSAVTGLTQMGGEGSQWIGQAPFTDIAHLFQNIG
DGTYFHSGQLAVQACVAAGVNITFKLLYNEVVAMTGAQHAEGALGVASLT
HKLKLEGVAQVIVCADEPRRHRRRDLAAGTLLWHRDRLDEAQRRLRDVPG
VTVLIYDQHCAADARRQRSRGTLPSRTTRVLINEAVCEGCGDCGVKSNCL
SVQPVDTEFGRKTRIDQTSCNTDYSCLDGDCPSFVTVEVTPGRARKPGSA
PTPPPVPDVCVEPVTSTHNVLLAGIGGTGIVTANQVLATAALRAGYDVES
LDQIGLSQKAGPVVSHLRFAADRLEPANRLTPGTADCILAFDLLAAADEK
NLGYGDPATTVSIASTSRTPTGEMVYDASVAYPDTSSLLHRLGRASRRVQ
EFDASAAAKTLFGNTAAANFLLIGAAYQAGALRIPAAAIEEAIGINGVAV
ATNVAAFRWGRVAIADPAHFHDVAVPVPAGPVGTAPVHLLAGTGISGRVG
DLIARRAADLIAFQSEAVARRYVSVLQRVWTAERRIGSRTEFSEAAAKGL
YKFTAYKDEYEVARLLTHPRFLAQVRAEFPAGENLTYKVHPPTLRALGRR
KKIGLGPRSHVVLRALAAGKRLRGTVFDPFGYAHVRRVERRLLAEYTDLI
TGVADTLDEHNYDRAVQVAGLADTVRGYEGVKLASVEVYRARLREMGF
145225010YP_001135688.1 hypothetical protein Mflv_4431 [Mycobacterium gilvum PYR-GCK]MTWDDPDAASLRNLLDEHRLRALVHRYCRAVDRGDVEALRTLYHDDADDA
HGDFSSGSVRDFIAGIAAARPYLRSMQHHVTTTNFAIAGNVAEGEIYMIA
THTLIADGRDVDVVVGGRYLDRYEKRDGTWKFVARAIVTDTAHVLDPSTR
DLSHPVTRGTPLGSMGDDDPAHAFFTLLKLLQE
145225008YP_001135686.1 luciferase family protein [Mycobacterium gilvum PYR-GCK]MRFGNFMAPFHPVGQNPTLALERDLDLIVAMDRLGFHEAWVGEHHSAGFE
IIASPEVFLGVAAERTKHIRLGTGVSSLPYHHPLMLADRMVLLDHLTRGR
VMLGCGPGQLTSDAHMLGIPADEQRPRMEQCLDAIVRLLRGETVTMHTDG
FTLQDARLQLKPYSEPCFDIAVAASFSPTGPRGAGRHGIGMLSIAATARQ
GMDLLAQHWNTWDEVAREHGHQADRSKWRLVGPMHLAETREQAERDVEYG
IAEFSRYFTHILPSGPVQGDTPEEIIANNRQSGFAVIGTPDDAIAKISEL
VEASDGGFGAFLLFDHDWAPPAAKLRSYELFAQYVIPHFTGQLSAPIASR
DWVTESGRVFVDQATHAIGRAIESHAAEQQAKQSRTSD
145225006YP_001135684.1 amino acid permease-associated protein [Mycobacterium gilvum PYR-GCMSVDTAEGTAEPTRLARRITGPLLFLFILGDVLGAGIYALMGELSSEVGG
VLWAPMTVALGLALLTAGSYAELVTKYPRAGGAAVFAERAFGKPLISFLV
GFSMLAAGVTSAAGLALAFSGDYLATFVDVPVALAAVVFLALVACLNARG
ISESLKTNVVMTAIELSGLVLVIAVVAMMVGRGDGEVGRVTEFPDGTTPA
LAILGGAILAYYSFVGFETSANVVEEIRDPRRVYPRALFGALITAGVVYA
LVGLASAIAVPTDELSQSSGPLLDVVAASGAAVPDWLFSLIALIAVANGA
LLTMIMASRLTFGMSDQGLLPSVFARVLPNRRTPWVAIVATTAVAMALTL
VGDLSMLAETVVLLLLVVFLSANVSVLVLRRDHVEQDHFRVWTFVPVLGI
ASCLLLLTQQTAKVWLLAAALLAVGVVLYLLAKRFGGQGVQDTGDAAPSR
SE
145225004YP_001135682.1 putative PAS/PAC sensor protein [Mycobacterium gilvum PYR-GCK]MRLKKVLKWNNAEMPDTGRVVGSELDEMVRTHGNLRLGSFRFWFVGQRWE
WSDEVARMHGYEPGTVTPTTELLLAHKHPEDRQHVQELLDRALHSGGSFS
SRHRFIDTRGGEHTVLVLADRMTDADGAVVGTEGYYIDLTDTLDEARRDA
LNSTLPDLFAARASIEQAKGALMLVYGVGPDQAFELLQWRSQQTNTKLRT
LAGRIVADFPTLRAPRDELRRQFDHLLLTVHQRVE
145225002YP_001135680.1 multi-sensor signal transduction histidine kinase [Mycobacterium giMNWAQTPLGPTSEWPQSLQTAANILLSSRFPMWMAWGPDLTFFCNDAYRN
VTLGRKYPWALGRPASEVWAEIWDDIGPRIERVLSTGVATWDTSLLLFLE
RSGYTEESYHTFSYSPLRDDDGAVVGMLCVVSEDTLQVIGERRMATLRDL
GSDPSVVRTEGEILSFVDRQLAQNLRDLPFTLTYLFDDDGSAHLAGMSGI
TGDHPAAPDVLTGADGELWPVGPPAGGETVLLEVDTAPYPAMPTGDWREP
PRQVLIVPLLQQGAAPTGFLVAGLNRYRVLDDAYRGFVALVAGHIAAGIG
LSRSYRTQQMRAEELAELDRAKTTFFSNISHEFRTPLTLILDPVSELRRA
DTLGDAARQELDVVWRNGLRLNKLVNTLLDFSRIEAGRTQAHYQPVDLGA
VTAELASVFRSAIERAGLVFDVDCPPLGEEAYVDLDMWEKVIFNLLSNAL
KFTFEGSVSVTARRDGRGAVITVSDTGTGVPADEMPRLFERFHRIENTRA
RSNEGSGIGLALVKELVGLHGGTIEADSAESRGTTFTIRLPWGAGHLPAD
AVASQPRERRPGNTVDAYVEEALRWTPDGVREYVAESAQPTTGPEKPIGT
GTLARVLVADDNADMREYLGRLLRSDGYAVEAVVDGWQALEAIRAEPPDL
VISDVMMPRLDGLGLVAELRADRRTAAVPVLLLSARAGQEASISGLQAGA
DDYLVKPFAAAELLARVRANIQLARLREGHARWRTALVDSLQEAFFVCDE
HGAVVEINPAFTEILGYDSTGLPYPLMHPWWPLKGSDAEANRRVEEAFGS
FMRDPHGTLTEVPVTHRDGHRLYVTVTFSHADDPETGRDVIVGTLRDVTA
ERYIVQRESALASLNEKLAQADTLDDAVLAAAEEFSSIWSARRVVAATWP
DEPDGEHESDAPSLTVVGAPATWDGLPGSARELILTLRRDHLLAPHTSDA
GAAGVALRHPRGVLVLYVELPEQRLFTAEDDTLLTVLAGRLGQGLQRVHQ
IDQQRETALALQHAILGPSLSSAFAVRYQPATRPLQVGGDWYDVVDLEDG
RIGLIVGDCVGHGLAAATVMGQLRSACRALLLEHPSPAAALSALDRFAAR
LPGARCTTAFCAVLDPRIGEVVYSCAGHPPPIMVTADRTTELLEGARATP
LGLKNPPHRTEARVTMPARATLLLYTDGLVERRRESIDDGIARATDVVQG
NRATDLDQLANVIMARLAPADGYHDDVALLLYRQPEPLDLDFPADVAELA
GSRTVLRGWLDSAGVPQDQALDVLIAVGEALANAIEHGHRDDPGGRVRLR
AVALPDRVQLTIIDTGSWKAPDDVPALHRGRGIALMKALMQDVTIDSQTT
GTTVHMNTRIA
145225000YP_001135678.1 DNA primase- small subunit [Mycobacterium gilvum PYR-GCK]MGTSENRDGVDLTNLDQPLSDDADATKRDLVDYLDAVADRILPVLAGRPL
TVLRALRGRAPFMQKNVPKYTPDWVRTVPIWAEASRREIRYAVCDDRRTL
LWLANQRAVEYHPALGPADDVYRPTHLILDLDPPDDGDFASVVAVAHLVR
RALADCGLDGAVKTSGSRGLHVFVPIDDSAPVDDVAAATRALAARTEALD
PTVATTAFIVADRAGKVFVDATRAGGATVAAAYSPRLRPGTPVSFPVAWD
ALDRIHPSDFTVRTAVSALAGRDPWADAMPAPTRLPTDLIEQGRAIPVAR
VAAMHEGKRRARARRKDDEAGADQTG
145224998YP_001135676.1 TRAP transporter solute receptor TAXI family protein [MycobacteriumMTAFATLMLAATAATACGGRQDAPAADSGGEITCEVGTETRVSIATGNST
GVYFSLGNAFAEQVSAATDGTVKATAAETGASVQNIQQLVAGSYQVAFSL
ADTASDAIEGTGSFDGKEQPIQALSRIYPNYTQVIARTDSGITSIADMRG
KRVSTGSPGSGTEVIANRLLESAGLNPQTDVAAQRLDLTKTVDGMKDGSI
DAMFWSGGLPTPGITDLFTSAREDVTFIDVTPQLGRMAEISPAYEEGLIP
ATTYQLPSDVATIVVPNMLLVRDDLDANLACVLTRTLFEKQPEMAQVVGA
AKGIALDNARDTDPVPLNRGAEYALDELNAPR
145224996YP_001135674.1 HAD family hydrolase [Mycobacterium gilvum PYR-GCK]MSTQSVSPAVLFDIDGTLVDSNYLHVHAWMRAFDDENLPVSAWRIHRCIG
MDGTTLVRTLSGDAGQGVLDRLKDAHSRYYKENSSLLAPLPGARDLLRRV
AATGLQVVLATSAPDDELTLLREVLDCDDVVAAVTSSADVDTAKPKPDIV
QVALDRAGVGAQDAVFVGDAVWDCEAAGRAGVTSIGLLSGGVSRGELREA
GAAGVFEDAGDLLAKLDSTVIGDLAARVSDPR
145224994YP_001135672.1 hypothetical protein Mflv_4415 [Mycobacterium gilvum PYR-GCK]MSGGLFALLDDVAVLAKLAAASVDDIGAAAGRATAKAAGVVIDDTAVTPQ
YVHGIAAERELPIIKRIAKGSLRNKILIILPVALLLSQFVPWLLTPILML
GATYLCFEGAEKVWGMIRGHKSHGTLVAGSGEAAEKAMVAGAVRTDFILS
AEIMVIALNEVADQSFLPRLIILLVVAVVITIAVYGVVAAIVKMDDIGLS
LTQRSSGFAQKIGRGLVAGMPKLLSALSVIGTVAMLWVGGHILLIGADEL
GWHAPYALVHHAEELVHHVAGVGGVLGWLVNTAASAVIGLVVGAIVVAIV
HALPFGKKVGKKNEAHG
145224992YP_001135670.1 hypothetical protein Mflv_4413 [Mycobacterium gilvum PYR-GCK]MDAAHAVATAAIFVWLGMVLAISFLEAPLKFRAPGVTLPIGLGIGRLVFR
ALNTCEVVLGVAAVAALVSGEGSTAALIASIVAVAMLLSQIVFVRPALTR
RSDQVLAGADGPRSRAHYVYVALELVKVVALIVAGVLLLTHSA
145224990YP_001135668.1 long-chain-fatty-acid--CoA ligase [Mycobacterium gilvum PYR-GCK]MSVLATALSEAMTASTRDLVLLDRASGQWVRHPWQELHTRAENIAEHILN
DRDGAVGLVGEPTAELVSAIQGTWLAGRALAILPGPIRGADEREWAAATA
QRFAGIGVGQILTYGEHLELLRPNVFGITVHDLAVVGHAQRSTTLVSAPA
APGTPAVLQGTAGSTGTPRTALLSQDAVKHNVAGMLRHTDVDPGRDRGLT
WLPLYHDMGLTFLLTGFMSGSEMWLAPTASFAASPFRWLAWLSESRAGLT
AAPNFAYSVIGKYARRVPDVDLSNLRFALNGGEPVDCDGFELFLRELSRF
GLDPGVAAPSYGLAESTCAVTSPRPGTGLLVDDITDPDTGTPRRHAVLGE
PIPGMELRIAPSEGRRSGEREIGEVEIRGTSMMSGYLGEEPLAPGQWFPT
GDLGYLTDAGLVVCGRVKELITIAGRNIFPTEVERVAAEVRGVREGAVVA
VGTDSGSARQGLVIAAEFRGADESGAKSEVVQRVASQCGVVPSEVVFLKP
GSLPRTSSGKLRRLAVKNDLDGLRAPVS
145224988YP_001135666.1 hypothetical protein Mflv_4409 [Mycobacterium gilvum PYR-GCK]MTDIVTLTAYFAERHRSGDSFLADAILGLCDERQIATSVMLRGIASFGPT
QVIRSDRSLSLSEDPPVTITAVDTAARIGSLAEQVSALVDRGVLTLERGR
ALPDAGRPDDPVRLSLHLGRRHRIGGLPGYVAVCDLLHRHGFVGAQAYLG
VDGTVAGRRCRARFFGRNADVPLTIMGVGTNAQAAAAVDELGDSLPEARF
AVAPVAVCKNDGRDVQGPPAADSAFQALVVHADESSLSDGRPIHRALIER
LKESDHASGATVLRAIWGFRAPGRPHGDRFIQLTRHVPVTTVMIDTASNI
EATYPIVDELTRGEGLVTVSALTGMLEVHSGRRHGALDLGDGNPTQGG
145224986YP_001135664.1 camphor resistance protein CrcB [Mycobacterium gilvum PYR-GCK]MALDRRELAAVFAGGAVGTLARAAFEELAAADPGRWPWPTFTVNIVGAFL
LGVFVTRLLERLPVSSYRRPFLGTGLCGGLTTFSTMQVETIRMLEHGHHW
LALGYVAASIAVGLVAVYLGTVLTRRVRVRS
145224984YP_001135662.1 major facilitator transporter [Mycobacterium gilvum PYR-GCK]MSSTKEGDCPTTKQRLPREVWVLVVANVVVALGYGVVAPVLPQYARHFGV
SIAAATFVITAFAVMRLVGAPPAGFLVQRLGERRVYTSGLIIVAVSTGAC
AFAETYWQLLLFRSLGGVGSAMFTVSALGLMIRISPADARGRVAGLFSSG
FMIGSVGGPILGSLTAGFGLAAPFLIYGAALLVAATVVFVSLRNSAVVGQ
ADDDVQVPIPFRTVFRHRAYKAALFSNFATGWASFGLRIALVPLFVVEVL
GEGPGAAGLALTAFAVGNIAVVIPSGHLSDRLGRRKLLIFGLMLAAVSTA
LVGFTTSLPVFLVAAVIAGAATGIFVSPQQAAVADVVGNKSRGGPAVATF
QMMADFGSIGGSLLVGLIAQYTSYGWAFLVSGIILAVAAIGWFFAPETRP
TPSTEHTPGRPLGPEAGGEVP
145224982YP_001135660.1 zinc/iron permease [Mycobacterium gilvum PYR-GCK]MMMTIAVVLAVSGALIAGAAWGIYGTLPEGLEGFIVALAGGALIFSVVLE
LVEPAVRDLHLLLVALVVLTGAMVFAGLDRLVKAKARNSGGAGLLVAITL
DGVPENLALGVALIGAGPLHVAALSGSIFLSNLPEAAGGAKEMSEGGRSN
GKVFALWGATAVLLSVAALAGNFLLAGAPAALLAAIKCFAGGAVVSSLAT
EVFPQAFAKDSYQAGIATALGLVLAVSLDHLA
145224980YP_001135658.1 hypothetical protein Mflv_4401 [Mycobacterium gilvum PYR-GCK]MTILDSDVLIADAKESAGVTDFGDDTLPERVALVVDRLNNADLDETGSRA
AALTINGLLTSRLHFMADRARMPLAAERITAPLFATGEPRSGTTLLHALL
AEDETSRALRFWEVMYPSPPPGPAVGASEATGEHSADDPRRAQADADWRE
ILDRIPPWIVSHPYNDLLGDGLPECERTWAFDFRATNPSAWWRVPVTIQN
FAQDHHAQYALHHMMLQHIQYARPPKRWVLKGFHGRRLGALFDTYPDARI
VWVHRDPVQVLASQIVAFGQINESLAGALDWTQYAKATIEGSRANFHAYL
IDPFVDDPRIHHVRYRDFVADPVATIGGFYDFAEVPFTAHAEQAMRDYLA
TNRSDRYGKFTYSTDVLPVPVQQLHDEFAPYRERFGIDIETRR
145224978YP_001135656.1 hypothetical protein Mflv_4399 [Mycobacterium gilvum PYR-GCK]MDPTLQALAASAFDNVYHVGHVVPELVSAMESLADAMQIRWAPPFEMRSG
FVRPDGSADDQIVRLAFSMSGPPYLELIEVVPAADSIFAEPTLGGMHHVG
YYAQRWRDDAARLQDEGWELERTGAGVAFLRDPRSGLRVEVVSVKGRDFL
ARVLSGEMASAYPLSERP
145224976YP_001135654.1 hypothetical protein Mflv_4397 [Mycobacterium gilvum PYR-GCK]MSGGDLQTSIAALRAAFEEVAAADVDLLTRPDLVAALDELEELSCQLPAV
GHRLLARLQVETSAREMGAKSWNQVLAVRWRISTGEAHRRLTEAALLAPR
QSLTGTPLPPALPATAVAQSRGLINAEHVEVIRKAVKKLPGWVDVATREQ
FEVNLVRTAVGNGPKELRDAAELTLFLLDQDGPEPDDTERARKRGLTKGK
QRPDGMIDLAGTLTPEAWAVLEVIFAKYAAPGMCNPADPEPCTYGTPTQA
QIDNDQRSLAQRQHDALVAVGRIALMSGELGQLNGLPVSIIIRTTLQDLE
SRAGVGTTGGGTVVPIKDVIRMAGHANHYLAVFDRATGSALDLFRTRRVA
SPAQRVMLIARDGGCTKPCCTVGAYGCQVHHAETDYAHGGNTNIDELGLA
CGPDNRSVTEGGWTTRINDRCEVEWIPPPGLDTGQARVNTYHRPERLLAP
PDDPEPPNQTRTTATEPVEDQAIDDPETDAPPPLDDPGEPGGPAPPDNRA
A
145224974YP_001135652.1 hypothetical protein Mflv_4395 [Mycobacterium gilvum PYR-GCK]MWRSDTPAGTVVLRYRRRERSERRESARICRRHHRCVPGQSRGRSRHRPP
STQRLREIVAYARVHSPHYRRLYRDVPESISRIDQLPPVTKAELMSHFDD
WVTDRAVTKERVEEFLADPGTIGRDFLGRYVVCTTSGATGEPAILLHDAV
ALRVYNIVGYARSVPVALLSPRTVWALLRGRARMAAVFVTGGHFLATR
145224972YP_001135650.1 peptidase S9 prolyl oligopeptidase [Mycobacterium gilvum PYR-GCK]MALPDLIPVEDLFNPPTRAAAKISPDGTRMAFLAPSNNRLNVWVENLDPE
SGGLRRVTDDDNRSVLHFEWTDDPRWLIYLQDTNGDENWHVHRVDLDDPE
APAVDLTPFPGAMALPVREVKNGRTTVMVNNRDATLLDIHELDIATGDLT
LIAKNPGHVNGWLSSDDGDLFATALTADGDLELSRWDRDDEALRPIIRFD
GTDYPIGIHPLVLTPDGTGVWLGFNRGTDRTRLVHVDLATGEETDVDSHP
TFDVDPRAAVSPLLPAPLIQDRRTGELLGVRYYGERQTIRALDSRFGDIL
ANLEKLSDGDLGNLSSDENGVRWIVGFNHDRDPGATYLYDHSTGESRLLF
RPLPQLDPSQLAPMRPVTITARDGLPLQSYLTLPVGVEAKSLPLVLVVHG
GPWFRDSWGFDGHVQLLANRGYAVLQVNFRGSTGFGKAFLKAAIGEFAGK
MHDDLIDGVNWAVEQGYADPDRVAILGGSYGGYAALVGVTFTPDVFAAAV
DYVGISNLANFMRTLPPIARPQLANNWHAYVGDPDDPEQLADMMARSPIT
KVDQIRTPLFVIQGANDVRVVQAESDNLVNALRDRGVEVDYLIQTDEGHG
AVNAENTIEMWEAVVRFFARHIGGRA
145224970YP_001135648.1 hypothetical protein Mflv_4391 [Mycobacterium gilvum PYR-GCK]MTSTTATKPGVAPGLLLGLGLGGFIDGIVLHEILQWHHMVSHVEDYPVDT
LAGLEVNVLADGFFHVATWLLVWAGTIALLMSWRRGRLAPNWSFHFGLLL
AGWGIFNVVEGLIDHQILQIHHVRDDLGGPMSWDIGFLAFGALLVLGGWL
IYRRGARRMGDQAGADIR
145224968YP_001135646.1 aldehyde dehydrogenase [Mycobacterium gilvum PYR-GCK]MTQIVDTAGVFVGGEFRRTDRTVPVFEAATGEILGEGPSAAAADIDDAVA
AARGEGAAKWRAATVDERADGLKRFATALRGRAKHTSTLVSRENGMPITL
SRAVNGAFPSVLVNYYAKLIRSWTAEEVRPALIGHTVVRREPIGVVGAIT
PWNYPQALAVMKIAPALAAGCSVVLKASPETSLDALVFAEAAAEAGLPPG
VLNVVPGDAAAGAHLVTHPGVDKVAFTGSTNAGRVIGAECGRLIRPVTLE
LGGKSAAVILDDADLDTTVNGLRTASFVNNGQTCHLSSRILVPAKRYAEF
VSAIAELADSLTVGDPLDEKTEIGPLVSERQRERVLDYVQVGRDSGARLV
AGGSVPTGLERGWYVAPTVFADVDNSDRLAQEEIFGPVITITAYADDADA
VRLANDTEFGLAGTVWSQDSARATEIARAMHTGSVGVNHYQLDIQSPFGG
IKSSGLGRELGPEGLDAYLVTKSIYQADPFPE
145224966YP_001135644.1 hypothetical protein Mflv_4387 [Mycobacterium gilvum PYR-GCK]MSQDDLREALRRAASALKADGPPFALAGSYALWVHGAPEPVHDVDFVVAE
HDAEAAAATLSKAGFDIRRPPEEWLFKAAFSVDGPVLIDVLHQINRVPVD
AELIERAEVTDVLALTIPVLAPTEVVTQKLRALHEHHCDFEKLFGPVRAV
REQLDWAQLRRATAENPFAVAFLSLCDSLGIAEHH
145224964YP_001135642.1 hypothetical protein Mflv_4385 [Mycobacterium gilvum PYR-GCK]MASLAADCPLDAEVLHTRAREATGLDDFGPDDYRERLEMYLAELREIDMH
APGVVNFHVQLVQWLKNRLLLTDLLTRHPEIEEIELLPPVVIAGLPRSGT
THLHNLLAAAPTFRSLPYWESVEPFPLPAEQGVEPDPRIGRMDLALQTMD
LLMPHFALMHEMTTDHAHEEIQLLANDFSTMLMETLAHVPRWTEYYWNRD
QTPTYEYLVTQLKALQFLRGGGRWVLKSPQHLAQLPVIGRVLPGVRVVFT
HRDPVPVALSMIAMVTYSARMHRDHVDVPVVAAAWVDRLEKLLDACVRDR
EVIAPDRSLDVRFDDFMADELGVAESIYALTGEDFDGRSRAAVAQYLQSH
RRGRHGRVHTSADMFGLDPEELRERFAPYSARFLS
145224962YP_001135640.1 hypothetical protein Mflv_4383 [Mycobacterium gilvum PYR-GCK]MTTESHEATAAWRELLDTLRTLDASFMSGPKAVGDDRHVADGYRMLATTL
GVAFDTYLFADPSRPHWVELNSPFRPDRRWGGDNTDAIYFMCPVDPHRRY
RISGNRGDSVYFSMTAYNEPAPGAWSDKIVAIVRDDDLDIDAEGNFSFEF
GPQPGAAVLMTRDYQADPLVGRAATWTIEALEPPDPFRHGEAETAAALRA
SAAWMRTMFAILPLSVGVKNADAHELGHETALVANDFADPYQVPDANFGW
SARDACYSYGSFDLAEDEALVITHRPPACRFWNLVVWNQFMAVPGVEDAR
SSVNGYTAAPNGDGSVTVVLSRGMTAHPNSLTTLDYPRGNLAFRWFLADE
VPARPEVRLVKVSDAPTAVT
145224960YP_001135638.1 hypothetical protein Mflv_4381 [Mycobacterium gilvum PYR-GCK]MKASGAGVAALALAATVIGYRTRLRPWIYRWGATYEESVAGLPGDELVAG
GARTTRAITIDAPPTQVWPWLAQIGEDRGGFYSYSVLERAVGADIRNASR
IHREWQDLAVGDTVWLARRGGDRGRQIVAALMPNSHLVLMSPADYERVQR
GEKASGSWSFHLKAQGGRTRLLARGNGGYGGNVLYDVVHFIMERRMLLGV
RDRAEVRESSVGRSA
145224958YP_001135636.1 acyl-CoA dehydrogenase domain-containing protein [Mycobacterium gilMDLGWSATDLEFRDEVRAFLEEKLAPELRQAGRLMTSVYADHDASMAWQA
ILHERGWAAPAWPVAHGGCDWSLTQHYIFSRESTLAGAPSLSPMGIRMVA
HAIIKFGTDEQKDFFLPRILTGEVFFCQGYSEPEAGSDLAALSMAARDDG
DHLVCTGSKIWTTHAQEANWMFALVRTTRTDKKQRGITFVLIDMATPGIE
IRPLVMTSGEEVQNQVFFDEVRVPKSNVIGQIDDGWTVAKYLLEFERGGG
AVAPGLQVMAENIATVAADQPGPGGGRLLDDPAFARKLADVRIRTEVLEI
LEYQVLAVVAGGGNPGAKSSMLKVLGTELSQAITELAMEAAGPRGRVYQP
HATYPGGPIAEFEPPEGDYVSGEPWQAVAPLRYFNDRAGSIYAGSNEIQR
NILAKAALGL
145224956YP_001135634.1 GAF sensor-containing diguanylate cyclase/phosphodiesterase [MycobaMSESLDLVVTSVATRLMGAGAATWAEASQQVLADLVEHFGVDVSFLRRND
HTIRASVLVAEWPVRPGIPDPDPLAVVYFADADPVFALAEFQKEPLVFRP
DANTDEYQKTIEEGRQVPQVSMAAVPLLSGDVTTGVLGFVKFGDRDWTGV
ELNALKAIASLFAQVQARVEAETQLRYLAEHDDLTGLNNRRALLSHLDGR
LAEGQPGPVSALFFDLDRLKAINDYLGHTAGDWFIRVLAERLREGADPRA
LIARLGGDEFVVVPAGPMDGEAAESLAHQLQSTLKERVSIDGEMLTRTVS
IGVAVGIPGQDTTSDLLRRADQAVLTAKNSGGNRVTVFTEEMSLKQEFNN
DIELHLQSVIENGALLLHYLPEIDMRTGDILAMEALVRWQHPTRGLLSPE
SFIGVAESINLAGELGRWVMRSACTDFARWRALGIGKDAIMRINVSPVQL
VTDGFVESVAGIVDEFGLEHGSVCLEITESVVVQDIETTRVTLNGLKKAG
VLVAIDDFGTGYSALSHLKSLPVDTLKIDKSFVRELGSDPGDLAIVRAII
ALAEAFGLELVAEGVETDVGALTLLRHGCHRAQGFLLSRPIPTDAMETLL
AQGRIPVSFSKG
145224954YP_001135632.1 hypothetical protein Mflv_4375 [Mycobacterium gilvum PYR-GCK]MDDDMTTPEFHSAAFDRASLTESPSYWDPATQCTVVYATPARERELWRDY
ARGACASYEKHGVAAALDLDALRTGHDTVLFAALVNSAGAVVGGLRARGP
YRSADECHAVNEWDGQDGQAAVHKMVTDRIPFGVAEMKTAWVTDDPDENR
RLTTAIARTPLHAMTLLDIQFIVATAASYVLKRWLSSGGLLATKIPATPY
PDHRYDTKLAWWDRTTFTKHAEPSQVSAFFSEQRQLAETVPHLMGAPVTA
PAL
145224952YP_001135630.1 flavin-containing monooxygenase [Mycobacterium gilvum PYR-GCK]MLQTPPYVAVIGAGISGLTAGKMLKDYGIDYTTFESSDRIGGNWAFGNPN
GHSSAYRSLHIDTSKDRLSFKDFPMPEHYPSFPHHAQIKAYLDDYADTFG
LLDHIEFENGVVHAGRTDDGGWIIRDQGGADRHFDLLVVANGHHWDPRLP
EFPGSFDGESIHSHAYIDPATPLELTGKRILVVGIGNSAADITVELSSKA
LRNQVTLSTRSSAWIVPKYIAGRPGDTLFRTSPHLPLSWQRKAVQLIAPM
LGTDPTMYGLPPADHKLFEAHPTQSVELPLRLGSGDVTPKPNVARLDGST
VHFVDGTHSDFDVIIYATGYNITFPFFDPDFVSAPDNAIRLYKRMFIPGI
ENLVFMGFAQAVPTLFPFVESQSRLLAAYAVGRYALPPVDEMERTIDADQ
QLHAGHCTDRPRHTQQVDYFVYEHDLRTRELPAGLKRAQRAVAVAR
145224950YP_001135628.1 short-chain dehydrogenase/reductase SDR [Mycobacterium gilvum PYR-GMRLEGRVAFITGAARGQGRAHAVRMAKEGADIIAVDIAGPLPPCVPYDHA
TADDLAETVELVKATGRRIIASAVDTRDGDALTAAVDSGVAELGRLDIIV
ANAGVTAPQAWDDISAEDFRDVIDVNVTGTWNTVMAGAHKIVDGGRGGSI
ILISSAAGIKLQPFMIHYTASKHAVTGMARAFAAELGKHSIRVNSVHPGP
VVTDMGTGDMVTALGKAMETNPQLSNMMTPFLPTWAVEPEDIADAVCWLA
SDESKFVTASAISVDQGSTHY
145224948YP_001135626.1 3-ketoacyl-ACP reductase [Mycobacterium gilvum PYR-GCK]MSLLTGQTAVITGGAQGLGFAIAQRFVDEGARVVLGDVNLEATQEAAEKL
GGADVAHAVRCDVTSSAEVDALVAAAVDTFGALDIMVNNAGITRDATMRK
MTEDDFDKVIAVHLKGTWNGLRAAAAIMRENKRGVIVNMSSISGKVGMIG
QTNYSAAKAGIVGMTKAASKELAYLGVRVNAIQPGLIRSAMTEAMPQRIW
DSKVAEVPLGRAGEPDEVAKVALFLASDLSSYMTGTVLEVTGGRHL
145224946YP_001135624.1 butyryl-CoA dehydrogenase [Mycobacterium gilvum PYR-GCK]MSRLAQTLGLTEFQTEIVSTVRQFVDKEVIPTAQELEHADTYPQAIVDAM
REMGLFGLMIPEEYGGLGESLLTYALCVEELARGWMSVSGVINTHFIVAY
MIRQHGTDAQKSHYLPRMATGETRGAFSMSEPELGSDVAAIRTRAKNNGD
GTYTIDGQKMWLTNGGSSTLVATLVRTDEGADKPHRNLTAFLIEKPTGFG
EVAPGLTIPGKLDKLGYKGIDTTELIFDGYRADAGDILGEAPGQGFFQMM
DGVEVGRVNVSARACGVGIRAFELAVKYAQQRSTFGKPIAEHQAIAFQLA
EMATKVEAAHLMMVNAARHKDSGERNDVAAGMAKYFASEVCAEVTQQSFR
IHGGYGYSKEYEIERLMRDAPFLLIGEGTSEIQKNIISKRLLADYRV
145224944YP_001135622.1 L-carnitine dehydratase/bile acid-inducible protein F [MycobacteriuMTGVLDGIRVLDYGRFIAAPWCSALLADMGADVIRVEKREGGEDRWVQSI
ADSGEGGTFLQCNRNKRSLTLDTTTAEGREVTRKLVAGADIVVANMPAVG
MRTSGLDYDTLRTIKPDIILASATAYGEGGPYSDRIGFDGAGQVMSGAVY
RQGLPDQPIRTVVPYADFGTALTLTIGVMMALYHRDRTGEGQHVEGALLP
TAMMLSNAFLIERDLLGTDKPRMGNQGTSVAPCDLYRTSDDGWVLLQIAG
PSMFRRWCRLVGRPELFDDPRFADDDLRWQHGEELNGIMAQWCADKTKAE
VLELLEAAKLPAAPMHSTQEVLEDPHVQAMGYLKRVPFPGTPKDVPLIET
PFRLSATPGEIRRRAPLLGEHTDEILEEIGYSSEAVVGLRDRGVV
145224942YP_001135620.1 AMP-dependent synthetase and ligase [Mycobacterium gilvum PYR-GCK]MSDPCTVAEVLRAQRRHGDKPLLICDDERLSYAEADERSAVLAARLTTLG
VGKGSHVGILYPNGAQWVVAMLAAARIGAVVVPFSTFSTAVELRRQLRDS
DVGVLLATRAFRTHDYVRALGEAVGVPLDDGPLLSAEVPVLRHVVFDAEC
GGAADVSALEGDVDGSDVLAIIYTSGSTSDPKGVVHTHTSLLAHQRGLNE
IRGLTAEDRLFCNSPFFWIGGFAFGLLATLVAGSTLICSTASDAGRTLDL
LEAEKPTMTNGFVAGITHLTRHPSFARRDLSSMRRGNLYSIMAPDVRPAD
PELRHNMLGMTEAGSVVLLSGDESDQPEARRGSYGFLAPGFDARVVDPDT
GSDTDGAVGELVLRGPHLMQRYYGRSREECFDADGWFHTGDLVRRDDDGV
FYFVGRAGSMIKTAGANVAPAEVEKALSAALQAVDAGVAVHVVGLPDPER
GQIVAAVIATDNGTVFDEPAVKEALSTQVSAYKIPRRVLSLRHTEIPTMS
SGKIDLAALRRLFDD
145224940YP_001135618.1 enoyl-CoA hydratase/isomerase [Mycobacterium gilvum PYR-GCK]MPMTFETIDLDLDHDVRVATITLNRPEALNSFNRAMCREMRDAWHLVKSD
ESINAVVLRAAGDRAFSAGLDVKSSYGQPDIVWNHEDPGELLSPKWQKMW
KPVVCAVQGMCTAGALYFVNEADVVICSDGATFFDSHVSAGLVSALEPIG
LMRRVGLGDTLRMALMGNDERVGAQTALRIGLVTEVVPEDELWSRAHEIA
TAIAAKPPTATQGTVKAIWESLDKPYRAAMDQGLIYTRLGNPIAKAELAE
RPIPKTAPRIR
145224938YP_001135616.1 enoyl-CoA hydratase/isomerase [Mycobacterium gilvum PYR-GCK]MRDDADAGAVRLTRDDAVLHITLDRPSRRNSLSRTMIGTLVDTLTEAASD
DSLRAIHLTGVGKDFCAGSDWVATNSGGGKPRPGNLLRRVPHQANRVVEL
LATIQLPVVCTVRGWAVGLGCNLALAADFTVATPEANLWEPFIDRGFSPD
SGATWLLPRLAGVARAKRMLLLGEKVTGADAADWGLIHQAVPQDEIAGVA
EDLMHRLAAGPTVAIGLAKRSIHYGMHATLPQSMDHELSDLELACRTSDF
KEGLAAFRDRRAPGFTGR
145224936YP_001135614.1 enoyl-CoA hydratase/isomerase [Mycobacterium gilvum PYR-GCK]MTTTDDDRVLFDVDRDTRIATITLNNPKQRNSYDAAMRNLLARHLDEVAE
DDDITVVLLRGAEGVFSTGADMNNAYGWYGPEDPAGAGKPRKSRPSQRRR
LTVDRKSFGFYHNLMGFPKVTVGEISGYALGGGFEMALMTDISVIARDTR
IGMPATRFLGPALGSLHLFFHRLGPVQARRLLLTGDIIRAADVEHLGVFT
ETCDADAVTARARYWAEKAAKMPADGVVIAKEAFRLVEQSQAYQGEEVAS
YLFHAYGTNLQFADGEFNFVKTRAQHGTKEAFRLRDEHFHVPEP
145224934YP_001135612.1 TetR family transcriptional regulator [Mycobacterium gilvum PYR-GCKMARQATAEKRQRRERGSINPDDIIKGAFELAEQVGIDNLSMPLLGKHLGV
GVTSIYWYFRKKDDLLNAMTDRALRQYAFATPYVEARDWRETLANHARTM
RKTFNGNPILCDLILIRSALSPRAAKVGVQQVEKAIGSLVEAGLSPEDAF
DTYSAMSVHVRGSVVLQRLREKNLAGDDGHGDIDDTMAIDPETAPLLAAV
TQKGHHLSASDDRNFEFGLDCILENAARLIEKAKTTRKAPARKR
145224932YP_001135610.1 short-chain dehydrogenase/reductase SDR [Mycobacterium gilvum PYR-GMDLGLRDATVVVVGGGRGMGLAAAHCFADDGARVALVGRTRDVLDEAAAQ
LRGRGSPDAVGVVADCADEAAVQRAFGELAERWNGELNVLVNAVGPTVRG
TFDELSDADWRQAVDEGAMGMVRCVRAALPLLRAAEWARIVNFSAHSTQR
QSVILPAYTAAKAMVTSISKNLSLLLARDEILVNVVSPGSIASEALVGWA
DSVGVDGSDPYALMAAIDEHFGHPAHLPRAGLPTEIGSVVAFLASRRNSY
MTGADINVDGGSDFT
145224930YP_001135608.1 enoyl-CoA hydratase [Mycobacterium gilvum PYR-GCK]MSAVDRAVDRRAEPVLFDLHDSGVAVLTLNRPDRMNSWGGGLARAFYECI
DRAEADPDVRVIVLTGNGRAFCAGADMGDLDSISGASDSSDTDVTQLVGE
RHPHFVTQLRTPIIAAINGACAGIGLTQALMCDVRFAAAGAKFTTAFSRR
GLIAEYGISWILPRIVGWGAAQDLLLSGRTFYAEEAKSLGLVNDVVAPDE
LMAHTLSYAEDMARNCAPSSMAVIKRQLHKDALRNLHDASAEAETLMHES
MLRPDFIEGITAFFEKRPPSFPPLSTQKEETP
145224928YP_001135606.1 acyl-CoA synthetase [Mycobacterium gilvum PYR-GCK]MPEWTIGGVVDAIAEAIPDRLMTVCGSRRSTYAETAERTRRVANFLSANG
IGAHQERDTIDGWQCGQDRVALIMHNDLYPDMVIGALKARAVPVNVNFNY
TPREVDELLAYLRPRAVIFHRSLGAKFADVLPRTGVEVMISIDDGSDAPE
LTGAVTLDDALAAGDADQPITPSPDDVMMICTGGTTGRPKGVMWRQSDTY
VVSMNGADHESVDEIHAKVQHAGPPWFAVSPLMHAAGMWTAFAALLNGQT
VILYDKPTLDAAAVLETAEREKVGLMTMVGDAYARPLIAELQRRPYDLSS
LFAIGTGGAATNQRHQDALLELLPQITLINGYGSSETGNMAFGRSLRDDR
KDTFERRDGVVLLSEDRTRFLEPGEDEIGWVAREGRIPLGYFDDADATAR
TFPVVDGRRVVISGDRASLEADGTIRLYGRDSLVINTGGEKVFVEEVEEV
LRAHHGVADALVIGRDSDRWGQEIVALVQKQPDAVVDPSALLDACHEALA
RYKAPKEFLFVDRVRRLGNGKADYRWAKSQVAPQDTLAGQP
145224926YP_001135604.1 acyl-CoA dehydrogenase domain-containing protein [Mycobacterium gilMDRYELRRLDYSLSEDHQALQAAYKDLFATRCTIDTVRAAEESGFDKNLW
ERLCAMGATTMALPESVGGDGATLVDLTLVAEEIGRSLAPVPWIDHVVAA
RLLARLGSVDADVVNGKNLVALDPAPDSAGVRLIPAGSIADRLLVRDGDE
IVALSFSSRPARVDNIGKLPMAWVDPAAADSRTVLASGAAALAEYQRALD
EWQLLTAAALVGLVEETMTIAAEFSKTRYTLGVPISTLQAISHPLANIAI
VVQGGRNLARRAAWFLDNEPDERRELAPSAFVFMAEEAAKAATMAVHVQG
GLGVSAEAAATAYLVRARGWAIAGGDPGVTAKYIAQIVADREGRS
145224924YP_001135602.1 thiolase [Mycobacterium gilvum PYR-GCK]MHDVAIIGVGLHPFGRFEGKTAMQMGVDAITAAVADAGVSWNDIQFGVGG
SWTVANPDAIVGMLGLSGIPFTNVFNACATAASATKTCADGIRLGDYDIG
IAVGLDKHPRGAFTEDPGLVGMPSWYAENGQYLTTQFFGMKANRYLHTHH
VSHRTLAKVVNKNLRNGALNPNAFRRKPMDEDAILNSPMLNYPLTQYMFC
SPDEGAAAVVMCRADLAHKYTNKPVFVRAVEVRTRKYGAYEVNTTFAPVD
EDVAPTVYASRAAFEKAGIEPSDVDVIQLQDTDAGAEIIHMAEAGFCADG
EQEKLIADGATEIGGTMPVNTDGGLLANGEPIGASGLRQLHEIVRQLRGQ
AGDRQIPGDPKVGFAQLYGAPGTAGATILTT
145224922YP_001135600.1 cytochrome P450 [Mycobacterium gilvum PYR-GCK]MDVVGQSVADVHFDPFSADFYDDPHACYPRLRAEAPVYYNQTYEFYALSR
HADVAAGLKDFATYSSAYGVDLGMVRRGEKVPAKMIISLDPPEHRAMRSL
VNKVFTPRAIEELRAMVSDTVGRFLAAAVGDAGSEGSEFDVVQDFSAYFP
VEVITQMLGVPERFRQQVRLWIDESLHREPGQIDISESGKQAMAEMWLMY
YELIQQRRDDPGDDMISALIAAEVQREDGAVDRLRDSEIAGFATLLGGAG
AETVTKLIGSAAVTFARHPDQWQQLLADRGKIGVAIEELLRYDAPVQYNV
RRSNVDVTVHGVTIPAGAPVFLLGASANRDPEAWTAPDTFDINRDRSEAQ
NLAFGYGIHSCLGAALARLESAIALDKLLDLMPRYEVRWDRCRRVSMQNV
SGWSHVPVRILP
145224920YP_001135598.1 L-carnitine dehydratase/bile acid-inducible protein F [MycobacteriuMIKVMEGVRVLEVAQFTFVPAAGAILADWGADVIKIEHPVRGDTQRGFIN
MGGFQLDPNRHPLIEHPNRGKRSVGIDVSTPEGQEVLYEIAKTADVFLTN
YMPQARQKNKFDIEHIRAVNPNIIYARGSAYGDKGPERLVGGFDGTAFWT
RSGVGHALTPEELGGALPQGIPAFGDSIGGMNIAGGISAALFHRERTGEA
VEIDVSLLSTAWWAAGASVTQGMETGETMRSLMPGTTTSVNPFMANYQTS
DGGTINLCIVSPTGYIRDTWEHLGLPELADDPRFSDVMPLIQNAEEGVRL
ITEAIAAKPFEYWRRHLKTMKGQWAPFQSLVDLGTDEQAIANDMIVEVEA
SDGGKPFKVVRGPVQFNHEPLETTRAPQASEHTEIVLMELGLEWDRIEEL
KDKGAIA
145224918YP_001135596.1 cytochrome P450 [Mycobacterium gilvum PYR-GCK]MRVDTPVQDVEMDGPIDLRDPYPMFARHRAEGGVFRGSVMDWSKTPESLM
PEKLYAAVSFDAVNRVFRDGKVFNSKIYDATIGLFIGPTILAMEGKPHWE
HRNLVSAAFKTRSLARWEPEIVRPVVNGLIDEFIDRGSADLVRDFTFEFP
TRVISRLLGLPEDDLPWFRKRAVELISYTINHKRAFEASAALKDYFLAQI
EKRRCAPTDDIIGDLVSAEIDGEHLTDEAIFSFLRLLLPAGLETTYRSSG
NLLYLLLTHRDQFDAVDADHELIGQAIEEGLRYETPLTTVQRFTTEDTEL
EGVPIPAGAVIDVCIGSANRDEKRWERSEEFDIFRKRVPHLSFAAGEHTC
MGLHLARMETRVAVETLLTRLSDIRLVTDDDPHIHGQPFRSPTALPVTFS
PAAAK
145224916YP_001135594.1 hypothetical protein Mflv_4337 [Mycobacterium gilvum PYR-GCK]MTRGDKTLCVIYAAVALVALVATWWHNVAFILSGQGESLLDFIRAAYANH
AGASLTNDLLLLGVAVFVFMVVEARRLGIARIWLYLVISIGVAISVGLPL
FLIVRQVALARTRGAEKGAQA
145224914YP_001135592.1 acyl-CoA synthetase [Mycobacterium gilvum PYR-GCK]MTEPNQFTVPAAADAVAAVIGDREFIIQGERRYTYAQIVERSNRLAAFLH
AQGLGCHTERSELPGHEVGQDLLGIYAYNGPEYVEGMLGAWRARVAPFNV
NYRYVKSELQYLLADAGATALLYHSAFAPRLAEVLADLPSLKVLIQIADD
SGNELLPGAVDYESIVAEGPAEVPPVQPSPDDLYVLYTGGTTGMPKGVLW
RQHDIFMASFGGRSLYTGELISSLDDVAQRCVESPGTTLMVLPPLMHGAA
QWAVFTAMNTGQSVVFSPVTEHLDVDDVVATIEREKVLAVTVVGDAMARP
LADAFERTTADLSALAVVANGGAQLTPSAKQRLIDVKKNLMVVDGVGSSE
TGAQMTHMSAPGAVSTGKFTAGPDTFVASEDLSTILEPGHDGMGWLAQRG
YVPLGYKGDATKTAATFPVIEGVRYSVPGDRARHLADGAVELLGRDSVTI
NSGGEKIFAEEVESAIASHPAVADVVVAGRPSERWGQEVVAVVALDSGAT
ATAEELIDHASAVIARYKLPKAVVFRPAIERSPAGKADYRWAREQAISGS
145224912YP_001135590.1 Rieske (2Fe-2S) domain-containing protein [Mycobacterium gilvum PYRMKVPFTWKVTGWFMIGWSAEFEVGDVKALRYFGEDLAAYRDESGRLHVLE
AHCKHLGAHIGHGGKVVDDCIECPFHGWRWGPDGSNTYIPYQPDRPNRGL
RLRSYPVEEQYGCIFMWYQPQGKEPQWELPDIFHKFPQFETDANAYYRPY
PEFSSRADAIPVHPQIVAENGPDSSHFRYVHGATVTPVCLHWEHVDEEWR
FLTGWPDARSDDPDKMALRIHSHFSGLGFAMSAFEGSSNHRLIFACTPVD
DEVSDMFYSIWWPKLPGETSDIPPAEVIEKVERQFLKTVWEDCDIWRYQK
YVENPPLAKIDAKPYMAMRKWAQRFYEVPPVGDPVASR
145224910YP_001135588.1 hypothetical protein Mflv_4331 [Mycobacterium gilvum PYR-GCK]MKTSERLWRIGSDFAGVLPRAHSAVAVGQAWNPLSVRGLRQLGEVALDEL
ALTGMTLTAPPPRLERSEASCAAAAAELAGLGVTGANADPDPVDIGSLRR
RRLGRHRYEQLTFDHDPHLPDTLSAEGFGGAATAVAHLCRTDSKRRPWLV
WVHGAGQGQPIDLLFSRARRIQDELGVNVALPVQPGCGVRASAWPEYPTM
DPLANVAGMLRVVSEVRALVRWLRPQATAIAVAGVSMGSPVAGLVSHLEP
VDAVAVYTPIFGLNAMIAAHLGRWGPSVDDTVALLRSEVVEQVSAAVDYQ
AVEPSASPDRRLIVGAWHDRMAMREPAQVLHARWGGELYWHQGSHVGHLF
APGVHTASEKFLRSLTG
145224908YP_001135586.1 hypothetical protein Mflv_4329 [Mycobacterium gilvum PYR-GCK]MTRTAREVVEQYNLIVWNERDFALAEELMGDTVIRHDVGESTTLTHEQAV
ARVVDHWAMFESIRFDLNLVIAGDDGEHVTIVYQSPMKLKDGTETTIGSM
EIFRVVDGRITEVWNCGYKQGVWA
145224906YP_001135584.1 propionyl-CoA carboxylase [Mycobacterium gilvum PYR-GCK]MAKAEDWAETLDELSRRRDHSRAMGGDERLARHHGKGKLDARGRIQHLVD
KGSFREFGTLVGGDIAADGIITGAALIDGRPVMVGAEDFTTLAGSIGPGG
NAKRYRLAELALRDRVPMVMLLEGAGFRPSGEHYGRTPTDLLAQAQCSGK
VPTVGGLFGPSAGHGALVAPVCDWTIMTGQGAIFTAGPPVVKESTGEDIS
KEDLGGPSVALASGVIHNLGADDAAVLDDIRRYLSFFPSSAWSYPSSTPP
GEGTGHRATPELLDIVPRGNRQVYDMSDVLDVVFDDSGWFEVQPRFGRAM
ITALARLGGHPVAVVANQPKVLAGSIDADAADKAAHFIMVADAFHLPIVF
LADNPGMLPGSRSEKTGVLRSGARMFAAQTAASTIKLHVTLRKAYGFGSM
VMSLLGFDNQSATFAYPGATMGAMSAAALSRASNATEDLEAKLRQAEVDA
SFRSAGHLGFDDLIHPQETRDVLLDALERGLYSRQAAAQPVTRTVITP
145224904YP_001135582.1 cytochrome P450 [Mycobacterium gilvum PYR-GCK]MSVRVADEAGKVFADPTAYADEQRLHAAMTHLRANAPVSWVDVEGYNPFW
AITKHADIMAIERDNTVFTNSPRPVLTTAEGDAQHASMGVSTLIHMDDPQ
HRKVRAIGADWFRPKAMRALKVRVDELAKTFVDQMYDRGGECDFVQEVAV
NFPLYVIMSLLGIPESDFGRMLTYTQELFGSDDAELQRGTTMEERGLALF
DMFTYFNELTASRRAQPTEDLASAIANARINGEPLSDIDTVSYYLIVATA
GHDTTSATISGGLQALIENPDQLARLQQAPELLPLAVEEMIRWVTPVKEF
MRTAQQDTEVRGVPIAAGESVLLSYPSGNRDEDVFTDPFRFDIGRDPNKH
VAFGYGVHFCLGAALARMEINSFFSELLPRLTSVELAGRPEHIATIFVGG
LKHLPIRYSLTR
145224902YP_001135580.1 hypothetical protein Mflv_4323 [Mycobacterium gilvum PYR-GCK]MGDNDYRRYLDHHARTHAGQVPMTEREYWRRRHAQADAEPGARCC
145224900YP_001135578.1 ATP-dependent DNA ligase [Mycobacterium gilvum PYR-GCK]MLLVDVAGASADVAASSARLAKIARIAELLRRAGREDVAIVVSWLSGELT
QRQIGVGWASLRSVPAAAAEPTLTVAEVERRFGEIGATAGRGSQARRAQL
LADLFSAATDVEQTFLRRLLTGELRQGALVGVMADAVAKAADLPAATVRR
AAMLGGDLPAVAAAALTDGDAGLAQFTLQAGKAVGPMLAQTAADVTDALD
RLGGTAMFEAKLDGARVQIHRRGDSVSIFTRSLDDVTARLPEVVEATLAL
PVTDLIADAEAIALRPDGRPHRFQVTASRFGRRGGTSDTASNPLSVFFFD
LLHVDGVDLLDAPAHERIARLDAVTPDSQRVDRLVTSDPGAAQEFFDRTL
AAGHEGVMAKSTVAPYEAGRRGAGWLKVKPVHTLDLVVLAVEWGSGRRSG
KLSNIHLGARDPGTGGFVMLGKTFKGMTDEMLAWQTRRFLDLADGDATDH
YVVKVRPEQVVEIAFDGLQTSTRYPGGMALRFARVVRYRDDKAATDADTI
DTVREIYERGN
145224898YP_001135576.1 short-chain dehydrogenase/reductase SDR [Mycobacterium gilvum PYR-GMEIEGKKAIIVGGASGFGRATAEALAKRGATVAVLDRPQSKGKEVADQIG
GTFYEVDITDFEGTESVLNKVVEDLGGLHIAVTTAGGGIAERTVKKDGPH
SLDSFRKSIDLNLIGTFNISRIAAWHMSKNEPVDDEAEERGVIINTASIA
AFEGQIGQLAYTASKAAIAGMCLTMARDLGSLGIRALAIAPSLFATGLTE
GIPDEFATVLTKDAAFPKRLGKPEEYAKLAVAIVENPMLNGQCLRLDAGQ
RFAPK
145224896YP_001135574.1 hypothetical protein Mflv_4317 [Mycobacterium gilvum PYR-GCK]MLFAAGILGGLTGSIAGLASVATYPALLVAGLPPVTANVTNTVALVFNGV
GSVLGSRPELRGQRTLLTRAIPFAVLGGVTGAVLLLSTPAEGFEKIVPAL
LGFASLAILLPVRPAGDPSTASRRRRTLTLAVQGLAVFAICIYGGYFGAA
AGVLLLAMFLRLGGETLAHANAAKNVVLGVANGVAAVIFAVVAPVQWVAV
LALGAGCLVGSRIGPVVVRRTPDRPMRLAIGLAGVALAVKLGIDAYR
145224894YP_001135572.1 cytochrome P450 [Mycobacterium gilvum PYR-GCK]MTAISTPEYLLDQAKRRLKPTPVTIPGMGAIEKRLLEKQWDEIILAEPPA
GSGLKAVRGDNGLPIVAHMIEMFRGGPDFILHQYRKYGPVYYSGSQVLPA
VGALGPDATQAVFSNRNKDFSQRAWDPVIGPFFEGGLMLRDFEDHMYHRR
IMQEAFTRSRLTGYVEHIDQVASAVIANDWVADDRRFLFYPAVKELTLDI
ASVVFMGHKAGTDKQLVTTVNEAFTTTTRAGNAIVRKPVPPLSWWRGIRA
RKTLEDYFNAGIAEKRRSESTDMFSVLCHAQDEDGQSFTDQDVVSHMIFL
MMAAHDTSTSTLTTMAYHLAANPEWQDRCREESERIGDGPLDIEALEKLE
TYDLVINEALRMVTPLPFNFREAVRDTELLGYYIPAGTAIMTWPALNHRL
PELWTDPEKFDPARFAEPRNEHKKHRYAFAPFGGGAHKCIGMVFGQLEIK
TVMHRLLRKYRLEPVSPNYRPRYDHGGMAVPIDGMPIVLRPLH
145224892YP_001135570.1 short chain dehydrogenase [Mycobacterium gilvum PYR-GCK]MAQRSGSDRFSGKRCFVTGAASGIGRATALKLAARGAELYLTDRDADGLA
LTVADARALGGVVAEHRALDISDHDAVVAFADDIHSRHPAMDVVMNIAGI
SAWGTVDKLTHDDWTSLININLMGPIHVIETFVPPMMEARRGGHLVNVSS
AAGIVALPWHAAYSASKYGLRGLSEVLRFDLARYRIGVSVVVPGAVRTPL
VDTVRIAGVDRDDPRVQKWTNRFSGHAVSPDVAADKILDGVARNRYLIYT
SLDIRALYLFKRTMWLPYSIAMKQVNPLFTRALRPKTKQR
145224890YP_001135568.1 putative GAF sensor protein [Mycobacterium gilvum PYR-GCK]MASQVPGFDERLDDALVDEAARAGEPVDVFIARAVAARIAVEMARRSDPD
LDGILRRLRLMDLSPPRPGLPADTGSVIADPERLQALYETGLLDERRGPV
LDRIVEMTVAALAVPTAVVSLVDRDSVYLPSAIGMPGVLAAARQVSLERS
ISRPIVATGEPVIVEDARSHPALRDHPMVLDGFVVGFAAMPITNSGGHTI
GTLAVWDSTPRRWTDGHIQILEDFTAIICDRIFGRGAA
145224888YP_001135566.1 TetR family transcriptional regulator [Mycobacterium gilvum PYR-GCKMSAPENRNGLPVLSVAESGPSERAAERGDAARNRVLLLDAARRLVDERGA
DSVTTDDIANAAGVGKGTLFRRFGSRAGLMIVLLDEDEKAQQHALLFGPP
PLGPGAPPLERLLAYGRHRLKFVDTHHALLSDVGRDPQMRFNAPMTLHHS
HVRLLLDEAETTGDLDAQAAALLALLDADYVHHQRTDLGRSLESIADAWE
TVARKLCGT
145224886YP_001135564.1 glutaredoxin-like protein NrdH [Mycobacterium gilvum PYR-GCK]MPAHPAFLIGAVPQMTQPAPVTVYTKPACVQCNATYKALDKQGIAYEVVD
ISVDTEARDYVMALGYLQAPVVVAGSDHWSGFRPDRIKALAGAVTATA
145224884YP_001135562.1 ribonucleotide-diphosphate reductase subunit alpha [Mycobacterium gMDYHALNAMLNLYDADGKIQFEKDVQAAREYFLQHVNQNTVFFHSQDEKL
DYLIEKNYYEREVLDQYSRNFVKGLLDRAYAKKFRFPTFVGAFKYYTSYT
LKTFDGKRYLERFEDRVVMVSLTLASGDTTLAEKLVDEIMDGRFQPATPT
FLNSGKKQRGEPVSCFLLRIEDNMESIGRSINSALQLSKRGGGVALLLTN
IREHGAPIKNIENQSSGVIPIMKLLEDSFSYANQLGARQGAGAVYLHAHH
PDIFRFLDTKRENADEKIRIKTLSLGVVIPDITFELAKKNEDMYLFSPYD
VERVYGLPFADISVTEKYYEMVDDARIRKTKIKAREFFQTLAELQFESGY
PYIMYEDTVNRANPIDGKITHSNLCSEILQVSTPSLFNEDLSYAKVGKDI
SCNLGSLNIAKAMDSPDFAQTIEVSIRALTAVSDQTHIWSVPSIEQGNNS
SHAIGLGQMNLHGYLARERIFYGSDEGVDFTNIYFYCVLYHALRASNRIA
IERGTAFGGFEKSKYKSGEFFDKYTDQVWEPKTEKVRGLFADAGIRIPDQ
EDWKQLKASVQEHGIYNQNLQAVPPTGSISYINHSTSSIHPIASKVEIRK
EGKIGRVYYPAPYMTNENLEYYQDAYEIGYEKVIDTYAAATQHVDQGLSL
TLFFKDTATTRDVNKAQIYAWRKGIKTLYYIRLRQMALEGTEVEGCVSCM
L
145224882YP_001135560.1 hypothetical protein Mflv_4303 [Mycobacterium gilvum PYR-GCK]MSRPNAQSMKPATAAKKLDVYLPATPADFQQNPITRDELAALQADPPQWL
IDLRKNGPHPKNLVAAKLGVSIAALARNGVGTALTTEEINELVEENPEWL
AVEREGYQQVLREERRLKSLRADQAGDS
145224880YP_001135558.1 ABC transporter-like protein [Mycobacterium gilvum PYR-GCK]MRHGPTTSHDIGSRDGLGRRDVVDGDRAGGNRRSRGSRRPRYRRRVRDHL
RGADAGRTRRPDPASGRLARPGRRQGRATRRRCARRRGAEDDLPRRLLPA
AQRGERGHRPRDPRARPAHRGDQRESARGSDGAGRRRVAAYRRPVEAGEQ
VIVQRHQDDRPADPVQLRMIETSGLTKSFGPKKVLDDVSVCFPGGTVTAL
LGLNGAGKTTLLRLIAGLDRPDGGTVTVDGRAPGGDPNQVGVHLGPGALD
PRHTVGRHLKWLAALAGTEVRRIDDVLDETGLHAQRRERIGALSLGARQR
LSIAGALLCSPRALLFDEPLNGLDVPGIVWFRGLLRKLADDGCAVVVATH
LLAEVVLSADRVLMLDCGRPRVHGPLDNVIPAGDQPRDWLESALLDGARC
A
145224878YP_001135556.1 type 11 methyltransferase [Mycobacterium gilvum PYR-GCK]MADSPLPLAERSDADLPGHWLLARLGKRVLRPGGLELTTRLLTAARIQGA
DVVELGPGLGRTATDIVAERPRSYVGVDDTAAATEQVRSIVAPVGGKVVV
ADAASTGLPDGSADVVVGEAMLTMQGEKAKRAIIGEAFRVLRPGGRYAIH
ELGLSPDDLSQGIKDDIRRDMSRAIKVNARPLTSAEWTALLTDAGFKIES
VDHAPMALLNPARVLADEGPLGALRIVGNLIRRPAARKRVIGMRKTFQRY
RRSLTAVAVVGVVPGQ
145224876YP_001135554.1 hypothetical protein Mflv_4297 [Mycobacterium gilvum PYR-GCK]MDVVSLKATAAEQLEAARNAHAGRAAHTVYGGHEHKLRQTAIALLADHRL
DDHESPGEASLLVLHGRVRLSTSSESAELGEGEYLIIPAERHNLAALEDS
VVLLTVVTGI
145224874YP_001135552.1 WD-40 repeat-containing protein [Mycobacterium gilvum PYR-GCK]MSRIFLSHSSRDTRQAIALKQWLIEQTPPLANEIFLDVDPGSGLRAGTRW
KDALRQANARCEAVICLLSKNWEASHECKVEYRTAENLNKQIFVARLEPS
TGDDLTSEWQRCDLFGEGPTTAIDTGQGDPVEFATAGLYRLRDGIRGAGI
GAASFVWPPPRDPDRAPYRGWEPLDEADAAVFFGRDAQIVRALDTVRGMR
LSGVTSMFVVLGPSGTGKSSFLRAGLLPRLRREDRRFVVMNIVRPERNVL
SGDAGFAAALCATRSEFGLSEPSLGEVKAACLAGDADRVISMLAELRQVA
ADRLLQRGGDGDELVAPTVILPLDQAEELFNAEHAESSERFLDLLRQILD
AANGSDLGLAVAATIRTDRFEIMQTHPRLAGLGTALFDDLKPMPATQFKE
VIVGPAQRSTEGGRPLQIAVDLVDRLLADAGSGADTLPMLALTLARLYTD
YGSTGELTLRQYEGMGGMNRVVQSEIDEVLSRDAVQRTRQLQALRSAFIP
WLATINPDNGQPMRRVARLSDLPQDSRGLIDALVAKRLMVSDVRGGTTVV
EVALESLLRQWSELAGWLRDERKDLRDADDLIRGAAAWRGSNRNPAWLLE
GTRLSEAAALVNRPGFRERLREVHDYLDASHRRQQQERDDEEKRRRGELI
AAQEREQAAQERARYAQEQQLTAERHATTLRKRGRVLRSVLALTAVVAVV
AVAGLAWAVSANSRAAERFRQATSLRLTSDSLAMMRGTRPGGDIQAIQQM
VAARALTSSPDDYALSTIVEQDNNTTKIIPAQGVMAGVSYSPDGSRLAAS
GADGYVRVWDAESGQPVVDPIPDHQGVSEIAFSPDGQALVTADLDGVLRI
FDAGDFSVDHEIDTGTENLSSIAFTSDGSRFATIGNDRVIQVVDTDTGDP
VREFPSGHQGYVSELAFSPDGALLLSGSEDGTLQMWDAEAGTAIGPRIET
GGMVADVAFRPDGRRFVSSGNSVILWDTQTRKPIGDPLQGHVNAVTTVSF
SPDSQVLATGSADATVRVWDADTGAFLWNVMYGHEGRIWGLVYSPDGRHI
ASASSDGTVRIWNPLGSQPLLGHTAAVRDLSYSPDGEFMASAGEDGTVRL
WDPDTHQLLGRPLDAGVPLYALDFSEDSSTLVAGGDGGTVVLWNMGSRQV
AGRYETGRAGAIRTLEFEDKGERLSVLDWDGVASVMDIDGQQVGEEVPDV
EAITLSPAWNLAATSRMSENNVYVLPIGGDSQGSEVTLEGHTNRVGRLVF
NPDGSLLVSASDDTTVRRWNPATGESVGGPLAGHTDEVLDLAFSPDGTRL
VTGSADTTARLWDVATGRQIADPYVGHTEHVTSVAFDPDGGSFATGSRDG
TVRVRSVTASPEMLCAKLTTNMSHKQWDEWVSPDIDYVQACPGLPIAPD
145224872YP_001135550.1 hypothetical protein Mflv_4293 [Mycobacterium gilvum PYR-GCK]MRTASLSSTRTVVIRNVLAMIVAGLTGYLAAVAAWPQVHDLVPEQLRWFG
APNSAVTMGIVVIAYIALAVVLVRAGGGRRGGTPVAIVLILAIATTLLGV
ASYWRCQDETHPDFFTPLLWTAALLKGGDPARSLADGSCPSPMPVALNIA
QLSALAALFTSVAGVALALFRSQFDRLRLRLSRSVTVVVGGDDDASSLVA
AIAHTMGRTGTLVVVVGSAETDYARRARTAGACIVAVDLDDAEHLLAVPV
WDKLDRLYLLAPDPSTNLLRLRAVTARGGDERLRIPLVVRIDDPWQAAAW
RAQHFGGAHNRWAADTVGMYEVTARRLLDRTLTGPRVDRLFVCGSSQLTT
ALCADMLTRRLEAEYLGDDELPVLHVLAPDATQYQRDYAFTATQMGHADR
EADIVAVDEAPSVATLLRLVGEGDAQSTALIFADSTDYGSTATRIAARLP
DTTIHVHDHRADATRERVSVVGRLYTYRLSLDLPGGQAHDAWERAAILIH
RRYVAESGATGPAAEPWEELDEFYRESNRRQVRNALWMVEKIGGHTWNTW
GKPPDGVSTVALRELQPQEQLRQLGFDLTTATAMARAEHEDWCRYYRRHG
WRHGPRRDDRAKVHDKLIDWTQLESDPAMVAAALRSLAATLTKLRELGYR
SHSDASTHWERFRRAGTVIAEQRATAWTWTAHDGSTMHAAAGDWEVREES
GTDSWSVRDDIFRATHRHIGGNRWRRLGTVLARPANDGERIRTLEGTITA
PPGSWIVQGDHGDVWAVPGDEFTRRYALADHNRSNPGGK
145224870YP_001135548.1 geranylgeranyl reductase [Mycobacterium gilvum PYR-GCK]MTQRYDVVIAGGGPSGSAAAWQAAQTGAKVVVLDKAQFPRAKPCGDGLTA
RAVSYLQKMGLADEVATYHRVNRVTVFSPSRWELSFPKRPGMPDHGHTVS
REHLDTVLLKHAESAGAEIRQGAEVAGPEFDASGRVVGVILKSGEKVLGD
AVIAADGAYSPIKRALKIDSEYNGYSAIAIRSEMPANRPDTDSLDIYLKL
LFEGDQLPGYGWVFPMGDGIFNIGLGYVNSYKNWQSINATQFLGEFLRTL
PREWELPPIEELKKNKSVRAWRLPMGFTAWPPWRPGVLFTGDSLGAGKPA
SGAGISKALESGLAAGECAVAALTNGGPDDFTNYALRMEAAWGREYRRGR
IMHKLIGQPKLAEAGVKLIDNAAFRDRMLKALYKKAQGPQHSF
145224868YP_001135546.1 hypothetical protein Mflv_4289 [Mycobacterium gilvum PYR-GCK]MNTHSTPRAAAAAVTAHPVLPDGDDERFVGFGIMGLPFASGHYLALRQFP
ATTFAPAYTSVWHRDPSCTWTFYATTPGQQSCARYFSSATPNDPVQCDIR
VTWDSEWDVRIEIPDLLRWDVQLENTWATRTMTSLGGRLPQAAWTSKSAL
SLISRVAGPVLGAGDIRLTGTAANGQHYMVAPTTVWAVGASRAIVDGKDL
GPTGPLMRQARLGDFRCPQRGIGVIGSGHFENYDAERHLAAERTVAFG
145224866YP_001135544.1 putative monooxygenase [Mycobacterium gilvum PYR-GCK]MTVAESADTTAPPQTPVRTRTLIIGSGFSGLGMAIELQRRGVDFLILEKS
DEIGGTWRDNTYPGCACDIPSHMYSFSFEPKADWSHMWSFQPEIQEYLLG
VTAKYGLRRYIEFGAHVDRAHWDDAEMRWHVFTKDGREFIAQFLVSGAGG
LHIPLIPEFEGYDDFLASGRAAFHSAQWDHSVDIAGKKVAVIGTGASAIQ
IVPEIVEDVAELQLYQRTPAWVMPRPNNPIPEGMQRAFATVPGTRAAMRA
GIYWIHETVGFAMTKQPKLLKIGELLGKWNIRRSVKDPVLRRKLTPDYRA
GCKRILNSDTYYRGIADPRTEVITDRIARFTARGIVTADEHGRETEREAD
VVVFATGFHVTDSYTYVDIKGPGGEDLVDRWNREGISALRGITVAGMPNL
FFLLGPNTALGHNSVVFMIESQIRYAAKAIAAVEKKGVQCLTPTREAQDA
YNDELQDDLRGTVWSTGGCRSWYLDEHGVNRTLWSGMTWQYWLATRRFKE
SEYTFG
145224864YP_001135542.1 hypothetical protein Mflv_4285 [Mycobacterium gilvum PYR-GCK]MGQPRECHPGNHSAKTIRAGTASKKTLIVALSAFAVGCAGMASVPAASAS
ESGYWPLCGAFSLFSEGQCDAIKYYLSTDDPACRPDGTQPSPVPPQRWTA
Q
145224862YP_001135540.1 transposase- mutator type [Mycobacterium gilvum PYR-GCK]MVGIGRSAKNSYSKGTTMKKSNQIQSVDVSASAVPERVSVAMSEIAENMS
EGLLALAVGAGLQVMAALMEADVTALAGPKGRHDQARTAVRHGRERGSVT
LGGRRVPVTRPRVRAADGTGELAVASYELFSSTEILGRLAMEKMLAGLST
RRYPVGLEPVGVQITEKATATSKSAVSRRFVAMTETALAELLSRDLSGLD
LVALMIDGVHFAESCCVVALGIDIEGTKHPLALVEGSTENATLVTELLVD
LRERGLDVTRAMLVGLDGSKALRKAVLDVLDHPVIQRCQLHKVRNVKDHL
PQRLRTTVGCRMTDAYHAGSALEAEAALLALAKELDRTHPSAAASLREGL
DETLTVLRLGVPPTLARTLRSTNCIESMISVCREHAGNVKRWRDGQMALR
WCAAGMVEAGKQFRRVNGHLHLPALRAALEREVAEHVVPVVHNDQVSAA
145224860YP_001135538.1 TetR family transcriptional regulator [Mycobacterium gilvum PYR-GCKMRSRGWAGSTPASDEEAIARILDAVDDVVAERGPAMRLADVARRLGVTRQ
TVYRYFPNADALLIASAMRTADGFIDQVAAHAAGIPDPVTALVECVSFGV
QNLTGDPQLEGLLTPRHEGDAVISLTSDAAMTFCLSIFRRLDVDWALHGF
DDTALTELAEMTLRTVHSILVDPGEPPRDESELRRFVTRWLGPAILYPRI
TVLAGARR
145224858YP_001135536.1 alcohol dehydrogenase [Mycobacterium gilvum PYR-GCK]MSTVSAYAATSATEPLTKTTITRREVGPHDVAFDIHFAGICHSDVHTVRA
EWGQPAYPVVPGHEIAGIVTEVGPEVTRYKVGDRVGVGCFVDSCRECEEC
RAGEQQYCTGGGMVGTYNGVGRDGEPTQGGYSGAIVVDENYVLRIPDSIS
LDKAAPLLCAGITTYSPLHHWNAGPGKKIAVIGLGGLGHLAVKIAVAMGA
EVTVLSQSLKKMEDGLRLGATDYRATSDRDTFKDLKGTFDLIINTVSANL
DLSDYLKLLKLDGTLVELGMPEHPMEVPAGALIFGRRSIAGSLIGGIAET
QEMLDFCAEHDVTPEIEVVAPDYINEAYERMLASDVRYRFVIDTASLR
145224856YP_001135534.1 cytochrome-c oxidase [Mycobacterium gilvum PYR-GCK]MVAEAPPIGELEARRPFPERIGPKGNLIYKLITTTDHKLIGIMYCVACFA
FFLIGGLMALFMRTELALPGLQFLSNEQFNQLFTMHGTVMLLFYATPIVF
GFANLVLPLQIGAPDVAFPRLNAFSFWLFLFGALIATAGFITPGGAADFG
WTAYSPLTDAIHSPGAGADLWIMGLAVGGLGTILGGVNMITTVVCMRAPG
MTMFRMPIFTWNILVTSILVLLAFPILTAALFGLAADRHLGAHVYDPANG
GVLLWQHLFWFFGHPEVYIIALPFFGIVSEIFPVFSRKPIFGYTTLIYAT
LGIAALSVAVWAHHMYATGAVLLPFFSFMTFLIAVPTGIKFFNWIGTMWK
GQLTFETPMLFSVGFILTFLLGGLSGVLLASPPLDFHVTDSYFVIAHFHY
VLFGTIVFATYAGIYFWFPKMTGRLLDERLGKLHFWLTFIGFHTTFLVQH
WLGDEGMPRRYADYLPSDGFTTLNIVSTIGAFILGLSTLPFLWNVFKSWR
YGEVVTVDDPWGYGNSLEWATSCPPPRHNFTELPRIRSERPAFELHYPHM
IDRMRREAHVGRAHGPEDGDVTRNEENVRT
145224854YP_001135532.1 GntR family transcriptional regulator [Mycobacterium gilvum PYR-GCKMTEALATRSLNVDLLARELGNWRTSSRSGPAYHGLADAIRLLIVDGRLPV
GARIPSERALSEALRVSRTTVTAAYTQLREDGYLNARRGARSTTALPLTP
TPALRPVTATANLAAATLAAPASVTARAFTEAADMVAPYLQEIGIELTGV
PPLRAAIAERYCARGLPTDVDEIMVTTGALHAISLILATYTQPDDRVLVE
QPTYHGALAAMASRGLRPVPVAMAPDGWELDAVEAAIRQLAPELAYLIPD
NQNPTGMTMPVGDRARLARIISETKTRTIIDETITDMWLDEQVPPPLATE
VTSRPDLVMTVGSMSKSFWGGLRIGWIRAERSTLATIATLRPAIDMGTPI
VEQLAAARLLAADEEVLPERRDILRSRRALLLRLLAEHLPDWQPVPGKGG
MSVWVRLPAPMSSALSAAASRMGLEIPPGPRFGVDGTLERFIRVPYTLPD
AQLVEAIELLARAWRSVTGLTAPEPATVVV
145225689YP_001136367.1 cyclopropane-fatty-acyl-phospholipid synthase [Mycobacterium gilvumMSDNSTGTKDMTPHFEDIQAHYDLSDDFFGVFQDPTRKYSCAYFTGPNVT
LSEAQIANVDQHLDALDLKPGMTLLEVGCGWGLTLQRAMEKYDVNVIGLT
LSKNQKAYCDQLLGKLGSERTFDVRLEGWEQFHSPVDRIVSIEAFEHFGF
ERYDDFFKMCFDVLPEDGRMTIQSSVGYHPYDLAERGKKLTFELARFVKF
MITEIFPGGRLPTTQMMVEHGEKAGFTVPQPLSLRNHYIKTLGIWADRLE
ANKDAAIAATDEENYERYMRYLKGCQYYFIDEAIDVSLVTYLKPAVAA
145225688YP_001136366.1 alpha/beta hydrolase fold protein [Mycobacterium gilvum PYR-GCK]MQVRTGTARSGELEIHYEDMGDPNDPAVLLIMGLGAQLLLWRKGFCEKLI
NQGLRVIRFDNRDVGLSSKLTGHHAGAPLLPRMARSLAGLPSPAAYTLED
MADDAAALLDHLDIDRAHVVGGSMGGMIAQVFAARHHPRTKTLGVIFSSN
NQAALPPPGPRQLAAILQRPKGSSRDEIVDNAVRVSRIIGSPGYPAPLDR
LRTDAIEGFDRSYYPAGVGRHFAAILGSGSLRRYDRQITAPTVVIHGRAD
KLMRPSGGRAIARAIPGARLVLFDGMGHDLPEPLWDDIVGELKTTFAEAP
145225687YP_001136365.1 hypothetical protein Mflv_5111 [Mycobacterium gilvum PYR-GCK]MSSTQRNQRTPHRAVARLDRVPLPMEAARIGVTGWQITRTGGRVLSSLTT
RGTLQQKVVKQIPQAFADLGPTYVKFGQIIASSPGAFGEPLSREFRGLLD
RVPPADSDAVHKLLREDLGDEPQNLFKSFDEKPFASASIAQVHYATLHSG
EEVVVKIQRPGIRRRVAADLQILKRGARLVEFAKLGQRLSAQDVVADFAD
NLAEELDFRLEAQSMDAWVAHMHSSPLGQNIRVPQVYWDLTSERVLTMER
ITGVRIDDVAAIRKKGFDGEALVKALLFSVFEGGLRHGLFHGDLHAGNLY
VDDDGKVVFFDFGIMGRIDPRTRWLLRELVYALLVKKDHAAAGKIVVLMG
AVGTMRPEAEAARDLEKFATPLTLKSLGDLSYAEIGKQLSTLADAYDVKL
PRELVLIGKQFLYVERYMKLLAPKWQMMSDPALTGYFANFMVEVSREHSD
TGPDA
145225686YP_001136364.1 hypothetical protein Mflv_5110 [Mycobacterium gilvum PYR-GCK]MFLPHQIVGDQLNKQFDANVRTNFFRGMDFAGPVGDPGWFGPGSAVWHVH
SHMPALVFGLQCAAFLERLDPSIYWMGVHHSRLVKPETKNNPMPEIDPQG
FWARLGHSVAFFTGTAYGSTPTAERLALAVRSMHHTIKGTRPDGARYDAD
DPEWLRWNYATVVWGIATAHELYHPQPLRGKKLDRYYGEFVRVGHALGGT
DLPATKQDTLDCLKSYLPRLAVTYGAAMATGPGLPIPLAALNWAVRDTMP
SWAKGLIQHRDPNIVERTARRATVWSIINGWHAAAGPLPEFAEATARVAD
GVDPDLAPHTVPAYQPGSDPVRTRTELEDAFA
145225685YP_001136363.1 TetR family transcriptional regulator [Mycobacterium gilvum PYR-GCKMSGAPHATRWAGVPLTDRRAERRALLVDAAFRLFGDGGESAVSVRSVSRE
CGLNTRYFYESFGGTDDLLGAVYDRVSAELSVAVADAMDHAEDSLRARTR
AGMAAVLHFSSADPRRGRVLFTDARSNPVLTARRAATQDLLREAVLTEGW
RLHPDTDPVAAATGAAMYTGAMAELAQQWLSGNLGDDLDVVVDHALRLVL
R
145225684YP_001136362.1 hypothetical protein Mflv_5108 [Mycobacterium gilvum PYR-GCK]MPALPPPIADERAGLREYLAAQQYAFHAIAFGLTDEQARSTPSVSALSIG
GLIKHVTHCQRGWMERVAAAPELCESDRRPMEDQADEYGDEFVVREDETL
ADILAAFQRQNDETIRLLESVDLGAAVPIPQHVPWFPKDVPAWSVRWVFF
HMIEELARHAGQGDIVRESIDGATLYELVAGLEGWPETEWLTPFTPAEV
145225683YP_001136361.1 hypothetical protein Mflv_5107 [Mycobacterium gilvum PYR-GCK]MSNDLTRRLAEQLDWHWAHQLRPRLAGLTDDEYFWEPVPDCWTVHRDGTV
DFAYPPPTPEPVTTIAWRLAHLIVGVLGARTHSHFGGPPADYGTWNYALD
AESALAQLDEAYAGWITGVRGLDDADLTKPCGPAEGPYAAEPMTALVLHI
NREMIHHGAEIALLRDLFAHTKEN
145225682YP_001136360.1 helix-turn-helix- type 11 domain-containing protein [Mycobacterium MSETTGRVLQLLGLLQSRRVWSGDELAARLRVTTRSVRRDIDRLRELGYP
VHASTGHGGGYQLGAGAALPPLLLDPDEAVAVAVCLRVAAGGSVAGVGES
ALRALSKLDQVMPSRLRSQVAAVHDTTVTLAGATDTPVEPEVLMTLARAS
RDHEHVTVGYTDVRGNVTSRRVEPYQLVTTGRRWYLMCFDRDRDDWRSLR
LDRMSDVRAVGTTFIPREAPDAASYVRRAISSSPYPYVARVRYRAPADVV
ARVFPAASVDVEPDGPDACIVTVGADDPQRMVPWLAMPGCEFEVLEPDEV
VDAVRVVAERIARAGAGGD
145225681YP_001136359.1 hypothetical protein Mflv_5105 [Mycobacterium gilvum PYR-GCK]MAAPSRILARSAAMLGIASLGAVGAVAFISVGAGTAGADVKRMAPRPVVT
SRQASQNSVIRINDMGVARGISEARLGDAGVVHAQGEVRDSVKAVQGSKS
RPFRGGFPSGPSIGEW
145225680YP_001136358.1 glycoside hydrolase family protein [Mycobacterium gilvum PYR-GCK]MDVLSAASTELFTGPPDAPMQVVRVTYRDCALPTPVRVEGAGLCTVGEPV
AEPGGVPVEVSVQVADPAPGRRRDATVVAGDTSAAFDFVDAEPGWTMFMV
SHFHYDPVWWNTQAAYTSVWTENPPGRCRQTNGFELVSAHLDMARRDPEY
TFVLAEVDYLKPFWDTHPWERADLRRLIAEGRVEIMGGTYNEPNTNLTSP
ETAIRNFVHGIGFQRDVLGAEPATAWQLDVFGHDPQFPGMAADAGLTSSS
WARGPHHQWGPMAEVDGRAGDPARMQFASEFEWIAPSGRGLLTHYMPAHY
AGGWWMDSSATLQEAEDATFELFTNLKKVALTRNVLLPVGTDYTPPNKWV
TDIHRDWNARYTWPRFVCALPREFFAAVRAELDARGGTASPQTRDMNPIY
TGKDVSYIDTKQANRAAENATLEAEQFAVFAGALTGATYPDAALAKAWVQ
LAYGAHHDAITGSESDQVYLDLLTGWRDAWQLGTTARDHALALLSDSVDA
SVVVWNPLSHNRCDMVTVRLEEPFTGGMIDRDGNAVPVLTEHGGRTVTWR
ARDVPSLGWQSYTFVPGDQGGGWEPSEGDEIANDRYRVRVDPARGGGVCS
LQADGRELVAEGRVGNELTVYAEYPAHPVAGEGPWHLLPRGPVTSSSQHP
ATAVRRYRSALGERLVIDGEIPGLFTYTQTLTLWHGVDRLDCRTTVDDFG
GSDRLLRLRWPCPITGAMPVSEVGDAVIGRGFALLHDPDSGESVDAAVHS
HTLDNPAFGWFGLSSALRVRFRGDAVRAVSVAEVISPSGCEPAVRKLVAA
LVRAGVTATCTAADAPRYGDLSIDSNLPDLRISVGGVDENAFTATILTGV
VGDPPRWIPAARPLREVWVPGADLRDPSTLPVLVVGADGDVDDAIAALID
DLADAQIRIDQDVDEHFESYTVAMINRGVPGFAVEADGTLNASLMRSCTG
WPSGTWIDPPRRTAPDGSNFQLQHWTHAFDYAVVAGEGDWRDLRMPSRAA
EFNQPLLPVPARHDPSRGGLPSWGSLLDVAPERDVRVAALKAHGNPTARG
SARRGGPHDGVTLRVVETLGRDAEVSVQSGLRHIDAPQRLNLIEEPLRET
RRTAHLAGYEIATLRTELNFPRIRNAEQMSLAPDAEPVQPLYARYWLHNR
GPAPLGGLPAVAHLHPHRLQAVGSEVVTLRLTVASDATDTALHGRVRLVA
PPGWDLGADELPFVVPPGEYLESTVEVRVPGDVMPGHYPVRAELALVGGE
IPAAWHQTVEDVAVISVGGHADPLLHWVAEPQAVHVDAGQVASLGVTVGS
AAHADLTVEAHLISPWGTWEWLRPNIVGGALPARGGLALHFEVAPPVGTA
PGRWWALIRVACAGELLYSPAVPVVVRR
145225679YP_001136357.1 putative malonyl CoA-acyl carrier protein transacylase FabD2 (MCT) MTGWAATVGADVITVADVDAREDLLRAGDRAHALPGPGTGEARQLRRWLT
QVLVAERIVAASPGADPAPSEQDLLLDEVGLMELGSVAAATLATPHGRAV
YASVTAEVQVGADAVSDYFARNPYRFAHGAARPGVWRGPSSPPRFDDVRA
LIHAHLLAAARRREYRRWLDAQCAALVTLADGYEHPGDPRQPDNTHRH
145225678YP_001136356.1 ROK family protein [Mycobacterium gilvum PYR-GCK]MALSMSDLTLTLDIGGTKLAAGLVDADGNLVRRAQTPTPDGDAETIWDAV
ASLLAETRSAADSTIGAVGIASAGPVDVPAGTVSPINIAEWHRFPIVERV
EAATGLPVYLGGDGLCMAMGEWWRGAGRNRRFMLGMVVSTGIGGGLVLDG
APFHGRTGNAGHVGHVVVEPDGDACTCGGRGCVETVASGPHLARWARAHG
WEGADARELAEAAGRGEDVALRAFARGADAVARTIASVAAVCDLDLVVVG
GGVAKAGSLLFDPLHQALRTYAGLDFLTDLRVVPAELGGDAGLVGAAALA
AHHGRFG
145225677YP_001136355.1 50S ribosomal protein L10 [Mycobacterium gilvum PYR-GCK]MAKADKATAVADIAEKFKESTATVVTEYRGLTVSNLAELRRSLGSSTTYT
VAKNTLVKRAAAEAGIEGLDELFVGPTAIAFIEGEPVDAAKALKKFAKDN
KALVVKGGYMDGRALSVSEVERIADLESREVLLSKFAGALKAKQSQAAAL
FVAPASQVARLAAALQEKKSAGDSAESAA
145225676YP_001136354.1 50S ribosomal protein L7/L12 [Mycobacterium gilvum PYR-GCK]MAKLSTDELLDAFKEMTLLELSEFVKQFEETFDVTAAAPVAVAAAGPAAG
GGAAEAAEEQSEFDVILEGAGEKKIGVIKVVREIVSGLGLKEAKDLVDSA
PKPLLEKVNKEAAEDAKAKLEAAGASVTVK
145225675YP_001136353.1 ABC transporter-like protein [Mycobacterium gilvum PYR-GCK]MGIGIQVEGLTKSFGSQRIWEDVTFDLPAGEVSVLLGPSGTGKSVFLKSL
IGLLRPERGKIVVDGTNIIECSAKELYEIRTLFGVMFQDGALFGSMSLYD
NTAFPLREHTKKKESEIRKIVMEKLDLVGLGGDEDKFPGEISGGMRKRAG
LARSLVLDPQIILCDEPDSGLDPVRTAYLSQLLIDINAQIDCTILIVTHN
INIARTVPDNMGMLFRKHLVMFGPREVLLTSDEPVVKQFLNGRRIGPIGM
SEEKDESTMAEEQAMVDAGHHDGGTEEIEGVPPQVMATPGMPERKAVGRR
QARVREIMHTLPPAAQEAIRADLENTQQTQPYPDGYSDGTTAHHARHDDE
TPTGRIPVAGER
145225674YP_001136352.1 hypothetical protein Mflv_5098 [Mycobacterium gilvum PYR-GCK]MVDRLSVLIGAGVLTAGMSAAVLTGAGVAIASPDTASSTSETSETSDTSG
SERVSEKPADPRGEKADETPDETEAPDSVEDVVQDLDDEPDETDDRDDAA
TEADLDTDVAVDADEADEVADVEEPQADVEVPAVEVPAVVDQPASTVAVE
EPVAAVLVPATTTTPIEAHVARASASEAATPPRRQTLLSVLGAVVFNIYS
VALRVLGGPPILPPNSTVTVRSSTLTIDCGDGYEVPADWYVPDGPTPTRL
IYFQHGFMAAGPFYSFTAARLAEATHSIVVTTSLTSNFLACDGCWVGGTP
MHRAVADLFGDGNSALGDSAVAAGYAGALLDGVDKVALIGHSAGGGLAAG
AAAAMTGTGAFDRLAGVVMLDGVGFGDVTPRALERLPLDFPIYNLAARSY
FWNMSGTTNTAMETWRPGGFNGVKLDDSSHGDAMTGGNVFVQVAMNLVTG
WPKPANARAAELISAGWLDDMFTATSASGFYGAPNATLSIETASGVATAR
VLPGPAEKLTFIDRLFTAGSMILFGIDFATCADTDAGPEAQIGESAGIGR
PNTALSLDGRAKAGQSIGQQCVHG
145225673YP_001136351.1 DNA-directed RNA polymerase subunit beta [Mycobacterium gilvum PYR-MLEGCILAGSRQIESTTNNSVPGAPNRISFAKLREPLEVPGLLDVQTESF
EWLIGAEDWFQRAVDRGDVDPKGGLQEVLEELSPIEDFSGSMSLSFSDPR
FDEVKAPVDECKDKDMTYAAPLFVTAEFINNNTGEIKSQTVFMGDFPMMT
EKGTFIINGTERVVVSQLVRSPGVYFDESIDKSTEKTLHSVKVIPGRGAW
LEFDVDKRDTVGVRIDRKRRQPVTVLLKALGWTNEQIVERFGFSEIMMST
LEKDNTAGTDEALLDIYRKLRPGEPPTKESAQTLLENLFFKEKRYDLARV
GRYKVNKKLGLNVGQPITSSTLTEEDVVATIEYLVRLHQGDQTMTAPGGS
EVPVEVDDIDHFGNRRLRTVGELIQNQIRVGLSRMERVVRERMTTQDVEA
ITPQTLINIRPVVAAIKEFFGTSQLSQFMDQNNPLSGLTHKRRLSALGPG
GLSRERAGLEVRDVHSSHYGRMCPIETPEGPNIGLIGSLSVYARVNPFGF
IETPYRKVVDGVVSDQIDYLTADEEDRHVVAQANSPLDGDGRFEEERVLV
RRKGGEVEFVSASEVDYMDVSPRQMVSVATAMIPFLEHDDANRALMGANM
QRQAVPLVRSEAPLVGTGMELRAAIDAGDVVVTDKAGVVEEVSADYITVM
ADDGTRHTYRMRKFARSNHGTCANQRPIVDAGQRVETGQVLADGPCTENG
EMALGKNLLVAIMPWEGHNYEDAIILSNRLVEEDVLTSIHIEEHEIDARD
TKLGAEEITRDIPNVSDEVLADLDERGIIRIGAEVRDGDILVGKVTPKGE
TELTPEERLLRAIFGEKAREVRDTSLKVPHGESGKVIGIRVFSREDDDEL
PAGVNELVRVYVAQKRKISDGDKLAGRHGNKGVIGKILPVEDMPFLPDGT
PVDIILNTHGVPRRMNIGQILETHLGWVAKAGWNIRLASDGADGSTEVPA
WAAKLPEHMLSAPADSIVATPVFDGAQEGELQGLLGATLPNRDGETMVNS
DGKAVLFDGRSGEPFPYPVTVGYMYILKLHHLVDDKIHARSTGPYSMITQ
QPLGGKAQFGGQRFGEMECWAMQAYGAAYTLQELLTIKSDDTVGRVKVYE
AIVKGENIPEPGIPESFKVLLKELQSLCLNVEVLSSDGAAIEMRDGDDED
LERAAANLGINLSRNESASVEDLA
145225672YP_001136350.1 DNA-directed RNA polymerase subunit beta' [Mycobacterium gilvum PYRMLDVNFFDELRIGLATADDIRNWSFGEVKKPETINYRTLKPEKDGLFCEK
IFGPTRDWECYCGKYKRVRFKGIICERCGVEVTRAKVRRERMGHIELAAP
VTHIWYFKGVPSRLGYLLDLAPKDLEKIIYFAAYVITAVDDEMRHNELST
LEAEMVVEKKAIEDQRDADLEARAQKLEADMKELEEEGAKSDVRRKVRDG
GEREMRQLRDRAQRELDRLDEIWTTFTKLAPKQLIVDELLYRELQDRYGE
YFEGAMGAESIKKLIETFDIDAEADSLRDTIKNGKGQKKLRALKRLKVVA
AFQTNRNSPMGMVLDAVPVIPPELRPMVQLDGGRFATSDLNDLYRRVINR
NNRLKRLIDLGAPEIIVNNEKRMLQESVDALFDNGRRGRPVTGPGNRPLK
SLSDLLKGKQGRFRQNLLGKRVDYSGRSVIVVGPQLKLHQCGLPKLMALE
LFKPFVMKRLVDLNHAQNIKSAKRMVERQRPQVWDVLEEVISEHPVLLNR
APTLHRLGIQAFEPQLVEGKAIQLHPLVCEAFNADFDGDQMAVHLPLSAE
AQAEARILMLSSNNILSPASGRPLAMPRLDMVTGLYFLTTEIEGDKGEFT
PAAKDQPESGVYSSPAEAIMAMDRGALSVRAKIRVRLTQLRPPAEIEAER
FPDGWNMGDAWTAETTLGRVLFNELLPRGYPFVNKQMHKKVQAAIINDLA
ERYPMIVVAQTVDKLKDAGFYWATRSGVTVSMADVLVPPEKQEILERYEA
AADSIEKQYQRGKLDKGERNEALVKIWQDATEEVGQALRSHYPKDNPIIT
IVDSGATGNFTQTRTLAGMKGLVTNPKGEFIPRPIKSSFREGLTVLEYFI
NTHGARKGLADTALRTADSGYLTRRLVDVSQDVIVRETDCETERGITVTL
AELQGDQLLRDQHIETSAYARTLATDAVDANGNVVVERGHDLGDPAIDAL
LAAGITEVKVRSVLTCATGTGVCAMCYGRSMATGKLVDIGEAVGIVAAQS
IGEPGTQLTMRTFHQGGVTGGADIVGGLPRVQELFEARIPRNRAPIADVS
GRIRLEESDKFYKITIVPDDGGEEVVYDKLSRRQRLKVFKHDDGSERLLT
DGDHVEVGQQLLEGSADPHEVLRVQGPREVQIHLVKEVQEVYRAQGVSIH
DKHIEVIVRQMLRRVTIIDSGATEFLPGSLTERGEFETENRRVVAEGGEP
AAGRPVLMGITKASLATDSWLSAASFQETTRVLTDAAINCRSDKLQGLKE
NVIIGKLIPAGTGINRYRNIQVQPTEEARAAAYTIPSYEDQYYSPDFGQA
TGAAVPLDDYGYSDYR
145225671YP_001136349.1 CaCA family Na(+)/Ca(+) antiporter [Mycobacterium gilvum PYR-GCK]MNGLWFVVGLITVIVGAEVMVRGGAEVAARLGISPIIIGLTVVSIGTSMP
ELAVGVVAAADGSGALAVGNIAGTNVVNILLILGLSALLVPLGLAMRTIR
FELPMMAVAALLFWGLAADGNLSRLDGGILVTAAVGYTAAVIWSARRESR
AIAAEFASEFAPEPAATTTEVRRRTATHVAMTVGGIVVVVIGADWLVDGA
VGMARQFGVTDALIGLTVVAIGTSAPELVTTVMTTLRGDRDIAIGNLIGS
SIYNILLILGITCLIPAGGLALPDSLVRLDIPIMVAVAGLCIPIFLSGRR
VSRMEGGLMVAAYLGYLAFVLSTQT
145225670YP_001136348.1 hypothetical protein Mflv_5094 [Mycobacterium gilvum PYR-GCK]MTPAQVGDTSLLMSDLKREGYVQVPDAFGERCTAPIRDAVTLLSQRGIPL
PFAFVFDELWLAFQGLSTFLSTALGADYRALPDFWVWYVPPNENAAGWGP
HRDRVQPTLDPDNSPHTLTVWLPFTDATPLNGCMYVLPAHHDPRFVERRW
DGDGNNVVHNPQDIRALPATAGSLLAWNQAVLHWGSRGSRLGKVARISAA
FEFQRGDRAPFNNPLLDPARIPTFSERLGLIGKQVLQYRHMYPLSDEVAA
VATTLFDRYMPRTMITLRG
145225669YP_001136347.1 endonuclease IV [Mycobacterium gilvum PYR-GCK]MLIGSHVHGDDPLAAAEADGADVVQFFLGNPQSWKKPPPRDDADVLKAAS
MPIYVHAPYLINVASANNRVRIPSRKILQDTCDAASEIGATAVIVHGGHA
DDNDMDAGFERWVKALASLKTDVPVYLENTAGGDHAMARHFDTIARLWDH
IGDMGIGFCLDTCHAWAAGEALVDAVERIKGITGRIDLVHCNDSRDAAGS
GADRHANFGTGQIDPQLLVAVVTAAGAPVICETSDEGRKDDIAFLREHVN
145225668YP_001136346.1 FkbM family methyltransferase [Mycobacterium gilvum PYR-GCK]MTTAFRDLLGPQRLTDVVDIGANPIDGEPPYSPMLTEGLCRVTGFEPQPE
ALHDLQSRKGPYERYLPYAVGDGSEHTLNICRGSGMTSLFEPDPATLGLF
EILGPYAEVVDRVALPTQRLDEVAEIEHLDFLKIDIQGGELAVFCNGREK
LADAVVIQTEVSFVTLYKDQPAMGAIDVELRSQGFIPHCFAAVKHWPIAP
YVVEGNPRQAVNQLLEADIVYVRDFSRPDSLSDEQLKHLALIAHHCYGSV
DLALRCVMLLEDRGSIEVGARQRYSEILTAS
145225667YP_001136345.1 triple helix repeat-containing collagen [Mycobacterium gilvum PYR-GMVTFGGGATPTPTSLGAAAVDLSGTSCGLICNGQDGTGQNGGILFGNGGS
GWNSDVVGMDGGNGGNGGLFGGNGGNGGNGLGGGNGGNGGNAGAFALFGN
GGNGGNGGVGVVGATGAVGAPGVAGATGATGVTSGVVGGNGEDAVGYGAT
GAAGAAGAAGAAGAAGAVGSAGAAGEAGETGTWGNAGLPGKAGDAGGAGA
VGAAGAAGTVGTAGATGGTGTGANGGAGGVGGVGGTGAAGAAGGAGGLGE
TGTTGGAGGVGGQGTAGGTGGVGGIGGAGSTGAVGGVGGKGIQGGQGLQG
GKGGDGGAGGKGGDADSMGSAGATGGKGGNGGNGGRGGLFGKGGNAGNGA
DGGTGGAGGAGGTGGTGGAGGTGGTGGTGGIGGAGSTGGTGGTGGTGGTG
GTGGTGGTGGTGGTGGTGGKGGTGGTGGAGGTGGDGGTGGTGGTGGTGGT
GGTGGTGGAGDGTGGTGGTGGTGGQGGQGGQGGTGGTGGQGGLGGGGGTG
GQGGTGGTGGQGGTGGTGGTGGTGGTGGAGGDGGLGGLGGFGGSGGTGGQ
GGLGGPGGSTGGAGGAGGQAGTAGKGGLFGGSGSAGKAGATGAAGASGGK
GAQGATGAQGATGAQGATGATGAAGKAGATGAAGAAGAAGSAGTTGAQGS
AGTNGANGANGSQGAAGKAGATGTTGATGAAGEDGDAGSGGSGINGGAGG
AGGAGGEGGEGGDGGKGGAGAEGGAGGGGGAGGSGAGGAGGAGGSGGSGG
SGGSGGSGGAAGDSDD
145225666YP_001136344.1 formyltetrahydrofolate deformylase [Mycobacterium gilvum PYR-GCK]MVEHTDADIHGPKDIGRLLLRCADRPGLIAAVSGFLTQTGANIISLDQHS
TEPVGGTFMQRTIFHLPGLTAARDGLEREFAEKVAEPFGIDFRLTEAAKP
KRVAIMASREDHCLLDLLWRNRRGELDMSVVMVIANHPDLADAVRPFGVP
FIHVPARTEIRDEAEQRQLDLLRGNVDLVVLARYMQILTPGFIEQVGCPL
INIHHSFLPAFIGASPYRRAKERGVKLVGATAHYVTDDLDEGPIIEQDVV
RVDHRHSVDDLVRLGADVERAVLSRAVLWHCEDRVIRHGNQTICL
145225665YP_001136343.1 glycosyl transferase family protein [Mycobacterium gilvum PYR-GCK]MPTDRPTICLNMIVRNEAHVVHEVLDSVAPFIDAWVIVDTGSSDGTQDTI
RAHMATLGIPGELHERPWRNFGHNRSEALDLARGHADYIWVMDADDLLVG
TPDFSGLTADVYQLHYGPDVSYWRRQLFRDGLGWRYVGVLHEYAECDGPC
AEERLHGDYHIESRRLGGRNLDPEKYARDAEVLLAEVERNPEDPRSVFYL
AQSYYDHGDYASANRWYRRRSEMGGFDEEVYYSLTRVADTMSRLGEPWPL
VQDAYLRAWEYRPWRAEALYAIARQYRDDQRYQLGHLFAERAARIPLPEG
DVLFVGAEVYTWRALDEQAVCASWIGKQNETFEICRQILRRDDVPDDDRQ
RVAANRDCGVPSLLEATAVYPDTLPHSLTRGGDVTVTLVAGPDRMASERT
LNSLLRCCSDITRVARLMVIDIGLWPEDRAALADAYPFLEFRQSRPAVRR
EQIRSEIGTKYWMDLGMGWQFFAQEDYIRRLTSALEAESSVCQVGVNYGD
ADKLTGCVAPLTTIRGNADTGRYVLTDTAADGPAMFDCTRWNHTENALRT
ASLDEVLCVLQR
145225664YP_001136342.1 type 12 methyltransferase [Mycobacterium gilvum PYR-GCK]MSIDTAYMRDALTRRLLRRGVSGGTITLPAVPAMVDEYVSMCNKIFAALG
RRFNADELSHLRSLLAKELANAFDGSNRSNIVISYDAPIGNVLNYHIQPQ
WTSLADTYDNWVATRKPPLFGTHPDARVTTLAAEIADPTTARVLDIGAGT
GRNALALAKKGHPVDAVELTPKFADILREEAYKHLLGVRVIDRDIFETLD
DLQKDYSLIILSEVTPDFRSPEQIRAVFELAAQCLAPGGRLVFNVFMPRP
GFMSDDAVNELADSARQLAQQVYSAIFFGDEIDTAGAGLPLRLMSNDSVY
EFEKENLPPGAWPHTGWYAEWVSGQDIFDVPREQSPVEMRWLVYQKTG
145225663YP_001136341.1 hypothetical protein Mflv_5087 [Mycobacterium gilvum PYR-GCK]MTDHRAQESGSSDDLKVSRTPQKVTRTTSPLTPIALLISLVAIGLAVWAL
VSMPEPASVSATGSPLSGNAKDRVCTAAHTVAMGVQRQTNANIGPEPAAV
EAVAANARLAMLGGGEYLLGQISPDTPQELADAARDFATTLQLIGTNALA
GATQDDELQAGRMKEAEARRGDLSRICSR
145225662YP_001136340.1 acyl-CoA dehydrogenase domain-containing protein [Mycobacterium gilMQDTHVVTNQVPPLVDFNPAASPVLAESLVREGGGWGADEVADLGALAGS
DRAQRWGDLADRHRPVLHTHDRYGHRVDEVEYDPAYHELMSVAVAHGLHA
APWADDRAGAHVVRAAKTSVWTPEPGHMCPISMTYAVVPALRHNPELAAI
YEPLLTSRDYDPELKLPTTKAGITAGMSMTEKQGGSDVRAGTTQATPNGD
GSYSLRGHKWFTSAPMCDVFLVLAQAAGRGERSDGGSGGLSCFFLPRILP
DGTRNRMFLQRLKDKLGNHANASSEVEYDGATAWLVGEEGRGVATIIEMV
NLTRLDCTLGSATSMRNGLMRAAHHAQHRSAFGAYLIDQPLMRNVLADLA
VEAEAATMLAMRMAGATDHAVRGDERETLLRRIGLAAAKYWVCKRATPHA
AEAMECFGGNGYVEDSGMPRLYREAPLMGIWEGSGNVSALDTLRAMATRP
ECVDVLFDELGIATGHDPRLDRHVAGLRPQFDDLESIQYRARQVAEDISL
ALQGSLLVRHGHPAVAEAFLASRLDGQWGGAFGTLPTGLDLAPILDRALV
KA
145225661YP_001136339.1 PaaX domain-containing protein- C- domain [Mycobacterium gilvum PYRMRRPANRMTARSVVLSVLLGAHPAWATAAELIRLTSDFGIRESTVRVALT
RMVSAGDLVRSEDGYRLSGRLLARQRRQDDVLEPRRGEWDGLWTTLVITS
VGADARTRAHLRNTLQNHRFAELRDGVWMRPANVEVQLGANITEKARILQ
ARDERPAELATHLWDLTGWAVDGRRLLKEMDDAHDVPTRFVAAATIVRHL
LTDPVLPDELLPADWPGADLRAAYNDFAAEMVARRDDVKLTEAG
145225660YP_001136338.1 enoyl-CoA hydratase [Mycobacterium gilvum PYR-GCK]MTIRVEKNGAVTTVIMDRPQARNAVDGPTALALHAAFDEFDKDDSASVAV
LWGDHGTFCAGADLKAMGTADSNPVHRTGPGPMGPTRMVLSKPVIAAISG
YAVAGGLELALWCDLRIVEQDAVLGVFCRRWGVPLIDGGTVRLPRLIGHG
RAMDLILTGRAVDADEAKSIGLANRVVPSGAARQEAEDLAAELAALPQQC
LRSDRMSALNQWGKSESDAMDVEFGSLSRVAAESLEGAARFSAGTGRHGA
KT
145225659YP_001136337.1 hypothetical protein Mflv_5083 [Mycobacterium gilvum PYR-GCK]MTSSRARVIGLLGAAAVVLAACGSGDGDNPTVTAGTSGAQVEIGNTINYG
SFGTTAEIDCADGKSVNVGGSNNTLTVKGTCAKANIGGADNKIDFERVET
ELSVVGLNNTVTYRDGDPQVNDTGSNNTITKG
145225658YP_001136336.1 hypothetical protein Mflv_5082 [Mycobacterium gilvum PYR-GCK]MSTSPLASAENGDTHVTGVGVVRTVDCRDSTLFVNGNGNQVFAIGNCYAV
TVQGSSNLVVADNVVNDITVYGWDQKVFYKNGAPFVWDRGRELGMTNQIN
RVSA
145225657YP_001136335.1 hypothetical protein Mflv_5081 [Mycobacterium gilvum PYR-GCK]MLQRVGRVAFPFLVAVSATATATSCAHTVTGTPRSAQASVPDPDRSYGYV
DDRCGLLEDGTVQELLGADVVTRPYSGAVCQYVLALESAPDATTIDVVYS
WFDAGTLQRERDLATARGAVVEDTVIERHQAFLARRDTTGAACSATAAAG
SGVLAWWVQYRGRESAGDPCAEAEKLLSATLRSDM
145225656YP_001136334.1 hypothetical protein Mflv_5080 [Mycobacterium gilvum PYR-GCK]MTAGSAARLAAALSLGALLAGCGAPDRPVTPPSSPAAPGDGFESADCNGV
TDADVARAAGPGMFAPAVVSDVGCFWQEDTMIEDVGAGMGITTWWYRGSD
MDTERDLEQLAGRTLTEWSIDDNEGFKAFDDSACSIYVAKGGDVITWSIQ
TMNSATMPDLCPVVEQLAQLSQQRVN
145225655YP_001136333.1 TetR family transcriptional regulator [Mycobacterium gilvum PYR-GCKMAARPPRTAKLSRDSIVNAALTFLDREGWDALTINALANQLGTKGPSLYN
HVHSLDDLRRTVRMRVVGDIIDMLNTVAQGRNPDDAVVVMASAYRSYAHH
HPGRYSAFTRMPLGGGDDPEFTEVTRAAAAPVIAVLSSYGLDDEAGFYAA
LEFWSAMHGFVLLEMTGVMNGIDTDAVFTDMVMRLAAGMQTR
145225653YP_001136331.1 30S ribosomal protein S7 [Mycobacterium gilvum PYR-GCK]MPRKGPAPKRPLVNDPVYGSQLVTQLVNKVLLDGKKSLAERIVYGALEQA
REKTGTDPVVTLKRAMDNVKPSLEVRSRRVGGATYQVPVEVRPDRSVTLA
LRWLVSFSKARREKTMIERLANEILDASNGLGAAVKRREDTHKMAEANRA
FAHYRW
145225652YP_001136330.1 elongation factor G [Mycobacterium gilvum PYR-GCK]MAQDVLTDLSKVRNIGIMAHIDAGKTTTTERILYYTGVNYKIGETHDGAS
TTDWMEQEQERGITITSAAVTCFWNQNQINIIDTPGHVDFTVEVERSLRV
LDGAVAVFDGKEGVEPQSEQVWRQADKYDVPRICFVNKMDKLGADFYFTV
RTIEERLGARPLVIQLPIGAENDFIGIIDLVEMKAKVWRGETALGEKYEV
EEIPADLADKAEEYRTKLIEAVAETDEALLEKYFGGEELSIDEIKGAIRK
LTVASELYPVLCGSAFKNKGVQPMLDAVIDYLPSPLDVESVTGHVPNKED
EVISRKPSTDEPFSALAFKIAVHPFFGKLTYVRVYSGTVESGSQVINSTK
GKKERLGKLFQMHANKENPVERASAGHIYAVIGLKDTTTGDTLCDANQQI
VLESMTFPDPVIEVAIEPKTKSDQEKLGTAIQKLAEEDPTFKVHLDQETG
QTVIGGMGELHLDILVDRMRREFKVEANVGKPQVAYRETIRRKVEKVEFT
HKKQTGGSGQFAKVLIDLEPFSGEDGATYEFENKVTGGRIPREYIPSVDA
GAQDAMQYGVLAGYPLVNIKVTLLDGAFHEVDSSEMAFKVAGSQVLKKAA
QAAQPVILEPIMAVEVITPEDYMGDVIGDLNSRRGQIQAMEERSGARVVK
AQVPLSEMFGYVGDLRSKTQGRANYSMVFDSYAEVPANVSKEIIAKATGQ
145225651YP_001136329.1 elongation factor Tu [Mycobacterium gilvum PYR-GCK]MAKAKFERTKPHVNIGTIGHVDHGKTTLTAAITKVLHDQYPDLNESRAFD
QIDNAPEERQRGITINISHVEYQTEKRHYAHVDAPGHADYIKNMITGAAQ
MDGAILVVAATDGPMPQTREHVLLARQVGVPYILVALNKADMVDDEELIE
LVEMEVRELLAAQDFDEDAPVVKVSALKALEGDEKWVKSVQELMAAVDES
IPDPVRETDKPFLMPVEDVFTITGRGTVVTGRVERGVINVNEEVEIVGIR
PTVTKTTVTGVEMFRKLLDQGQAGDNVGLLVRGIKREDVERGQVVVKPGT
TTPHTEFEGSVYILSKDEGGRHTPFFNNYRPQFYFRTTDVTGVVTLPEGT
EMVMPGDNTDIAVKLIQPVAMDEGLRFAIREGGRTVGAGRVTKIIK
145225650YP_001136328.1 cutinase [Mycobacterium gilvum PYR-GCK]MIGMSAGVATAQPAQPACPDVHWIGAAGSGERLGAGAADGGMGRVIAKSY
RDFAGLIQQSGRTITAEAVNYPAVAVPEDGGILDWAGFMGSVDTGTAALG
QQYQAFVAQCPTSQVVLAGYSQGAMVVHRNLHSLDASPNLAAALLVADGD
RLPQDPTVNIGSVTAVPGAGKGVAQDWPILAHAPAPLPVTMGARTISVCN
LGDAVCDYDPDAEDEMNPAAVAVHTSYARKAGAMDSWTVPLYQLVTQRQA
PLPAYPVQVTAGS
145225649YP_001136327.1 hypothetical protein Mflv_5073 [Mycobacterium gilvum PYR-GCK]MSTFWRYVKIQAFVLLCGIVGPIFLVIYFATGADPLLAWMFWTGLLITAA
DVLIALAITGFGARSAAKKQALEATGVLALGQIVGIHETNTRINDQPLVK
IDLQVSGPGITPFSTQDQVVASVSRLPMITNRQLAMLVDPITNDYQIDWE
RSALVSGMMPATFTISEDNQTYDLTGQTEPLMEILQVLKSHGIGVDHMID
LRSNPAARQQVQAIVRRAVAQQAPPPPVPAGAPYLAAAPEPTTAQRLQEL
ETLRATGSITDDEYAAKRAEIIAEL
145225648YP_001136326.1 3-ketoacyl-ACP reductase [Mycobacterium gilvum PYR-GCK]MPMSSGTPLEGRVALITGAARGQGRAHAIRLAADGADIVALDVCKPVSES
VTYPMPTSEDLAETVRLVEETGRKVLAREVDIRDLAAQQQLVADAVEQFG
RLDIVVANAGVLSWGRIWEMSEDQWDTVVDVNLNGTWRTIRAAVPAMIEA
GNGGSIIIVSSSAGLKATPGNAHYAASKHGLVALTNALALEAGEFGIRVN
SIHPYSIDTPMIEKDAMMEIFSKYPTFLHSFAPMPFKPVARDGKPGLQEF
MTVEEVSDVVAWLAGDSSATISGSQIAVDRGTMKY
145225647YP_001136325.1 ornithine aminotransferase [Mycobacterium gilvum PYR-GCK]MTAVHASTDALIAAEARHVAHNYSPLPVVAASAQGAWITDVEGRRHLDCL
AAYSAVNFGHRNPEIIAAAHAQLDAVTLVSRAFHSDQLGPFAEALAGLCG
KDMVLPMNSGAEAVESGIKVARKWGTDVKGVSDSTIIVARNNFHGRTTTI
ISFSDDDTARRGFGPYTPGFRSVPFGDADALEQAIDGNTVAVLLEPIQGE
AGIIVPPDDYLPRVRALCTEHDVLMIADEIQSGLARTGRTFACDHWGVVP
DVYLLGKALGGGVVPLSAVVADRDVLGVLHPGEHGSTFGGNPLAAAIGRT
VVDILERGEFQQRATELGAHLQARLSTLTGRGVVAVRGKGLWAGVDIDPA
HGTGKQISLRLAERGVLVKDTHGSTLRFAPPLVITADEIDWAVARLEEVL
T
145225646YP_001136324.1 amidinotransferase [Mycobacterium gilvum PYR-GCK]MDIAAARPLRHAPTPRSARPRRYLMTAPQFFAVDYVINPWMDASVVVDTD
RAITQWETLRQTYLDLGHSVDLIDPVPGLPDMVYAANGGTVLNGRAVVAR
FAHPERAREAVAYADWMTRNGYDAFETRHVNEGQGDLLTVGGVVLAGFGF
RTDRRAHDEVAGHIGLPVVSLELVDPRCYHLDTALAVLDDATVAYYPPAF
SQDSRATLARMFPDAIKVASADAYVLGLNAVSDGLNVVLPDAATGFAEQL
RAAGYRPVGVDLSELLKGGGSVKCCTLEVFP
145225645YP_001136323.1 AsnC family transcriptional regulator [Mycobacterium gilvum PYR-GCKMFCCFRRMMDRLDDTDERILAELADNARATFAEIGQHVNLSAPAVKRRVD
RMLDNGVIRGFTTVIDRSALGWTTEAYVQVFCHGTIAPAELRAAWKDIPE
VVGAATVTGTADAMLHVLARDMRHLEEALERIRSSADIERSESIVVLSNI
IERSPG
145225644YP_001136322.1 FAD-dependent pyridine nucleotide-disulfide oxidoreductase [MycobacMGTSEVSGGSGGVVIVGGGLAAARTAEQLRRAEYPGAITIVSDEDHLPYD
RPPLSKEVLRAETDDVTLKPAEFYDENNITVLLGNGAKSVDTAAQTLTLA
DGSTLGYDELVIATGLVPKRIPSFPDLPGIHVLRNFDESLALRREAASAS
RAVVVGAGFIGCEVAASLRKLGVEVTLVEPQPAPLASILGQQIGDLVTRL
HRAEGVDVRCGVGVSEVSGDDRVRKVTLGDGTDVEADVVIVGIGSHPATS
WLEGSGLELDNGVVCDEAGRASAPHVWAIGDVASWRDTVGGQVRVEHWSN
VADQARVLVPTMLGQEPPAAVSVPYFWSDQYDVKIQALGEPEATDTVHIV
EDDGRKFLAYYERDGAVVAVVGGGFPGKVMKTRAKIAAGAPISDLLG
145225643YP_001136321.1 hypothetical protein Mflv_5067 [Mycobacterium gilvum PYR-GCK]MKNLTIATTAAAALSAAFLGLAAPARAAPTGGDAQATISSLEAQGNRVIV
HKLADVDLDDASVVGINRGPAIRGTVQDYANDRTYQNTVTGRVYYVNVK
145225642YP_001136320.1 hypothetical protein Mflv_5066 [Mycobacterium gilvum PYR-GCK]MGGVDYPRTYQEFRAWFPDDASCAAYLARLRWPGGFRCPSCDHDRAWQTS
TQHWKCVSCGRKTSVTAGTIFHRTRTPLSTWFAAIWLVTSQKNGASAKNL
HDMLGLGSYETAWAWLHKMRRAMVRPDRELLTEVVEVDESFIGGRATGKK
GASTSKAPVMIAVENIGTQVNRKLRLGRVRLGVADSPGSKQLVDFARTTV
EPGSVIRTDGARMFRVLAGEGFKHEYISGYSSPEPGHVTLPGPHRVASLL
KRWNAGTHHYRVEREHLQYYLDEFTFRFNRRRSTARGMLFYRLLQQSVNT
DPHPLSELVSRTSEPFSPNDNPTEFITSDTYGEF
145225641YP_001136319.1 hypothetical protein Mflv_5065 [Mycobacterium gilvum PYR-GCK]MFDTMHRGLGEADLLAAIEQAAREEAQAGARRLAAIAELVDLTVDEDDER
GMWAFDPWKNAACHIGAALSISERRASAQMCIATALRYRLPQIAALYVQG
RLSTRLISEITWRTGLVADDVIATVDAALAGKAEKWGPLSEDKLIDAINT
VIARHDPDAVRRTKEALKKRDVHIGAHEDTDDVTTIWGLLLPPDAAAYTA
RIAALVKGLCDADPRSAGERRSDAMGAIGRGENQLACRCGSPNCTASGPS
TSPVVITVIADQAAVDTAQQLIADQDAEQQNTTATTAEPTCTKDPGSALL
PGAQILPIPVLAEAIRSGAKITPLWLPGPDPEPHYRPSAKLAAFIRSRDL
FCRFPGCDVSADRCDIDHVVPYPFGPTHASNMHCKCRSHHLMKTFWGGPD
GWRERQLPDGTVLWTTPAGTTYTTTPGSRLFFPAWDTTTAELPPMTTPPP
GAGREIQMPKRQRSRTADRAARIKAEREHNGTQRNLEERPRRGQPPPDYG
NDPPPF
145225640YP_001136318.1 glyoxalase/bleomycin resistance protein/dioxygenase [Mycobacterium MTDPMDALRGGDLPVDPDPAFARRLRSRLEAAANLFEQQPDRTKDIIMSG
TDTVLAELTEPTSGGLIPYLTVTDARAAIDWYVDVLGASVVGAPITMDDG
RIGHAELTVSGATLYLADEYPEIGLKAPSSQHVSASMMLTVTSVDGTLER
ARSARAFVQREPYEDHGARTAAIVDPFGHRWMLTGPITGAPVPIRHGDVG
YVSVRTPDAQRAAAFYGHVLGWVFDPETQRVTNTGQRIGITTAPGRHTLF
CCYAVTDLDGARDSIVAGGGTVDDVVEFDFGSVLGATDPAGAEFGVYRPA
ADEPRPLLNGGGPGELSYITYQVPDSAEFRAFYSRVLFWTYEPGRVDDGW
GVVGAHPMSGAAGGHVEAVTVPMWTVADIDAAVARVREAGGTVIEEPSQQ
PYGKSALCTDDQGARFYLGEF
145225639YP_001136317.1 ECF subfamily RNA polymerase sigma-24 factor [Mycobacterium gilvum MSADSEGAASEGAVPEGLDAPSALLALYDEALPAVYGYFVRRCGDRGTAE
DLTSETFLAAMDAARKPSPPDLSVRWLIGVARHKLADHYRRRWDRFATPV
AELPEPADPADEWDAELDRIVAEQVLTRLSDPHRAVLVLRYMDGCSVPEC
AELIGRTVHATEALLVRARRAFRAMYPEPEGGLS
145225638YP_001136316.1 TetR family transcriptional regulator [Mycobacterium gilvum PYR-GCKMSAARPRVGRRRSTSWEHISDVAIDLFMARGFDDVSVDDVASAAGIARRT
LFRYYPSKSALPWGDFDAHLDHMRALLADLDPEVPIRDALRTALLAFNDF
DDPDRHRQRMRLILETEALQAYSMTMYAGWRAVVAAFVADRLGVGGDDLR
PQTVAWTMLAVSLSAYEHWLADETACLQSSLGEAFDLLASGLSGLESGVS
EFAPGARR
145225637YP_001136315.1 hypothetical protein Mflv_5061 [Mycobacterium gilvum PYR-GCK]MAAPTITFDADRNWRLHPQVAVRPEPFGALLYHFGTRKLSFLKNRTIVEV
INSLSDHPDARSACRAAGIDDSQLAPYLHALGVLVQSNMLVAGENR
145225636YP_001136314.1 radical SAM domain-containing protein [Mycobacterium gilvum PYR-GCKMTLAAPVPRLVDQFERGLDAPICLTWELTYACNLSCVHCLSSSGKRDPRE
LSTQQCKDIIDELERMQVFYVNIGGGEPTVRSDFWELVDYATEHHVGVKF
STNGVRIDKTVAAKLAASDYVDVQISLDGATAEVNDAVRGPGSFAMAVRA
LENLKEAGFKDAKISVVVTRHNIDQLDDFKALADTYGATLRITRLRPSGR
GADVWDDLHPTADQQVQLYNWLVAHGERVLTGDSFFHLSGLGEPGALAGL
NLCGAGRVVCLIDPVGDVYACPFAIHDKFLAGNILTSNGFEDVWQNSELF
RELREPQSAGACSGCNHYDACRGGCMAAKFFTGLPMDGPDPECVQGYGEP
ALAADRDKPKSSVDHSRSGGRGKPKGPIPLTLLSAPPKKFCNESPV
145225635YP_001136313.1 (S)-2-hydroxy-acid oxidase [Mycobacterium gilvum PYR-GCK]MARDTWFETVAIAQQRAKKRLPKSAYSSLISASEKGVSVSDNVEAFAELG
FAPHVVGATDKRDMATTVMGQDIPLPVIISPTGVQAVHPDGEVAVARAAA
ARGTAMGLSSFASKPMEEVTAVNDKIFFQIYWLGSRDAIAARMERARAAG
AKGLILTTDWSFSHGRDWGSPKIPEQMDLKTILKMSPEVLTKPRWFFSFA
KTLRPPDLRVPNQGRPGEPGPTFFEAYGEWMGTPPPTWEDVAWLREQWGG
PFLLKGLVRVDDAKRAVDAGVSAITVSNHGGNNLDGTPAAIRCLPAIADA
VGDQVEVLLDGGIRRGSDVVKAVALGARAVMIGRAYLWGLAANGQAGVEN
VLDILSGGIDSALRGLGKSSIQELTPEDILVPEGFTRTLGV
145225634YP_001136312.1 creatininase [Mycobacterium gilvum PYR-GCK]MNSAYHRRVVFPRELGNSTSRQLHDAHAIHMPTLVVPVGSTEQHGPHLPL
DTDTRIATAVADAVVTRLRARDETHWVMAPAIAYGASGEHEGFPGTISIG
TPALAELLVEFVRSACRWTPRVAFVNGHGGNVDALRRAVTQLRHEGRDAA
WSPCVAGNADAHAGHTETSVLLHLSPDAVRQEERVPGNRAPLAELMPQML
RGGVAAVSSLGVLGDPTTATADEGRRIFAEMVDACAARVVRWEPDRGGML
T
145225633YP_001136311.1 glycosyl transferase family protein [Mycobacterium gilvum PYR-GCK]MTGPRLPDGFAVQVDRRVRVLGEGAALLGGSPTRLLRLAPAAQTMLHGGR
LEVHDAVSAQLARTLLDATVAHPRPLSGPSHRDVTVVIPVHNNATGLTRL
VAALRGLKVVIVDDGSSRPVNEADFASAACDIRVLRHSRRKGPSAARNAG
LAVCATDFVAFLDSDVVPRKGWLEALLGHFCDPAVALVAPRIVAHEPSDN
VVARYEAVRSSLDLGLREAPVIPFGTVSYVPSAAIICRRSAILEIGGFDE
TLVSGEDVDLCWRLNESGARLRYEPIAMVGHDHRTELRKWFARKSFYGGS
AAPLTIRHPGKTAPLVISGWMLVVWMLVAVGSGIGYAASVAVAAVTGRRI
AKSLSTVQTEPMEVAVVAAHGLWSAALQLASALCRHYWPIALVASVLSKR
CRRVVVVAAVLDGVFDWVTRNGNADEDTKRVGILTYILLKRLDDIAYGLG
LWSGVVRERHAGALKPQIRA
145225632YP_001136310.1 glucose-methanol-choline oxidoreductase [Mycobacterium gilvum PYR-GMSVLIVGAGSAGSVLAERLSADPGCEVTVVEAGPGLSDSRVRDQISDGLR
LPIGAASSVVRRYDTALTEEPRRHARIMRGVVVGGSGAVNGGYFCRALPA
DVDGWGMDGWSWDDVLPHFRAIETDLDFATPVHGDTGPITVRRVAEFDGA
TASFVDAARTAGFGWVEDLNGATAEHAVPAGIGAVPLNIDRGTRVGPGGA
FLQPALGRANLTVLTDTRVLRLTFAAGRVTGVLCVGPDGPVTVGADRIVL
CAGAIATAQLLMVSGVGPPPVLRAAGVPVEIDLPVGVDTIDHPEWVLPVS
WAPTHGVPPLEAVLTTDDGVEIRPYTVGFEAMMTGRRDDPTDQPHLGVTL
MRPLSRGRVTICSADPDADPVIEHRYDSAPADVALLREGAQLASELAGAT
VQSEPSWATSQHLCGTAKMGAVVDERCRVYGVDNLWVVDGSILPDIPSRG
PHATIVMAGHRAAEFVSSSAGA
145225631YP_001136309.1 major facilitator transporter [Mycobacterium gilvum PYR-GCK]MVDTLPRSDQDIDAAVMTLSKRRRIWLLAVASIDVLMVISSMVALNAALP
DIALQTSATQTQLTWIVDGYTLALACLLLPAGALGDRYGRRGALLVGLAI
FALASLAPVFLDSPTQIIVARAVAGVGAALIMPATLSLLTSAFPKSERNK
AVGIWAGVAGSGAVFGFLGTGVLLHFFSWQSIFYMFAAGALLMFIATCTI
GSSRDETATPIDWVGGALIGTAIAVFVLGVVEAPARGWTDPVVLGCLAAG
VVLAVAFAMVQLRREHPLLDVRLFTRPDFATGAVGITFLFMANFGFFFIE
MQFMQLVMGYSALETAFALAPLAFPVLVLGGTLHLYLPKVGLRFAVTGGL
LLLAGGLFLMRFLDADATFLDIMWPLLLAASGIGLCTAPTTSAIMNAAPD
EKQGVASAVNDATREIGAALGIAVAGSILAAVYHRSLASRLADFPEQIRT
TATDSLAHALSISEQMGPQGARLSELAQDAFIHAADRALLVLSLLLLVAA
VFVAIWSPGRDGRQWSVVRRLRKN
145225630YP_001136308.1 TetR family transcriptional regulator [Mycobacterium gilvum PYR-GCKMAAVSSDPRPARSRARLLDAATALLRSGGPSAVTIDAVTRKANVARATLY
RHFPSANDLVAAAFVGLIPPPPMPPSTGSLRERLLAIVVEWAESIAEAPT
TLTAMAWLSLGPDIEQVPSAGGSQVGSLRERIAEQYSAPFDAVFDSPDAA
AELRPVDRTMAFALLIGPLAFGRISTLTEFDYRAVAIAAVDGFLSTFSAT
NTGREGA
145225629YP_001136307.1 cytochrome P450 [Mycobacterium gilvum PYR-GCK]MSTPTMDRDSQEAAKVLADPKAYADDDRLHSALSYLRANDPVVWVDHPPY
RPFWAITKHADIMAIERANDLFLSAPRPLLVTAEADDLGKSQQEAGIGLR
TLIHMDDPHHRKVRAIGADWFRPKAMRDLKVRVDELAKRYVDRMRDIGPE
CDFVTEIAVNFPLYVILSLLGLPEEDFGRMHMLTQEMFGGDDEYKRGTTP
EEQLAVLTDFFNYFAALTASRREHPTEDLASAIANGLVDGEPMSDMDTLS
YYVIVASAGHDTTKDAISGGLHALIENPGELARLKGDLSLMPTAVEEMIR
WSTPVKEFMRTAAEDTTVRGVPIAKGESVYLAYVSANRDEEVFADPFRFD
VGRDPNKHLAFGYGVHFCLGAALARMEINSLFTELLPRLDSIELAGEAEL
SATTFVGGLKHLPVRYSLR
145225628YP_001136306.1 cytochrome P450 [Mycobacterium gilvum PYR-GCK]MSTPVIDDAAKVLAEPRAYAEEPRLHAALAHLRANAPVAYVDVPDYYPFW
AVTKHADIMAIERANELWINEPRPMLNTKATDDLAAANLANGGGLRTLIH
MDDPLHRDIRKVGADWFRPKAMRALKERVDELAKRYVDRMVEIGPECDFV
QEVAVNFPLYVILSLLGLPESDFGRMLKLTQEMFGGDDDELSRGKSAEEL
HEVITDFFRYFTKLTADRRENPTEDLASAIANAKLDGEYLNDIDCLSYYV
IVASAGHDTTSAAISGGLLALIENQDQLARLKADPSLMGTAVEEIIRWTA
PVKEFMRTATADTEVRGVPIKKGEAVLLSYVSANRDEDVFDEPMRFDVGR
DPNKHLSFGYGVHFCLGAALARMEINSFFTELLPRLESIELAGDPEFIST
IFVGGLKHLPIRYSLR
145225627YP_001136305.1 type B carboxylesterase [Mycobacterium gilvum PYR-GCK]MLVALVVAVACGSQASPQPAPDPAVVQTSTGPVRGTVADDHRLFAGIPYA
APPVGALRWQGPRPAPKWDGVRDATAYGPRCMQDLDGDLELGRQTDEDCL
NLNVWTPPVAGDRPEPKPVMVWIHGGSFVAGSSGVYDSRRLVARGDIIVV
TVNYRLGALGFLAHPALGPPGAVGNYGLADQQAALRWVRDNIANFGGDPA
RVTVAGESAGAMSVCDHLVAPGSDGLFDAAIVMSGLCQSQADLPTAEKRS
LDYAAQAGCGGPVPAECLRGLDANALRTPVWYYDIGDDRLSGPVTGSAVL
PTAPPVAFGDGKAARVPVLMGTTRDEWTLFVALQHLRDGKDYAPQEYPRL
LADTFGADAPAVEAHYPLTAFSSVALAYAATVTDGVFACAGRRWAGDLAE
TAPVYFYEFNDRDAPAPDPLRTVPFPVGASHSLELRYLFDTGGAPPPSPA
QVRLGEQMIDYWASFVKTGDPGFPGIDSGVMSLQPDGSRMIEDFDRVHQC
VFWDGLG
145225626YP_001136304.1 30S ribosomal protein S10 [Mycobacterium gilvum PYR-GCK]MAGQKIRIRLKAYDHEAIDASARKIVETVTRTGASVVGPVPLPTEKNVYC
VIRSPHKYKDSREHFEMRTHKRLIDILDPTPKTVDALMRIDLPASVDVNI
Q
145225625YP_001136303.1 50S ribosomal protein L3 [Mycobacterium gilvum PYR-GCK]MARKGILGTKLGMTQVFDENNKVVPVTVVKAGPNVVTRIRTTERDGYSAV
QLAYGEISPRKVNKPVTGQFAAAGVNPRRHLAELRLADNEDAGALYEVGQ
ELTAEIFADGAYVDVTGTSKGKGFAGTMKRHGFKGQGASHGAQAVHRRPG
SIGGCATPGRVFKGTRMSGRMGSDRVTTQNLKVHKVDAENGVLLIKGAIP
GRNGGLVVVRSAIKRGEK
145225624YP_001136302.1 50S ribosomal protein L4 [Mycobacterium gilvum PYR-GCK]MANKTIDVVTPAGKKDGTVELPAALFDAEPNIALMHQVVTAQLAAKRQGT
HATKTRAMVSGGGKKPYRQKGTGRARQGSTRAPQFTGGGVVHGPQPRDYS
QRTPKKMIAAALRSALSDRARNDRIHAITEVVEGQSPSTKSAKAFLATLT
DRKQVLVVIGRADETSALSVRNLPGVHVISPDQLNTYDVLKADDVVFSVE
ALNAYIAAATKTTEEVSA
145225623YP_001136301.1 50S ribosomal protein L23 [Mycobacterium gilvum PYR-GCK]MANVVDPRDIILSPVISEKSYGLIEDNVYTFIVHPDSNKTQIKIAIEKIF
KVKVDSVNTANRPGKRKRTRTGYGQRKATKRAIVTLAAGSKPIDLFGAPA
145225622YP_001136300.1 50S ribosomal protein L2 [Mycobacterium gilvum PYR-GCK]MAIRKYKPTTPGRRGSSVSDFAEITRDHPEKSLIRPLHGKGGRNAHGRIT
TRHKGGGHKRAYRVIDFRRHDKDGVDAKVAHIEYDPNRTANIALLHYLDG
EKRYIIAPQGLKQGAIVESGANADIKPGNNLPLRNIPAGTLIHAVELRPG
GGAKMARSAGASIQLLGKEGTYASLRMPSGEIRRVDVRCRATVGEVGNAE
QANINWGKAGRMRWKGKRPTVRGVVMNPVDHPHGGGEGKTSGGRHPVSPW
GKPEGRTRKPNKASDKLIVRRRRTGKNKR
145225621YP_001136299.1 30S ribosomal protein S19 [Mycobacterium gilvum PYR-GCK]MPRSLKKGPFVDDHLLKKVDVQNEKNTKQVIKTWSRRSTIIPDFIGHTFA
VHDGRKHVPVFVTEAMVGHKLGEFAPTRTFKGHIKDDRKAKRR
145225620YP_001136298.1 50S ribosomal protein L22 [Mycobacterium gilvum PYR-GCK]MTTAIQYPSASAKARFVRVSPTKARRVIDLVRGKSVEDALDILRWAPQAA
SEPVAKVIASAAANAQNNEGLDPSTLVVATVFADEGPTAKRIRPRAQGRA
FRIRKRTSHITVIVESRPAKKQGASASAARARRAQASKAASQKEGSE
145225619YP_001136297.1 30S ribosomal protein S3 [Mycobacterium gilvum PYR-GCK]MGQKINPHGFRLGITTDWKSRWYADKQYADYIKEDVAIRKLLATGLERAG
IADVEIERTRDRVRVDIHTARPGIVIGRRGTEADRIRADLEKLTKKQVQL
NILEVKNPESRAQLVAQGVAEQLSNRVAFRRAMRKAIQSAMRQPNVKGIR
VQCSGRLGGAEMSRSEFYREGRVPLHTLRADIDYGLYEAKTTFGRIGVKV
WIYKGDIVGGKRELAAAAPAGADRPRRERPSGTRPRRSGASGTTATSTDA
GRAATEEAPATDAAATAPAAGQPETTES
145225618YP_001136296.1 50S ribosomal protein L16 [Mycobacterium gilvum PYR-GCK]MLIPRKVKHRKQHHPRQRGIASGGTSVSFGDYGIQAMGHAYITNRQIESA
RIAINRHIKRGGKVWINIFPDRPLTKKPAETRMGSGKGSPEWWVANVKPG
RVLFELSYPDEKIAREALTRAIHKLPIKARIVTREEQF
145225617YP_001136295.1 50S ribosomal protein L29 [Mycobacterium gilvum PYR-GCK]MAVGTTTGELRELSDDELTDKLRESKEELFNLRFQMATGQLANNRRLRVV
RQEIARVYTVLRERELGLAAGPGGEDS
145225616YP_001136294.1 30S ribosomal protein S17 [Mycobacterium gilvum PYR-GCK]MADTKGEKHTPRTEDKRGRRKTAIGYVVSDKMQKTIVVELESRKSHPLYG
KIIRTTTKVKAHDENESAGIGDRVSLMETRPTSATKRWRLVEVLEKAK
145225615YP_001136293.1 sulfatase [Mycobacterium gilvum PYR-GCK]MTTEFNGKIALDIRDSEPDWGPFAAPTAQPEAPNVLYLVWDDIGIATWDC
FGGLVDMPAMSRIAERGVRLSQFHTTALCSPTRASLLTGRNATTVGMATI
EEFTDGFPNCNGRIPFDTALLSEVLSENGYNTYCIGKWHLTPLEESNLAA
TKRHWPLSRGFERFYGFMGGETDQWYPDLMYDNHPVAPPATPEEGYHLSK
DLADKTIEFIRDSKVIAPDKPWFSYVCPGAGHAPHHVFKEWADRYAGRFD
MGYEAYREIVLENQKRLGLVPPDTELSAVNPYLDVKGPDGQDWPAQDTVR
PWDSLSEDEKRLFARMAEVFAGFLSYTDAQIGRVLDYLEESGQLDNTVIV
VISDNGASGEGGPNGSVNEVKFFNGYIDSAEESLKVFDELGGPQTYNHYP
IGWAMAFNTPYKLFKRYASHEGGIADTAIISWPKGIAAHGEIRDNYVNVA
DITPTVYDLLDITPPATVRGVAQKPLDGVSFKVALENPNAPTGKETQFYT
MLGTRGIWHRGWFANTVHAASPAGWSHFDDDRWELYHVDADRSQVHDLAA
EYPEKLDELKALWFSEAQKYNGLPLGDLDIFETMSRWRPTLSGERSAYVY
YPGTADVGIGAVVELRGRSFAVLAEVEVDPGGANGVVVKHGGAHGGYVMY
LQGGRLHFCYNFLGEYEQTLAAPDPVPPGLHTLGFTYTVTGTAEGSHTPI
GDAELFLDTERVASLAEMRSQPGTFGLAGASLSVGRNNGSPVSEAYHPPF
AFAGGRIARVNIDTSGAPYVDLERDFARAFARD
145225614YP_001136292.1 hypothetical protein Mflv_5038 [Mycobacterium gilvum PYR-GCK]MLTDLVDLEGGSFRMGSTRFYPEEAPAHTVTVAPFAIERNPVTNAQFAEF
VDDTGYRTVAERPPDPALYPGASPHDLVPGALVFRPTAGPVDLRDWRQWW
EWTPGADWRHPFGPDSSVDDRPEHPVVQVCYSDAAAYARWAGRRLPTEAE
WEFAAGAGSTAVYAWGDEPAPGGQLMANTWQGAFPYRNDGALGWAGTSPV
GTFPANGFGLVDMIGNVWEWTTTRFAGHHRVNPPPPPTCCPPADPDPAVN
QALKGGSHLCAPEYCHRYRPSARSPQSQDSATTHIGFRCAASPV
145225613YP_001136291.1 50S ribosomal protein L14 [Mycobacterium gilvum PYR-GCK]MIQQESRLKVADNTGAKEILCIRVLGGSGRRYAGIGDVIVATVKDAIPGG
NVKRGDVVKAVIVRTVKERRRADGSYIRFDENAAVIIKNDNDPRGTRIFG
PVGRELREKKFMKIVSLAPEVL
145225612YP_001136290.1 50S ribosomal protein L24 [Mycobacterium gilvum PYR-GCK]MKVRKGDTVLVISGKDKGAKGKVLVAYPDRNKVLVEGVNRIKKHTAESRT
ERGAASGGIVTQEAPISVSNVMLLDSDGKPTRVGYRKDDETGKNVRIAKS
NGKDL
145225611YP_001136289.1 50S ribosomal protein L5 [Mycobacterium gilvum PYR-GCK]MTSTETKTLPRLKQRYREEIREQLLKEFGYANVMQIPGVVKVVVNMGVGD
AARDAKLINGAVNDLMLITGQKPEIRKARKSIAQFKLREGMPIGARVTLR
GDRMWEFLDRLISISLPRIRDFRGLSGKQFDGTGNYTFGLTEQSVFHEID
VDSIDRPRGMDITVVTSATNDDEGRALLRALGFPFKEN
145225610YP_001136288.1 30S ribosomal protein S14 [Mycobacterium gilvum PYR-GCK]MAKKALVNKANKKPKFKVRGYTRCNRCGRPHAVFRKFGLCRICLREMAHA
GELPGVQKSSW
145225609YP_001136287.1 30S ribosomal protein S8 [Mycobacterium gilvum PYR-GCK]MTMTDPIADFLTRLRNANSAYHDEVTLPHSKIKANIAEILKSEGYISDYR
TEDARVGKSLVVQLKYGPSRERSIAGLRRVSKPGLRVYAKSTNLPRVLGG
LGVAIISTSSGLRTDRQASREGVGGEVLAYVW
145225608YP_001136286.1 50S ribosomal protein L6 [Mycobacterium gilvum PYR-GCK]MSRIGKQPVPVPAGVDVTISGQNVSVKGPKGTLTLDVAEPIEVSRNDDGA
IVVTRPNDERRNRSLHGLSRTLIANLVTGVTEGYTTKMEIFGVGYRVVAK
GSNLEFALGYSHPVLINAPEGVTFAVETPTKFSISGIDKQAVGQIAANIR
RLRKSDPYKGKGIRYEGEQIRRKVGKTGK
145225607YP_001136285.1 50S ribosomal protein L18 [Mycobacterium gilvum PYR-GCK]MATKTNTKETGHSPVGKNISETRRTSRLRRHARLRKKVSGTAERPRLVVN
RSSRHIHVQLVDDLAGVTLAAASSIEGDVRATDGDKKAASARVGQLIAER
AKAAGIEEVVFDRGGYTYGGRIAALADAARESGLKF
145225606YP_001136284.1 30S ribosomal protein S5 [Mycobacterium gilvum PYR-GCK]MAEQAGAGSAQDNRGGGRDDRGGRGRRDDRGGRGGRDDREKSNYLERVVT
INRVSKVVKGGRRFSFTALVIVGDGKGMVGVGYGKAKEVPAAIAKGVEEA
RKNFFRVPLIGGTVTHPVQGEAAAGVVMLRPASPGTGVIAGGACRAVLEC
AGVHDVLAKSLGSDNAINVVHATVAALKLLQRPEEVAARRGLPIEDVAPA
GMLRARREAEALAVSAAREGTA
145225605YP_001136283.1 50S ribosomal protein L30 [Mycobacterium gilvum PYR-GCK]MAELKITQVRSTIGARWKQRESLRTLGLRKIRQSVVREDNAQTRGLIKTV
HHLVEVEEVKA
145225604YP_001136282.1 50S ribosomal protein L15 [Mycobacterium gilvum PYR-GCK]MSDPIKLHDLRPAPGEKTKKTRVGRGEGSKGKTAGRGTKGTKARKNVPVM
FEGGQMPIHMRLPKLKGFRNRFRTEYGVVNVGDLNKAFPEGGTVGVDELV
AKGLVRKNVLVKVLGDGKLSAKVDITAHKFSGSAREAITAAGGSVTEL
145225603YP_001136281.1 hypothetical protein Mflv_5027 [Mycobacterium gilvum PYR-GCK]MIRHRRTIVAMVAAGLTMFGGAATAQAETPDERFANVVTTLGIPHTPDED
LSVVGKRVCDMLTGSLTGNPNPVPAVRGVVSTLSSNANITKQQAVGLMQA
STYIYCPQWARFTGR
145225602YP_001136280.1 signal peptide peptidase SppA- 67K type [Mycobacterium gilvum PYR-GMLALLSGVPGFDDVRHFARKLDTARHQGVPDGCILELDLQSAPPESAGFD
PVALLSGAGRPLLLREAVSALHRAAEDPRVAGLIARVQIDAAAPGAVQEL
REAIVAFTAKKPSLAWAETYPGTLSYYLASAFGEVWMQPSGTLGLVGFAT
NALFLRDALDKLGVEAQFIAKGEYKSAPNLFTEDRYTEPHREADTALVNG
LRTQVWDAVAASRGIDVATLDALADRAPLLRDDAVTAGLIDRVGFRDEAY
ARIADMAGADGVSPETGSGGIDPDGDDAPPRLYLTRYARAKRPTVPGLPN
RRRIAVVTVHGPIVSGRGGRQMSPRGGSNAGGDTIAAALREAAADDDVAA
IVVRVDSPGGSVTASETIWREVVRARESGTPVVASMGSVAASGGYYVSMA
ADAIVANPATITGSIGVVTGKLVARDLKERLGVGSDSVRTNANADAWSIN
APFTEEQHAQVAAEADLFYDDFVARVAEGRGLSVDAVEKVARGRVWTGAD
ALDRGLVDELGGLRTAVTRAKALAGIDEDTKVELQMLPGASLRDVLRPKP
SSQPAAASLPELLGALAIQSVAGVVDQTQRSLSGVNALWTGNPRF
145225601YP_001136279.1 putative methyltransferase [Mycobacterium gilvum PYR-GCK]MARTPDDSWDLASSVGATATMVAAGRAVASADPDPLINDPYAEPLVRAVG
LDFFTRMLDGELDLSVFPDSSPERAQAMIDGMAVRTRFFDDCCLAAASAG
VRQVVILAAGLDARTYRLPWPDGTVVYELDQPDVIAFKTQTLRNLGAEPA
ATQRPVPVDLREDWPAALRAAGFDATRPTAWLAEGLLIYLPPEAQDALFD
TVTALSAPGSTLATEYVPGIVDFDGAKARALSEPLREHGLDIDMPSLVYT
GARTPVMDHLRGAGWQVSGTARAELFARFGRPLPQDADGTDPLGEIVYVS
ATLAADA
145225600YP_001136278.1 putative methyltransferase [Mycobacterium gilvum PYR-GCK]MARTDGDTWDLASSVGATATSVAASRAFASRGPDALIDDPYARLLVEAVG
LPHFVKVARGEIDFDGDPLFGAQQAINQIVVRTRIFDDFLTDAGQREPQI
RQAVILASGLDTRAYRLDWPAGTVVYEIDQPEVIDFKTAVLTDAGVAPAA
DRRTVGIDLREDWPTALRDAGFDPDRPTAWIAEGLLPYLPPDAQDRLLDS
ITALSAPGSRLATEHMDAKALTGDWAKAMTERARRHGSDIDLTKLFYNGE
RRSATEHLGAVGWQTSVQTSNDAYIANGFGPIRDDLLAMIGDSGYLTAWR
P
145225599YP_001136277.1 putative methyltransferase [Mycobacterium gilvum PYR-GCK]MPRTENDTWDLASSVGATATMVAAARAVATRAEDPVIDDPYAEPLVRAVG
IDFFAKLASGELTPEDLDVSGDESPVGMSRFADGMAARTRFFDDFFTDAC
AAGVRQAVILASGLDARGYRLTWPEGMTLFEIDQPEVIEFKRTTLAGLGA
TPSTHLATVAIDLREDWPTALRDAGFDPSVPTAWIAEGLLGYLPPDAQDR
LLDTIGELSASGSRLAVESVPSQQSADQDEMREKMKDSTDRWRSHGFDLD
FSELVFLGERANVPDYLRERGWAVTATPTNDLLTRYGLAPLDTDEGFAEV
VYVNAAR
145225598YP_001136276.1 preprotein translocase subunit SecY [Mycobacterium gilvum PYR-GCK]MLSAFISSLRTVDLRRKILFTLGIVILYRVGASIPSPGVNYPNVQQCIAD
VSGGESGQIYSLINLFSGGALLQLSVFAVGIMPYITASIIVQLLGVVIPR
FEQLRKEGQAGQTKLTQYTRYLAIALAILQATSIVALAANGGLLQGCSLD
IIQGQSEGLNVWTLAVIVIVMTAGAALVMWMGELVTERGVGNGMSLIIFA
SIASAIPGEGKNILDSRGGMVFTLVCVAALIIVVGVVFVEQGQRRIPVQY
AKRMVGRKMYGGTSTYLPLKVNQAGVIPVIFASSLIYIPHLITQLITSAS
DSPSTGWWQSFVADYLTDPSSPVYIAIYFGLIIFFTYFYVSITFNPEERA
DEMKKYGGFIPGIRPGKPTAQYLSFVLSRITLPGSIYLGVIAVLPNLFLE
IGNTGSVQNLPFGGTAVLIAVGVGLDTVKQIESQLMQRNYEGFLK
145225597YP_001136275.1 adenylate kinase [Mycobacterium gilvum PYR-GCK]MREGPKLRIVLLGPPGAGKGTQAQKLAEKLAIPHISTGDLFRYNISNNTE
LGIEAKKYLDAGDLVPATLTNALVDDRLDDEDAAQGFILDGFPRSVEQAK
ALAEMLEKRGLTLDAVVEFRVPEEELVSRLKGRGREDDTEDVIRNRFKVY
RDETAPLLDFYSADLKTVDAVGELDEVFDRALTALGR
145225596YP_001136274.1 methionine aminopeptidase [Mycobacterium gilvum PYR-GCK]MVSLPGLRSRKVVPQRTAGELDAMAAAGALVAAALKAVQAEAAPGKSTLD
LDRVAEAVIRDGGGVPSFLGYHGFPATICASVNDRVVHGIPTADETLAAG
DLVSIDCGAILDGWHGDSALTFGVGDLIPADEALSAATRESMEAGIAAMV
PGNRLTDVSHAIEQGTRAAEARHGRKFGIVAGYGGHGIGREMHMDPFLAN
EGAPGRGPYLAPGSVLAIEPMLTLGTRKTLILDDGWTVVTADGTRAAHWE
HTVAVTDDGPRILTAR
145225595YP_001136273.1 RNA polymerase sigma factor SigL [Mycobacterium gilvum PYR-GCK]MEDADAAMMRVLYDEHAAALWRYALRLTGDRARSEDVVQETLLRAWRHPG
VIADVDRPARAWLFTVARNMIIDERRSARFRHETGVPDPEHVAEPASPDE
ADPTLDRILLGTALRQLSDEHRAVVRRAYYQGWTTGQIAADLQIPEGTVK
SRLHYAVRALKLGLQEMGVTR
145225594YP_001136272.1 putative transmembrane anti-sigma factor [Mycobacterium gilvum PYR-MTSADHYRTWDAAYVLGALSTDDRREYEGHLSGCGGCRSAVAELDGMPGL
LSLLDLDEVIALDHEQPAPPLRPEVLTSVIDRMGARRRRARRATVWAVAV
AAALLALAIVLAVRPAIFGSDGGGEQTAPMQNMAKVSETPINASIALTGY
GWGTRIDMACSYGDWGQNPRGTPPQNLGMVVIGHDGSRSQIATWLGLSGA
TALPSGTTPMQVDEIRAVQLVSASDGEVLLEKQW
145225593YP_001136271.1 MarR family transcriptional regulator [Mycobacterium gilvum PYR-GCKMVIHTAGAPVRYERCVASDRPDPIATARDNWERSGWHDVADGMVAVTSVM
RAHQILLARVETALRPYDLSFSRYELLRLLAFSRTGALPITKASDRLQVH
VTSVTHAIRRLEADGLVERLPHPTDGRTTLVRITDLGRSTVEDATVTLNK
DVFGDIGISGEQSRALADAIETLRRSAGDF
145225592YP_001136270.1 cytochrome P450 [Mycobacterium gilvum PYR-GCK]MIDRDDAGAWLVGAHADVVHVLDHPATFSNVVSRHVAVPNGMDPPEHTAF
RAVVDRYFTPSRLADVEPALRQISADLVAALPRGRTVEVMEWFAEPFAAR
AQCAFMGWPASLHEPLRQWVKRNHAATRARDRAAMADVASAFDGHIRAQL
DARRDGTGGTPQDATSRLLGDTVGDRPLTDDEIVSIVRNWTVGELATIAA
GIGIIAHFLATHPAVQEQLRRDATDLESAADEILRLHAPLLTNRRRTTES
VTLGGCTMAAGDPVLILWAQANRDEHAFDEATEFRRNREPSNNLLYGRGL
HVCPGAPLARMEFRVVLEELFRGTAHIAPDPDRAAEPASAPTAGFATLPL
MFSSRT
145225591YP_001136269.1 GAF sensor signal transduction histidine kinase [Mycobacterium gilvMTRPLLTADRELALLRELIQAASSGPGVEPLAAASARMITASTDSDVCFV
HVLDDTERSLTLAGATPPFDSEVGKIRLPLGQGISGWVASHRQPVVIRRD
KESDPRYLPFQSLRGRDFTSMVSVPMETDPGGLVGVLNVHTVAERDFTDR
DVELLLVIGRLIAGAMHQARLHRQLVARERAHENFVEQVIEAQELERRRL
AGDIHDGISQRLVTLSYRLDAAAQAAKSPADHAALTEQLDRARELADLTL
QEARAAISGLRPPVLDDLGLAGGLASLARSIPQIGIETDLDDTRLADHIE
LALYRIAQECLQNVVKHARASAARLTFAVDDNTARLEIADDGVGFDTFEH
PLGSDEMGGYGLLSMAERAEIVGGRLNIRSRPGSGTTVTATIPLHQGGA
145225590YP_001136268.1 two component LuxR family transcriptional regulator [Mycobacterium MSSEPVRIVLVDDHEMVIEGLKAMLAAFADRVCVVGQSVGADQVMGVVTD
LDPDIVLCDVRMQGSSGLDVCQQLRRRDPDRKIVMLSVYDDEQYLFQAMR
VGASGYLLKSISSEDLVEQLESVHSGKTAIDPTMAARAVEWPGARQGLTQ
RESEILALVVNGLSNRAIAAKLIIGDETVKTHLSSIYRKLGVSDRTAAVA
TALREGIFQ
145225589YP_001136267.1 hydrolase [Mycobacterium gilvum PYR-GCK]MRSVQSTQQKAWRAGRFWWDWSETGEPDGRSLTTLSAVIFDLDALADVER
TGHRLAFNAAFAELGLDISWSETRYRQLQELPDERRRVAAELRKRGVSTE
CDVLAELLVDEICATKEMILGETILDADITARPGMAELIAEAYGAGIAVG
LVSCGSHTWVEPLVRQLVGEGMVGAIVTVDDAPREDLFRAALAELGAPAH
GSLAFAGSQGSRRAAVAAGLPTVLVDGAETAPLRIADCQRIHDSWYETHP
RPTAA
145225588YP_001136266.1 3-hydroxyisobutyrate dehydrogenase [Mycobacterium gilvum PYR-GCK]MTTIAFLGLGNMGGPMAANLVAAGHTVHAFDVVPELRDAAEAKGANVFDS
AAAAVADADVVVTSLPNGAVVKAVYDEVVPAAKAGALLIDTSTISVDDAR
AIHEQATAGGLAQIDAPVSGGIKGATAGTLAFMVGGDDEAFERAKPVLEP
MAGKIIHCGASGAGQAAKLCNNMVLAVQQIAIGEAFVLAEKLGLPAQSLF
DVITGATGNCWSVHTNCPVPGPVPTSPANNDFKPGFATALMNKDLGLAMA
AVESSGAKAPLGTHAAEIYSDFAKEHAGKDFSAIIEALRD
145225587YP_001136265.1 acyl-CoA dehydrogenase domain-containing protein [Mycobacterium gilMDYFGLDDDDRVIAETAAAFAEKRLAPHALEWDETHHFPVDVLREAAELG
MAAIYCGEDAGGSGLRRIDAVRIFEKLSTADPTVAAFLSIHNMCAWMVDS
FGTEEQRKLWVPKLASMDAIASYCLTEPGAGSDASALRTKAVRSGDEYVL
DGVKQFISGAGTSDVYIVMARTGSDGPKGISAFVVPKDTPGLSFGTDEVK
MGWNAQPTRQVILEGARVPADALLGGPDGEGTGFGIAMKGLNGGRINIAA
CSLGGAQAAYDKTVSYLADRQAFGGSLLDEPTIRFTLADMATGLETSRAL
LWRAATALDNDHPDRVELCAMAKRYVTDACFEVADQALQLHGGYGYLREY
GLEKIVRDLRVHRILEGTNEIMRVVIGRSAASRARAS
145225586YP_001136264.1 methylmalonate-semialdehyde dehydrogenase [Mycobacterium gilvum PYRMTTRIPHFIDGKRSELASTRTAGVLNPSTGEVQSEVLLASAADVDTAVAS
AVEAQKEWAAWNPQRRARVFMKFIQLVNDHVDELAELLSIEHGKTVADSK
GDIQRGIEVIEFAIGIPHLLKGEFTENAGTGIDVYSIRQPLGVVAGITPF
NFPAMIPLWKAGPALACGNAFILKPSERDPSVPLRLAELFLEAGLPAGVF
QVVQGDKEAVDAILTHPDIQAVGFVGSSDIAQYIYSTAAAHGKRSQCFGG
AKNHMIIMPDADLDQAVDALIGAGYGSAGERCMAISVAVPVGEETANRLR
NRLVERVNQLRVGHSLDPKADYGPLVTGAALERVRDYIGQGVEAGAELVV
DGRERATDELSFDDQDLSKGYFIGPTLFDHVTTDMSIYTDEIFGPVLCIV
RAADYDEALSLPTKHEYGNGVAIFTRDGDAARDFVSKVQVGMVGVNVPIP
VPVAYHTFGGWKRSGFGDLNQHGPASIQFYTKVKTVTERWPSGIKDGAEF
VIPTMK
145225585YP_001136263.1 FAD-binding monooxygenase [Mycobacterium gilvum PYR-GCK]MPGAHRSDVVVVGAGPTGLTLACCLRLHGVSVRVLDAAAGPATTSRANFL
HARGSEVLDRMGALGTLPQESLRALRITNYLGDRPLATLEFGDPGMRTAA
PPMVVSQAKVEAALRARLADLDVEPEWGRKVIDVREDADGVVADLADGAR
VRGQWLVGCDGTTSVVRRQTGIEFPGVRLSERFLLADIHLDWAVDRAGTT
GWIHPDGVVGAMPMPSTDGRDDLWRLFVYDPSLDRKPTDSEILDRISELV
PYRTGRRVKIGDAEWLSMFTVHRRLADTYRRGRVLIAGDAAHVHAPFGGQ
GMLTGIGDAENVGFKLALVVRGLAADDLLDTYEAERRPLATQVLRGTSAI
TRVNVAGNPIVRFLRDRVAPRVFGLPAVQRWTTYTASQLWVSYRNGPLGG
RGSKPRPGDRIDDAPCSRPDGTATRLHGELGGRWALLLPRGVPAVGAAAV
RGPAGYLADHVVTLHHDRDDVMLVRPDAHLAWRGAHDDPTGLDRWLATAL
HPGGTQ
145225584YP_001136262.1 TetR family transcriptional regulator [Mycobacterium gilvum PYR-GCKMTAPVRGRPRDPDADRAILQAALDLFIERGVEGSSIEQIAKRAGVGKPTV
YRRWGTKEELIAAAMETLVAEEVGWTSPEAIETRSPHVLVEAAIDSAAAA
TAAPYYRALVARVYGSAVSHPELMTVYWDRYILPRRVQATRLLERARELG
TVAADTDLDVAIDMMVGAITYRVLRPNPPDVDEMRRYLREVYRQAGLLPP
G
145225583YP_001136261.1 dTDP-glucose 4-6-dehydratase [Mycobacterium gilvum PYR-GCK]MRLLVTGGAGFIGANFVLATVRDRPDVRVTVLDSLTYAGSRESLAGVDTQ
IRLVQGDITDADLVGRLVGESDAVVHFAAETHVDNALADPEPFVRSNIVG
TFTILEAVRHAAASRPVRLHHVSTDEVYGDLELGDPAKFTESTPYNPSSP
YSSTKAASDMLVRAWVRSYRLTATLSNCSNNYGPFQHVEKFIPRQITNIL
TGRRPKLYGTGANVRDWIHVEDHNSAVWKILTHGAVGRTYLIGADGECDN
LTVMRTILRLMDRSPDDFDHVTDRAGHDLRYAIDATALRDELGWRPAHSD
FEAGLRDTIDWYSANESWWGPIKDAVEAGYQSRGQ
145225582YP_001136260.1 hypothetical protein Mflv_5006 [Mycobacterium gilvum PYR-GCK]MTNSEGPSLKPALGRFGVWTGEPATPDQAVEIEKLGYGTVWVGASPAADL
AFVEPILEKTETLQVATGIVNIWTADADEVAESYHRIEKAFPGRFLLGVG
VGHPEHTQEYTKPYQALVDYLDKLDAAKVPTSRMVVAALGPKVLKLAAQR
SAGAHPYLTTPVHTGQARELLGPTVLIAPEHKVVLTDDAEKAREIGRGTV
DFYLGLSNYVNNWKRLGFTEEDLERPGSDRFIDAVVAYGSPDEIAARLSE
HLAAGADHVAIQVLGGGDELLSTLEELAGPLDLKAAD
145225581YP_001136259.1 hypothetical protein Mflv_5005 [Mycobacterium gilvum PYR-GCK]MSDVTPDLGRFGSFGRGVTPEQAQQIEALGYGAVWVGGSPPAELDWVEPL
LAATTTLQVATGIVNIWTADAGPVAESFHRIESAHPGRFLLGIGVGHPEA
HQQYRRPIDALVEYLDKLDEYGVPRGRRVVAALGPKVLKLSADRAAGAHP
YLTTPEHTARARELIGPEAFLAPEHKVVLTTDERSREEHVTDPDRAREVG
RKALEIYLDLANYLNSWKRLGFSDEDVAKPGSDRLVDAVVAYGTAEQIAA
RLREHLDAGADHVPVQVLTGSDKLVPALAELAGPLGLESTEEQR
145225580YP_001136258.1 cyclic nucleotide-binding protein [Mycobacterium gilvum PYR-GCK]MGEKCLPDELRSLFLFEKLTDDQLQDLCAHGHIATFEPGPICTEGDPATC
FYVMIDGELVMSKRSGGVDLETNRTSQRGVYCGAWSAYVPGEDKTYQASV
RVTRPSRFFVLDAAAFATFMQREFPMAVHLLEGHMVGGVRQRQIIDTREK
LLALGQLSAGLTHQLNNPAGATARAVADLREGVGKMRHKLAMLADGKFTP
EALRVLVSIQDEVAEQVAKSKAQELTAIETSDREDQIGDWLEAHGISAAW
DYAPTFVDAGLDVDWLERVEASIDDVDCSATLPGAIGWLKYTIDNELLMN
QIAEASKRISALLAGAKQYSQMDRAEYQQVNVHELLFSTVKTIFGDKLGK
DKINLVWDKDKTLPELLCYPGDLNQVWTNIIDNAIQAMDGQGTLTIRTMR
ENEDLIRVEICDDGPGIPDDIIDRIFTPFFTTKPFGEGTGLGLDLAWRIV
VEKHKGNLTVQSQPGDTRFVICLPLAAPAPTGPSNE
145225579YP_001136257.1 response regulator receiver modulated FAD-dependent pyridine nucleoMTGPEHQPRKPVILTVDDDPAVSRAVARDLRRHYGEKYRIMRAESGPDAL
ETLNELKLRGETVAVFVADYRMPQMSGIEFLEAAMDIFPLARRVLLTAYA
DTHAAIDAINVVDLDHYLLKPWDPPQEKLYPVIDALLDAWRSTGDRAIPH
TKIIGHPWNARSSEVREFLARNRLYYTWFRSDEPKGAALLEAAGQDGMTL
PVIITEQGETLVDPTDAELGSTLGLTTTPSGDFYDLVVIGGGPAGLAAAV
YGASEGLRTVLIERTATGGQAGQSSRIENYLGFPDGLSGAQLAERARRQA
EKFEAELITAAEVTRLEVDGNARTVHLSDGRTIGTRAVILAMGVEYRQLP
ADGCADLTGAGVYYGATASVAADCDDDEVYVIGGANSAGQAAMHLARTAK
TVTIVSRRTLEDSMSHYLIQQIRAQDNIRELPHTVVHAVKGDGHLEGICL
ENTQTGQRDEVTCGRMFIFIGAEPRTEWLDGVVVRDDHGFIPAGPDLRDV
SGWTLDRPPHHLESSVPGVFVAGDVRADSAKRVAAAVGEGSMAVMLVHRY
LAET
145225578YP_001136256.1 UspA domain-containing protein [Mycobacterium gilvum PYR-GCK]MPANVMVGYDGSPAACAAINAGAALFPNAHAWIAHIWQPPFAGKRLRRRL
RAAARTADELAELIEREGAREADTIASAGVALAKAAEWDAEPVVKRTYGS
DGMRLSQLAEQMHSDVLVLGDRGLDATDAVIGSVSDMAVHYSTVPVLVVP
NPLLAEEFAALARGPIVVAFDGSPGADAAAEKARTLFPDREVVLAGVRDE
DDDPAARQWPDDVEVLATSEPNWLGRPRDRATADALIDFADRRDAAVLVV
GSRGRSAVREVLLGSVAVAAVNRSHRPVMVVHS
145225577YP_001136255.1 hypothetical protein Mflv_5001 [Mycobacterium gilvum PYR-GCK]MRPRGLREGDGMTKRMIRAAVAAAALYGARRYFRDWGTTKGESSSVLAGD
ELLGPPVLQATEGVSIDAPVEAVWPWVVQIGQDRGGLYSFETLENAAGLD
YHNADLIHPEWQHLAVGDSVRLVPRKWFGLADGVEMTVARMTAPQSIVLR
AAPPGLPWEMVWSFHLIPRGDDQCRLLIRSRLALRHPGEVVAAELVGPAR
AFVTRGILLGIKRRAEKAVKMPPVQGFTPAHTAEDLRP
145225576YP_001136254.1 hypothetical protein Mflv_5000 [Mycobacterium gilvum PYR-GCK]MSNGAEAPPTVDVDVTTHGDFPGIAEYAQSKIGGLTRLARRPVSYARVRL
TRRHDPAVERPVIAQANLDVGGRPVRAQVEAATAQEAIDTLESRLRRRLE
HLHDRWDTPRGPGAAPPWRHDDKAEREIRSFGGTPREPRIIRRKSYSMAP
CTVDDAVAEMELLDYDFHLFAEKGSGTAAVVYRSEPTGYRIALVAPSLAG
EVAPFQGLVTISPHAVPCLREQDALERLRRLGLPFLFYVDAAQGRASVLY
RRFDGDYGVLTPAPITSER
145225575YP_001136253.1 UspA domain-containing protein [Mycobacterium gilvum PYR-GCK]MTLPTNRPYGVVAAVDGSPSSLAAAQWAAREASLRDVPVTLVHVKPTDEI
GPWLDMPVVPEYTAAIDRRCAEIVAEAVKVVSAALQDRRQVPVKEVTLSG
RVKPMLVEASGEADLLVVGCRGLSGLGRLLLGSTTAAMLHHARCPVAVIH
DEEVEEAASSDPVVVGVDASPASEPAVALAFDEASRRGVGLVAVHTWMNS
ADFYVDVSVIDVAAQAEEELAQRLAGWGEQYPDVEVRRVVAQDNPTHRLI
DESRRAQLLVVGSHGRGGFTGMLLGSVSSAVAQAARLPVIVVRGAG
145225574YP_001136252.1 hypothetical protein Mflv_4998 [Mycobacterium gilvum PYR-GCK]MQTFTLGFGVWLRRLASRSPLVRSTDRVEAAVMTLIVVAGVCAVPIAGAV
GTAEYDRLTNSLAAERLTHREVDATVVRDSRTVSEPYETTYLTEIGWNVG
SVARTAEITTTRKSAGDRLTIWVDDSGDLVRKGLTDGDAATQAVVGALGV
WFAVTGLGVATWMLLRLRLDHLRSQNWDRELDDLADNGGRSNNTT
145225573YP_001136251.1 alcohol dehydrogenase [Mycobacterium gilvum PYR-GCK]MQAMVYTGPGQRSWQTVPDPVLVDATDAIVRVDTVTICGTDLHILKGDVP
EVESGRILGHEAVGTVTAIGSAVQTLSVGDRVLVSCISSCGACRYCRQGH
YGQCLGGGGWILGHLIDGTQAEYVRVPFADNSTHKVPAGVSDEQMIVLAD
ILPTSYEVGVLAGRVGPGDVVAIVGAGPIGLAAVLTAKLYSPSHIVVIDV
ADTRLEAAKKLGADVTVNSRSRRPRDVIDELTGGLGADVVMEAVGLPETF
EESVDLVRPCGHVANIGVHGAPATLHLERIWIKNLTITTGLVDTHSTPTL
ISLVANGRLDAATMITHRYPMDEFDTAYQVFGDAANSGALKVVLTATS
145225572YP_001136250.1 UspA domain-containing protein [Mycobacterium gilvum PYR-GCK]MSALPLRHKPVVVGVDGSRAAVNAVRWAAAEALAREVCLRLVHAVASPAP
DDAVLDRAKIAALASHDSLEVEVVSTVGEPGPVLVRESRDASMICVGSRP
VASADAPTIGPTARALAAGADCPVAVIRTGRDGLPQTAGAIAVVLSDDDD
TDATVHLAMHEGRLRHATVRQIDRRTDSWVRRYPDVHVELVAAGTGRQYA
RNDLAPNGIGLAVVGRRDAVELAEVGRNNSHPILGYPDCSLLLVRS
145225571YP_001136249.1 UspA domain-containing protein [Mycobacterium gilvum PYR-GCK]MVRSSAVLVGVDGSATGAAAAAWAVKEAASRDLPLRLVHAVTATGDGRVD
AQDLARAGRIVHNAVTAVEALGAPVRIESQIICGATAPALSAASHDAAML
CLGFTNGASGRHRARRSTAAEIASSARCPVAIIHPAANHSPGARWVVAEA
GASPSDDATSTRAVDEALLRGAPLRIVAAWPSRYPDMYDDHAVARKNRLV
KARWERWLAPRRRQHPDLDAHVTAAPGSILNYLARHRKGIRLAVLSHERA
DDVAELLAPCVDCEFDILICDAPPGRRHDRTSSSEQSG
145225570YP_001136248.1 hypothetical protein Mflv_4994 [Mycobacterium gilvum PYR-GCK]MHDTAVDIEVITDAVALASRAPSLHNSQPWRWVADATAVMLFLDDAAAPR
HTDPTGRELVISCGAVLDHFRVAMAAAGWRSHTERFPNPNNLDHLATVGF
SRLDFVTDAHRRRADAVSRRHTDRLPFAEPAHWDGFLRGLTPFSASQGVS
LHVLPDASRAALVEASELTRTIRRYDSDYHAELIGWTADVAVAEGIPSAA
LLSPIESAHVGIARDFPAAGHGDRRGEIAEDHARVVVLSTGDDSRAVFLA
CGEMLSSFLLDATLAGLSTCTLSHLIEVPESRKTLAALTGSPDSPQLLVR
VGTAPSSRATGPPTPRRPPSDILRFED
145225569YP_001136247.1 heavy metal translocating P-type ATPase [Mycobacterium gilvum PYR-GMAGSGHTRWRPLLEPALTILTVGALGAGAVAWLSGADRIADMCWAAGTAV
AIVPAVAWVILALRSGRLGVDLIAVLSLGGTLLVGEYLAGALIAVMLAGG
RALDAAASRRASRDLTALLERAPRFARRRTGTEVQTVPIAEVAVDDVLVI
APGDVVPVDGRVVDAVAVLDESALTGESLQVEHPVGEAIRSGVVNAGDVF
ELRVTATSENSTYAGIVRLAQQAGAESAPLVRLADRYAAYFLPLALAMAG
IAWLASGSAVRAVAVLVVATPCPLLLAAPVAIVSGLSRASRSGVVIRSGG
ALENLGRATTLVMDKTGTLTMGQPRVVDVVTGPGTDAAEVLRLAASVDQV
SPHVLADAIVTEAVNRGLRLTLPTEAAEEPGRGVSAVLDGRRVTVGKLGD
DAAQSAWAQGAVNRARLDSAALAWVCVDDRPVGAVLLRDPLRRQAPRTMR
RLREAGFDRLVMLTGDRPEPAREVATVLGLDEVYAQQTPADKVAAVRDER
ERAVTVMVGDGINDAPALAAATVGVAMGARGATASSEAADIVLTTDRLDR
LADAMDIARWSRRIAVQSAVAGMSLSLVAMAAAAMGWLPPAVGALLQEAI
DVAVIVNALRALRHDPRTKVDLTAGTESMLQGFAAEHDELRDALGQIRDS
ADLLAGSAARPGAAAFDSVKQSYALLTERILPHERAEETELYPALAVPLR
SGEATATMSRMHAEIQRLSDRIGTHVHLAESSGGIQPYQVDDLLACLYGL
HALLRLHFVQEEENYFTLVQTDPDR
145225568YP_001136246.1 UspA domain-containing protein [Mycobacterium gilvum PYR-GCK]MSDPSTDLGILVGVDGSPESHAAVRWAAQEAVLRRRPVTLMHVVSPIVVT
WPIDTVVANFYEWQEDNAARVLKQSQETLAAAVSDTTAPTVEVEVRHDGI
VPEFTEASQHADLLVLGSRGLGPVGGAVLGSVSRALLHHAQCPVVIAKEG
VVPRDAGALPVLLGIDGSPASENATTFAFDEASRRGADLVALHAWSDVAV
FPILGMDWHQYEQQGHEILAERLAGWQERYPDVHIRRRIVCDTPARWLID
ESRHSQLVVVGSRGRGGIAGLLLGSVSTTVAESALAPVAVVRG
145225567YP_001136245.1 UspA domain-containing protein [Mycobacterium gilvum PYR-GCK]MATANSDMPVVAGIDGSAAALGAALWAVDEAAARGATLRLVYVTKPSDRS
AAEYAGDVRHGRQSLREAQVLVQSTGESVNVETEIVDGPPAQALVALSEH
AQMVCVGSVGIGRYARSILGSTAADVAAAARCPVAVIRPESRVGVDTPNW
IIVAVNDRPHNGAVVEHALQEAALRHAAVLVLGDSRTAASAEVLEQRIRP
WHERYPQVHVYPIANRADVAHFLRKHDEPVLLAVLGDDEADEVAQIVGHG
RSALRHGASSALVVRS
145225566YP_001136244.1 phosphoenolpyruvate synthase [Mycobacterium gilvum PYR-GCK]MESGTRNTHVCDISALSIGDAEEAGGKGANMGELVAAKLPVPPGFVLLRD
CYRDSMRAGGVDAELASLHREALDDVADTARLGELCERMQGLVRKAGVDD
ATAADMLAAYHAMGPGAVVAVRSSATGEDGADASFAGMNATLTNITGDDG
LVTAVTRCWMSLFSPRVITYRASRGFLGTPAMAVVVQKMIDSEKSGVAFT
ADPSTGARDRVVIEAAFGLGEVVVSGSVEPDTYVVSKETMEPIDVRLGNK
TFKIVRGEDGSDTVVQLDDATAASRVLTDEELHSVAELAVATERHNGCPQ
DTEWAIADGAAYLVQARPITTLGHTTPPARTEHVVLARGLAAAPGIASGK
VRVLQTPDEGHRLQEGEILVAQMTNPDWLPTIRRAAALVTDTGGMTCHAA
IVARELGVPCIVGTRTGTRDLHDGTTVTVDGARGEVASGVTEPAPQMTVS
PRSAPAPVTAEVTGTRVYVNLAMPESAETVAAQPVDGVGLLRAEFMLTEA
LGGRHPRDLIARGEQNMLVEKMVDSVGRIAAAFSPRPVVYRATDFRSNEF
RGLTGGAEYEPVEHNPMIGFRGCYRYVKEPELFALELEALARVRERSPNV
ALMIPFVRTRWELEECLSLVDASPLGRQRGLHRWVMAEVPSVVHWLPEYI
GMGIDGVSIGSNDLTQLLLGVDRDSDVCAELFDESDPAVLHAIRRIVDTA
NKFGITSSLCGQAPSTNPAFAEHLVRLGITSVSVNPDAVDATRRVIAAAE
RRIMLAAARSLPEDQ
145225565YP_001136243.1 HAD family hydrolase [Mycobacterium gilvum PYR-GCK]MPVFIDPRHHDAVIFEVDDPVADEVALSASQGDLARRLTAAGIGVGCAES
AMLRETARRLGVHPGRCVVVAGGEAGVRTARAGGFALIVGIDRAERAEDL
RSCGADVVVPDLVAVTVRDGYRRMSELADALQSYGEIVPLAETRTPVVLL
DFDGTLSDIVGDPDTAALVPGARSVLDALAARCPVAVVSGRALADIRDRI
GVPGIWYAGSHGFELCSPDGGIQENEAGLEIVRVLAGALAEVRERVGAVD
GVLIEDKRFSIAVHYRNVAAESVDEVVTAVRNIAQCNGLRADGGRRVVEL
KPDTGWHKGRAVEWILDRIDGDELLLPVYIGDDLTDEDGFDAVRLRGIGV
AVRSAESGDRRSAARFALDSPAAVCAFLARLSDQLAVEQDLTNDPWTLTF
GGYLPEDERLREALCTLGNGYLATRGAAPECDASRLHYPATYVAGIYNRL
FDEIAGTTVDNESLVNLPNWLPVTFRVDGGAWFDIDAVEFTSYVTTLDLR
RATLTREFVMRDQAGRITRIRQRRLVAMHRPHVAAMATTVRAENWSGRLQ
LRSVLDGGVENLGVERYRALSSRHLTVDAMRELSRDAVLLQTHTGESQIQ
IAVAARHRVTGGEPESVDQRVFRDDCRIGHDIEVVVTAGQAVTLEKVIAV
YTGRDHGMSGPVTAAEREIAGADTFDRLEDGHRLAWAHLWERFNIDMGHD
PNLLRLVRLHQLHLLQTLSPHTADLDVGVPARGLHGEAYRGHVFWDELFV
FPVLNMRLPKVTRSLLLYRYRRLPEARRAAAEAGYAGAMFPWQSGSDGRE
ESQRLHLNPRSGRWNPDASARAHHVGLAIAFNIWQHYQVTGDIGFLIDYG
AEMLVEITKFWVSAANLDPHRDRYVIRGVIGPDEFHSGYPGREYDGVDNN
AYTNLMAVWVIVRTLEALERLPLSYRLALLETVGVGDEDLAHWEDVSRRM
FVPFHDGVITQFEGYDRLRELDWEAYRNRYDDLQRLDRILEAEGDSVNNY
RAGKQADTLMLFYLLSADELYELFDRLGYNFAPEQIPATIDYYQKRTSHG
STLSAVVHSWVLARGDRREAMHYFRRVLASDVVDIQRGTTAEGIHLAAMA
GSIDLLQRCFTGLELRRDRIVVGPMWPEPLGRLAFTFRYRGHRLRLTVLG
RSSTLSAEPSEASPILVECRGQAQTLVAGGTVEFTR
145225564YP_001136242.1 erythromycin esterase [Mycobacterium gilvum PYR-GCK]MTTARRAASDQPRRVFRDRREAGQALAGLLGGYRGRENVVVLGLARGGIP
VAWEVAAALGAPLDAFIVRKLGAPGHDEFAMGALASGGRVVVNDDVVRAL
RVSPQQPRDVAEREGRELLRREAAYRAGRPPLELAGKTVIVVDDGLATGS
SMFAAVQALQEMDPAEVVIAVPAAPESTCREFAAIVDDVVCASMPTPFLA
VGESFWDFRQVTDDEVRELLETPTVGFATARIRLAETPAEVIDRCAVDAP
AGVPPLEALDELIGDARIVLIGESSHGTEEFYAARAEITKWLIEEKGFCG
VAAEADWPDAYRVNRYVRGQAGDGSAEEALRGFERFPAWMWRNTVVRDFV
AWLRACNADRRAQGRREAGFYGLDLYSLHRSMQEVIDFLDRVDPDAAQRA
RERYSCFDHSSGDDGQAYGFAAAFGAGLSCEHQAVEQLVEMHRSAVEYAR
RDGLLAEDELFYAQQNAQTVRDAEVYYRSMFGGRVTSWNLRDRHMAETLE
ALLRHLDRQGGSEPARIVVWAHNSHVGDARATEVGADGQLTLGQLAREKF
GDHVRLIGYTTYTGTVTAASEWGGLAERKAVRPALNGSVEELFHEVDRPA
FLVSPLISHAAAEPLDAVRLGRAIGVIYLPATERQSHYYHVRPSEQFDGI
IHIDRTTALEPLEVTSTWAAGETPETYPTGL
145225563YP_001136241.1 ribokinase-like domain-containing protein [Mycobacterium gilvum PYRMSGTAAIVTLTMNTALDVTADADNVVPTEKIRCRAERYDAGGGGVNVARF
AHALGAPVSAVFTAGGSTGARVIDLVHATGVCEIPVLIEGGTRESFTVND
RASGRQYRFVLPGPVLSLGEQARCLEALRRAAGTAGIVVASGSLPPGVPP
DFYQRVADICSDVGAMLVLDTSGGGLRHVTSGVHLLKPSIRELRECLDRP
LHTEPEQIAAARELIDRGAAKVVVVSLGADGALLVTPDDSERLSAVPMTS
VSCVGAGDALVAGVAVGLARRWPLGRAVRFGIAAASAKLQTPGTAAFHRD
DVERYFVTQAAHSEA
145225562YP_001136240.1 hypothetical protein Mflv_4986 [Mycobacterium gilvum PYR-GCK]MSTSDFAAAEGEYSVDDDNQLQPEDTLVDRGVDDVLDEGYSPPERAYERG
HFADEEDPAARLNSLFDDAELQRSDDAEREAEFPEHREVGGRRAGRLVAP
DQGFGPDIDAELVADDVGISGGAASAEEAAVHIVEDIVEDGD
145225561YP_001136239.1 UspA domain-containing protein [Mycobacterium gilvum PYR-GCK]MTDEAAPYGIVVGADGSPSSLSAVRWAATEAGLRHLRLTVAHVHEGSGAD
EADSVLDEATAEARNAAGVDGPDVEGRRLTGQPAAELVELSGDAQLVVVG
SRGRTGRSPGSVGLGLLHHARCPVVVVHDDLAPRNRPGRRPVLVGIDGSK
TSLHAAAIAFEEASRRSVDLLALHVCKDADTGGPHDHRMTILEEEAADFL
RETLADLQQRFPEVVVRPLIRFANPTRQLLVQAERSQLVVVGSHGRGAIA
GRLLGSVSAAVAEGCRIPVIVARRT
145225560YP_001136238.1 hypothetical protein Mflv_4984 [Mycobacterium gilvum PYR-GCK]MPATSTDHLALTRRQLDDIAWQFLRSEFTGDIYAQWSLDRSLDVFLLHRG
FRKLHDNGSAYSALMERVMANLGTAARLGLLRRPSVEAKP
145225559YP_001136237.1 acetyl-CoA synthetase [Mycobacterium gilvum PYR-GCK]MTVIHKSPEDWRVTPNLVDYENTCTTFRWDAAPDVCAGMGDGLCNIAYAA
VDRHAGGSAGGRTALRFVSESALTGETSVRDLEYSELASLSSRFTAVLRA
LGVGKGDRVFTLLGRCPELYVTILGALRNGSVVSPLFSAFGPEPVATRLR
LGDAHVLVTTRAMYRKKVADSRSALTSLKHVLLIDEDIDDDIGEEEGATA
TGFWRWMEATPDGAPIEPTTADDPALLLLRDQVDLDSMDWLNFLVGIHKR
LHVDIPEADYRKLRTLADVVGYVGSREAPS
145225558YP_001136236.1 hypothetical protein Mflv_4982 [Mycobacterium gilvum PYR-GCK]MASRTSSAIAGIVVVVAVAVAVGIIAIVLSGRTQSPGTAGAPEAVDFSRW
WAGTHQHVTDLQKSLDDSKRALNRMDGPALDSACQRMHDAAGVGLVAHLP
APDADLTAELEAVAADAHDAAHMCLAVLEQSLNSYDAEFTTRVDQADRHL
NEAVAVVNRQLAQESRSSRG
145225557YP_001136235.1 hypothetical protein Mflv_4981 [Mycobacterium gilvum PYR-GCK]MPIARPTVGLAVEALRDEVVLFGLRARRPLSDPASFERIHDEVVAALDFY
GGRGCLADPARFFTTPDALADVEVTPVRRRNHTYARLRWESGYHPLAGEP
GGDRWMTYTANRRGYALMLRHPEPRPWLMCIHGTEMGRAALDLALFRAWY
LHEELGLNVMLPVLPMHGPRGRGLPKGAVFPGEDVLDDIHATAHAVWDIR
ALLGWIRAENPGADIGVYGLSLGGFIAGLLAGLDDGLTCAVLGVPVADLI
DLLSRHSGLGRDDPRRRTILLAAPLGRMISPLSLPPPVPMSGRFIYAGLA
DQVVHPREQVVRLWEHWGRPNIEWYHGGHTGFFQSRPVQHFVTDALVRSG
LVTGIGRPQSPDAATG
145225556YP_001136234.1 zinc/iron permease [Mycobacterium gilvum PYR-GCK]MLLWIVAAGLAMSALALVGSLALLIPDRLFTRVVLPLVALAAGALLGGAM
FHMLPEAIEIVGDSTTVFAWCAAGIVSFHVLEQFLNWHHCHRPVSRHRPL
GYLILVADGLHNLIGGLAVGSAFVVDIKLGIVTWLVAAAHEIPQELGDFG
ILVHSGWTPSRALFYNVVSALTFLVGALLAYAFAGRLDVEVLVPFAAGNF
IYIALADLLPEIATTPALRDKLFYSTTFVIGLMLLWAVAQSV
145225555YP_001136233.1 hypothetical protein Mflv_4979 [Mycobacterium gilvum PYR-GCK]MDGYWLDLALVAVLVLVNGLLSGSEAAFISLGEGQLREMERRGTRRDRIV
VDLAREPNRFLATIQLGITLAGFLASATAAVSLAEPVESRLQFLGGAAAA
VSIAAVTIVVTASTLVFGELAPKRLGMQYARRWAGLVAPLLRFLAIVTKP
VIWGLGQSTDIAVRVVGGDPDVGKKEPTFGELRELIAGHSGLNPEQRTII
SGALEIHERALREIVVPRPRVFRLRADLPVPQALHALAASGHTRAPVVPA
GELDDAIGVVHLRDLLGSAGTVADVARPALLLPDSLRVTAALSRLMDEHE
QFALVIGERGGVSGIVALEDLLEEVVGEIYDEQDKDIRAARLLPDGSRIL
PGSFPVHDLGDVGVDGSRLPRGNHTTVAGLILDSLGRMPEGPGDRIEIGG
YRWEVTAVDAHAITEVRVVPSPH
145225554YP_001136232.1 UspA domain-containing protein [Mycobacterium gilvum PYR-GCK]MAVTPESAKVVVGVDDLSSSQPALEWAAAEAGRRGAPLVILYAATLPIGA
WPVVPVPTGFLDWQRQIGQEILADARQIAEKLTAGAIPVTAEFAVATPTA
ALVEESRTAGMVVVGSRGRGGFARKVLGSTSMGLVHRAHCPVVVVRDDGS
APASDAPVLLGFDGSASAAPAVEIAFQEASQRGVGLVAVHAWWSPGAFEM
PGFDWEEVRPDVEREASRQLSDWQRRYPGVPVELVVVRDQPARRLVERSG
AAQLLVVGSHGYGAVTGSLLGSVSGAVVQAATTPVMVVRPGDS
145225553YP_001136231.1 hypothetical protein Mflv_4977 [Mycobacterium gilvum PYR-GCK]MERMTAFDAGFLDAEDADRHVSLAVGAVSVVDGPMPDFDEIVAAIGEKIV
TIPRLRQVVRRQPLDLSAPEWVEDPTLDLAHHIRRAALPHPGDDDALFRF
TAEAMEPRLDRERPLWQAWIIEGLADDRWAILMKVHHCIADGIAAMHMLA
GLSDDGEGETYAGAIRAAHEAGASRPALPSPTLNPVRWARAGWNATTAVA
ATAAMTVEGAIGILSGLVRNAESSLNGPVTTMRRYSAVQVPLATVASVCQ
AFDVTLNDVALAAITDSFRSALKRRGEEPRRDSLRTLVPVSVRSDDARDR
LDNRVSVMLPHLPVDEPDPVEQLRTVHRRLNRAKSSGQRQAGTAAVAAVK
LIPFALATRAIRAVTSLPQHGVVTLATNVPGPQHRLQVMGREVVRMFPVP
PMALRLRTAVAILSYGDDLVFGITTDFDAFPDVDELAAGIGAAVDTLAAA
ARPL
145225552YP_001136230.1 hypothetical protein Mflv_4976 [Mycobacterium gilvum PYR-GCK]MGDDSGAKLIDDELRDVIATLRARYPDCPTGEIEALVADIYGRLNASATV
SAHLIPLTMNLSLRALRTMSQRRG
145225551YP_001136229.1 sulfate transporter [Mycobacterium gilvum PYR-GCK]MTSNFGELRSYRRSALRDDTQAGLSVAAYLVPQALAYATLAGLSPAAGLW
AALPPLLVYAILGSSRQLSVGPESTTALMTAAVLAPVVGGDDPVRYAASA
AVLAILVGLVCLGAGMLRLGYLANMLSKPVLVGYMLGVALAMVAGQLGRI
AGVEVTGDTVPAQLAAFAAAVDGVHWPTAGLALGVLVLVLTMERVAPTLP
APLIGVVVATVVTWAGELTRFGVAVVGDVPVGLPAPALPWLTVDQIQALI
VPAIGISVVAFSDNILTARAFASRAGQNIDPNTELRALGVSNLAVGFLRG
FPVSSSASRTALAAAAGARTQMYSLVVLAVVAVVVVFGGGLVSHVPAAAL
GGLIVYAALKLVDVRSFRALARFRRSEVVLAALTAIAVTVFGLLYGVVIA
VALSVLDLLRRLSHAHDSVQGLVPGLAGMHDVDDYPDARIVPGLVVYRYD
APLCFANAEDFRRRALEAIDQMDQPTRWFVLNAEANVEVDMTAIEALDQV
RQDCLRRGIVFAMARVKQDLREALAAGGVLDEIGQDRLYMTLPTAVAAYQ
AWVASGNKG
145225550YP_001136228.1 translation initiation factor IF-1 [Mycobacterium gilvum PYR-GCK]MAKKDGAIEVEGRVVEPLPNAMFRIELENGHKVLAHISGKMRQHYIRILP
EDRVVVELSPYDLTRGRIVYRYK
145225549YP_001136227.1 30S ribosomal protein S13 [Mycobacterium gilvum PYR-GCK]MARLMGVDLPRDKRMEIALTYIYGVGRTRSQEILEATGISRDQRTKDLTD
DQVSQLRDYIEGNLKVEGDLRREVQADIRRKIEIGCYQGLRHRRGLPVRG
QRTKTNARTRKGPKRTIAGKKKAR
145225548YP_001136226.1 30S ribosomal protein S11 [Mycobacterium gilvum PYR-GCK]MAQAKKGAPKKGQKTRRREKKNVPHGAAHIKSTFNNTIVSITDPQGNVIA
WASSGHVGFKGSRKSTPFAAQLAAENAARKAQEHGVKKVDVFVKGPGSGR
ETAIRSLQAAGLEVGAIADVTPQPHNGCRPPKRRRV
145225547YP_001136225.1 30S ribosomal protein S4 [Mycobacterium gilvum PYR-GCK]MARYTGPVTRKSRRLGVDLVGGDQSFEKRPYPPGQHGRARIKESEYRTQL
QEKQKARFTYGVMEKQFRRYYEEANRLPGKTGDNLLRILESRLDNVVYRA
GLARTRRMARQLVSHGHFTVNGVKVDVPSYRVSQYDIIDVKDKSINTLPF
EVARQTAGERPIPGWLQVVGERQRILVHQLPERAQIDVPLTEQLIVELYS
K
145225546YP_001136224.1 DNA-directed RNA polymerase subunit alpha [Mycobacterium gilvum PYRMLISQRPTLSEEVVAENRSQFVIEPLEPGFGYTLGNSLRRTLLSSIPGAA
VTSIRIDGVLHEFTTVPGVKEDVTDIILNLKGLVVSSEEDEPVTMYLRKQ
GPGEVTAGDIVPPAGVTVHNPDMHIATLNDKGKLEVELVVERGRGYVPAV
QNKASGAEIGRIPVDSIYSPVLKVTYKVEATRVEQRTDFDKLILDVETKN
SISPRDALASAGKTLVELFGLARELNIEAEGIEIGPSPAEADQAAHFALP
IDDLDLTVRSYNCLKREGVHTVGELVARTESDLLDIRNFGQKSIDEVKIK
LHQLGLSLKDSPASFDPSEVAGYDVATGTWNSDAGYDSGYEADDNQDYAE
TEQL
145225545YP_001136223.1 50S ribosomal protein L17 [Mycobacterium gilvum PYR-GCK]MPKPTKGPRLGGSSSHQKALLANLATALFEHGRIKTTEPKARALRPYAEK
LITHAKKGTLHNRREVMKKIRDKDIVHVLFAEIGPFYSDRNGGYTRIIKV
ENRKGDNAPMAVIELVREKTVTSEANRARRADAAQKVAAAAAPQAAVEPE
VTEGPSADEAEAVAETPIADEAQVEVEGTESVSEAEADEAKADSEDEAK
145225544YP_001136222.1 tRNA pseudouridine synthase A [Mycobacterium gilvum PYR-GCK]MKPSSQPVNEPATDSGGGFVRLRLDIAYDGTDFAGWATQAGQRTVAGVID
DALSTVFRTPVLTRAAGRTDSGVHATGQVAHADIPTDALPHAYPRTVRAG
EPEFGPLVRRLGRMLTEDVRVRGIVRAAPGFDARFSALRRHYVYRLTTAP
YGVEPAEARFVTAWPRPLDVDAMAGAAQNVLGLHDFAAFCRHRDGATTIR
ELQRLDCVRDGDRISVHVSADAFCWNMVRSLVGALLAVGEHRRDDTWCVQ
LLHARHRSSDFAAAPARGLTLVGVDYPPDDELAARNLVTRDVRTADEL
145225543YP_001136221.1 cutinase [Mycobacterium gilvum PYR-GCK]MIRQLRNLRVPYLVVALLFGAASLILPPAASAQACPQAELIFARGRIESP
GAGVIGNALASALRNKTGRDIDLYAVKYPADTEVDIGANDMSQRIQYMAR
NCPDTRLVLGGYSLGAAVTDIVIAVPIAAFGFKNPLPDGVDRHIAAVALF
GNGSQWVGPIANFTNPALRDRIVELCHGDDPICNPTAPENWQDNWPAHLA
SAYVGAGMVNQAADFIVGRL
145225542YP_001136220.1 cutinase [Mycobacterium gilvum PYR-GCK]MVPMAALAVMPTTTASAQPCPDVEVVFARGTSEPPGVGRVGQALADQLRN
QLGGRTVGTYGVVYPASYDFFTSGDGAADATNRISVMAAQCPNTRIVLGG
YSQGAAVVDMLAGVPPLGNRIGDVGLARPLPGGLNGNVAAVAVFGNPATK
FGNPVSARGSFAGKALDLCADGDPICSDGRNPFAHTSYERSPLIGQAAGF
AAGRL
145225541YP_001136219.1 cutinase [Mycobacterium gilvum PYR-GCK]MKIDLEVVTRGVRALVAAAVAAGVLVVAPAVAAPRSLPAAGAQGCTDIQV
VFARGTDEPPGLGRVGSAFVESLRGRVGGRSVGSYAVAYPATFDFLAAAG
GANDASNHIQWMMANCPSTRLVLGGYSQGAAVIDVIAAVPFPAVGFDRPL
PPNAPDFIAAIALFGNPTTKVGLPITASPVWGTRSIDLCNGADPVCSAGD
DIAAHSNYGPAGFTDQAAAFVAGLV
145225540YP_001136218.1 hypothetical protein Mflv_4964 [Mycobacterium gilvum PYR-GCK]MAALDSSVTSRTQARADHFRSGLLFALASAFAFGCSGPFAKALMTAGWSP
TAAVTARLAGGALAMAVFATVVRPGWVREARHHARTVVLYGIVPIAGAQL
FYFNAVAHLSVGVALLLEYTAPLLVVGWLWATTRHRPSGMTLAGVVLAVG
GITLVLGIIGPGGVAAAHINLAGVGWGLAAAVCAACYFLMSDKAGAMSDK
EVADGRPSLHPITLAAAGLAFGAVTVAALGFSGLMPLAFTANDAVIAGFT
TPWIVPVIALALIPTAIAYTLGIVGIARLRPRFASMVGLSEVMFAVLAAW
MLLGEGMAAAQVIGGAIVLAGLALARQGDRGELVGETNVGETSVTPTALP
QTTPVARGGPATIDP
145225539YP_001136217.1 hypothetical protein Mflv_4963 [Mycobacterium gilvum PYR-GCK]MLFTYDTELTLRAASVLINTDRVDGEQLADLAALDEYLDHFGWTGRRDHD
AAELKSVHQLRDRLGRIWAAADDEERAVGHVNALLSDTRASPWLTRHPEM
PEWHLHLASIHDPLWQRMGAEMAMALADLIRAGELRRLKLCAAPDCEASL
IDLSRNRSGKFCDTGNCGNRQHVAAYRERRSNK
145225538YP_001136216.1 hypothetical protein Mflv_4962 [Mycobacterium gilvum PYR-GCK]MGQPVTRLQISGQRFLTRRMEHALVRADARMLDDPLRAQSLSLVVGAVLA
AIAVAVCAVIAVVRPGGTLGDARIVVVRESGAMFVRLDDVLHPVYNLASA
RLLLGSPEVPRVVAQRAIDHAERGARLGIPAAPEQIPTPLSADEAAWSVC
DDDRGVTTVVAGPPATEGMTADRHVLVTPRGQSAAVTYLLHGGRRSRVDL
RHPAVVRALRLDGVVPQPVSMELLAALPEAPAIEPPRIPGLGAPAPGALR
NRTVGTVVTVAHAGTGSPRGAGDHFVVLADGLQRIGEVTADLIRFTDARA
GAEIPAVSADIVGALPVVTSLPVATYPDRADVTTASVVCATWAPTAGGHG
SRTELLTGPKLPPAPRPIVVAPGREVAVPPGRSLYVRAVGLTGGDHSGGL
LFLVTDAAIMFGIRDADAAAALGLVGAGVPAPWPVLATVPRGPELSRDAA
TGR
145225537YP_001136215.1 peptidase S8/S53 subtilisin kexin sedolisin [Mycobacterium gilvum PMTRTWRVAAVTAIALMHTTPTAAAIGPPPVDTLRLPTADPPAPAQPTVQF
TDCVAAPPAAGSAPGQLAGMDLPTVWALTRGAGQTVAVIDTGTARHRRLP
HLVPGGDYVSHRDGTDDCDGHGTLVAGIIGASPDAADPGGFTGIAPDVSL
LSIRQSSNKFRAVDDPGGSGVGDVETLAAAVRTAADLGATVINISTVACL
PVAAGLDDRTLGAALSYAVEAKNVVVVTAAGNVGGPGQCQDPNPRDVGAA
DQVRTVASPAWYDDYVLTVGSVGTDGSPSEFSLAGPWVDVAATGEGVVSL
AATGDGLADRSPSDAALTGTSYAVPVVSAVAALVRARFPEMTARQVMQRI
EDTARPSSAEWDPVVGHGVVDALAAVSGPGSHPAALPAAPPVDAPTPAPA
RVQRQGATAVRGALICVALTVCVALVSAVIARSRRHG
145225536YP_001136214.1 hypothetical protein Mflv_4960 [Mycobacterium gilvum PYR-GCK]MPDTLCRLTVHVVGADESAAVDLVLPAACPLGELMPSLVDTIFGDTAGQE
HWQLTRVTGPPLNPALSLRDNDIGDGDMVMLTASRVPSPRISPTEACTVV
ALAGGNRESGHGATPWCIAGIIVAAVTLVRSGMVTPGGWHLWCAAALSGI
AGTMSVALGRADRRVSTVLNTAAVVFAAATGVLAVPAAAWPAATLLAAAS
ALAMSTLLARMCPGAADLPAFCAVAGAVTAAAALSHLAAPRLTTAGAVLV
VLSLAGLAISPRITIALARLSPSRPAVDDEEAAAAHTLLTALVAGWSSSA
ALGAVVVAAATIVSGASAGLCAGLCVAAGVVLILRRNSHADGVRRLWLGT
SGFIACAAAVPAVADAAPAQAFWLSVAVAGGCVAGALRAGRPEPSNPALR
HGIQVLEYVALAAVIPLAFWVSGVYGLVRDASLL
145225535YP_001136213.1 cell division protein FtsK [Mycobacterium gilvum PYR-GCK]MVTVPCGTFSACGWNGAGVPCVYSYVDAGRIVLDAPPTPPAPTHTNVLAR
LMPVAMVAAMGGMTALYLTSTDATSRNPMFLFFPAMMAVSLIGTLAYGSR
GAGRSGELAAQRAEYLRYLDTVDGALARAGEDLHRYLHAAHPAPAVLWTL
AGTPRMWERAEDDPEFGMIRIGIGERAGATAVAAPGWVPGDDADPVTTEA
VQRLLAHRETVGDVPVTLSLRSVRTLAICGEPAAARSVARALLCQIATLH
HPDTMSISAAPVTDWDWLKWLPHQRSSQEGRHHVVVADEGVSARDGTTLI
ILTAGSGAPTVTADGVPVAAVCDQMSEAEAAACARRIARHRPRRPSRSLR
RDWPALMGIDDPDALDVDVRWSRDLGSDLLRVPIGVADDGSVVELDIKEA
AAHGMGPHGLCVGATGSGKSEFLRTLVLGMVCAHPPGLLNLVLVDFKGGA
TFLGLEAVHHVSAVITNLADEAPLVSRMRDALSGEITRRQEMLRAAGNLT
NITQYAQARARDDTLAPLPALLVIVDEFSELLTQHPDFSEVFVAIGRLGR
SLGIHLLLATQRLDEGRLRGLETHLSYRVCLKTFSAGESRAVLGVPDAYS
LSSQPGAAYLKTASGVLTRFQTAYVSGGYTPASRPRSQPLTVRPFTSSDH
DVASESTVSQRPLLGAVLTRLAGRGAPAHRVWLPPLTSAPRLADLLHGTP
GRRLQVPIGVVDCPFEQQQMRHVVDLSGPAGNLAVAGAPRSGKSTVLSTV
MTALAATHDAAAVQFYCLDFGGGELTGLQHLPHVGSVASRHEGELCRRIV
AHVESVVRHRESATDETWNGHVFLVVDGWATLRQDFDGLEPAITALAGRG
LAYGVHVMIAASRWADLRPALKDQIGSRIELRLGDPAESEMDRRRARDLA
DRPPGRALTREGREMAIALADQRLPVRRDGPGAAPVELLPAHVDRSAIAA
PVPRRGEVLLGLGERELSAVSLDLTEHSHLMVLGENQCGKTASLRLLCAE
LVAAPQEARLEIVDFRRTLLGAVDSDRLTGYAVTPAAVTSRVAAITGVLA
DRMPGEDVTQRQLRDRSWWHGPEIYVVIDDYDLVAGATGNPLTPLADFLP
HARDLGLHVVVARRSGGAARAMFDPLLARMRDMGCAGLMMSANAEDGVLL
GAVRPGRLPPGRGTLIARGRPDELLQVAWTDPP
145225534YP_001136212.1 hypothetical protein Mflv_4958 [Mycobacterium gilvum PYR-GCK]MRGPGLVPDSAAAALEFIDDPIALVGDEPVDTVELWRDVLRAASGGAGDV
VVVVPTWWPGQRVDVIVAAATCLPPGTVVRHRSAVLCGTASAVLELSAEY
AVLTQPDGDPVVTARGTPGMAAQLQTSHTLLIDTPEGVQILSADVAADLR
RAGIPFVHSTSERMRRAAAQSVAERAPVEAGSSRRRGGGRAVAVVAGIAV
TVTAAAGGWAAQTFSAVPRPQMATRTLIEGRVALQVPAEWTVERVTGDAG
SARVRVAAPGGLPALHVTQSLGAATVPLAEVGESLRAALTLETDGVFVDF
DAAGSRAGRPAVTYVERRTATLTRWAVIVDGPLRIAIGCQHEPGNRDSVE
QICAEAVGSAHALP
145225533YP_001136211.1 hypothetical protein Mflv_4957 [Mycobacterium gilvum PYR-GCK]MSTPSGAHGSALATDFDLMVSVAGRTEARNDEIRSMLSSFIGAMSSVPPS
VWGGVAAVRFREVVERWNAESVKLHSALQRIAETIRDNERLLRDVAEGHS
QRIASAGTGL
145225532YP_001136210.1 hypothetical protein Mflv_4956 [Mycobacterium gilvum PYR-GCK]MNETLSYDFGEIEFTVRQEIHSTSARFNAALEDLRAQIAPLQATWTREAA
EAYRVEQARWEQSAAALNDILVNLGNAVRDGSDDVAATDRSAANAWGA
145225531YP_001136209.1 putative GAF sensor protein [Mycobacterium gilvum PYR-GCK]MAASKPSARRASPPPPTPPSASRLQAVHELFVAGEVDTGYLNSHAVRPVV
AQSWERSRAGGVDPDIGAARSAAAAAAVDRLRETHPLAPALPVIRRLLVE
DAIGSGVVVAVSAADGTLLWVEGDPGACRRAEAMNFVPGADWSERSAGTN
APGTALTLGREMQIHGSEHFSRVVQPWSCTAAPVHDPTTGALLGAIDLTG
GGQVATSQTLALVRATAVAVENHLALLRLAGAGAEPAARKPHLVVLGGDR
PRWVTTDSVGHLQITHLTGRHADILVLLSRHPEGLSADHLAVLLDDKDLD
VVTVRAEMSRLRKVIGAENLGSRPYRLLTSITSDLGEVYEALDAADVETA
LDRYPGPLLTQSVSPAIARLRTQLSATLRAAVLAESAQGRTDLLRRWLEQ
PEGRDDRDGWQALRDSAGLTPVARARARGHLAGLDFELG
145225530YP_001136208.1 lysophospholipase-like protein [Mycobacterium gilvum PYR-GCK]MRKRVANAHYGIDDDSMDIDSYARFLPEAYTASWTRPVSTWWPWRGRTVH
IARAPVPDASVRVMIVHGGGGYSGALWPGASVAAGEGVEVLAPDLQLYGD
TVEPDPAGVRYDDWVTLLCDLVNAERAADPRPLILFGASMGGMLAYEVAA
RTGQISAVMATCLLDLSDPQARAAATRFAWMGRPAPTLLRAVEPVLGRVR
VPIRWLADMRAMSTDPRLSRLCASDPRGGGVRVPLGFLADWMNYAHTAPE
AYTGAPVTLVAPAADTWTPPELSIRFLQRISAPTELVMLKNCGHFPIEEP
GLGHLRDAFIRVAAQVGRP
145225529YP_001136207.1 TetR family transcriptional regulator [Mycobacterium gilvum PYR-GCKMSTLVDAAAQVFSREGLTATTNRIADRAGLSIGTLYQYFPDKLALLRAVA
ERHVRDADRELTAVFAALRTEAPPFDATMRAVLGAVVAVHAGGGRLHALL
HRMVPADARDLETVQALEDRICDEVAFHLKRCDRGGDDVEMTARTLVHAV
DAQLHRVLSRDGFDVGDATDTLMVTVDRLAPPHG
145225528YP_001136206.1 aldehyde dehydrogenase [Mycobacterium gilvum PYR-GCK]MTVYARPGADGSLMSFKPRYDNFIGGQWVAPTAGRYFENPSPVTGQPFTE
VARSDEADIEKALDAAHAAAPAWGKTSAAERAVILNKIADRIEENLESIA
LAESWDNGKPIRETLNADLPLAVDHFRYFAGCIRAQEGSLSEVDADTVAY
HFHEPLGVVGQIIPWNFPILMAVWKLAPALAAGNAVVLKPAEQTPASILY
LMEVIGDLLPAGVVNVVNGFGVEAGKPLASSNRIAKIAFTGETTTGRLIM
QYASQNLIPVTLELGGKSPNIFFNDVLAASDDYQDKALEGFTMFALNQGE
VCTCPSRSLIQADIYDEFLALAAIRTKAVRQGDPLDTETMIGAQASNDQL
EKILSYIEIGKSEGAKVVTGGERAELGGDLNGGYYVAPTIFTGNNTMRIF
QEEIFGPVVAVTSFTDYDDAISLANDTLYGLGAGVWSRNGNTAYRAGRDI
KAGRVWTNCYHQYPAHAAFGGYKQSGIGRENHRMMLDHYQQTKNLLVSYS
DQALGFF
145225527YP_001136205.1 alcohol dehydrogenase [Mycobacterium gilvum PYR-GCK]MQAAVVTAFGEPLVVEERDLPAPGPGEALVKLVTSGVCHTDLHAAHGDWP
VKPSPPFIPGHEGYGTVVAVGDGVDDLSVGDMVGNAWLWSSCGRCEYCRT
GWETLCEQQRNGGYSVDGSFGTYMLVDAAYAARIPDGVDPVEVAPILCAG
VTVYKGLKVTDTRPGQWVAISGIGGLGHVAVQYARAMGLRVVAIDVDDSK
LDLATGLGAEVVVNARTADVVAEVHRATGGVHGVLVTAVHRDAFGQAIGL
ARRGGTIVFVGLPPGDFPAPIFDIVLKGLTIRGSIVGTRQDMVEAIDFFA
RGLVHPTVHTTRLDDINDVFDRMERGQIDGRVVIDYR
145225526YP_001136204.1 50S ribosomal protein L13 [Mycobacterium gilvum PYR-GCK]MSTYTPKAGDTTRSWYVIDATDVVLGRLAVEAAKLLRGKHKPTFTPNVDG
GDFVIIINADKISLSGDKLTKKFAYSHSGYPGGLRKRAIGDLLAKHPTRV
VENAITGMLPHTKLGRQIQKKLKVYAGPEHPHTAQQPVPFEIKQVAQ
145225525YP_001136203.1 30S ribosomal protein S9 [Mycobacterium gilvum PYR-GCK]MTETEFTDTEGTEVAEAVETQVAETETETAADEYAAPREPVIIDRPIQTV
GRRKEAVVRVRLVPGTGQFHLDGRSLESYFPNKVHQQLIKAPLVLVDRLE
QFDIYAHLDGGGPSGQAGALRLAIARALILVQPEDRPALKRAGFLTRDPR
AIERKKYGLKKARKAPQYSKR
145225524YP_001136202.1 hypothetical protein Mflv_4948 [Mycobacterium gilvum PYR-GCK]MSFVKNAAAGAVLGGSLLFTAGLGMAQAQPVDAPDGLVNLTVGDLTLLES
VSADTAATAASALCGAEATDISALATQVDGEGAPQTVCSGLPGGDLVVAQ
NVSSQTPLPAAPFPAEDAAPAEEAPAAESGSAEEGAGDGADAPAVPGAEE
SEG
145225523YP_001136201.1 phosphoglucosamine mutase [Mycobacterium gilvum PYR-GCK]MARLFGTDGVRGVANRELTPELAMALGSAAARRLGRAGATRRRVAVVGRD
PRASGEMLEAAVIAGIAGEGVDTLRVGILPTPAVAYLTSAYDADFGVMIS
ASHNPMPDNGIKIFGPGGHKLDDATEDRIEELVHQGPGERPTGAGIGRVV
DAEDALERYLRHVGKAATTRLDPLTVVVDCAHGAASVAAPRAYRAAGANV
IPIHADPDGLNINDGCGSTHMESLRSAVVSYGADLGLAHDGDADRCLAVD
AHGRVIDGDAIMVVLALAMQQSGELVSDTLVATVMSNMGLHLAMRSADIE
VRTTGVGDRYVLEELRAGQFSLGGEQSGHIVLPSFGTTGDGIVTGLRLMA
RMAQTGRSLADLAQPMQTLPQVLINVEVADKTTVADAPSVRDAVAQVEAE
LGDTGRILLRPSGTEQVVRVMVEAADEDTARQMAVRVADSVSAES
145225522YP_001136200.1 hypothetical protein Mflv_4946 [Mycobacterium gilvum PYR-GCK]MGTVGAARVDSAAVRAIAREYDAVSSIVDGAVRQHFGDMDFGGASAGRAY
VERGEALRATVAELAVGLRQWSRAATEIAVALRASADRYRDADERAAGRV
G
145225521YP_001136199.1 hypothetical protein Mflv_4945 [Mycobacterium gilvum PYR-GCK]MPDDFDVGARLAQGRPAADTLQRYVAACRQLGYEHRDLTLHPAQVTDWYG
TEDGMDLAALHRCCVALDGVGRAAQEALAVQERQLGELSAAWEGAGGDAA
RMFLARHGDSSAVATAAVRTAAEALVSLREELWRVVGGKVDSTVSAEGRA
AGAQAQWSAAATSVTTGTGDTATAGEIVEHAVKPFVDTVIRDEWLPAMQD
AVAAVTAAYDGATAEIAAERTPTFDVPGDLGPDCPEPRPSCDDEGQSGRA
DVAASPPAAAMSAAWSPPAGMPAGTPAATAPSAWSPPVPPAPVPSAPVAP
APLAAPAPEAPLPSPGSLGSGMPGLGGGPSGFGQHFADALSGLLGGGLGG
DALESPDLDLEEPALDEPGVEEPELEEENEEDAELEEDDEAEEKPESVVA
ADPVLPEEPCDPPPEPAATVAAPEPPAPPPPAEPVPAAEPASDEQTPCEI
AAGEVPQVGESAG
145225520YP_001136198.1 hypothetical protein Mflv_4944 [Mycobacterium gilvum PYR-GCK]MRLRIPEVVVLFTLGGIAALIGDHSHVATGTTAYDTDAVPFIWSSPLWFP
VLVGGATVILAELRLHFPALRDGVSARQAVAGVAAVVGLYVTTALVHDGP
VVPVTALIAAGAVIVWCVLGDGPAAVCGAVIAVVGPAVEIALVHLDVFAY
HPDADQLFGVGPFLVPLYFAFGVVAALLGELTVARRPVDARPVCDTVSRG
SGAD
145225519YP_001136197.1 acyl-CoA dehydrogenase domain-containing protein [Mycobacterium gilMPVDRLLPTDDARDLVELARQIADKVLDPIVDRHEKDETYPEGVFATLGE
AGLLSLPYPEEWGGGGQPYEVYLQVLEELAARWAAVAVAVSVHSLSCHPL
MSFGSDEQRQRWLPDMLGGSTIGAYSLSEPQAGSDAAALTCRATAVDGGY
RITGSKAWITHGGIADFYNLFARTGEGSQGISCFLVPRDTEGLTFGKPEE
KMGLHAVPTTAAHYDDANLDSDRRIGTEGQGLQIAFSALDSGRLGIAAVA
VGLAQAALDEAVAYSQERTTFGRKIIDHQGLAFLLADMAAAVDSARATYL
DAARRRDAGLPYSRHASVAKLVATDAAMKVTTDAVQVLGGAGYTRDYRVE
RYMREAKITQIFEGTNQIQRLVISRHLTRG
145225518YP_001136196.1 TetR family transcriptional regulator [Mycobacterium gilvum PYR-GCKMTRPAFATRRQTELFDALVTLFLSEGFAHLTLDEIAARLRCSKSTLYTLA
GSKEQLVQAATVHFFRTATATVEADVAAVTGARERIAAYLAAVGAALDPA
SDRFMADLDAFAPARAIYEKNTRIAAGRVQELIAEGVAAGEFRDVHAAFA
ADLVATAMVRIQQRIVLDSTGLDDAAAYRELAAILTGGIQA
145225517YP_001136195.1 luciferase family protein [Mycobacterium gilvum PYR-GCK]MRTGIFLSYAGGFLEAVDEVVECEKLGVDIALVAEAYSYDAISQLGFLAA
RTSRIELGTGVVPIYTRTPALMAMTAAGVDYVSDGRFRLGLGTSGPQVIE
GFHGLPFDAPLGRTREVVEICRKVWRRERVSYDGKYYQLPLPAERGTGLG
KPLKLINHPVRENIPITIAALGPKNVELTAEIAEGWQPVFFYPEKADEVW
GDALRAGASRRDPALGPLDVMVSATLAIGDDVDDRLSWGKPQLALYIGGM
GARGKNFYHNLATRYGFGEVADHIQDLYLAGKKAEAIDAVPDELVRQVSL
VGPAGFVKERLAAFAEAGVTTLLVHPMGVDAAERVRFVEQLQGLL
145225516YP_001136194.1 hypothetical protein Mflv_4940 [Mycobacterium gilvum PYR-GCK]MASTKKLFTALTRRGPHKVLRGDLAFAGQPGVLYTPAEGRNLPGVAFAHD
WITSARRYDGTLEHLASWGIVAAAPNTETGLAPSVLNMAYDLGTTLDIIA
GVRLGEGAISVHPGKLGLVGHGFGGSAAVFAAVGLSSAPHAPKAVVAAYP
TVSSPAAEQPAAGLTVPGLILVDPGDPMSLRSNAVELARAWKPATLRATS
KTKSGGLVEGRTLAKVVGLPGADRGTQKIVRALMTGYLLHLLAGDKTYRD
FSDADAELPRAEVMDPFADDPVDLENKVVALLKP
145225515YP_001136193.1 glucosamine--fructose-6-phosphate aminotransferase [Mycobacterium gMAMCGIVGYVGQRPACDIVVDALRRMEYRGYDSSGVALVDGHGGLTVRRK
AGRLANLEAALAEAGAESPAGATGLGHTRWATHGRPTDRNAHPHRDSSGK
LAVVHNGIIENFAALRAELEAVGVEFASDTDTEVAVHLVAREYTHGDTAG
DFPASVFAVLPRLEGHFTLVFAHADDPGTIVAARRSTPLVLGVGDGEMFV
GSDVAAFIEHTREAVELGQDQAVVVTADGYRVTDFHGNDDAASARPFHID
WDLSAAEKGGYEYFMLKEIAEQPAAVSDTLLGHFVDNRIVLDEQRLSDQE
LRDIDKVFVVACGTAYHSGLLAKYAIEHWTRLPVEVELASEFRYRDPVLD
SHTLVVAISQSGETADTLEAVRHAKEQKAKVLAICNTNGSQIPRECDAVL
YTRAGPEIGVASTKTFLAQVAANYLVGLALAQARGTKYPDEVAREYHDLE
AMPDLISRVLASSEPVVALAKQFATSQTVLFLGRHVGYPVALEGALKLKE
LAYMHAEGFAAGELKHGPIALIEDDLPVIVVMPSPKNSATLHSKLLSNIR
EIQARGAVTIVIAEEGDETVRPYADHLIEIPAVSTLFQPLLSTIPMQLFS
AGVAQARGYDVDKPRNLAKSVTVE
145225514YP_001136192.1 anti-sigma-factor antagonist [Mycobacterium gilvum PYR-GCK]MMMISTDQTRSGKFTVTPRRDGDLLVLHVTGDLDVLTAPTLSTHLDIALA
DAPPVVIVDISDVSFLSSAGIGLLVETHRLTERGGISLRVVADGAATSRP
LRMMRIDEVIDLYATTDEAKAGRPA
145225513YP_001136191.1 hypothetical protein Mflv_4937 [Mycobacterium gilvum PYR-GCK]MALRDELLELEHAGWKSLCDGTGDTFYGDLMTDDAVMVLANGMVMDRQTV
VSALGQSPPWARYDIDDVRVIEIDDATAALVYTGTGWRDGLDEPFVGAMS
SVYHRTADGWALALYQQSQKS
145225512YP_001136190.1 carbohydrate kinase [Mycobacterium gilvum PYR-GCK]MSRMRYFYSADAIRDAEAPLLASLPDGVLMRRAAYGLATAIAAELGTVSG
KSVCAVVGSGDNGGDALWAATFLRRRGAGACAVLLDPERAHRKGLAAFRR
AGGRIVETVPPTTDLVIDGVVGISGSGPLRPHAAEIFAAVDVAGIPVVAV
DLPSGVDPYTGAADGAHVTPALTVTFGGFKPVHAFGDCGRLELVDIGLDL
APSDVGALDAGDVAACWPVPGPDDDKYTQGVTGVMAGSATYPGAAILCTG
AAVAATSGMVRYAGTAAGEVVSHWPEVIATSTPASAGRVQAWVVGPGLGT
DEVAAAALVHALETDLPVIVDADGLTILAAHPEIVQGRTAPTVLTPHAGE
FARLAGSSPGAERVADTRRLADRFGATVLLKGNVTVVAEPDGQVYLNAAG
NSWAATAGSGDVLSGMIGALLAAGLPTGQAAAAAAYVHSRAADLSARDPG
PAAAPTSASRILAHLRTALASIL
145225511YP_001136189.1 glutamate decarboxylase [Mycobacterium gilvum PYR-GCK]MPNVSRHSSLAPAYTGRMSMSPVPALRLPDESMEPEQAYRFIHDELMLDG
SSRLNLATFVTTWMDPEAGQLMSETFDKNMIDKDEYPVTAAIEQRCVCMV
ADLFHAENLRDDDPSTAIGVSTVGSSEAVMLAGLAMKWRWRDKFAGKDGD
GWKGRTPNLVMGSNVQVVWEKFCRYFDVEARYLPMEKGRYVITPEQVLDA
VDEDTIGVVAILGTTFTGELEPVAEICAALDALAAGGGCDVPVHVDAASG
GFVVPFLNPLLVWDFRLPRVVSINVSGHKYGLTYPGIGFVVWRNAEHLPE
DLVFRVNYLGGDMPTFTLNFSRPGNQVVGQYYNFLRLGRDGYTQVMHALA
DTAQWLARELEGMTGSDHKPVFEVITDGSAIPVVAFRLTEGAKFTVFDIS
ALLRSYGWQVPAYTMPEDATDIAVLRIVVREGFSANLARALRDDLREVLG
KLDKVGIGGFSDEEHFAH
145225510YP_001136188.1 alanine racemase [Mycobacterium gilvum PYR-GCK]MTTTENRLMNTPSAVIDLDAIAHNVGVLRDRAGRAAVMAVVKADGYGHGA
TAVARAALAAGATNLGVATLDEALSLRRDGVTAPVLSWLHPPGTDFTPAV
QADIEVALSSRRQLDDLLRAVARTGRTATVTVKADTGLSRNGVSPADHPG
LVSALARAQTDGAVTVHGLMSHLAHGDVPDHPFNDEQARRLTEMASEARS
AGVAYDVVHLCNSPAALTRPDLAFDMVRPGIAVYGQTPIPERGDMGLRPA
MTVKCPVALVRSVRAGDGVSYGHTWLAPRDTTLALIPAGYADGVFRALSN
RFEVTINGRRYPNVGRVCMDQFVVDLGPGPVDVAEGDDAILFGPGDDGEP
TAQDWADLLGTINYEVVTSPRGRIVRGYVGGAQ
145225509YP_001136187.1 alpha/beta hydrolase fold protein [Mycobacterium gilvum PYR-GCK]MSRGAGWLAGAAGVAAVGSAAGVSMARSLRRRVTDEDPHRDEDFELLDAD
RSCVVTTSDGVPLAVREVGPEDAPLTVVFAHGFCLRMGSFHFQRVRLTEH
WGAQVRMVFFDQRGHGQSGDAPPETYTVEQLGRDLEAVLAVMAPKGPVVL
VGHSMGGMAVLSHARQYPQRYPTRVVGAALISSAAEGVARSPVGEILKNP
ALEAVRFTARYAPKLVHRGRGAARSVIGPILRAASYGDEKISPSVVAFSE
RMMHDTPIATLVEFLHALEVHDETAGLETLRRVPTLVACGDRDLLTPKEY
SQEMADVLAKSELVIVPGAGHLVQLECPEVINDALVRLVERATPSKLTAL
TRRVTQRVRSDD
145225508YP_001136186.1 hypothetical protein Mflv_4932 [Mycobacterium gilvum PYR-GCK]MTDRAGSAELLTAEDTVALGATLGRELRAGDVVVLSGPLGAGKTVLAKGI
AQAMDVEGPVVSPTFVLARVHRARREGAPAMVHVDLYRLLDQSSVDLLAE
LDSLDLDTDLDDAVVVVEWGEGVAERLSDSHLDIRLERSSDTDARTAIWT
WSRP
145225507YP_001136185.1 peptidase M22- glycoprotease [Mycobacterium gilvum PYR-GCK]MSRLVLAVDTATPAVTAGIVRVDGDAIEVLAEQVTVDARAHAEQLTPNIV
AALGDAGIDASRLDAVVVGCGPGPFTGLRVGMATAAAFGHALGVPVHGVC
SLDAIAAGTTGDVLVVTDARRREVYWARYRDGRRVDGPAVNSAVDVPAGA
AAVAGSPEHTALFELPRLAPVYPSAAGLVAAVRDWDTDPAPLVPLYLRRP
DAKPSQAVKR
145225506YP_001136184.1 ribosomal-protein-alanine acetyltransferase [Mycobacterium gilvum PMSAEYGPLQTTDALRCAELEAQLFDGDDPWPERAFLAELAAKHNHYVGAR
VDDKLVGYAGIARLGRFKPFEYEIHTIGVDPAYQGQGIGRQMLHRLFDFA
DGAPIFLEVRTDNAAAIALYESEGFVKMGVRKRYYRVSGADAYTMKREKR
ERQ
145225505YP_001136183.1 putative DNA-binding/iron metalloprotein/AP endonuclease [MycobacteMIILAIESSCDETGVGIAELGDDGSVTLLADEVASSVDEHARFGGVVPEI
ASRAHLEALGPTMRRALATAGVDKPDVVAATIGPGLAGALLVGVAAAKAY
AAAWQVPFYAVNHLGGHLAADVFDHGPLPESIGLLVSGGHTHLLHVRSLG
EPIIELGSTVDDAAGEAYDKIARLLGLGYPGGRVLDELAREGDPKAITFP
RGMTGPRDEPYAFSFSGLKTAVARYVESHPEASQADVAAGFQEAVADVLT
AKAVRAAGDLGVSTLLIAGGVAANSRLRELAAQRCEAAGMTLRIPRPRLC
TDNGAMIASFAAHLIAAGAAPSPLDAASDPGLPVVQGQVA
145225504YP_001136182.1 hypothetical protein Mflv_4928 [Mycobacterium gilvum PYR-GCK]MSTADKLAVTELLYRYAELIDAGDFDGVGSLLGRGDFMGVAGAEAISTLF
AATTRRFPDHGNTPRTRHLVLNPIVDVDGEVASARSTFCVVQRTETVALQ
PIVVGRYRDTFARDTDGWHFTSRTVDVEMIGDVSDHLMMDLSRLG
145225503YP_001136181.1 hypothetical protein Mflv_4927 [Mycobacterium gilvum PYR-GCK]MFDGSLPDPGRLARLSDGELIDAVTGWARASAAAEARKVAAIAELHQRLC
TDAAATHAFWVCDDCDALAAQLSCALTINHGRALSQIELATAMRHRFPKV
GAKFLAGDIPISTVTSILARTELVTDERALAQLDSKLSERAVAWGSLTKY
SLEKALDVWVDRFDPDAVKRTRSSSRGCYFTVGSGSDNADGTTTVHGRVS
NADAAIMEQRIASMARNVCEDDPRTLDQRRSAAIGAIHAGSMFLACACDN
PDCTAKVDDGRGSTFVINVIADRESLDAPQDPLLHGDDVKDGETAEDRGP
AKHTKTTEHTETTTEPRRKAALIPAARNAILPPAMLAELIAQGATIRFVG
DPTGAEDHYRPSTALQRFIRSRDITCRFPGCDRPAAHADIDHTTAWPCGV
THSANCKCYCRLHHLIKTFWPGFSDAQHPDGTVVVTTPTGHAYSTKPLSG
LIFPGWDTAAESPPPPAQATQRSVGRHLKMPTRRRSRAQNRAARIKAERM
RNAALRASQVRPVASRQTYRAENSHDEHTFRPAGHEPDYGNDPPPF
145225502YP_001136180.1 hypothetical protein Mflv_4926 [Mycobacterium gilvum PYR-GCK]MMKNLTIATTAAAALSAAFLGLAAPALAAPTGGDAQATISSLEAQGNRVI
VHKLADVDLDDASVVGINRGPAIRGTVQDNANDRTYQNTVTGHVYYINVR
145225501YP_001136179.1 co-chaperonin GroES [Mycobacterium gilvum PYR-GCK]MASVNIKPLEDKILVQANEAETTTASGLVIPDTAKEKPQEGTVVAVGPGR
WDEDGEKRIPLDVSEGDVVIYSKYGGTEIKYNGEEYLILSARDVLAVVSK
145225500YP_001136178.1 chaperonin GroEL [Mycobacterium gilvum PYR-GCK]MSKQIEFNETARRAMEAGVDKLADAVKVTLGPRGRHVVLAKSWGGPTVTN
DGVTIAREIDLEDPFENLGAQLVKSVATKTNDVAGDGTTTATVLAQALVK
AGLRNVAAGANPIALGAGIAKAADAVSEALLASATPVKDAKSIGQVATVS
SRDELVGELVGEAMTKVGTDGVVTVEESSTLNTELEVTEGVGFDKGFISA
YFVTDFDSQEAVLEDALVLLHREKISSLPDLLPLLEKVAEAGKPLLIVAE
DVEGEALSTLVVNAIRKTLKAVAVKAPFFGDRRKAFLDDLAVVTGGQVVN
PDVGLVLREVGLEVLGTARRVVVDKDSTVIVDGGGTQDAIEGRKGQLRAE
IEVSDSDWDREKLEERLAKLAGGVAVIKVGAATETDLKKRKEAVEDAVAA
AKAAVEEGIVIGGGAALVHAGSALDSLRSELKGDELLGVEVFASALSSPL
YWIATNAGLDGAVVVNKVSELPAGQGFNAATLEYGDLIGDGVIDPVKVTR
SAVVNAASVARMVLTTETAVVEKPAEAEDDGHGHGHGHHHH
145225499YP_001136177.1 hypothetical protein Mflv_4923 [Mycobacterium gilvum PYR-GCK]MAKTAEKNTITEVPSDLAERAADLSDDVLTSLESGQRNAIDAVRKFVGTV
EESLPGHDGDGPSRRETIVDAALDMADQLVKTQYEFIRSIVSSAGDALKK
QGDEKSPPQ
145225498YP_001136176.1 lipocalin family protein [Mycobacterium gilvum PYR-GCK]MGRSSEVTSVSSLNLDRYLGLWYEIGRLPLRWEHPESTDITANYTREDDG
SLRVDNRCIDENGKPSRAIGRATPVDDHPGRLQVSFLPELLRWIPFTKGD
YWVLKIDDAYSVALVGTPDRRNLWLLAREPSIDPATQEAYLAEATRQGFD
LGQWITPKQSGARVTDDQLNR
145225497YP_001136175.1 hypothetical protein Mflv_4921 [Mycobacterium gilvum PYR-GCK]MAQPRLPHAAAGLVAVTAAVSFGPPAGAEPVNPIPGNGIFLVGQDIAPGL
YRTDGTASVFGVWINDVPTQDSMCLWFTYSTPDTNKDNVVATNMSIGPMY
ANINATVKAFESRNCAPWARVT
145225496YP_001136174.1 hypothetical protein Mflv_4920 [Mycobacterium gilvum PYR-GCK]MVTPDRLYREPRRSKPRSARAHNGEMTDAPEDTDNEDTARQRWLSAVAED
SRTDQRHLAAAEVLAHRAELPEEHLAAADDLVVMGLAWRNEIDGEFSYTP
IDPAGKPA
145225495YP_001136173.1 phospho-2-dehydro-3-deoxyheptonate aldolase [Mycobacterium gilvum PMTLAQTATSQETSDRRIRRFSEIPSPHDVLTEFPLGARRAERVARDREEI
ADILAGRDDRLLVVVGPCSVHDPAAALDYASRLVKVADDLGDRLKVVMRV
YFEKPRTTTGWKGLINDPGMDGSFDVARGLRTARQLLLDIIDIGLPVGCE
FLEPTSPQYIADAVAWGAIGARTTESQVHRQLASGLSMPVGFKNGTDGNI
QVAVDGVKAAAAPHVFFGMTDMGRGALVSTTGNQDCHVILRGGTDGPNCD
AASVTVTAEKLVTAGLPGRVVIDCSHANSGKDHIRQVQVAKDVAQLVRDG
LPISGVMLESFLVAGAQAPEAQPLTYGQSVTDKCMDWGATDLVLRELANH
G
145225494YP_001136172.1 hypothetical protein Mflv_4918 [Mycobacterium gilvum PYR-GCK]MNKIARPLALAVSGLAALGIVTACAGSSGPAREGPATQTAPGGSAAMDAA
GPAPEFGPPQAPPTVEKRDVVRTAAMTVMVADPSKAADEAAVIAERAQGR
VDSRTEDAGSGSGRASTTVTLRVPVAELDATVRELKTLGTVETASTTAED
VTAQRVDLDARIEALQVSVDRLLAIMRDARDPEALIAAEEALSQRQADLD
SLRAQRDALGDRISYSTVDVAFFAEQVGGPAPKKYEGFFGQVQRGWDGLV
AVVSGAVLLFGFLLPWLGVLAVVGVVIYGLIRWSRARTAPPPPAPDLTPP
DEPAPPPSAEPASPRR
145225493YP_001136171.1 hypothetical protein Mflv_4917 [Mycobacterium gilvum PYR-GCK]MTSSPDRVAALDHIVERNQVWPRMAAKYGVENPVPPWKTSLDGFCDALDH
ASCTAAVPTFKERRDEEDALAATLYADLPYPENQLVALAHSLLARGVIDE
ETLARRMAAVRARLGA
145225492YP_001136170.1 thiocyanate hydrolase [Mycobacterium gilvum PYR-GCK]MSHDHEHDHDHDHDHDRTVKPMVDEITDFEVLEIALRELCIEKGIFTAEE
HRRFTEYAEQIGPTPAATLVARAWLDPDFAELARTEPMTASKEVGVDWME
PTGFGTPSDFTAFEILADTPTLHNVIVCALCSCYPRPILGNSPEWYRTPN
YRRRMVRWPRQVLSEFGLSLPEGVDVRVQDSNQKHRYMVMPMRPAGTDGW
SEEQLAEIITRDCLIGVALPKPGVTTNVIVDTRPAVHP
145225491YP_001136169.1 hypothetical protein Mflv_4915 [Mycobacterium gilvum PYR-GCK]MSTAAERAAQLDLVARLKSAFPELPDAPTPDLLDHARITAYLKPVHDVGG
EPDAPMKYENKQYEQWEEMTYVICEVLAWRGIWLSEERRRIGNVDVGRAE
YLGLPYYGRWLLSVARVLVEKHHIGLTELSERMAEVAARYPDGLAGRKLE
AQPKSVGDGADVRRNAHHLHAVGKGDPQVYAGRAGEPRFAVGDAVVVREL
PVLFYTRTPEYVRGAVGEIDTVAYESPAAEDETWDRPDATPEWFYIVKFM
MADLWHGYTGPSTDILRTEIPQRWLEAAH
145225490YP_001136168.1 transcription factor WhiB [Mycobacterium gilvum PYR-GCK]MPQPQQLPGPNADIWDWQMQGVCRGVDSAMFFHPDGERGRARAQREMRAK
EMCRRCPVIAQCRSHALAVGEPYGIWGGLSESERELLLKRGIRRTA
145225489YP_001136167.1 hypothetical protein Mflv_4913 [Mycobacterium gilvum PYR-GCK]MDTTPAVSANDLSTAAFGGDPGLWPLPPASGAHDLWVRAVVAGGQGRYAS
GFADLDRLERLPRSATTSSLALSTRASFLRQLGWHTVARGWDGRAAAVAA
GSAEPGAADAGADALIGLAADALGVGRFAASARALEGAAELIGAAATSRP
AVRMGWVSSELAMFRGDGPTAVAHARRAVDLAAGFGSVRHRVKSHVVLAA
ALCSSGDLDAARQEGDLALADATRSGLVPLQWAVACLLADIGSQAYPAAR
IRAVRDASAEAVTRWGGVWRPR
145225488YP_001136166.1 RNA polymerase sigma factor SigD [Mycobacterium gilvum PYR-GCK]MTISGERLDAVVAEAVAGDRGALREVLETIRPLVVRYCRARVGTAERSGL
SADDVAQEVCLAAITALPRYRDQGRPFLAFVYGIAAHKVADAHRAAGRNR
ADPMDVVPERLSGEAGPEQMAIDSESSARMATLLKVLPEKQREILILRVV
VGMSAEETAEAVGSTAGAVRVAQHRALSRLKAEITSTGQGRDYA
145225487YP_001136165.1 hypothetical protein Mflv_4911 [Mycobacterium gilvum PYR-GCK]MPDFGRRDPGGGDPSLTDINRTDQFLDALAAQQQPFVTDRDDVELAQLLA
GWRDDIRETPMGHVVTPLQAEAALDRVTRPAAPRRRFSLAVVGSAAAAVL
AIGGFGAVVAGSGPGDALYGLRTMLFGEQVQMRDDAVILAAQTEMQQVQQ
LIEQGDWQQAQAKLEAVTTTVATVDDVAQKEELIAQWQELTVKVEAQDPV
ATVPPGAPLPTFPELPAAVLDQATTSSETTAGTTSDTTAPSSETTAPSSE
TTGPSSETTTAPSETTGPAPTTTAPTSAPTTTAPAPSTTPTTSVGQTRSS
AAPSTPPSSAPTSTTVVLQSTTTSAAAPTTSAAPTTAAPTTAAPTTAVPT
TPSAVETTPAVEEETPPSPVAPVTTTTPVLPLPGE
145225486YP_001136164.1 hypothetical protein Mflv_4910 [Mycobacterium gilvum PYR-GCK]MRDHLPPGLPPDPFADDPSDPSAALDALEPGQPLDPQERTAVEADLADLA
VYEALLAHKGIRGLVVCCDECQQDHYHDWDMLRANLLQLLVDGTVRPHEP
AYDPEPDAYVTWDYCRGYADASLNEAASESDGYR
145225485YP_001136163.1 inosine 5'-monophosphate dehydrogenase [Mycobacterium gilvum PYR-GCMSIAESSIPIAVPVPTGGDDPTKIAMLGLTFDDVLLLPAASDVIPATADT
SSQLTRRIRLKVPLVSSAMDTVTESRMAIAMARAGGMGVLHRNLPVAEQA
GQVETVKRSEAGMVTDPVTCSPENTLAEVDAMCARFRISGLPVVDDKGSL
VGIITNRDMRFEVDQSKPVAEVMTKAPLITAQEGVSAEAALGLLRRNKIE
KLPIVDGHGKLTGLITVKDFVKTEQFPLSTKDSDGRLLVGAAVGVGEDAW
TRAMTLADAGADVLIVDTAHAHNRGVLDMVHRLKRAVGERVDVVGGNVAT
RAAAAALVDAGADAVKVGVGPGSICTTRVVAGVGAPQITAILEAVAACAP
HGVPVIADGGLQYSGDIAKALAAGASTAMLGSLLAGTAESPGDLIFVNGK
QFKSYRGMGSLGAMQGRGATGNLRGSYSKDRYFQDDVLSEDKLVPEGIEG
RVPFRGPLSTVIHQLTGGLRAAMGYTGSASIEALQQAQFVQITAAGLKES
HPHDITMTVEAPNYTTR
145225484YP_001136162.1 inosine 5-monophosphate dehydrogenase [Mycobacterium gilvum PYR-GCKMRDMVEIGMGRTARRTYELGDINIVPSRRTRSSKDVSTAWQLDAYRFEIP
VLAHPTDALVSVEFAIELGRLGGLGVLNGEGLIGRHADVEDKIARVVEVA
EKDPDPAAATRLLQQLHAAPLDPELLGAAVSRIREAGVTTAVRVSPQNAQ
ALTPTLVAAGIDLLVIQGTIISAERVAKDHDGEGEPLNLKTFISELDVPV
VAGGVLDHRTALHLMRTGAAGVIVGYGSTSGVTTSDEVLGISVPMATAIA
DAAAARREYLDETGGRYVHVLADGDIHTSGDLAKAIACGADAVVLGTPLA
ISAEALGGGWFWPAAAAHPSLPRGSLLQVVDEERPSLAQVLNGPSDDPFG
SLNLVGGLARSMAKAGYCDLKEFQKVGLTVGC
145225483YP_001136161.1 TetR family transcriptional regulator [Mycobacterium gilvum PYR-GCKMADGITAREAKRLQTRERLLGAAIAEFKRAGMAEADVSTIVGAAGVAHGT
FFFHFPTKEHVLLELERREEDRIAKRFATFTKTHHDLSAVLREAADLVLG
LERRLGVVLFKDFLALHFSPTRPPAEHGGDHPVVVLVAAQIEHARQRGET
AADVTPMNSAIYFLLGLYALLVTTDESTGRSVLVTDYLTRTLRSLQ
145225482YP_001136160.1 FAD dependent oxidoreductase [Mycobacterium gilvum PYR-GCK]MRPDYDVLIIGSGFGGSVSALRLTEKGYRVGVLEAGRRYADDEFAKTSWN
LRKFLWAPQFGMYGIQRIHLLRNVMILAGAGVGGGSLNYANTLYVPPEPF
FNDPQWRDITDWRAELMSHYDQAQRMLGVVTNPTFTDADRIMKEVADDMG
VGDTFVPTPVGVFFGPDGEKTPGKTVADPYFGGAGPARTGCIECGSCMTG
CRYGAKNTLVKNYLGLAEKAGAQVHPLTMVTGFEQRPDGLWEVHTARTGS
KVRRRRKTFTAEHVILAAGTYGTQKLLFKMRDRGKLPKLSDKLGVLTRTN
SESIVGAGRLTVGDDLNLTHGVAITSSIHPTADTHVEPVRYGKGSNAMGL
LQTLMTDGTGPEGTDVPRWRQLLDTARNDRKGTLRLLNPRRWSERTMIAL
VMQHLDNSITTYTRKTKFGFRMLDSKQGHGEPNPSWIPAGNEVTRRIAEK
IDGVAGGTWGELFNIPLTAHFLGGAAIADSPERGVIDPYQRVWNYPTLSV
MDGAAVSANLGVNPSLSITAQAERAAALWPNKGEEDLRPEQGQPYRRLSP
IEPKHPVVPADAPAALRRIPIEPVTSAG
145225481YP_001136159.1 Signal transduction histidine kinase-like protein [Mycobacterium giMATNGGGAEPTARHQLMTRAAGVGLLMRSTINLGVSLIALADPLSTALPA
GRWLLAVLAVWSLYRLATRSHATALLAVDYGLVLAVCLAVPLLVPVTDFH
TFNTAPQAIAGTAVISFSVAVRVAACVPMAVGIAAAYAAGAASVIGWENV
LSVMALYYFAVQCGTASIIRFMLLRVAGAIDQARRERAEAEVAERVTDAV
RDYEREQLALLHDTAASTLMMVGQGVSLPPERMAAQARRDLHLLRAGSWE
APPPRVELVAALRDCTARLSTPVEFDGRERLWVAGATANPVIAAAREAMN
NVDRHARAELLRITVTETCVRLADDGIGFDLGHPRTGHGVDDSIIGRMAR
AGGDAHITSSPGAGTVVEMSWAPSAPSAITPPAVDPDRLIDRTRTRYGLA
LTAYSLVNLAITVPTSDAVLGILATLTSLAAIPGIMWQRWLFAWPAMLAA
LIVAIGQPAMLPQDHLLGYPHWAQGAIGWCVLPLMLALPTRTGAALVMAY
WACNSLVLVIRDPSPLILVNIGYGTASILGIQLFALVFNGLMRDAATAVE
SENAARQRLLTRDRVSQALRAEYQRRYATIVAGVVPLLEALTRGEKIDTA
MQLRARAECRRLRALFDQASTFDHPLMQRIRPLIDAAEGRRVDVAIDVSG
TLPDLDDEQISALATPVTEVLNRASTSARIVVTGADGQVEISVVIDIADT
ADTPPADVDGAEVIVSGRELWCLIVSGVQKG
145225480YP_001136158.1 two component LuxR family transcriptional regulator [Mycobacterium MSREDDTRRPVRIAIIDDHDVVHAGIQAWCAEADPPIDLADSFQRPDEYF
AKYPDAADDVDVVLLDLQIEGNRPDFDALSKLAASGRRVIVYSHITADEV
ILTCLELGAVTYLVKSEGKRHLIEAVHSAHTSTPYVGPRMGKAMLNDSTM
GRIKLTDREKQVLIAWFQTESKDLVAERLFIAPTTVRTHLQRARAKYAGV
GRPASTKSALLARAIEDGILSLKDLY
145225479YP_001136157.1 GMP synthase [Mycobacterium gilvum PYR-GCK]MESAHPRPVLIVDFGAQYAQLIARRVREARVFSEVIPHTASIEEIKARDP
RAVVLSGGPSSVYADGAPQLDPALFDLDIPVFGICYGFQAMAQALGGTVA
RTGTSEYGRTELKVAGGELHSDLPEVQPVWMSHGDAVTEAPSGFEVVATS
VGAPVAAFENRARRLAGVQYHPEVMHSPHGQQVLSRFLHEFAGIDAAWTP
ANIAEALVEQVRNQIGDGRAICGLSGGVDSAVAAALVQRAIGDRLTCVFV
DHGLLRAGERAQVQRDFVAATGANLVTVDVADRFLEALSGVTNPEGKRKI
IGREFIRAFEGAVRDTVERSDGSDVPVEFLVQGTLYPDVVESGGGSGTAN
IKSHHNVGGLPDDLKFALVEPLRLLFKDEVRAVGRELGLPEEIVARQPFP
GPGLGIRIIGEVTSDRLDTLRRADVIAREELTAAGLDHQIWQCPVVLLAD
VRSVGVQGDGRTYGHPIVLRPVSSEDAMTADWTRVPYEVLERISTRITNE
VPEVNRVVLDITSKPPGTIEWE
145225478YP_001136156.1 MerR family transcriptional regulator [Mycobacterium gilvum PYR-GCKMSGPIQTILRRLRRGSRDVIENAVSQLFDAAVQPHDNAESGEYRIEELAR
LAGTTTRNIRVYRDRGLLHPPLRVGRVALFNDTHVTRLRLITSMLDRGYN
LAHVDEMLSAWEQGKDLGDMLGLESAIAGSWAVEKPQRMLTAQARRLIDD
PAGFERLVGLGIIRLEDDHATIVRPTLVEAFTEIRRHGVALDKLIDVHEQ
VAPLLDQIGAILVQAGLDEVLDKINPGAAMPDDVEVAELITTLVRFRTHA
VSAVGATLAFSIEAQVESVVAELLGDLISKSAEAAGE
145225477YP_001136155.1 flavin-binding monooxygenase [Mycobacterium gilvum PYR-GCK]MPPRALRGVDTYRGRRIDAENWSDHHDFAGRRVAVIGIDSLTVRIIPELV
EHAGFVKVFQDVPRWVLPQLLAEVPAPQAIIARLAKAYLRTQVRDPWLRR
QLTPDAAPERTHTLVSGGYYAALQRDNCKLIDWPIATLSPVGVRTSDGVE
HHLDALVFGRTIGFGDDAACHDRQYVR
145225476YP_001136154.1 hypothetical protein Mflv_4900 [Mycobacterium gilvum PYR-GCK]MAIDMDAMLAKIKDRQWALADIDWTAPGADRITDEQRPKLKAFMADLCWI
ENIGARGFAALAKKAPTPTIAEIYRYFHAEEQRHANAELALMKRWGMLDE
ASGELPEPNVNIRMAMDWLDTYADDMSLSILGTVIPMLEVALDGALLKFL
LEEVDDPVCHQVFEKINNDESRHIAVDFEVLNMIGHADARRLAIEFVGSV
ATPGLIIGAIMYIPLLNRIRNEIVGMGLEPERLYNAVKRFQSLGERGEFS
HRVPTYQVLKRHAAAVVNPDHPYHLLANSLVWVSERYPRRLLRPIPSWFK
ELTHEPAA
145225475YP_001136153.1 hypothetical protein Mflv_4899 [Mycobacterium gilvum PYR-GCK]MGRCSVTRAEQVEQLRKQMAAVSGKVGGSRRAVAPVPQPTPVSETPDSLL
PMPDSLAELLPDSLPRGTVAVVSGARSLQLSMVAAVTAQGGHVAIIGQPD
VGLLAAAEMGADLSRVAVIPEPGADPVEVAAVLMDGMDLVVLGLGGRTVP
ATRARSVVARARQRGCTLLVTDGDWQGASARLDAHVSGYEIAGGQGGVPT
PGCGRIGRVRLAMRARGRSVGPSARVVGG
145225474YP_001136152.1 hypothetical protein Mflv_4898 [Mycobacterium gilvum PYR-GCK]MAGRVLALWCMDWPAVAASAAAELPPTTPVAVTLANRVIACSAAARAAGV
RRGLRRRESQARCPELHVAAADPARDARHFENVTLAVDELVPRAEVLRPG
LLALSVRGAARYFGSEVAAAERLVDAVAAVGAECQVGIADQLPTAVFAAR
VGRIIDPGGDGPFLAELSIRQLSGEPSLASASREELVDLLWRMGIRTIGQ
FAELSRSDVASRFGADGVTAHRIARGEPARGPSGREPEAELDAVMNCDPP
IDRVDAAAFAGRSLAGVLHRSLEAAGVGCTRLAIHAMTANGQELERVWRC
AEPLTEDATADRVRWQLDGWLNRRNPDRRAGAKRPGDGYGRPGAPITVLR
LRPVEVVSAEALQLPLWGGVGEQDRLRARRALVRVQGLLGPEAVKVPVLS
GGRGPAERITLTPFGDELVPQANPDQPWPGRLPEPSPTVLLDDPVELFDA
EGNPVRVTGRGLFSAEPSRLHAPGRSGQLSWWAGPWPVDERWWDPSSKSG
RTARAQVLIDETQALLLCYRQRRWYLEGVYE
145225473YP_001136151.1 inosine/uridine-preferring nucleoside hydrolase [Mycobacterium gilvMSGDSHPVFLDVDTGVDDAMALVYLLASPEADVVGIASTAGNVGVDDVCR
NNLALLELCGTTGIPVSRGSATPLVAPLRTAEDTHGPRGLGYARLPEPTT
TLTDHDAAQAWVRAARDHPGELIGIATGPLTNLALALRAESALPRLLKRL
VIMGGAFDYRGNTTPVAEWNVSVDPESAAETFSAWSRSGAGHLPIVLGLN
LTEHAEMTPELLRRLAEAAGSTSTQMSVSDVRGTASTASNPLIRVLEDAM
RFYFEFHHDQGEGYLAHVHDPLAAAVALDTTLVRYRSAPVDVELTGTLTR
GMTIADWSGHWGREPNALIGVEVDPAVFFDRFIARVGAFAAALDHS
145225472YP_001136150.1 short chain dehydrogenase [Mycobacterium gilvum PYR-GCK]MRYVVTGGTGFIGSRLIGRLLARPDVTAVHVLVRRGSLGRFERLARDWDD
RVHALVGDLTDPDLGLTDATVAELGPVDHVVHCAAIYDMTAPENRQRAAN
VEGTRAVIALSRRLGATLHHVSSIAVAGTHPGVFTEDDVDVGQELPTPYH
RTKFEAEQLVRAADGLRFRIYRPAVVVGDSRTGEIDKIDGPYYFFGVLSA
LAALPRFTPMMLPDVGRTNLVPVDFVVDALDVLMHADGRDGQTFHLTAPK
NTGLRGIYRGVARAAGLPPLVGVLPRAAAAPLLQVSGRAKAIRNMAATQL
GIPGEVLDVVELAPTFTSERTDEALCDSGISVPEFASYAPGLWRYWAEHL
DPNRARQDDPAGPLVGRHVVITGASSGIGRASAVAVAARGATVFALARNA
EALDDLIAEIRESGGDAHAFTCDVTDPSAVEHTVKDILGRFGHVDYLVNN
AGRSIRRSVTASTDRFHDYERVMAVNYFGAVRMVLALLPHWRERRFGHVV
NVSSAGVQANNPRYSAYIPSKAALDAFSEVVGAETLSDHITFTNIHMPLV
KTPMIAPSGRLNPAPAISPEHAAAMVVRALVDKPARIDTPIGTVADLGMY
LTPKLARRVLHQLYLGFPDSAAAQGIAENDRVHSATRTPERKPWPPRRPV
PSVRIPSAVKQAIRLVPGVHW
145225471YP_001136149.1 dehydratase [Mycobacterium gilvum PYR-GCK]MPIDPGALGASTPPAIFRWTDRDTLLYALGVGAGTDDLAFTTENSHDVTQ
QVLPTYAVIACSPFAAITKIGSFDFSRLLHGSQRIRVFSPLPAAGALSVV
SEVADIQDKGEGKNAVVMLKGTGRDPDTGAVVAETLTTLVLRGEGGFGGQ
PGSRPTAPPVPDREPDARVSLPTREDQALIYRLSGDRNPLHSDPWFAQLA
GFRRPILHGLCTYGVAGRALVSELGGGDATRITAIAARFVAPVLPGDTLT
TSIWRVESGRGVFRTEAANADGSDSRSVLEDGEVEFVDNQR
145225470YP_001136148.1 diguanylate cyclase [Mycobacterium gilvum PYR-GCK]MFEGLRRLSANSLAPAVWRFDQYYWFTAILTARGFQTATGRLVAACIAAF
GLLPLGVIAGVFGPQSLVAQILAGIVVIASLAMAMLWLREHWPTRAQSLA
CVAAGALGIGISSLLVADPFVGFLGTAAFVPLTIFIVCFHAARVLALSWT
VGALVLAVLVVRMGSTDLAVALTGLVIAVLINVFVAISCRTVIRLLKPDA
HHRDIEQLTGLLHRDAFYNSVATLLASRSRSDDQYLVFVAVNIDSFSLLL
GLSGSGGGNRARVTVGQALRETVRHNAIVAHVSDDDFVIADTFTTSDASP
LVERIRGAIAATPQRLTASIGVVVTPLPPLAAEPPDEVLDKLIAISQQAI
EQARMAGGNQVRYVLRPDLGEGDDNGDDWPEQNRPA
145225469YP_001136147.1 error-prone DNA polymerase [Mycobacterium gilvum PYR-GCK]MRRVLEGKPRRAGWPIDAQVGDGGDSPAWSSKRGQYRAPESRGPATGRSM
PYAELHAHSAYSFLDGASTPEELVEEASRLGLRALALTDHDGLYGVVRFA
EAAKELDVDTVFGAELSLGGGTRTDVPDPPGPHLLVLARGPEGYRRLSRQ
LAAAHLAGGEKGVLRYDFDALTEAAGGHWQILTGCRKGHVRQALLRGGDS
AAEAALADLVDRFGRERVTVELTHHGHPLDDERNAALAALAPRFGLTVIA
TTAAHFAEPSRGRLAMAMGAIRARNSIDEAAGYLAPLGGSHLRSGEEMAR
VFAHCPEVVTAAADLGEQCAFGLALIAPQLPPFEVPAGHTENSWLRHLVM
QGARERYGPPERASRAYAQIEHELRVIEQLNFPGYFLVVHDITRFCRENA
ILSQGRGSAANSAVCYALKVTNVDPIANGLLFERFLSPARDGPPDIDIDI
ESDLREKAIQYVYERYGREYAAQVANVITYRGRSAVRDMARALGFSQGQQ
DAWSKQISQWGNLADATHVEDIPEPVIDLAMQISHLPRHMGIHSGGMVIC
DRPIADVCPVEWARMENRSVLQWDKDDCAAIGLVKFDLLGLGMLSALHYA
IDLVAEHKGLEVDLAKLDLSEPAVYEMLQRADSVGVFQVESRAQMATLPR
LKPRMFYDLVVEVALIRPGPIQGGSVHPYIKRRNGQEPVTYEHPSMERAL
RKTLGVPLFQEQLMQLAVDCAGFSAAEADQLRRAMGSKRSTEKMRRLRGR
FFEGMAELHGISGDVARRIYEKLEAFANFGFPESHSLSFASLVFYSSWFK
LHHPAAFCAALLRAQPMGFYSPQTLVADARRHGVDVHGPDVNASLAHATL
ENHGLDVRLGLGSIRHIGDELAQRLVEDRKLNGPFVSLTDLTRRVQLTVP
QTEALATAGALGCFGITRREGLWAAGAAATERPDRLPGVGSSSQVPSLPG
MTELELTAADVWATGVSPDRYPTEFLREDLDAMGVVPADRLLSVRDGTRV
LVAGAVTHRQRPATAQGVTFLNLEDETGMVNVLCSQGIWARHRKLAQTAS
ALVVRGIVQNATGAVTVVADRMGPINMKVASKSRDFR
145225468YP_001136146.1 nitroreductase [Mycobacterium gilvum PYR-GCK]MTLNLSADEVLTTTRSVRKRLDFDRPVPREVLNECLEIALQAPTGSNAQG
WQFVFVDDPEKKKALADIYRIAADPYLEAEKPTFGDVRDERTPLVVDSAK
YLAEHLHEAPVMLIPCLEGRPDGAPAGMSAGFWGSLLPAVWSFMLALRSR
GLGSAWTTLHLIGDGEKQAAEVLGIPFDKYSQGGLFPIAYTKGTDFKKAK
RLPAEQLTHWNTW
145225467YP_001136145.1 tRNA/rRNA methyltransferase SpoU [Mycobacterium gilvum PYR-GCK]MFNVLFYSPRIAPNTGNAIRMVAGTGCALHLVEPLGFDLSEPKLRRAGLD
YHDLASVTVHADLGAAWSVLMPARVFAFTAHAATSFAGVGYEPGDVLMFG
PEPTGLDEATLADPHITGQVRIPMLSGRRSLNLSNAAAVAVYEAWRQHGF
AGAV
145225466YP_001136144.1 type 12 methyltransferase [Mycobacterium gilvum PYR-GCK]MAETSLWMQKVAADPGHSRWYIERFRAMARAGDDLFGEARLIDAMVPRGA
RILDAGCGPGRLGGYLAAAGHHVVGVDVDPVLIDAAEKDHPGATWLVGDL
AELDLPARGIAEPFDVIVSAGNVMTFLAPSTRGEVLRRLRTHLAAEGRAV
IGFGADRDYDFAEFLDDAAGAGFVPDLLLSTWDLRPWREDSGFLVAVLRR
M
145225465YP_001136143.1 integral membrane sensor signal transduction histidine kinase [MycoMARSLRPDQRPSRWAPPNWPVRVKVLALVTVPLVLACVFGGLRISASTVE
ARELAHAADRAQMVPAVVDYMAALQNAMVTAGGGGNPAAALGEFDFRKAE
LSRVLEGADVDDSVRLATNTLLEYGQNLLDRIGAAEMNLRTQVMTFGPLL
ITAQTALTGSVGSDEDSVRTEADVLSRAVGARGQMAMQDMLVTRGGELPE
PLLRSAMVTLAGTEPATVTAMGTFLGGASDRADALRSQMVRRMSLLSDPA
VVLVGNPELLMSQKITADIAQSLINRIADEIPARVSRQADDARTAAIRDS
VLVGAAILVALILVLWVARSLVRPLRTLRDSALRVAHDDLGREVERVRDD
GKEFAVDPIPVHTTEEVGQVAHAVDELHQQALVLAGAQARLQLQVTDMFE
TLSRRNRSLVEQQLSLIDGLERDEEDPDRLQSLFQLDHLAARMRRNGANL
LVLAGARISHDRAEPVAVAAIVNAAASEVEEYPRIVTGDLPDSEVAASAA
GDLVHLLAELLDNGLRYSPPHTQVRVSAVPTDNNGLVIEVSDTGLGMTEA
DLRVANMRLESGGEVNPYTARHMGLFVVSRLAAQHGLVARLRSTVAGQPD
SGTTAGVYIPARLLVRRAAPPVQARDVRPAAPAPAPTPAPAPAPPPPPAP
VVPPADVLPQRRPEPPPPVEPPPPVETPPPVETPRPGHADIDHDDTIYQK
MLSEWLVDPHELSHSSDLNWKSVWDNGWSAAEAADAAPVRHRTPEGLPVR
RPGARLIPGHADTENGHPLPVRDPDAVRASLGGHFGGVHAGRRHAREAAG
DDR
145225464YP_001136142.1 roadblock/LC7 family protein [Mycobacterium gilvum PYR-GCK]MNPQPPQPDSSLDWLVARFAQDVAGVTHAILVSADGLLMAASGHIPQERA
DQLAAVASGLASLSTGAAQLVDGGHVLQSVIEMEHGYLLLMRVGDGSHLA
TLTARNGDIGQIGYEMAILVERVGAVVQAPRRPRQHQ
145225463YP_001136141.1 hypothetical protein Mflv_4887 [Mycobacterium gilvum PYR-GCK]MGAHERKDPAPSLVRPYTLTSGRTESGVTLPLEAPVGLAKSAPPPGWPAG
DVRSRIVALCDARPSVAEIAAHLSVPLGVARVLVGDLVLQGYLQVHATLG
EAATPDERRALIGRTLRGLRAL
145225462YP_001136140.1 hypothetical protein Mflv_4886 [Mycobacterium gilvum PYR-GCK]MVSGHSDSRGRASTKIVISGGFGAGKTTFVGAVSEIVPLRTEALVTTAST
GLDGLAATPDKTTTTVAMDFGRISLDDDLVLYLFGTPGQRRFWFMWDDLI
RGAIGAIILVDVRRLEDSFAAVDFFEARKLPFLIAVNDFDGAPRHPLPAV
REALALAEHVPVISVDARSRESAKSALIAVAEYALSRLAPAG
145225461YP_001136139.1 pentapeptide repeat-containing protein [Mycobacterium gilvum PYR-GCMDSTHPREADREFDGHDFCDADLSGLRTERVVYTECDFTGADLSDSDHTG
SAFRNCTFRRTSLWHSTFRHCSFLGSTFTECRLRPLTLVEVDFTLAVLAG
VDLRKTDLSDCRLRETSLVGTDLREAVLAHADLTGARVQDAKFDGADLRG
ARVDPTFWTTARLRAAKVDLPQALAFAAAHGLDIGG
145225460YP_001136138.1 6-7-dihydropteridine reductase [Mycobacterium gilvum PYR-GCK]MKGIPMAPNVTAAPAELEAAHAEMIAATLPLVGAHIDEITTEFYRRMFAA
HPELLRNLFNRGNQAQGAQQRALAASIATFATHLIDPDLPHPAELLSRIG
HKHASLGVTADQYPIVHEHLFAAIVEVLGADTVTADVAAAWDRVYWIMAD
TLIALERDLYKAAGVTDGDVYRRATVVSRVDDPSGVVLITVRPEGRPFTG
SIPAQYVSVGVTLPDGARQLRQYTLVNAPGTADLTFAVKPVASVAESPAG
EVSSWISANLCVGDIVDVTVPFGDLPAPDGAAPLVLISAGIGITPMIGIL
EYLAASAPEASVQVLHADRSDRVHPLRERQHELAEALPNARLDVWYEDGV
TAGAPGAHAGLMNLSAIDLPADAHVYLCGNNGFVQAVRGQLTDRGFISER
VHCELFSPNDWLLG
145225459YP_001136137.1 TetR family transcriptional regulator [Mycobacterium gilvum PYR-GCKMSDNDESRRAAAIEAALDEVQQWGVDRFRLEGVAHRAKLSPDYVRQIWGS
ETELIAEALLSYSQAMMELPDTGSLHGDLTGLALALADYLNEPVGRRISR
MLVIDSKSQAVDRDTRARFWTVRRAIVEDIFRRAAERGELRDDVRHIVAL
QLLTSPLHTFALYSEDPIPPEYCRLIADLVTRAIRAD
145225458YP_001136136.1 ABC transporter-like protein [Mycobacterium gilvum PYR-GCK]MSRPGSPALTVRYDGSTHTFAAGNDVVVGRDLRADVRIAHPLISRAHLVL
RFDQGRWIAIDNGSLNGMYVNGRRVPAADISDGGQLHIGNPDGPLLTFEV
GRHQGSAGTPPSTTAVPVPGRTSATWPAQHSGPTGRPPVQRPPTGPYPGA
GAYPPGGPRPVPAPPPPAAQSRPAHVQQPISAPAMDPVTVMGPAAAPRSS
GSDGNIATSMLRILRPGRPADVPAGSIKIGRSSDNDIVIPDVLASRHHAT
LVPTPAGTEIRDNRSINGTFVNGSRVDSAILADGDTVTIGNVDLSFRDGT
LVRRTETAAATATGGLDVHGVTWTIENNKTLLDNISMSARPGTLTAVIGP
SGAGKSTFARLVAGYTHPTTGQVSFEGHDVHAEYASLRSRIGMVPQDDVV
HGQLTVRQALMYAAELRLPPDTTKADREQVVNEVLEELEMTKHLDTRVDK
LSGGQRKRASVALELLTGPSLLILDEPTSGLDPALDRQVMTMLRQLADAG
RVVLVVTHSLTYLDVCDQVLLLAPGGKTAFYGPPSQIGSAMGTTNWADIF
SSVAGDPEAAAARYLSQNGPPPPQPPALTPSELGNPTRTSLRRQLSTIAR
RQIRLVISDRGYFAFLMLLPFIMGILSLSVPGDVGFGVPKTALEGGEAPN
EPGQILVMLNVGAIFMGTALTIRALIGERAIFRREQAVGLSTSAYLLAKV
VVFTAFAIVQAAIVTTIAIIGKGWGPGAVDSGAVVGDRSIELFLDIAVTC
VASAMVGLALSALAKSAEQIMPLLVVAIMSQLVFSGGMIPVTDRLVLDQM
SWFTPARWGFAASASTVDLIRLVPGPLTPQDRHWEHTPGTWLFDMGMLAL
ISVGYLALVRWRIRLKSAG
145225457YP_001136135.1 TetR family transcriptional regulator [Mycobacterium gilvum PYR-GCKMPRPARYTVDVLLDAAAELLAAEGPAAVTMSAVARSTGAPSGSVYHRFPT
RAALCGELWVRTEERFQEELLEALSGDGDPQNRCVAGALRNMQWCRENPV
EAHVLLAGPDQLDMGEWPDTVAGRRKRLQRKLRKVLAEIAGDHGRIDGRV
DGRVAAAVMDVPAAIVRRHLRARQSIPAAADDIVADCARALICPN
145225456YP_001136134.1 NADH:flavin oxidoreductase [Mycobacterium gilvum PYR-GCK]MLSIPPRGKLGDMTVPHDVFSPAKLGPLTLRNRIIKAATFEASTPNALVT
EDLITYHRLPAAGGVGMTTVAYCAVAPGGRTDGWQLWMRPEAVPGLRRLT
DAVHAEGAAISAQIGHAGPVANARTNKATALAPVRFFNPLSMRFARKATA
DDIREVTEAHANAARLAIDSGFDAVEIHLGHNYLASSFLSPLINRRTDEF
GGSLANRAKVARGAVLAVKEAVGDRIAVTAKLNMSDGVRGGISIEESLQT
AKWLEEDGGLDAIELTAGSSLLNPMFLFRGGAPIKEFARNFKPPLSWGMR
MTGKKFMREYPYEEAYLMRDAKKFRDELTMPIILLGGITNRETMDRAMAE
GFDFVAMGRALLAEPDLLNRIRADSSVKSICDHCNLCMPTIYNHTYCVRT
GSPSPVSSGR
145225455YP_001136133.1 bifunctional 5-10-methylene-tetrahydrofolate dehydrogenase/ 5-10-meMMRVGAITLDGKATRDEIFVDLRERVARLAAAGRTPGLATVLVGDDPGSH
AYVRGKHADCAKVGINSIRRDLPADISQAVLDETIDELNANPECTGYIVQ
LPLPKHLNENAALERIDPSKDADGLHPTNLGRLVLNEPAPLPCTPRGIVH
LLRRFEVEIAGAHVAVLGRGVTVGRPLGLLLTRRSENATVTLCHTATRHL
PEITREADIIVAAAGVPHMVTADMVRPGAAVVDVGVSRDDAGKLVGDVHP
GVWDVAGHVSPNPGGVGPLTRAFLLTNVVERAEANL
145225454YP_001136132.1 hypothetical protein Mflv_4878 [Mycobacterium gilvum PYR-GCK]MIAFARKILGGQWPILVVALFLVAAFALVAAGYWRRGALVMAIGVAVAAA
LRTALPEDRVGLLAVRSRTVDIVTTASVSAAMLYIAWTIDPLGTS
145225453YP_001136131.1 type 11 methyltransferase [Mycobacterium gilvum PYR-GCK]MTAESDRRSLSFGAEAAAYERGRPSYPPEAIDWLLADSGSRRLEVLDLGA
GTGKLTTRLVERGLDVVAVDPIPEMLDLLRTSLPDTPALLGTAEEIPLPD
DSVDAVLVAQAWHWFDETRAVKEIARVLRPGGSLGLVWNNRDERLGWVKD
LGDIIGHEGDPWSQSVELPAPFTGVERHHVEWTSYLTPQALIDLVASRSY
CITSPERVRARTLDRVRELLTTHPALANSSGLALPYVTVCVRATLA
145225452YP_001136130.1 homoserine O-acetyltransferase [Mycobacterium gilvum PYR-GCK]MTIVDILSERVALPPEGEIGIVDIGTLTLESGEVIEDAFIAVQRWGELSP
DRDNVVMVLHALTGDSHITGPAGPDHPTPGWWDGVAGPGAPIDTDTWCAI
STNVLGGCRGSIGPSSTAPDGKAWGSRFPVITVRDQVAADVAALARLGIT
EVAAVIGGSMGGARALEWAVTYPDSVRSALVLAVGARATADQIGTQSTQV
AAIKADPNWAGGDYHDTGRSPDAGLEIARRFAHLTYRGEAELDDRFGNDA
QTGEDPTTGGRYAVQSYLEYQGRKLLARFDAGTYVLLTDALSSHDVGRGR
GGIAAALAGCPVPTVVGGITSDRLYPLRLQAELAELLPGCDALDVVESAY
GHDGFLVETDAVGKLIRRTLDLAGK
145225451YP_001136129.1 O-acetylhomoserine aminocarboxypropyltransferase [Mycobacterium gilMTDPDLTAGWAFETKQVHAGQTPDSATNARALPIYQTTSYIFDSTDHAAA
LFGLAEPGNIYTRIMNPTQDVVEQRIAALEGGVAALFLSSGQAAETLAIL
NIAGAGDHIVSSPRLYGGTYNLFHYTLPKLGIEVSFVEDPDDLESWRAAS
RPNTKAFFAETISNPKIDVLDIPGVSGVAHDIGVPLIVDNTIATPYLIQP
LSHGADIVVHSATKYLGGHGTAIAGVIVDGGTFDWTASGRFPGFTEPDPS
YHGVVFAELGPPAYALKARVQLLRDLGSAAAPFNAFLIAQGLETLSLRIE
RHVQNAQRVAEFLEAHPDVVSVNYAGLPSSPWYGLGKKLAPKGTGAVLAF
ELSGGIDAGKAFVNALSLHSHVANIGDVRSLVIHPASTTHQQLSPEEQLA
SGVTPGLVRLAVGIEGIDDILADLELGFAAAKPSAAATDPNAVASF
145225450YP_001136128.1 alpha/beta hydrolase fold protein [Mycobacterium gilvum PYR-GCK]MAPREPIHRGTGEPIVLLHPFLCSQNVWRTVADQLADTERFEVFAPTMVG
HHGGPKSPTWLLHTEVLVDDIEHRMDQLGWDTAHIVGNSLGGWVAFELER
RGRARTLTAIAPAGGWPHHSLSKYETVLKFIMGGPALIAARLLGPRILNV
PGARRLATLPVSGPADGPSQSDLAALVEDATHCSAYLQLLVKTLRMPGLL
ELASLGAPTQLVLCEKDRVFPTPRGNRYFLTHLPDEARVVRLDGVGHIPM
LEAPGAITELIADFVDDHSTPSGKAIG
145225449YP_001136127.1 exodeoxyribonuclease III Xth [Mycobacterium gilvum PYR-GCK]MTRPVTVSTINVNGIRAAIKQRSPENLGMLPWFKETAADVVCLQETRADD
AQLAEALAPVLADGWHLASAEPSMKGRNGVAVLSRDPIDEFRIGCGAEEF
ATHGRYLEADTAGVTVASVYFPTGEAETDRQREKERFMAAVAARMAALLQ
RSVVDGHESVLCGDWNIAHTENDIKNWKGNVKKAGFLPQERQWLTEVLGT
GWVDVVRQAHPDVAGPYAWWSWRGKAFDNDAGWRIDYHLATPGLAARATS
VLTERPAAYALRWSDHCPVTVHYA
145225448YP_001136126.1 hypothetical protein Mflv_4872 [Mycobacterium gilvum PYR-GCK]MRPLSVSLAMLVVASFFGAGSAHAAPQPAGRAVVVVSGGNATSPFTTPEQ
ACASGLAAGNTDTALRQDLLDHGYRVFTSPAMAGRGPVVDQDGFGAFGDC
PITLPEIMTVDSTGSIDTAGEHLARFFTHLHDVYGVSELDVVGHSMGGLY
SRAAFRVLQSLGSPIRIRSLTTIGTPWQGTYLSDYAHGLTPKSDCLGDRF
CEAAMDDLKAEVDRLVAGSGREVNQAYLMGPGGWNEYQAGVLDDIPVTLI
AGNRFTAPSEPANPSVWPNDGLVATSSALAVDVSERVLPRRRCFTFDDTH
SIFVSDAAGLPWETGLTWDPRVHDVVRGAIDGTLDERLGCSSSR
145225447YP_001136125.1 tryptophanyl-tRNA synthetase [Mycobacterium gilvum PYR-GCK]MSNTTRPVVFSGAQPTSDSLHLGNALGAVSQWVSLQDGYDAYFCVVDLHA
ITVAQDPATLRRRTLVTAAQYLALGIDPSRATVFVQSHVPSHAELAWVLG
CFTGFGQASRMTQFKDKSQKQGAEATTVGLFTYPVLMAADVLLYDTELVP
VGEDQRQHLELARDVAQRINARFPDTFVVPEAMIPKATAKIFDLQDPTAK
MSKSAESDAGLISLLDDPAKTAKKIRSAVTDSEREIRFDREAKPGVSNLL
TIQSAVTGTDIDKLVEGYAGRGYGDLKKETAEAVVEFVTPIKSTVDDLLG
DPAELEAVLARGAERAREVSGQTLRRVYDRLGFLASR
145225446YP_001136124.1 putative ribonuclease [Mycobacterium gilvum PYR-GCK]MTTQSATADPEDKPGFLDRQRARRPWFDHVMRAQERYKDSKGDFYAAGIT
YFTIFALFPLLMLGFSVAGFVLANQPELLQDVEERIRSTFSGDLGQQLVT
LMDSAIESRGAVGLIGLATAAWAGLGWMANLREALSQMWGLFRGETPGFV
KTKLSDLVALLTTFVAIIVTLALSALGNSSLVENILTRIGFPDSPVLTVV
LRASSITVSVLVSWLLFTWIIARLPRERVGFRSSVRAGLIAALAFEVFKL
VASIYLRSVLTGPAGATFGPVLGLMVFAYITSRLILFSTCWAATTPENMR
ENEIPAPPPAVINNRVIARPGLQIWQGLTAAAVGAIGALSLSRRRR
145225445YP_001136123.1 Serine-type D-Ala-D-Ala carboxypeptidase [Mycobacterium gilvum PYR-MATLRTTLLRASALVTASMLALAPAAAAQPAPAADPCPYRVTTPPAVDAS
EVPKPGDPTPGPLPVPAKPMGGDALSGCGVITAPGTPPVPGDVSAEAWLV
ADLDSGDVIAARDPHGRHRPASIIKVLTAMQALRDLPLMKTVPGTPEDAA
QEGTKVGVGEGGVYTVNDLLHGLLMYSGNDAAHALAMQMGGMDTALNKIN
VLAQKLGARDTRVATPSGLDGPGMSTSVYDMGLFYRYAWHNPVFADIVAT
RATQFPGREGAGYPIENDNKLLANYPGALGGKTGYTDDAGQTFVGAAERD
GRRLVAVLMRGTRQPIAPWEQAARLLDYGFATAPGTKVGTLIEPDPSLGV
DRADPAVAALTKTNANANAVLPDVDAMPVRIGVGVIGAVIVLTLIMGARA
LNSRPAR
145225444YP_001136122.1 metallophosphoesterase [Mycobacterium gilvum PYR-GCK]MTDEVRVSCVTQHPARRTRVEELPKLLKGCPLFLVVLGSVLALMHFYVWK
RTVKDTSQGRARRWLSAALVVLMLMLVAALVVPRTVGVPESRWIAWPGYL
WFGVLVYLFLVLLALEPVRLVLRRWTRPAPPPTPTDAETADPEMAPAVDR
RVFLARTAAVTAGAAAVGLTGFGAARALGPPDVLRVPVRLSRLAPAFDGF
RIAVVSDIHLGPLLGRAHTERIVRMINEAQPDLVAVVGDLVDGTVEELGA
AAEPLQDLVAPEGAFFVTGNHEYFVDDTPAWLRELERFGLDVLSNENTLL
TRGGAGLHLAGVNDIAGESRSDPPDFDRALAGAGARGPTVLLAHQPIEVE
KAADRGVDLQLSGHTHGGQMWPFHYAVELAQPTLAGLSRVGDTQLYVTRG
AGFWGPPLRIGAPPDISVLTLRSGD
145225443YP_001136121.1 AMP-binding domain-containing protein [Mycobacterium gilvum PYR-GCKMTGSYDAGPTDVAILEETIGANFARIARTHPGRDALVDVAGGRRWTYAEL
DAEIDTVARGLMAIGVERGDRVGIWAPNCPEWVIVQYATAKIGAILVNIN
PAYRTHELRYVLEQSGVATLISATQFKTSDYVAMVDEVRPDVPALQRVLF
IGTADWDTLRAAGSGVDDADLRRRSGALSNRDPINIQYTSGTTGFPKGAT
LSHRNILNNGFFVTEQIRLQPGDRLCIPVPFYHCFGMVMGNLGCTTHGAT
IVIPAPAFDPGLTLRAIETERCTAVYGVPTMFIAMQNHPDFAERDLSTLR
TGIMAGAVCPVEVMKRCVEEMHLTEMSIAYGMTETSPVSCQTLIDDDLER
RTSTIGRVHPHVEIKIVDPETGEIVERGTPGEFCTRGYSVMLGYWREDEK
TAQAIDADGWMHTGDLAVMRPDGYCNIVGRIKDVVIRGGENIYPREIEEF
LYTHPDVEDAHVIGVPDDRYGEEVCAWIRMRPGRTALDAAAVREFATDKL
AHYKIPRYVHVVDEFPMTVTGKIRKVEMREVSARLLGL
145225442YP_001136120.1 AMP-dependent synthetase and ligase [Mycobacterium gilvum PYR-GCK]MATNTDLFRSARDHLVDVMADYDKALDTFEWPRIAGSFNWATDWFDAIAA
DPASADRPALWIVEEDGREQKVTFAQMAHRSDQVATWLQGLGVGKGDRVI
LMLGNQVELWESMLAVAKLGAVIMPTTGALGSEDLADRIRRGGAGYVIAN
AADAPKFDGVDGDYVRIAVGGGADGWHTYADSAHADAHTHDPQTTAGDPL
LVYFTSGTTSKPKLVEHSQISYPVGHMTTMAWLGVRPGDVHLAISAPGWA
KHAWSCFFAPWIAEATIFVYNYGRFQAPALLDQIRRAGVNTFCAPPTVWR
MLIQSDLGERPEGLRELLGAGEPLNPEVISAVEQAWGLTIRDGFGQTETT
LQIGNTPGQPVKAGSMGRPMPGVPVVLVDPLTGELADEGEICLDLSGTPL
NLMTGYLGDDERNAQVMRDGYYHTGDVASRDADGYITYIGRTDDVFKSSD
YKVSPFELESVLIEHPAVVEAAVVPQPDDTRLAVPKAYIALADGWSADES
TAKAILEHSRDHLAPYLKVRRLEFADLPKTISGKIRRVELRRREEDAHRS
GAPIESEYRYEDLVN
145225441YP_001136119.1 response regulator receiver protein [Mycobacterium gilvum PYR-GCK]MSAASPLLRPRDGDALRAELRRVAALGGVPVLFGGEIHEDTLLISEYYGL
RTAGLRGLAVRSSSGLGGASMVAGRPLAVADYRNASSITHDYDGPVLSEG
IRSVLAVPVLVDGRARAMLYGAYRTGAPFGGRAADLVVESARRLSEEFRI
RDEVDRRLRMRDAQAAGGQVSDEQIREVHAELRLLAVTAPPPLQNRLRAL
ADTLSGTGTEPGAGPDAATLAPRELDVLAQVALGCTNAEAAQRLSLKPET
VKSYLRSAATKLGTRTRYESVSKARRLHLIP
145225440YP_001136118.1 hypothetical protein Mflv_4864 [Mycobacterium gilvum PYR-GCK]MKNFTIATTTTAALAAGFFALAAPAAAAPAGGDATDTTAALEAQGNRVIV
HRLSDTPLAQADVVSINPGADIRSTVQDHANDRTYQNTITGKVYYVNIR
145225439YP_001136117.1 strictosidine synthase [Mycobacterium gilvum PYR-GCK]MPRFKRPIDPVRWQAPPVDPLPEFGSAALTLTPIPGGEPEDVVVDARGYL
WTGALDGSIVRLRPDGTAPEVVANTGGRPLGLAFARDGRLLVCDSPRGLL
ALDVDTGAIETLVTSIDGRPLLFCSNVTETSDGTVYFTESTSAFTIDQYL
GAILEARGRGALHRLDPDGRVTTVVDGLYFANGVTPTADGSALVFAETQG
RRLSKYWLTGPNAGSVTPLAVNLPAMPDNLSTGAEGRIWCAMVTPANPVA
DRLAAGPPVLRKLVWRLPARLQPKPEAVAWAVAFDPDSGDAVAGFRTTHP
EFRMATGLVESGGRLWLGSIGGPYLASVDLAATAP
145225438YP_001136116.1 hypothetical protein Mflv_4862 [Mycobacterium gilvum PYR-GCK]MTIISETEQATASELGAKANRHLWGHFARHGAGITPPIITRGEGVHIFDD
KGKRYIDGLSGLFVVQVGHGRKELAEAAAKQAEQLAFFPLWSYATPTAVE
LAERLAGYAPGDLNRVFFTTGGGEAVESAWKLAKQYFKLTGKPGKHKVVS
RSIAYHGTPQGALSITGIPAFKAPFEPLVPGGFRVPNTNFYRAPAEYAHD
EKAFGRYCADRIAEAIEFEGPETVAAVFLEPVQNAGGCFPPPPGYFERVR
EICDEYDVLLVSDEVICAYGRIGSMFACEDFGYVPDIITCAKGLTSGYSP
IGAMIASDRLFEPFNDGSTVFGHGYTFGGHPVSSAVALANLDIFEREGLN
ERVKQNAPAFRATLEQLLELPIVGDVRGEGYFYGIELVKDKATKETFNDE
ESERLLRGFLTPALWDAGLYCRADDRGDPVVQLAPPLISGQAEFDAIYDI
LRSVLTEASARM
145225437YP_001136115.1 AsnC family transcriptional regulator [Mycobacterium gilvum PYR-GCKMANPGLPHAVGPVSFRVNESRPGAAFQLDELSKAIIEKLQQDGRRSYAGI
GKAVGLSEAAVRQRVQRMVDAGVMQIVAVTDPMQLGFARQAMIGIKCTGD
TTKVAQKLAELPSVDYVVLTAGSFDAIVEVVCEDDDSLLELLNTQIRALP
GVIATETLVYLKLVKQQYNWGTR
145225436YP_001136114.1 gamma-aminobutyraldehyde dehydrogenase [Mycobacterium gilvum PYR-GCMTVASSWIDGAPVKTGGAQHTVINPATGESVAEFALAQPGDVDRAVVSAR
AALPGWKGATPAERSAVLAKLAKLADDATADLVAEEVSQTGKPVRLATEF
DVPGSVDNIDFFAGAARHLEGKASAEYSGDHTSSIRREAVGVVATITPWN
YPLQMAVWKVIPALAAGCSVVIKPAEITPLTTLTLARLASEAGLPDGVLN
VVTGSGADVGAALAGHADVDMVTFTGSTPVGRRVMLAAAAHGHRTQLELG
GKAPFVVFDDADLDAAIQGAVAGALINTGQDCTAATRAIVAEGLYDDFVA
GVAEVMSKVVIGDPADPDTDLGPLISAVHREKVAGMVERAPGEGGRVVTG
GVAPDGPGSFYRPTLIADVAESSEVWRDEIFGPVLTVRSFTDDDDAIRQA
NDTKYGLAASAWTRDVYRAQRASREIHAGCVWINDHIPIISEMPHGGFGA
SGFGKDMSQYSLEEYLSIKHVMSDITSAVDKDWHRTIFTKR
145225435YP_001136113.1 hypothetical protein Mflv_4857 [Mycobacterium gilvum PYR-GCK]MRIRMLSLGPARSTTSRAAREARAGRRDDLAVTRAAVPDAPNIESQLADG
IRLESTRKKLKSNDGDLFVADSPRFAAPKRIFLGSTASRILAGVDVPGDC
GAARGLSFVCERALTVVGSAWPLP
145225434YP_001136112.1 transposase IS3/IS911 family protein [Mycobacterium gilvum PYR-GCK]MASNKRRRHTPDQIIRKLAEGNKLLGAGQELSKVCRHLQTAESTWHRWIA
QYGGMNANEAKQLKELGAETLVSKKLAADQALDIDMLKEISAGNFLPRTV
SAAPSSRCANADLRRGSRDETIETRRHT
145225433YP_001136111.1 YVTN beta-propeller repeat-containing protein [Mycobacterium gilvumMGYSKYVGRVGALALALGIGTAVATPAWAESPSTSESASSESKAPQKPSS
RRSTPATSGDSANGGDSAGKSGSDGSTASAGGNDNDSPVEDEADIEVAPE
PEAAEDAPPLVDEVVEESDAHDGNSASAAPEVDSPSTAVPSDATGVSEAE
APAHETLASLSPDQDPEPVDTEIADAPTPLGYALAVTAPPVEPAPAPLVR
QPRGPVGVILGGPAAMIDIAAKALQMLFNPGPTVPGDPPLLLGVLAFVRR
EIQRTFFNSSPTAVADTTSTSEGLPTRISVLDNDTDPNIDDVLTVTDFTQ
AANGVVELNADGSFTYTPTTGYSGTDTFTYTISDEASEWHGHVAGFVRGH
TSTATVSVTVLPPPVNESPSAAGDSATTAEDTPAVIDVKANDSDPNGDDI
SIASVGTAQHGAVAVLDGKITYTPESNFHGTDTFDYTITDGDLSDTATVT
VTVTPVNDAPVAVHDAITVAGSSVANVINVLGNDTDPDTEVTLTVAEVGA
PNHGGTVTIVDGNAIAYTPAAGFSGTETFSYTVSDGELTDTATVTVSVEQ
VVPSNIAPSAYDNVSYYTTNENTTLNVFANDGLIEWDAFDPDGDALTAGL
ATGPAHGTLDLNPDGSFTYTPDFGFIGDDSFRYTVTDGASSSNIATVGIS
VTPAGSSNTGNNRPPRAFDDFANIRENTTLTVPAGQGLLSTRSAHDADGD
SLTVDLVTATTNGHVSVDADGSYTYAPNDGYVGEDSFTYTISDGQATSSA
ATVTILVHAASEQTAPEAYGDDQIVVQDSSLTVSTENGLTSRFNAYDNEG
DALTAALATGPSNGQVTVNSDGSYTYTPNDGYIGEDSFTYTVSDGQLVSA
AATVYIDVQSNAYNMETGITIGPDGKVYVLHGTTRSNPDGTTGGSFHLAS
RNSDGSLTDLVQLSGASADSLPTGLAAGSDGRIYVADHLTGSITVYDRSG
GYSPTLIASIPAAAGIALDSKGRIYVTTVDYTDPDRAVGQLWILDSTGTQ
IGRPIDLAGPAAGVAVASNGDVYVAGLSGGLSVYSHRVLQTNITAEDLPG
FLHGLAIGPDGTAYIANWEAVSSSGELLDGAINIVNPADPTNIKQLPGVS
DPWGVVYANGLLYVTSTATQSVITLDPANATPFVNPNENAGGGALDPYTY
DVKTGIALGPTGDTFVIRGSVTYSPADGSSESTFYLARQNEDGSFSDLAE
IDGSPTSLAVGPDGRLFVTDNETGIVTMYDPSDGYSARAVAAIPNAAGIA
VDASGRIFVTTVTSDESGEPTGQLWILDATGSQIGQPVDLRLPSAGVAVA
SNGNVYAAGLFGGLAIFDPATELLETISSTDLPGFLHGIAVGPDGTAYIG
TWEGSNAYGDLLNGAIIIVKPGEPTTIKQVTGVSQPWGIAFANGMILAVS
ADTQTVVTLNPADATTFIKPSSDNGSDGAGSAEFASASTAVTMSATAAHT
AAVSTSISVSTKTATTAPAMASTANTANSSYGTHVTIDLDGTPTNVTLSA
NGTRGYVVVGNQVKIIELGASAPVIVDSVNVGVNPNMVAVNSFGTVAYVT
NSGDGTVSIIDKARPTPLTVTVGSNPTGIALSANGTRAYVSNTNSNTVSI
IDYGGGVLQLPKVVANVPVGSRPTSIAVNSTGTVAYVTNEGGDTVSIIRY
NGSGSPSVSTVNVSAQPQSVKTDDTGTKAIVYSRGGIVTIINGSGSVPTA
TTVPGRHFSYADYPGFVAISSDGRTAFVTEHDSPRRVTIIDTANPGVTPR
FVDLPDYSHSIVSLPDGTRAFTVAHDALWVIESKTGQATPVYVPADNNFS
QHQRIAISSDGRRVIAADNFGSLTAFYLSGGGSVKPPNLDWLRNSPTASS
TAVTTDSLLTKIPTSTPDTIRIQKSTDGGTTRVVVYISGVKEPSLQAAGS
YWAVLRAKQGITDENMRDTINKAISDIEKDGTTVSEIMLVGFSKGGMTAQ
NYASKRSFLGIDIYNETYGDKVKAVITFASPLVRKADEYGYGVDVVHLAA
QNDYLPRDEFFGGVLGWVDGQQVTQASNRGVRETFINERSDWKTIYTYDT
KSFSKDPITRHSVDNYHLVAKNYDANASRWIQSKLVTSAITRFFKGTINE
IDLDPNSPKTTKTF
145225432YP_001136110.1 UspA domain-containing protein [Mycobacterium gilvum PYR-GCK]MHLTVGYLATPTGDDGIALASALAKTFDATVDVVIVVREELPDGHPGRLE
YQQMLIRRGEEWVAKAVEALAVDGVSAGSAVIVGESFAQTLVEFAESKSS
DLIVVGGARDGFFGRHTIGPVTGALLHISPIPVALAPRGYAEDPDDKIEA
LTAAVPTRPGDDNPLPFTIRLAALAQLRIRMLSLVSAENLAEAGSAREVR
ALQRAAAEENLAVAARELPDAPDIESLVADGMTLESALKKLKWDDGDLLV
VGSSRFAAPKRIFLGSTASRILAGVDVPVIVVPREG
145225431YP_001136109.1 amino acid permease-associated protein [Mycobacterium gilvum PYR-GCMVIGLGAVAPAYSLAATLGYVVLNVQEKAPSMFVLAFIPMLLVAFAYKEL
SQDTPDCGTTFTWATKAFGPWIGWIGGWGLAVSAIIVLANVSEIAAIYLY
NFLGLTSLAESVPATVALGCFFIIAMTLVSARGIVVSERVQNVLIAIQFG
VLITVSIIALVRVFSGTAGAQAVMPEVSWLWPSGLDVSSIAAAVILCIFI
YWGWDACLAVGEETKDPGKTPGIAALITTVILVCTYVLVAYALQSFAGFS
EVGIGLNNPNNTDDVLTVLGEPVAGAIAASALLLTVSVSALSSTQTTILP
TARGTLSMAVYEAIPRRFASVHPRYMTPAFGTIVMGISALFFYLVLKMLS
ENALLDSVASLGLAVAFYYGITAFACVWYFRRTLFSSARNLFFRGVFPLL
GGLSMLAAFAISAKDMIQPDYGHTAFGSIGGVFVLGVGMLVLGIPLMLAC
FAFGTKRFFRGETLNADTAVKVPDTF
145225430YP_001136108.1 RNA polymerase sigma factor SigJ [Mycobacterium gilvum PYR-GCK]MPHGGIYTRRMTASARVAEFEQMRPHLLSVAYRLTGTVADAEDIVQDAWL
RWSTHRGAAVEDLKAWLTTVVSRLALDKLRSAAHRRETYVGEWLPEPVVT
GLDGRDPLSALVADEDARFAAMVVLENLTPDQRVAFVLHDGFAVPFSAIA
EVLGTSTQAARQLASRARRAVSSAPPPAADHAEVVGKLLAAMASGDLTAV
VSLLHPDVTFTGDSNRRAPTAARVIRGSDKVARFLLGLGAKYGPERLLAG
SELGLVNGELGVYSPGADATPDAPRIMPRIQALAVRDGLVVAIYDVANPD
KFTASPLAR
145225429YP_001136107.1 hypothetical protein Mflv_4851 [Mycobacterium gilvum PYR-GCK]MTTTTRIEPVSPQRASLMTRLLWRYAKRRFGEVPEPFTIYAHHPGVMLAG
AMHEGMLERASTALPANVRELAVYWVARQIGCSWCVDFGAMLMRLDGLDL
ARLTHIDDYATSTSFTDDERAAIDYAAAMTTDPHTVSDEQVADLRRRFGD
KGLMELTYQVGVENMRARMNAALGITEQGFSSGDACRVPWTQ
145225428YP_001136106.1 hypothetical protein Mflv_4850 [Mycobacterium gilvum PYR-GCK]MVQEETTQEKTSKPERGTIYAAHLRSSAVVAVQFIAVAAALWVLAWVLGK
TWVVVLPLALALVVCTVLWPPVRWLRNKGVPPAAAVLVVLLLAVGVLAGV
VAAVAPAIVEQSQELAEQATAGIVQVRDWLGGPPLNISEAQLNSGVAAIT
DRLNSSSAQIASGVFTGVGAATSALVTLFAAIVVTFFFLKDGPGFIPWLR
RTVGQPAAPHLAEVLDRVWTTLGGFIRTQALVSFVDAVLIGIGLVVLGVP
LAYALAIITFIGGFIPIVGAFVAGGLAVLIALVSNGPVDALIVLGIIVAV
QQLEGNVLQPWLQSKSMKLHAVIVLLAVTLGASTFGVIGAFLAVPVAAAA
AVMIRYYGEQVGRAAGEDPPPEAAEDENTEDENTEDDGAAVVKT
145225427YP_001136105.1 hypothetical protein Mflv_4849 [Mycobacterium gilvum PYR-GCK]MDVGVASADDEAFLLDLLNTTPVVEGVPTDVLADKATAAEWMSSHGVGAT
DKARRVLIDARSALQAVVRGKATPDVLQRFLEGVHLTPTATDGGVDWTLA
GTDGAARAVLAWDGLRITSPGRLRPCANTECQLFLIDRSKPNNARWCSMA
ICGNRMKARRHYQRSRG
145225426YP_001136104.1 alpha/beta hydrolase fold protein [Mycobacterium gilvum PYR-GCK]MTVVHHRIDTVDGHQVFYREAGDPDAPVIVLLHGFPTSSFMFRNLIPELA
DRYRVIAPDYLGFGYSDAPTVEDFDYTFDALTDSVAGLLTQLGIRRYAIY
VQDYGAPVGWRLALRDPAAITAIITQNGNGYNDGFVAEGWQPAWDYQREQ
TPETEAALRGILTFETTRMQYTAGVPDPSVVSPDTWHHDFALLSRPGNDR
IQLKLFLDYSTNPKIYPALHDYLRASGVPLLAVWGDKDPFFGPDGARAFA
KDAVDSEIHLIDGGHFLLESELTRVANLIRDFLERRL
145225425YP_001136103.1 succinate dehydrogenase iron-sulfur subunit [Mycobacterium gilvum PMSAPVLDKQDTPPVPEGAVMVTLKIARFNPESPDDAGWQSFRVPCLPSDR
LLNLLHYVKWYLDGTLTFRRSCAHGVCGSDAMRINGVNRLACKVLMRDML
PKNPNKQLTITIEPIRGLPVEKDLVVDMEPFFDAFRAVKPYLITSGNQPT
RERIQSQTDRARYDDTTKCILCACCTTSCPVYWSEGSYFGPAAIVNAHRF
IFDSRDEAAAERLDILNDIDGVWRCRTTFNCTEACPRGIQVTKAIQEVKR
ALMFAR
145225424YP_001136102.1 succinate dehydrogenase flavoprotein subunit [Mycobacterium gilvum MIVEHRYDVVIVGAGGAGMRAAVEAGPRVRTAVLTKLYPTRSHTGAAQGG
MCAALANVEEDNWEWHTFDTVKGGDYLADQDAVEIMAKEAIDAVLDLEKM
GMPFNRTPEGRIDQRRFGGHTRDHGKAPVRRACYAADRTGHMILQTLYQN
CVKHDVEFFNEFYALDITMTETPSGPVATGVVAYELATGDIHVFHAKAIV
FATGGSGRMYKTTSNAHTLTGDGLGIIFRKGLPLEDMEFHQFHPTGLAGL
GILISEAVRGEGGRLLNGDGERFMERYAPTIVDLAPRDIVARSMVLEVLE
GRGAGPNKDYVYIDVRHLGEDVLEAKLPDITEFARTYLGVDPVKELVPVY
PTCHYVMGGIPTTVNGQVLSDNTTVVPGLYAAGECACVSVHGANRLGTNS
LLDINVFGRRAGIAAANYALGHDFVELPESPAEMVVGWVGDILSEHGNER
VADIRGALQQSMDNNAAVFRTEETLKQALTDIHALKERYSRITVQDKGKR
YNSDLLEAIELGFLLELAEVTVVGALNRKESRGGHAREDYPNRDDTNYMR
HTMAYKEGSDLLSDIRLDYKPVVMTRYEPMERKY
145225423YP_001136101.1 putative succinate dehydrogenase [Mycobacterium gilvum PYR-GCK]MTQASRPASGRAENAYDHISDRGGPAPVMQRSFDRPAGLDNPRAPRRSGG
MPNFEKYTWLFMRFSGIVLVFLALGHLFIMLMWENGVYRIDFNYVAQRWS
SPFWQTWDLLLLWLAQLHGGNGMRTIIADYTRKDSTKFWLNTLLALSMAF
TLVLGTYVLLTFDASIS
145225422YP_001136100.1 succinate dehydrogenase- cytochrome b subunit [Mycobacterium gilvumMSTATSADTDLPEPRSKPTRRRTFYRGDPGMWSWLLHRISGATIFFFLFV
HVLDTALVRVSPQAYNEVIETYKTPIVGLMEIGLVAAVLYHALNGIRIIL
IDFWSEGPRHQRKMLWIIAGIFIVLFTAGLGVIGMHMAERFL
145225421YP_001136099.1 cytidine deaminase [Mycobacterium gilvum PYR-GCK]MTGEIDWNLLRRKAIDVSQHAYAPYSGFRVGAAALVDDRRMVAGCNVENV
SYGLGLCAECAVVCALHSSGGGRLVALTCVGPDGEVLMPCGRCRQVLFEH
GGGDLLIDHPLGPKPLGELLPDAFGPADLDRRPYPVEETP
145225420YP_001136098.1 thymidine phosphorylase [Mycobacterium gilvum PYR-GCK]MSFDAAGPISHLDAPSVIRTKRDGGALSDEAIDWVIDAYTRGEVAEAQMS
ALLMAIFLRGMTGHEIARWTAAMIASGERLDFSDLRRDGKPLALVDKHST
GGVGDKITIPLVPVVMACGGAVPQAAGRGLGHTGGTLDKLESIPGFTAEI
TKSQIRQQLCDLGAAIFAAGELAPADRKIYALRDVTATTESLPLIASSVM
SKKIAEGTKALVLDSKVGSGAFLDSEAESRELARTMVELGVEHGVQTRAL
LTDMQTPLGRTVGNAVEVVESLEVLAGGGPDDVVELTLALAREMCDVAGL
DGVDPAQTLRDGTAMDRFRDLVAAQGGDVDSLDAAMLPLGQHTETISAPR
SGTMGDIDAMAVGLAVWRLGAGRSVPGEQVQFGAGMRIHRKPGEAVAAGE
PLFTLYTETPHRLAAAASELDGAWSVGDHAPPTRPLIIDRISM
145225419YP_001136097.1 adenosine deaminase [Mycobacterium gilvum PYR-GCK]MTTPLTLENIRRAPKALLHDHLDGGLRPSTVLELAEQYGYDDLPAHDADE
LAEFFRTAAHSGSLVRYLEPFAHTVGVMQNHDALHRVARECVEDLADDNV
VYAEIRFAPELHIDGGLSLDAVVEAVLAGFADGEKAAAAAGRTITVRCLV
TAMRHAARSREIAALAIRFRDQGVVGFDIAGAEAGYPPSRHLDAFEYMRS
NNARFTIHAGEAFGLPSIHEAIAFCGADRLGHGVRIVDDIDMDAEGGPKL
GRLAALLRDKRIPFEMCPSSNVQTGAVASIAEHPFDRLARLRFRVTVNTD
NRLMSDTTMSLEMLRLVEAFGYGWSDLERFTINAMKSAFISFPERLAIID
EVIKPRYAVLVG
145225418YP_001136096.1 hypothetical protein Mflv_4840 [Mycobacterium gilvum PYR-GCK]MAADIVPIGLTLTKGDVYTLWAPRWRADGDEWEAFLGKDEDLYVLESVAD
LAAFVRTNNDNDLVDHPAWTKLTEANAHRLTPTESNTHDLVVLEELLAQK
PTEAGVSALYGALAVVSSMGSVCELPAVTKFFNGNPVLGTVGGGVEAFAG
RAGKKRWAEIEKIIAKGWDKVIEALDEIITIPEVDSAAVAKAQAELDADA
PEPDEELVIDDVVDTPEESDDLAAEAETKVLGSDKDFWERVGIDPIRIMM
TGETYFTLRCYFDDRPIFLGRNGRISVFPSERALARYLADEHDHDLSDLA
TYDDIRTAATDGSLRVDVTDDNVYVLTDIVDDLAEGPDALDHDQIELAVE
LLRDIGDYSEEATVDTKLAPDTALGRVIFHVLEPGKVARPNAPFADAVTQ
WESLERFVESRLRSET
145225417YP_001136095.1 luciferase family protein [Mycobacterium gilvum PYR-GCK]MIDAVAASAERSGFETLWFGDQVVMADEDGPHHPYRDDGEIPASAQTDWL
DPLIALSFAAAATNRIELATGVLVLPERNPVVTAKQAASLDRMTGGRLTL
GVGIGISPQEYDALGVPFASRGARLAEYVGAMRTLWRDDDASFAGRYVAF
DGVRANPKPQGRSIPVVLGGNSDAALRRVAEWGDGWYGFDLADVEEAAFR
ASKLRSMCREFGRDPTELKLSVALHDPVPADAVRLADAGIDELVLVAGPP
ADPIAAEAWIADLAGQWMRVRT
145225416YP_001136094.1 NLP/P60 protein [Mycobacterium gilvum PYR-GCK]MPSATVEALAAPIRRVQGLVGPGWSGDPAADPSGALAGVRQMLSDVAGSA
GHAWRTVDDRWSGAGADAAASFASATTAAIDDAADRAGRLGVAAEDAAAA
VGHAHRRLQQIVDEFESKARALEQRLDDPGVARELLTAARDALGEAIAVV
EELQTELDRQARIVDSAAPAGSPPTTPAEWQSASGTGGGPGGGFAPGSGG
FGNSGATGEMAAFTRPDGTDTPDAAEFGEGVAVRLPDGTVVVAPNAVAAN
AVRHALTQLGVPYQWGGTTPGVGLDCSGLTQWAYREAGLDIPRLAQEQDI
GGAVSGGSLLPGDLAVWDGHVAMVVGDGLMVEAGDPVQLSPIRTANAGQG
FQGFWRPTV
145225415YP_001136093.1 hypothetical protein Mflv_4837 [Mycobacterium gilvum PYR-GCK]MLAHLSVETGLVHDYGVACATHAADLDAAAARLRGVGVGAAAAFGPVGAP
FLASLTRAAAAQSASLGRLSTSVDAGRAAATSCAQAYDLSDGDAASRLAG
SI
145225414YP_001136092.1 uracil phosphoribosyltransferase [Mycobacterium gilvum PYR-GCK]MFRTSRIPVRFPLRSGSMDVRVVDHPLAAARLTTLRDERTDNAGFRAALR
DLTLMLVYEATRELATHTISVRTPVAETAGTKLATPPLLVPVLRAGLGMV
DQAHELIPEARVGFVGVARNEETHQPTPYLESLPDDLSRQPVIVLDPMLA
TGGSMVHTLELLYSRDAVDVTVICVVAAPEGLALVEKTAPELRLYTAAID
SGLNDIAYIVPGLGDAGDRQFGPR
145225413YP_001136091.1 ectoine hydroxylase [Mycobacterium gilvum PYR-GCK]MSAPATLVPEDRYPTRLPEPRDPIRREEPTVWGDTFSGPLAESDLQSMSD
RGYLVRPGTMPEAWLPTLTAELGRMAGEVAPDDPRVIRERDGGIRSVFEP
HILSDVLAEVLTMDTVLPVARQLLGSDVYVHQARINMMPGFTGGGFYWHS
DFETWHAEDGMPAMRAVSCSIALTENFPFNGSLMVMPGSHRTFYPCVGAT
PRNNHASSLVRQEIGVPSRQTLTDAAAQHGIDQVTGPAGTALWFDCNIMH
GSGSNITPYPRSNIFVVFNSVQNQLVSPYRAETPRPEYLAARTFRPFNEP
VLT
145225412YP_001136090.1 L-ectoine synthase [Mycobacterium gilvum PYR-GCK]MIVRTTDEITGTHRDVAAANWRSKRIVLADDAVGFSFHETTIDADSVSEF
HYRHHVEAVWIVEGTGTLTNHETGEEHPLRPGTMYLLNGHERHRVTCDTT
MRMLCVFNPPVTGQEIHDETGAYPPAVQAS
145225411YP_001136089.1 diaminobutyrate--2-oxoglutarate aminotransferase [Mycobacterium gilMTATVVTPPTTDPVRENALPDVYDRVESEVRSYCRNWPATMASARGSWMT
DTSGRQYLDFFAGAGALNYGHNNPVLKAPLIDYLSQDSIVHSLDMATAAK
TEFLETFERLILRPRSLDYKVQFPGPTGANAVESALKLARKVTGRESIIN
FTNAFHGMTLGALSVTGNSMKRAGAGIPLVHATPMPYDNYFGGITEDFHW
FERVLDDSGGGLNHPAAVIVETVQGEGGLNVARMEWLRALAELCQRRDIL
LIVDDVQMGCGRTGAFFSFEEAGIVPDIVTLSKSISGYGLPMALTLFRRD
LDVWAPGEHNGTFRGHNPAFVTATKALETYWKSATFAENTAAKGQHVRDR
LESIAAAHEGISARGRGMAQGLKCEEKDLAAAICATAFERGVLMETSGPS
DEVIKLLPPLTTSTEDLDAGLDILAEAVATTVS
145225410YP_001136088.1 L-2-4-diaminobutyric acid acetyltransferase [Mycobacterium gilvum PMSSSLSETGVAAPPEWTLASKDSVVHRNSWGPFLRRPESTDALAMHKLVA
DTEVLDLNSTYTYLLMATDFADTTIVADRDGDLCGLITGYHPPTRPDVLF
VWQVAVARSAQGTGLAGTMLDSLVGRVHRARCGHPVTVEATVAPSNSASR
ALFGGFARRHGVPLVERPHFTAAQLDAAGAHDDEPILRIGPIVTSRDS
145225409YP_001136087.1 phosphoglucomutase/phosphomannomutase alpha/beta/subunit [MycobacteMHTAVEEWLAHDPDPESAAELAACDDDELAERFAHTLTFGTAGLRGPLRA
GPNGMNLAVVIRATWAVARVLTDRSPASSQVVVGYDARHRSAEFGRAAAE
VFAAQGFTVQLMSGPVPTPAVAFAVRHLGAAAGVQITASHNPPTDNGYKV
YVTGGLQIVSPTDREIEAAIAAAPPADEIPRAPVEVPAADELRAYLERAA
SVRHAAGAARIALTPMHGVGGEFALDALALAGFADVHVVEEQFAPDPDFP
TVAFPNPEEPGASDALLALAAGVDAEIAIALDPDADRCAIGVPTPTGWRM
LSGDETGWLLGDYVLSHADPTHAVVASTVVSSRMLASIAAAHGARHVETL
TGFKWLARADEGLDATLVYAYEEAIGHCVDPGAVRDKDGISAAVLACDLV
VSLREQGRTLLDALDDLARRHGVHTTTAVTRRVRSPQDAAAMMSRLRAAP
PEEIAGFAVTVTDLMPRTDALIFSGGDSATSVRVVMRPSGTEPKLKSYIE
IRCTGEVATGRSHAADVQDAVAAAIATWR
145225408YP_001136086.1 MarR family transcriptional regulator [Mycobacterium gilvum PYR-GCKMYGSHGSLLPRFSLSIEQPAATELRESLMAVARQLRRHRPDNGLTLSQMQ
LLGEISRAGVTTPAELGVRMHVRVQSLTDSLNELESRGLIGRRPDETDRR
RQLVEMTPEGTALLDDDRAERDAWLHHTMRDTLTDLEFDLLMLVAPILRK
LADSDTR
145225407YP_001136085.1 putative ammonia monooxygenase [Mycobacterium gilvum PYR-GCK]MKWWRSILRWTCLLAVTGAVTVPLTRVGVPSAALFAALAVGIVFALTVGG
PARVPRRLGIAAQGVLGVYIGTMVHRDALSALKGDWVIVLAVAVGTLLLS
VLAGALLGMRRDVTPLTGSLALVAGGASGLVAIARELGGDDRVVAVVQYL
RVALVTASMPVVVTLIYHADRSRATTQIAETPAAPWYLSVAIMAALVVVG
AVGGRLIRLPGAGLLGPLALTVALEVSGLSFGLSVPMLLVQAGYMLIGWQ
AGLAFTRASLRSVGRLLPTALALIVFIGVATAGLGVLLARVAGLTPLEGY
LATSPGGVYAVLATAVETGSNVTFVIAAQVVRILLMLFTAPLLARAVVWA
SRKLSPDQSPAMTADSREPIRVAD
145225406YP_001136084.1 purine nucleoside phosphorylase [Mycobacterium gilvum PYR-GCK]MDDPGVLAQQAADELRRRTGVDTHDVAVVLGSGWAPAATSLGEPDAAIPM
ADLPGFTPPSAQGHGGQVLSVRAGPHRVLVLLGRIHAYEGHNLRHVVHPV
RTACAAGARTVVLTNAAGGVREDMTVGQPVLISDHLNLTARSPLVGAQFV
DMVDAYSPALRALARDIDPSLTEGVYAGLPGPHYETPAEIRMLRTLGADL
VGMSTVHETIAARACGAAVLGVSLVTNLAAGMTGQPLSHEEVLAAGRQSA
TRMGSLLSAVIAGL
145225405YP_001136083.1 amidohydrolase [Mycobacterium gilvum PYR-GCK]MSSAAASTSVEDAVNRRRSDLIELSHSIHAEPELAFAEHRSCAKTQALAA
ERGFEVSEVAGLDTAFRAVYGSGPLVIGVCAEYDALPGIGHACGHNIIAA
SAVGTALALAEVADELGLTVVLLGTPAEELGGGKALMLDAGAFDDIAAAV
MLHPGPLDIAAARSLALSEVTIGYTGRESHAAVAPHLGVNAGDAVTVTQV
AIGLLRQQLAPGQMVHGIVTDGGQASNVIPAHTELRYTMRATNSESLHEL
ESRMAGCFASGAVATGCEHVVSETAPAYAELAPDPWLAERVRAEMLRRGR
TPVPAELEAEFPLGSTDMGNVTQVMPGIHPIVGIDAGGASIHQPAFTAAA
VNASADAAVVDGAIMLARTVVALAESDVERDRVLDLWRKRAS
145225404YP_001136082.1 amidohydrolase [Mycobacterium gilvum PYR-GCK]MSVLRHAAARWLSEHYDDLVGWRRHIHRHPELGRQEFATTQFVASLLADA
GLNPKVLPGGTGLTCDFGPEDGPRVALRADMDALPMSERTGLPFSSEVAG
VAHACGHDGHTSVLLGAALALASAPELPIGVRLIFQAAEELMPGGAIDAI
AAGALTGVSRIFALHCDPHLAVGQVAVKAGPITSAADHIEVTLHSPGGHT
SRPHLTGDLVYGMGTLITGVPGILSRRIDPRNSTVMVWGAVHAGVAANAI
PQTGTMAGTIRTASRETWLTLEDIVTDAVASLLAPLGIEYVVQYRRGVPP
VVNEEASTRILTHAIEAIGPDVLADTQQSGGGEDFSWYLEEVPGAMARLG
VWSGQGPQLDLHQPTFDLDERALGVGVRLLVNLVEQSAVVP
145225403YP_001136081.1 transporter [Mycobacterium gilvum PYR-GCK]MCRRATGSAITTFGRNNFGFNNFGLNAVEDRTVHGDKPHFYGIARVIRAA
SIPIILIWVAIAAFLNVSVPQLEEVGKLRSVSMSPDDAPAVISMQRIGEV
FEEYESNSSVMIVLEGQEPLGDDTRAYYSELIADLEADTKHVEHIQDLWS
DPLTAAGAQSADGMSTYFQVYLAGNQGEALANESVRAVQELVAESQPPDG
VAAYVTGASALAAEQEEAGHSSMRFVEALTFLVITIMLVLFFRSIVTTLL
ILVMVGLSLMTVRGAVAFLGFHDIIGLSTFATSLLVTLAIAIAVDYAIFL
IGRYQEAKGTGATSEEAYYTMFGGTAHVIVGSGLTIAGATFCLSFTRLPY
FQSLGVPLALGMLVLIAVAMTFGPAVVTVASKFGLLAPKRDMRVRGWRKV
GAATVRWPGAILVASVAVSLIGLLALPGYQTSYNDRKYLPADIQSNIGYA
AAERHFSPARLNPEVLMVETDHDLRNPADFIVIEKIAKALFAVEGIGRVQ
TITRPDGKPIESTSIPYIMSRQNTTQQLNEKYMLDRMDDMRAQADSLQTT
INVMERMQALMTQMSAITTSMVGKTRTMTADITQLRDHIADLDDFVRPIR
NYFYWEPHCYNIPVCHSMRSLFDLIDGTNLLTENTQELLPDLERMAAIMP
ELIALMPSQIESMKSQRDNMLTQYQTQNSQLEAGAEMSVDSGAMGDAFND
AWNADTFYLPPEAFENKDFQSGIEQFISPNGHAVRFIIAHEDDPLSPAGI
EKIDGLKTAAKEAIKGTPLEGARVYLGGTAATFKDMADGTRYDLLIAGIA
AIGLIFIIMLILTRAVIAAAVIVGTVVLSLGASFGLSVLVWQHFVGIELH
WMVLPMAVIILLAVGADYNLLVVSRLKEEIQAGVGTGLIRTMGGSGSVVT
AAGMVFALTMMTMAVSDLTIIGQVGTTIGMGLIFDTLVIRSFMTPSIAAL
LGRWFWWPQKIRTRPVPVPWGAGASGGGDGDGDGDGDDGGGGAPRARASA
Q
145225402YP_001136080.1 hypothetical protein Mflv_4824 [Mycobacterium gilvum PYR-GCK]MDDELLALFDAQRGVALSGQILSLVPRRRFEQWLNTVVLERIWQGVYCLG
EADDALRLAGLDLSSGRRVAVCLGTAAAIFGFDTEQPRDLHVLNPPGCAL
RDADGLVVHRRDGAPLVTVEGRRATSPAWTAIEVARSLRRPRALATLDAA
LRSGTCTRPDLWRAATEQKGRRGIVAVRNLLPLADARAESPGESAARLAM
LDADLPVPHLQYEFVDGNGDLRRLDFAWPEAGVAAEYDGVDWHSGPDAMQ
RDRRRYSALLAVGMVVIPIVAEDLRDGGWEMASRIRDQLRRARAA
145225401YP_001136079.1 hypothetical protein Mflv_4823 [Mycobacterium gilvum PYR-GCK]MPIYAAYGSNMDPDQMLERAPHSPMAGTGWLHGWRLTFGGADIAWEGALA
TIVEDPTSKVFVVLYDVTKEDEENLDRWEGSELGFHKKIRCRVHRTSSDT
TTDPVLAWLYVLDAWEGGIPSARYLGVMADAAEIAGAPPEYVHDLRTRPA
GNVGPGS
145225400YP_001136078.1 flavoprotein disulfide reductase [Mycobacterium gilvum PYR-GCK]MVTRIVIIGGGPAGYEAALVAAGLGRELTQVTVVDSDGLGGACVLYDCVP
SKTFIASTGVRTELRRAQGMGYDIGIDDAPISLPKINNRVKTLAASQSAD
ISSQLLNQRVTIIGGRGELVDDVAGMAHHRVKVTTHDGKVGVLKADVVLI
ATGASPRVLPNAVPDGERILTWRHVYDLEELPEHLIIVGSGVTGAEFCNA
YTELGVTVTVVASRDQILPHEDSDAAAALEQVFNERGVTLIKNARAESVT
RTDTGVRVTIADGRVVEGSHALMTVGSVPNTSGLGLERVGVELNPGGYIP
VDRVSRTPAPGVYAAGDCTGLLPLASVAAMQGRIAMYHALGEGVAPIRLR
TVASATFTRPEIAAVGIPQSAIDDGSVPARTLMLPLSTNARAKMSLLRHG
FVKIFCRPATGVVIGGVVVAPIASELILPIALAVQNRISVTDLAQTLSVY
PSLSGSIVEAARRLMAHDDLD
145225399YP_001136077.1 FAD dependent oxidoreductase [Mycobacterium gilvum PYR-GCK]MSDPIPAPGNGETFLGPDERARAWQRLGSEQFDVIVIGGGIVGAGAALDA
ATRGLKVALVEARDFASGTSSRSSKMFHGGLRYLEQLEFGLVREALHERE
LSLTTLAPHLVKPLPFLFPLTNRVWERPYIAAGIFLYDQLGGAKSVPPQK
HLTRAGALRLSPGLKRSSLIGGIRYYDTVVDDARHTMTVARTAAHYGAVV
RTSTQVVALLREGDRVTGVQVRDSEDGRVTDVRGHVVVNATGVWTDEIQA
LSKQRGRFRVRASKGVHIVVPRDRIVSEVAIILRTEKSVLFVIPWGTHWI
IGTTDTDWNLDLAHPAATKADIDYILGHVNKVLATPLTHDDIDGVYAGLR
PLLAGESEETSKLSREHAVAVPSPGLVAIAGGKYTTYRVMAEDAIDAAAE
FIPTRVAPSITEKVPLMGADGYFALINQTQSVGTYYDLHPYRVRHLLDRY
GSLIGEVLKLAEDNPDLLNPITEAPVYLKVEAAYAAAAEGALHLEDILAR
RMRISIEYPHRGVDCAREVAEVVAPILGWSPEDVDREVSTYLARVEAEVQ
SQTQPDDASADALRAAAPEARAEILEPVPLN
145225398YP_001136076.1 pseudouridine synthase [Mycobacterium gilvum PYR-GCK]MRRPPPLPVRDGLGPARVRVQGGLLVEEFQRRWGTGAKVVDGEVFCADGT
VADGSTVLPPGAYVYLYRDLPDEVPVPFDIPVLHRDDDIVVVDKPHFLAT
MPRGSHVAQTALVRLRRELDLPELSPAHRLDRLTAGVLLFTVRREVRGAY
QTLFVRGEAAKTYVAHSSHATDREFPMTIRNRLVKHRGSLQAVEEPGEPN
AETVVEYLDEGMYRLTPRTGRTHQLRVHMAGLGIPITGDPLYPDVVDVPP
GDFGSPLRLLAQALEFTDPISGELRRFTSGRTLAGE
145225397YP_001136075.1 hypothetical protein Mflv_4819 [Mycobacterium gilvum PYR-GCK]MRWLRILPAKAHCLLRPDAVQMSRGPASRALYSKSACRCAGTYWAVGPRA
VRVGCHNHHSCLRISGVALRGSVIVASAAMFVAGALGVAPAGHAAVCGSV
GGVHVDVSGCADPLYELNDALAPPPPPPPPPPPPPGAPPPPPPPPPPPPP
PVYIPPPLPNVNVCADVGRRINVSGCI
145225396YP_001136074.1 short-chain dehydrogenase/reductase SDR [Mycobacterium gilvum PYR-GMDRASFDRLFDMTDRTVVVTGGTRGIGLALAEGYALAGARVVVASRKADA
CEQAAHHLRELGAQAIGVPTHLGQVDDLGALVERTVAEFGGLDVLVNNAA
NPLAQPFGHMTVDALSKSFEVNLQGPVMLTQEALPHLKASDHAAVLNMVS
VGAFIFAPMLSIYASMKAAMMSFTRSMAAEFVHDGIRVNALAPGPVDTDM
MRKNPQEAIDGMVGGTLVGRLASADEMVGAALLLTSDAGSYITGQVIIAD
GGGTPR
145225395YP_001136073.1 enoyl-CoA hydratase/isomerase [Mycobacterium gilvum PYR-GCK]MSSVLEVARPTPEIAVLTLNRPDKLNALSYELVEALHAELDALARDNACR
AVVLTGAGRGFCSGLDLSAPNPEETGGGTEFPRSGMRWQERIADLTAKIH
RLRQPVIAAVQGVAYGGGLGIAAACDIRVAAPTARFCTQFIKLGLGGCDI
GVSYTLPRIVGAGVAFDMILTARTVAADEALRLGLVSRVSDTPVDEALAI
AETLCNYGKFGVESTKQVLWANLVASSLEAALHLENRSQILASTSGEMRE
LAAKILRKG
145225394YP_001136072.1 TetR family transcriptional regulator [Mycobacterium gilvum PYR-GCKMGSRQEISAACGRFHTVNSRTPSSRRGHSSRSRSKDGNSRETLSREERKE
ATRRAIVDAALHLLAERGFSALSLREVTREAGIVPAAFYRHFDSMEALGL
VLIDESFRSLREMLRGARAGKLDPNRVIESSVDILIDGVQQRREHWRFIG
RERSTGVTVLRYAIRTEIRLITSELAIDLARFPALNTWSSEDLNILASVF
VNSMIAIAEQLEDVTDTASVDEIRRTAVKQLRMITVGVAGWRSG
145225393YP_001136071.1 oxidoreductase FAD-binding subunit [Mycobacterium gilvum PYR-GCK]MFTEVLTKRSRRFALLDLLTGPHGVDRYTELVDPTWTRGNARAKVVGVRR
STPRSVTLTLAPNRAFDGFRAGQHINVSVEIDGRRRTRPYSPANAEGEAN
IELTIGRHDGGLVSTYLFDHARRGMVVGLDSVGGDFVLPARPAENILFVS
GGSGITPVMSMLRTLRARRHAGQVTFVHYARSADEACYRAELAVIAREMP
NVTVLHGYTRVATDSDLDGRFGAGQLPAGVTHADAVYACGPPALVDAVRE
LHPHAESESFVPPVFTADESGGGTVSFTTAGVDVVDDGRPLLNQAEDAGL
APESGCRMGICFSCTRRKTSGVVRNVVTGAVSSTEEEDVQICVSAAVGDV
DIDL
145225392YP_001136070.1 fatty acid desaturase [Mycobacterium gilvum PYR-GCK]MTPDQLDAFGKELDALKESVIADLGERDATYIRRMIKAQRGLEIGGRALL
FGGIFPPFWLAGTTMLGLSKIIDNMEIGHNVMHGQYDWMGDPAISSKGFE
WDTACPADQWRHSHNYMHHTYTNIVGLDRDIGYGILRMSSDQKWRPYYLG
NPVYAFLLMVLFQYGVALHEMESEKIAAGEITLTDKREILREIWAKTKRQ
TLKDYVAFPLLAGPFAPWVFAGNLTANLMRNVWSYMIIFCGHFPEDVQEF
SIEETKAETRGQWYFRQVLGSANLTGGKLFHILSGNLSFQIEHHLFPDIP
AFRHAEIAPKVREICERYGVPYNTGPLPRQFASVVRKIVKFALPF
145225391YP_001136069.1 hypothetical protein Mflv_4813 [Mycobacterium gilvum PYR-GCK]MGVAWAQPPVPSAGELTSELQQVLNTGTPTEVRAAKLAGGDAAVPTADNI
ANRLNTYGGMINWRVENPVLNGDQLDAQIAVTIPIWGTKTHNIYWVEQDG
AWKLSNPSACVIARDVAGVDCTV
145225390YP_001136068.1 hypothetical protein Mflv_4812 [Mycobacterium gilvum PYR-GCK]MGDIIIGTEAVANGTVTRHQLQRWYRPIFTNIHAPRGPAPTLGDRAVGAW
LYSKRHGIVTGLAAAALHGSRWIDADVDIELIYKCPRPPSGIVARNDRID
PDEWQSIDGLPVATAARTAFDLGRYRPEHDALARLDALMAVRPYSVEDVL
LLTKRYKGARGVARLKALLPFVDGGAQSPRESWWRKLVLDSGFPPPRTQI
PVVDENGYHVRTLDFGWEGPNVAVEYDGDQHQSDRAQYLKDRRVMPALRR
LGWHVTTVVKEDDPVAVIQTLSAAMRARGWRGSIQIPRYAYTTRFRAEIA
SRQEKCE
145225389YP_001136067.1 formamidopyrimidine-DNA glycosylase [Mycobacterium gilvum PYR-GCK]MPEGDTVYRTAAKLRDALEGRELTRCDIRVPRYAAVDLSGQVVDEVLSRG
KHLFIRVGQASIHSHLKMDGAWVIGRVRVPTYKIRIVLETANSRASGVDL
GVLEVLDRATDMEAVEHLGPDLLGEDWSAEVAAANLVADPERPLAETLLD
QRVMAGVGNVFANELSFVFGLRPGTPVGELTDPLRVANRAQQMLWLNRLR
VNRTTTGNTRPGQDVWVYGRAGLPCRRCGTPIETDKNTERVTYWCPTCQR
145225388YP_001136066.1 DEAD/DEAH box helicase [Mycobacterium gilvum PYR-GCK]MPAKTDPLSRFSTLTREWFAGTFVEPTPAQAQAWNAISAGENTLVIAPTG
SGKTLAAFLWAIDGLAREPRAERGTRVLYVSPLKALAVDVERNLRTPLTG
ISRIAERNGEEPPAISVGVRSGDTTPSKRRELITKPPDILITTPESLFLM
LTSAARESLSDIETVIVDEVHAVAATKRGAHLAVSLERLDAMLPKPAQRI
GLSATVRPPEEVARFLSGASPTTIVAPPAAKTFDLTVQVPVPDMAAPNTG
SIWPDVEERIVDLIEAHNSSIVFTNSRRLAERLTARINEIHAERTGIELG
AHNPGVAGGAPAHLMGSGQTYGAEPVLARAHHGSVSKEARADVEDALKSG
RLKAVVATSSLELGIDMGAVDLVIQVETPPSVASGLQRVGRAGHQVGEIS
QGVLFPKHRTDLIGCAVSVQRMLAGQIETMRVPANPLDVLAQHTVAASAL
EPINADAWFDTVRRSAPFATLPRSAFEATLDLLSGKYPSTEFAELRPRIV
YDRDNGMLTSRPGAQRLAVTSGGAIPDRGMFTVFLASSAESEKPSRVGEL
DEEMVYESRPGDVISLGATSWRITEITHDRVLVIPAPGEPARLPFWRGDG
VGRPVELGAAIGAFNGELARLDRPAFESRCRDVGFDDFATDNLWQLISEQ
REATSSVPSDTTLVVERFRDELGDWRVILHSPYGLRVHGPLALAVGKRLY
ERFGIDEKPTASDDGIIVRLPDTDDTAPGADIFVFDADEIEPLVTTEVSS
SALFASRFRECAARALLLPRRHPGKRSPLWHQRQRAAQLLDVARNYPDFP
IVLEAVRECLQDVYDVPALTALMDRIAQRRVRILEVETPTPSPFAASLLF
GYVGAFMYEGDSPLAERRAAALALDPTLLAELLGRVELRELLDPDVIATT
TRQLQHLTPERAARDAEGVADLLRLLGPLTVDEIAERCVQPDIGGWLEGL
LTSKRVVTLSFAGQTWWAAIEDIGRLRDGVGVAVPVGVPIAFLEPIVDPL
SELLSRYARTRGPFTTMEAATRFGLGVRVAADVLGRLTADGKLVRGEFTD
LPTESGVEQWCDAEVLRILRRRSLAALRAQIEPVSTGAFGRFLPAWQMVG
ADSASGVDGLASVIDQLAGVPVPASAVEPLILGQRVRDYQPGMLDELLAS
GEVLWSGAGSLSAADGWVSFHPADTAPLSLAPPGDLDLTDVHHQILAALA
GGGAYFFRQLSLDGVSSESLKEALWQLIWAGYVGGDTFAPVRALLAGTKG
PGSRRTAAPSHRHRRPPRLSRYSLSTSSLSAHRDSDPTVAGRWSALPTAE
VDTTVRAHYQADQLLARHGVLTKGAVASENFRGNIPGGFASMYKVLTTME
DAGRCQRGYFVESLGGAQFATASTVDRLRSHADSIDDQQQKLRAVTLAAT
DPANPYGAALPWPSRGTDGDTAHRPGRKAGALVVLIDGELTWFVERGGRS
LLSFTDDAETANAAAAALAELVTRHRVPALLVERIDGVPVLESRESVMVE
ALILAGFSRTPRGLRLR
145225387YP_001136065.1 regulatory protein LuxR [Mycobacterium gilvum PYR-GCK]MGRPRIADRVVPRPDLLKRLESSAGGDLVVLTAPAGYGKTTVTAMWDAED
RRQFAWARIDHLDDDPGHLLLHIATAVVRLGAGDDHLLNYLRGPGREPEH
LLPAVVRLLEEFGPIVVILDDVHKLSTPQSISALHAFVDAAPLTTTVALL
GRFLLPLDIARRRLAGNLVEVDQDALRLTAEETVAALESVRGPSDDATVA
TVIDLCEGWAAGVILTAMALRDGTAPEALAGRNNLVVEYVVEEVIDRVDD
DTRSFLLESAMLDRFTAEHLDAVLGRVDAAWMLEQLATSGNPFLISLDSQ
GDSFRYHHLFGDVLRARLRASEPARFRELASRAADLLEREGDIDGALVHA
LEAGDRARAAALVGREAVRLGFDGRAGVLARRLGMLDARTFAEQPDAAVA
RAWLGVTTADAELIQRSLMLALHSDHGGPLADGTPSVSVAVALISSLVGV
GGVAEVIRHADTVRAAGDNLVNPWWGAATVMKGAAEAMRGQGGRARLLLE
SALPVIEDLPGFHAAALAHLALLDLAAGDDEAAVERCDAARTLADKYDLS
DVVPMIVVYSTSAVMSARVGDVPAALHAVQITQTLLERLGNLSARTALLG
HGLLAWTAAALQDRALLSRHLTAAERVRHREPDAVALVQRVERVKAMAVG
GTRPLTAAELRLLPHLATHLSLQRIAEELVIGRETAKSQATSIYRKLGVS
SRGQAVSEAIRIGLLAD
145225386YP_001136064.1 hypothetical protein Mflv_4808 [Mycobacterium gilvum PYR-GCK]MSPRPARTYNQNHVARPHNGRRRISIYWTWSYPWEAQRDTASMSNRFSTL
TEVRNVVYPTYETPEFEADNFLQGIAGTLELFHRSTLTFQDLVGELTGHP
VAVFQRVDQAGYRQPIDDRILTDTDTLMVFGLDHLDSGLDADRDEVDAIR
EWLRREDTCLLLAPHHDVGFTDDLAQRQVEFEHHGDRLVPRQQRFSRYTR
SLMRALGVPVHNIWGLRPALQPGTRDPLPLNRFQDYDEIGLLDSVSTLSF
HQHLPHYELTAPEGATLRVLARQAVDLTRPHPFTAAGDSEFTAVIWMPPD
GDRAGDILLIDSTHFTTLFGGTESLQNLWRNLTRMGCDR
145225385YP_001136063.1 Dyp-type peroxidase family protein [Mycobacterium gilvum PYR-GCK]MTLDLDDIQHILLTRTPAITGRYEFLTFDRADGGRAWLTELLDRVQSASD
AVATMDASQRWITLAFTWTGLRALGVPDDALATFPDEFREGMAARADILG
DTGPNAPQNWVDGLAGDDVHAIAILFARDDDEHRRCVGEHDKLVARCDGV
RTVSYLDLNASPPFNYAHDHFGFRDRLSQPVIKGSGEEPTPGSGAPLEPG
EFILGYPDEFTATPEIPQPDELARNGSYMAYRRLQEHIGAFRSYLADHAG
TPDEQELLAAKFMGRWRSGAPLVLSPDVDDPELGADPLRNNNFNYKEMDP
FGYACPLGSHARRLNPRDTAHNMNRRRMIRRGATYGPALPDGAPEDGTDR
GIAAFIICASLVRQFEFAQNVWINDTTFHELGNEHDPICGTQDGTLDFTV
PKRPIRTVHKGIPAFTTLRGGAYFFLPGIKALRYLAGGLR
145225384YP_001136062.1 hypothetical protein Mflv_4806 [Mycobacterium gilvum PYR-GCK]MADHTWTTPAAVAIPREGYFELERGRYGPLFPRTPACHGFSIIAKVKEGR
EEAVRAYGKQIEEAVAASPDVLEPLRLHYLRWILFDVGSGLHFQYQGIFD
TDFDKYTEDAVRLFSATGITTVFTNLEGFPEDWQTNPDAFITFVREHQVP
SFLEYGEYPYVTALEIKKALRLKAAFSEMLDQMQ
145225383YP_001136061.1 hypothetical protein Mflv_4805 [Mycobacterium gilvum PYR-GCK]MHMIAVVMTPVVSLATVVAVAAPAAADCTTAGATTICSQGDVRGTNSGTG
PVGSSGPYVPYPCDWNYYNCNEWWDVDFDVDLDPGRPGIGGPGGPGGPGI
GAPGGPGRPGGGFGGGGGRGGGGRR
145225382YP_001136060.1 hypothetical protein Mflv_4804 [Mycobacterium gilvum PYR-GCK]MSLRRLARAGAVLGCIGVLAAAPAVAQPPPNCTSADLTGTMTGVMAATTA
YLYTHPQVNEFFSSLQGRSPEERRAALEEFLTANPQVQAELQGIRQPMKD
FRNRCG
145225381YP_001136059.1 hypothetical protein Mflv_4803 [Mycobacterium gilvum PYR-GCK]MLSLSMRRMLAAALGTGAALIAVAVPAQAQPAPPNCTAADLAGVATGVSA
ATSAYLFTRPAVNEFFTSLFAMDAEQRKAAVTAYMDANPQVASELRGIRQ
PLADLRHRCGFRHHPHHE
145225380YP_001136058.1 TetR family transcriptional regulator [Mycobacterium gilvum PYR-GCKMAEARRRLSPDDRRNELLALGAEVFGQRPYDEVRIDEIAERAGVSRALMY
HYFPDKRAFFAAVVRAESERLFDATNTPAQPGQTLFTQVRAGVLAYLRYD
ELHPHGAWAAYMGMSRSDPVLRGIDDHDNDRQANRIIDRVTAGVEPLDAK
VERDLRAAVYGWLAFTFEMCRQRLMDASLDADYLGDLCAHALMDALARVP
GIPADLAEAVAPDRR
145225379YP_001136057.1 cytochrome P450 [Mycobacterium gilvum PYR-GCK]MVDHRQPFPPLPHPPRRVPVVGDVFGFSADILTRPPSDPGLGPVFEFRFL
GARYVVAASADAVAEVNDERRFCKHVGPDIDALRIMGGDGLFTAYNEEPN
WQRAHDLLMPAFSQQAMRGYHSAMLDAADGLVARWDGKARTGASVDVPAD
ATRVTLETIGQCAAGHPFGCFDTEDPHPFVEHMVAGLKGSDWVGVLRETV
LPNFFARRAERRVRRHAVQMHRIADEIVSERLRDGLGHHDDLLELMLTSD
LDPANIRYQLINFLVAGHETTSGALSFALYFLSRHPEVADRARAEVAEVW
GDDERPGFELIAKLRYVRRVLDEALRLQPTVPGYYREAREDTVLAGVHPM
RQGDWVLAMTMALHRDPRWGGDPDAFDPDRFAPDRVRARPAGLYKPFGTG
PRSCIGRQFALHEAVLLLAVLLRRYDLVPEPGYQLQVAQRLTLMPKDFRL
TLRRRRSE
145225378YP_001136056.1 short-chain dehydrogenase/reductase SDR [Mycobacterium gilvum PYR-GMELAGRTAIVTGAASGIGAALATELARRGVSVVIGDLDDDGAHATASAIR
ADGGAAAALRADATSVADIEALITLASREFTPVDIYVANAGVIGKPGLGT
ESDWDVILDVNLRAHVRAARLLVPHWQSVGSGYFVSVASAAGLLTQLGAA
GYAVSKHAAVGFAEWLAVTYGDDGIGVSCVCPLGVKTPLLQGIRGIDDPD
ARLGASSIEQSAGVISAADVATVTVEAIREERFLVLPHAELLEMYRRKGG
DYDRWISGMRRYQRTLRSL
145225377YP_001136055.1 aldehyde dehydrogenase [Mycobacterium gilvum PYR-GCK]MSTAVTALPTAEKLRTRVRDALAAVGARIALGVPTAHGLPASTPITGDVL
FTVPASSAADVDAAVGEAADAFSTWRTTPAPVRGTLVARLGQLLVEHKSA
LASLVTIEAGKITSEALGEVQEMIDICEFAVGLSRQLYGRTIASERPGHR
LMENWHPLGVVGVITAFNFPVAVWAWNTAVALVCGNTVVWKPSELTPLTA
VACQALLERACADVGAPPAVGRLVLGEREVGEKLVDDPRVSLVSATGSVR
MGREVGPRVAARFGRVLLELGGNNAAVVTPAADLDLAVRGIVFSAAGTAG
QRCTTLRRLIVHSSIADELVSRIVKANEQLPVGDPFRGGTLVGPLIHTRA
YRDMVGALQQAQAEGGEVIGGERVDVGDEGAFYVTPAVVRMPEQSAVVHQ
ETFAPILYVLTYDTLDEAIALNNAVPQGLSSSIFTLDMREAERFLAADGS
DCGIANVNIGTSGAEIGGAFGGEKETGGGRESGSDSWKAYMRRATNTVNY
SSDLPLAQGVEFG
145225376YP_001136054.1 hypothetical protein Mflv_4798 [Mycobacterium gilvum PYR-GCK]MAEFVESCELRAQFAAGLSRMYGAEVPAYHTLVEVSSLVNTASPGALRLG
SLERVTAERHGAIRVGSAAELAQVADLFSAFGMYPVGYYDLREAASPIPV
VSTAFRPIGQDELARNPFRVFTSMLTVADGRFFSADLRTRVQRFLDSRQL
FDPALIASAQRIAAAGGCPAGDAPGFVTAAVSAFALSREPIDRAWYDELS
AVSAVAADIAGVTSTHINHLTPRVLDIDALQQAMTERGITMIDRIQGPPR
VDGPQVLLRQTSFRALAEPRRFRSPSGEVTDGTLRVRFGEVEQRGVALTR
AGRERYDAAMSAPDPAAVWHRHFPATDAEMAASGLAYYVDGDPSRPVVYE
DFLPASAAGIFRSNLDTASAAVQGGDTTEYCQDWMAGRIGHHIHDPYDLY
EKVAHS
145225375YP_001136053.1 AsnC family transcriptional regulator [Mycobacterium gilvum PYR-GCKMTVPDDPQPPAPLDEIDRVLARELVADGRATLAHLAATAGLSVSAVQSRV
RRLESRGIVTGYTARIDPEALGSKLSAFVAITPLDPSQPDDAPARLEHIP
EIEACYSVAGEDNYMLIVHVESARALEGLLQKIRTAADVKTRSTIILHKF
YSERRYVPE
145225374YP_001136052.1 L-lysine aminotransferase [Mycobacterium gilvum PYR-GCK]MTAVLSRADRTAVIVPADVRTVLSRSILADGLDLVLDLERSHGSYLVDAR
TGRGYLDMFTFFASSALGMNHPALADDPDFRAELAAAAVNKPSNSDVYSV
PMARFVDTFSRVLGDPALPHLFFVDGGALAVENALKVAFDWKSRLNEAQG
RSPDLGTKVLHLRGAFHGRSGYTMSLTNTDPNKVARFPKFDWPRIDAPSV
RSGANIEALEAESLRQARAAFEAHPHDIACFIAEPIQGEGGDRHLRPEFF
AAMRELCDEFDALLIFDEVQTGCGITGTAWAYQQLGVLPDVVAFGKKTQV
CGVMAGTRVDEVPDNVFRTSSRINSTWGGNLVDMVRARRILEVIERDGLF
DNAAQRGRHLRDGLAGLAVEFPGLVRDVRGRGLMCAFSMPSARQRDELLA
RLWECGVIMLGCGTDSVRFRPALTVNDDEIDAALTAVAAVLRTMAVPQAG
145225373YP_001136051.1 restriction endonuclease [Mycobacterium gilvum PYR-GCK]MTTLRWRLYAALAIAAGATAHLSGAGWLWTVLAGLLAPVLVVAAPSFVRS
VVAGAATPGPRENPVDADMSGTEFEDYVARIARTCGVPVIMTSMTGDWGV
DLIVGHRPHRLAVQCKRLSRPVGAGAVQEVVAGAPMQDCTQTMVVTNHEF
TPAARKLAELHGCTLVGGADLPRLRSTIRRLTRPAEPPSSSAPRPPP
145225372YP_001136050.1 hypothetical protein Mflv_4794 [Mycobacterium gilvum PYR-GCK]MADLSRNTELRRSTGVGDPGVRDAIRTGVGISVAALVFLFVADMWNGTCT
GSLAQAIGCAPSQQAALTLGAPAILLAGGIWSMARGFRVRAGHSAMAWQV
AGWTLFTLAVACAVLSLPSLPGR
145225371YP_001136049.1 hypothetical protein Mflv_4793 [Mycobacterium gilvum PYR-GCK]MRGPSDPVDHVRTTRPHAGESMKDNKIMPGLVVIGLSLVSFVAMLSAFAT
SHHDVGVMLGAIAAAGFVLGGGWLFIEHQRVRRLEERWYAEHPGAWRQRP
NS
145225370YP_001136048.1 hypothetical protein Mflv_4792 [Mycobacterium gilvum PYR-GCK]MRRPFVGSEALASGALTRSALRWNYRRIFPDVYLPVDVRPTLYDLTVAAW
LWSGRRGVIAGAAASALHGSRWVVPTVPIEMIWQNGRPPPGIVVRNERID
GDETCVRGGMLVTTPERTAFDLARHLRRDQAVARLDALANATEVKAVDVL
ALAERHPAARGIRRAVAALSLMDGGAQSPRETWLRLLLVDEWLDPLRTQV
EVGDGRTTVHLDLGYDEPRIGLEYEGSHHSEDRRTYVHDIGRTEFIERHG
WVAIKVVKEHSPEFIRFRVREAFARRGVTPRLRSGSRNRQRPRP
145225369YP_001136047.1 hypothetical protein Mflv_4791 [Mycobacterium gilvum PYR-GCK]MTEKNSGPQEGIKGVVEDVKGKAKETIGTVAGRDDMVQEGKAQQDKADAQ
REVAEKEAEAESARAGAKAAEKRQEANQ
145225368YP_001136046.1 putative anti-sigma regulatory factor [Mycobacterium gilvum PYR-GCKMDSGDKAWGNLASKFPGGQMADVASHSNGQRLSPQSVELRVAAALENLAV
LRTLVAAIGTFEDLDFDAVADLRLAVDEACTRLIRSALPDSTLLVVVDPQ
PDALVVHASTTCDSTDILAPGSFSWHVLSSLTDEVTTFSDGQAADDGEVF
GISMTTRRASSLQ
145225367YP_001136045.1 RNA polymerase sigma factor SigF [Mycobacterium gilvum PYR-GCK]MTRSSSQGSSRSNSEYSDVADMFRELAELEEGSAAFQRQRDRIVERCLPL
ADHIARRFDGRGEPRDDLVQVARVGLVNAVIRFDVTAGSDFVSFAVPTIM
GEVRRHFRDNSWSVKVPRRLKELHLRLGAATAELSQRLGRAPTPSELAAE
LEMDRDEVVEGLVAGSSYNTLSIDSGGGSGNEDAPAIADTLGDVDLTLDQ
IENREALRPLLAALPERERTVLVLRFFESMTQTQIAERVGISQMHVSRLL
AKSLTRLRDQLE
145225366YP_001136044.1 anti-sigma-factor antagonist [Mycobacterium gilvum PYR-GCK]MPHVPGPPTPPVPDSLICHTARFDTTWTDPATAIVAGKGEVDAANGIRFV
DYALRHADQTQWLVIDLSGLSFFSTAGFSALHTLNVQCVGEDIRWALVPG
TAVHRVLRICDPDSALPICPDVPSALVAVQEDPPRSFELITKTR
145225365YP_001136043.1 hypothetical protein Mflv_4787 [Mycobacterium gilvum PYR-GCK]MTGVVLAAGAGTRFGMPKVLADGGEWLRRSVAAVSDGGCDDVVVVLGAAV
VDVPAPARAVVADDWRDGLSASVRAGVRAASGADFVVLTTVDTPDVGAAA
VRRVLTAARESASGLVRARYGGRPGHPVVIARRHLPQLLDSLSGDDGAGP
FLKARADVVAVECGDLSSGRDIDTR
145225364YP_001136042.1 hypothetical protein Mflv_4786 [Mycobacterium gilvum PYR-GCK]MTRFSRFLATPLLSAAIFGATLGMAGTATAMGVNESNMAPDTHSRTYYQL
LTESRYGF
145225363YP_001136041.1 hypothetical protein Mflv_4785 [Mycobacterium gilvum PYR-GCK]MEPVEINAGAWYLRALRADDRVDDRPALADLGEHDAGYVNRRAAHWDSGT
LYSWAVCEPTTGELLAEVTLDPATGAIATRSRPGHERAAGTGADAVGRFA
AAMLG
145225362YP_001136040.1 carbamoyl-phosphate synthase subunit L [Mycobacterium gilvum PYR-GCMASHASSKISKVLVANRGEIAVRVIRAAKDAGLQSVAVYAEPDADAPHVR
LADEAFALGGQTSAESYLVFEKLLDAAAKSGANAIHPGYGFLSENADFAQ
AVLDAGLIWIGPSPQSIRDLGDKVTARHIAARANAPLVPGTPDPVKDADE
VVAFAKEYGVPVAIKAAFGGGGRGMKVARTIEEIPELFDSATREAVAAFG
RGECFVERYLDKPRHVEAQVIADTHGNVVVAGTRDCSLQRRFQKLVEEAP
APFLTDAQRKEIHESAKRICKEAGYYGAGTVEYLVGQDGLISFLEVNTRL
QVEHPVTEETSGIDLVLQQFKIANGEALDITEDPTPRGHAFEFRINGEDA
GRGFLPAPGPVTKFEPPTGPGVRMDSGVESGSVIGGQFDSMLAKLIVVGA
TREEALARSRRALAEFNVEGLATVIPFHRAVTADPAFIGDGETFTVHTRW
IETEWDNTVEPFTGGDPIDEEDTIPRQTVVVEVGGRRLEVSLPGDLAVGG
GAPAHGAIRKKPKPRKRGGGGGAAASGDAVTAPMQGTVVKVAVEEGQTVA
AGDLVVVLEAMKMENPVTAHKDGVVTGLSVEPGAAITQGTVIAELKDAE
145225361YP_001136039.1 diguanylate cyclase [Mycobacterium gilvum PYR-GCK]MPRQLSVVAGLRHWWRQADHYDWFADYLSARGLVGLARVITAVTAAGLAL
VGATVMFCPGGPTGTLDVTLGWAAVALAFGCAIVRWSIWPSKRQSVVLIL
ALNLAIALFCQVQTDQLIGVVGATAFATTGISIACLHSAKYMLYNVVVAA
YIGGLQAVRAMDETDGHLILAALGLVLIINISVPFSVQSLVHALGGDVVQ
SDRDPLTGLCHRRALFRQLNALLLSHREHADFLAVTMIDLDKFKVLNDTY
GHSAGDDALVAVGEALLTAANGRALVGRVGGEEFMVAELCETARDTGLSE
RLRAAIAALPHHITGSVGTAVASINDVPTDDFQDLVVTLFRRSDRAMYEA
KRAGGNQIRHTVIDLPAIPVSGADNLPAGNRPARRTSD
145225360YP_001136038.1 hypothetical protein Mflv_4782 [Mycobacterium gilvum PYR-GCK]MSKTTEGWVRVRKVAAWSAVIAAPTALLVFTAGTASADRIAPDRTVNSGQ
GTVSKDATFGDVRGADDYLHAQGEVRDSMIAVPGRIDGTRARGFRPSWSG
GPGMGTW
145225359YP_001136037.1 Fe-S metabolism associated SufE [Mycobacterium gilvum PYR-GCK]MSMPAALAEVVSDFKDVDGQDKLALLLEFADELPPLPAELEEAAMEPVPE
CQSPLFLHVDADDRDHVRLFFSAPAEAPTTRGFAAILATGLDGQSAADIL
AVPDDFYTDLGLAKLISPLRLRGMSAMLTRIKKRLT
145225358YP_001136036.1 rhodanese domain-containing protein [Mycobacterium gilvum PYR-GCK]MPLPADPSPALQSYAHPERLVTADWLSGNLGRPGLAIVESDEDVLLYDTG
HIPGAVKIDWHTDLNDPNVRDYITGEQFADLMNRKGISRDDTVVIYGDKS
NWWAAYALWVFTLFGHPDVRLLDGGRSLWISDGRDTTLDVPTKQTTGYPV
VERNDAPIRAFKEDVLAVLGTEPLIDVRSPQEYTGERTHMPDYPEEGALR
GGHIPTAVSIPWAKAALDNGKFRSRAELDELYGFLSEHDNPETVVYCRIG
ERSSHTWFVLTHLLGMPGVRNYDGSWTEWGNAVRVPVAVGSEPGDAPGEA
PATAR
145225357YP_001136035.1 acyltransferase 3 [Mycobacterium gilvum PYR-GCK]MVTRVDQWREASARRRRRAERANHRLDVQGLRAVAVLGVFAHFLTGWPRG
GFVGIDIFFVIAGFFVTESLLRTAADTGSPSLRTFYVGRVRRILPAATAV
LILTVAATALVMPDDLRDVGVDALFAFFFVANWHFAASGVDAASAAESAS
PLLHYWPLAVEEQFFIVWPVLILGITAIAVRKAWTDERWRAHLAVAVGVV
VIASLAWAAVQTASSPSWAYFDTFARVWELGVGALLALAVGTLSRIPDPI
RPILSWTGLTLIGAAFVLVDGGSGFPVPWALLPVAGAALVIAAGVGREPE
LQGFLRNRVSTYLGDISFALYLVHWPVIVLLAAVMDRSVFYYASVVTLAF
GLALAVHHFVENPARDATVQGLRQAREDRRHGLHHTELSTKIAGVAALIL
ITFSVISYAMSPEAIDDPAPIAPTAPSP
145225356YP_001136034.1 hypothetical protein Mflv_4778 [Mycobacterium gilvum PYR-GCK]MQTKLVSATAAACALLGGALGAAGPAWAHADDALIQYKEPDAMWVMPDLK
GKVLFAAKQEVEADVENMPLTFNVVAPNHAPVYNLENWVVCGESPRAGAA
LSQKTKKITLLVERPGAEHCGA
145225355YP_001136033.1 hypothetical protein Mflv_4777 [Mycobacterium gilvum PYR-GCK]MERKGFKKIAAGTASFGMLLTGVLVAAPTAGAQTSTWTMPALRGEVLERA
VNSVEGAAGSAPIRFNIYDSVNNQVVYNYTNWVVCGQSPRAEATVKVGAK
PQTVTFALKRRQAGC
145225354YP_001136032.1 Maf-like protein [Mycobacterium gilvum PYR-GCK]MTRFVLGSASQGRLGVLRQAGIDPEVVVSDVDEDALLASLDPELPPEAVV
AKLANAKALSVAAALPQELLADCVVLGCDSMLYLDGRLSGKPGTPEAARR
QWEQMAGTTGHLLTGHALLRLRDGVITHTEGDTGSTAVHFGRPSEAELTR
YVDSGEPIHVAGAFTLDGLGGWFIDGIDGDPSNVIGVSLPLVQRLISRTG
LSISEFWTR
145225353YP_001136031.1 hypothetical protein Mflv_4775 [Mycobacterium gilvum PYR-GCK]MNHDADIVEVSDPRDMTIDDPPAPDPHFQVVKGDPSPEEIAALVTVLASA
GGGAAADPGPQELNLWGHPVDKLRYDTTSWQRTTLWERMHMRK
145225352YP_001136030.1 carboxyl transferase [Mycobacterium gilvum PYR-GCK]MTEPEASHEIDIHTTAGKLADLRKRAEEALHPVGEAAVEKVHAKGKLTAR
ERILALLDEGSFVELDALAKHRSKNFGLEKNRPTGDGVVTGYGTIDGRDV
CIFSQDATVFGGSLGEVYGEKIVKVQELAIKTGRPLIGINDGAGARIQEG
VVSLGLYSKIFHNNIKASGVIPQISLIMGAAAGGHVYSPALTDFVIMVDQ
TSQMFITGPDVIKTVTGEDVTMEELGGAHTHMAKSGTVHYVASGEQDALD
YVRDLLSYLPPNNYAEPPRYPAPISGPIEENLTDEDLELDTLIPDSPNQP
YDMHEVITRILDDDEFLEVQAGYAGNIVVGFGRVDGRPVGIVANQPTQFA
GCLDINASEKAARFIRTCDCYNIPIVLLVDVPGFLPGTDQEYNGIIRRGA
KLLYAYGEATVAKVTVITRKSYGGAYCVMGSKDMGADVVVAWPTAQIAVM
GASGAVGFVYRGQLKEAAANGEDVDALRLKLQQEYEDTLVNPYIAAERGY
VDAVIPPSHTRGYVATALKLLERKVVQTPPKKHGNIPL
145225351YP_001136029.1 hypothetical protein Mflv_4773 [Mycobacterium gilvum PYR-GCK]MNAIATKFKVTAAAAAIAASAAVAPVAANAAPAVELPAAPAIGHLAEQPA
GLFGVFVVQFTGAVTRTSTYWTRITITNYESLLEARPDSIFAPFYQARID
RLNAQLARYGEVEMTSCVGGRSTSIVAGSYGGVTTGTC
145225350YP_001136028.1 hypothetical protein Mflv_4772 [Mycobacterium gilvum PYR-GCK]MGSRGFVLGTAVVLLVILGLGVWVAVGAFKAKSNLEAARGHAQAAKEALL
DGNTEAASQSADEALVSARDARDATHSVAWNVVSSIPWLGSPFKTGQQVT
EVVLGLASDVLRPAADVGLTIAPDRLYRDGRVDVELLRSQETELSGLAAN
AKRLNDDASAITDPRYVSLLSNARSQLQSQISSVTSIIENTALAARLAPS
MMGVDGPRTYFMGFQTNAEARGTGGLLGGYGILRFDNGVPSVDTLAPNTT
LDDAVAPVDFGFEYDQQYGFNQPFFDYRNSNISPHFPYAAQIWQGMWQEQ
TGQKVDGVIAIDPVALSYILGAVGPITMPDGEVVAKDNVVELTESTAYIR
FPTDQVARKQYLQDIANAVVTKMTGSVKSPRQLLDALGKGVSERRIAVWS
ADSEDQRLLEETPLAHVLPDDPAPYAGVVINNLGGNKLDYYLKTHIEYAA
DKCHGDTRASTVTVKLTNAVPSEPLPEYVAGAAGLSPELGIEVPAGTNVT
SVRLFATKGSELSSAILNGERVPAIMYTERGHPVFEVQVIITPGQTADVM
FQLSEPTAAGTPRIPMQPLVNTVVPKVEVPECAG
145225349YP_001136027.1 lipopolysaccharide biosynthesis [Mycobacterium gilvum PYR-GCK]MNLQDFVKLLRSRWMTVCVTMVFAVMGAIAYTLLITPQYQASTRLFVSTS
SSSSVSEIYQGNRFSQERVVSYAELLMGETLAQRTIDKLGLDMSASSLRE
NISASAKPDTVLIDVAVRDPSPVRARDIANTLSDEFVAMVRELETPDGGA
TPDARVVVEQRATIPEHPVVPNTTRNIAMGLALGVLLGVAIAVVRDLLDN
TVKDRETLEGITGAGIVGSVPLDKERRKQAAVAFDRDNSGIAEAFRKLRT
NLQFLAVDNPPRVIVVTSSMPSEGKSTTAINIALALAEGEHSVVLVDGDM
RRPSLHKYLGLVGPVGFSTVLSGGTSLSEALQKTRFPGLTVLTSGAVPPN
PSELLGSQSARKLLSELRAEFDYVIVDSTPLLAVTDAAILGAGADGVLVM
ARFGQTKRDQLAHAVGSLVDVGAPLLGAVFTMVPTRGSSSYSYSYSYYGS
ESAPQQARQDVPVAPTKPAALDAAPSQTGAEPPDPDSSLPRADATPGASR
RRRRQVSE
145225348YP_001136026.1 glycosyl transferase family protein [Mycobacterium gilvum PYR-GCK]MSEVIQPRRVSAVIRAYNEGKHIGRLLKGLEQQTVRVDEIILVDSGSTDD
TVAIAEAAGCKIVAIAKSEFSFGRALNRGCAAASGDILLFASAHVYPVYD
TYVEHIVNAFDRQGVAIAYGRQVGDERTKFSESRVMLKWFPTENIWDQGH
PFSNNANAAVLRSVWEESPYDEGLTGLEDLDFAQKALAAGHKIAYVADAP
VVHVHEESWEITRNRYRREAIAYAHIVEGSEMSLSRAVGLALSNIVGDYI
DAAKAKRIRGNLLSIPLFRSAQFLGAWEGFRAPANVSARLLERFYYPADS
QSYDLPPAPGRRILYSDDMSISHQ
145225347YP_001136025.1 acylneuraminate cytidylyltransferase [Mycobacterium gilvum PYR-GCK]MSRTVAIVPMRHNSERVPGKNYRPLAGIPLYHHVIRTLTLVSEIDLIVID
TDSELIIEDCAQSFPQVRVLVRPENLRDGGIAMNDVLLNTLDQVDADIVL
QTHSTNPFLKPETVSAALQLFHQPDREFDSLFSVTRLQARLWDEHNRPVN
HDPSVLLRTQDLAPLFVENSCFFIFTPELLRERGNRIGVQPLMVEMAPLE
AIDIDVEEDFALAEAIAGRNGTNT
145225346YP_001136024.1 D-isomer specific 2-hydroxyacid dehydrogenase [Mycobacterium gilvumMQVELPRHRKRIEDLGFEVLAPELGGRQQFSSSELLEYSSRLIGIIAGDD
ELDADFFAGAGKLKTVIRWGIGMDSVDHEAARRHGVTVRNTPGVFGYEVA
DSAFGYILNLARGYMAVDAAVRRGEWPKVEGITLDGSRLGIVGFGAIGRE
IAKRGAGFGQEVVAFDPFVKASPAGVSMVELDELLATSRFVVLACPLTPE
TFHLIDADRLAGMRSDSFLVNVARGPVVLEAALIDALKAGRLAGAALDVF
EVEPLPLDSELRTLPNVVLGAHNGSNTREGVVRASNAAVEFLIEELAR
145225345YP_001136023.1 short-chain dehydrogenase/reductase SDR [Mycobacterium gilvum PYR-GMTKAVIVTGAAGGIGAALCERVRKDGYLAVGIDRSPAPAADADIRLDLSE
SEQLVDVGRELGEKYELKAVVHNAAAQPIAGAGDTPLADWVEALRVNVIA
VDALMSGTRVNLAANDGSVIVISSAHARATTGGVTAYATTKAALEGWVRS
AALDLGPGVRVNAVAPGAIDTAKLREGFARWGEESAEARKAILRQRTALR
RIGEPSDVAGAVSFLIGDDARFITGTVLVVDGGATARLGSE
145225344YP_001136022.1 hypothetical protein Mflv_4766 [Mycobacterium gilvum PYR-GCK]MSDAAKQQIIAQEQGRTLGWKRRAATALLGENAARTVAARLTDLRAVRES
SLTAAGRANRSNIKQFKNSHAGERCVIIGNGPSLKKTDLSLLSGEITFGL
NRIYLMFDELGFETTFHVVVNQLVVEQCADDFRRIQAPLFTTTPSRAFLD
GAENVAYLNKLAGPRFSRDASHGIWEGATVTYVAMQLAYYMGFSEVVLIG
VDHRFAVTGPAHQVVESAGPDASHFDPNYFGKGFKWQLPDLETSELAYHL
ARKNFESNGRKIVDATVDGALTVFPKVRLEEALGP
145225343YP_001136021.1 glycosyl transferase family protein [Mycobacterium gilvum PYR-GCK]MNGPQPVRLSIVTVCWNDLENVQRTMSSLNRQTERHGWEHVLIDGASSDG
TADWYRSAHFDFPHHALSEPDDGLFDAMNKSLDVVKGDYVVFMNAGDTYA
DDGAVRRVLHRIQTNPPWGYSRARVVDNSGRKVRPHVGRIPYSRTMHLLG
RATICHQAVVMRTDLLRDLKGFDKRLGTAADYHLLIRAALRQVPDTWAEV
DVDFLAGGVSDSGIYEHLWNRHRARVDALALKSVGSRVDSAWTALQVVRI
WARKKLKPIFGPLYLRLRK
145225342YP_001136020.1 polysaccharide biosynthesis protein [Mycobacterium gilvum PYR-GCK]MRDTRIPAVSRFGITGRAAAAYLLLAGLQRGVSLLILPFISHAMLPSEYG
AASTLTASAMLIVAIIAAPVEQLVFRAAARGGDDAPALIRVAGTYCYLVL
PLFIACVAAGSVVYLPDLFGISGQIWAIELLAVGFLPAATYFALPFVRAR
QDLRKFVWLAATSILVTALSKFLLIVVWGLGVFGWAISDLVSAVVSALLA
IALIRLPRVHVAARNICAVLTFSIPLIPHRASFWALSSLSRPAMATVSTL
AQVGLLSFGLNLAAVANMILAELNQAFQPRYSREKFPAPNGETRKPVHWQ
LVLAFAIPALVGASVALGGQFIFAESYWPSFALTGLLLCGQVAYGLYLVP
MNYIVQSAGLPKFSALASVSGATIILVGILALGRQYGAVGVAYVTSSGFA
AMAVVAFILTRILRLNISWSSWLKNWPEIALGLAGLVCSIAALVLIVGST
ASYIFAVASIVLTVYALALTAARRSS
145225341YP_001136019.1 integrase catalytic subunit [Mycobacterium gilvum PYR-GCK]MPASGDHRVDVAPLDCPVRRHESQRGQTAQGTRSRERPAQEAGRQPGPRH
RHAQGDFGGKLLTPNRKRSAVIALRERFGVSERRACTVVGLHRSTMRLTP
APVTTEEAELRAWLRRFSTDRPRWGWRRAAKMARRAGWKANNKRIRRLWR
EEGLRVPQRRRKKRLTGIGVAVGAMSPIRPNVIWAMDFQFDTTADGRTLK
MLNVIDEFTREALAIEVDRAINADGVVDVLDRLALTYGAPHYVRFDNGPE
FVANAVADWCRFNSAGSLFIDPGSPWQNAWIESFNGRLRDELLNLWRFDS
LLEARVIIEDWRRDYNANRPHSAHGELTPAEFALQWTTTHQPQVA
145225340YP_001136018.1 FkbM family methyltransferase [Mycobacterium gilvum PYR-GCK]MDEALMVHRVIGGTTGTMVDVGAHHGSAFKPFLDSGWVVHAFEPDPANRK
ALQADHPRLTVDTRAVAEVDGEEVRLFTSDISTGISTLSPFHATHKPTST
VQTVRLDSYLRDNNIARIDFLKTDVEGYDLYALRSFPWSTHHPRVVLCEY
EDAKTIKLGHDSHAVAQFLQKQGYEVLVSEWHPIVEYGSEHQWRRFCHYP
TDLAPESWGNLIAADPNLIEALERCGRLTVRRLRVRSLVDRFR
145225339YP_001136017.1 hypothetical protein Mflv_4761 [Mycobacterium gilvum PYR-GCK]MPQSRSPRPATRYNWRRGYGGVDTDAVKIPRSCASRTPLKRLLAEAETVQ
RCSAGGLEGDPDPSAKCRAGDMLTTTLGMSERLACKPLG
145225338YP_001136016.1 hypothetical protein Mflv_4760 [Mycobacterium gilvum PYR-GCK]MRESAQAAHSTVPRRNEQRPQPGSVGDLQSTPNVMLVGLPTILASGTISL
TATVYAMMLVAVASLWMKRSSTSWFDIGLPCLLLPIASLSIVLRPNYPNT
AIHVVLFILACVVIGRVVYLSASTSDALISLIDGIGVFLATSLLLWLAGF
GGPHDRTSGLDNSLTGGERIVFPLSNSLAATPAMAAVYVAAVIPILLSYR
QYRNIRLVGVICAIAIFVLTDSRISLIGALLASAAVLLIPRIFRGAAPWI
SGALLLIPFIYGVIQSGLGRIVSAASTYSPWLARLGEDAYTLNRRDYIWS
QSLAFYWERVGWISQTVGHGSYGQTESGASSYYSANLTGLGRDDRLLTPH
NSLLQILFDGGWVTLGAIGATIVLMAVTLSRRNSPVDLSALAMLVTLLIV
GSTEVALSPGHAQPTWWILVALGFIVFARKRTQSAPVCAATPRS
145225337YP_001136015.1 SMP-30/gluconolaconase/LRE domain-containing protein [MycobacteriumMTRCAERLTPRAAHHGEGPFWDRRSGRLLFMDVLAGVVGAIESTGKVLRY
DVPADVATVIRRRASGGFVIATGHDLMCADDDLANFTHLTHVASDPHVRT
NDGGCDPTGGFVIGTMAYDERTGGGAVYRVAPDCHATTLLAPVSISNGIQ
WSADGTRVFYIDTPTRRIDVFDVDLDTGRWSNRRVHIDMNNSIGYPDGMA
IDVDQGLWVAMWGGGAVNHYDAFGQLVETIEVPGVTQVSSCAFGGGSLDE
LFITTSRQGLPNDSEPSAGAIFSTKTTTRGAALLEFAG
145225336YP_001136014.1 WecB/TagA/CpsF family glycosyl transferase [Mycobacterium gilvum PYMKPWEIKEITVPMSDSQDRCQVGTLAFEVATLDDAVNRTIDEALRRRSDH
IHLANAWSIALAEDDSQLRDAFGTGSNYPDGKPVVWVMRWRHRRSNGIKP
ARVDGPTFFERVLEQGVPQNVKHFFFGSTPETLEKLQDNVRIRFPGIDIV
GVSSPPFKDLTAEDLAGELARIRACEPHLVWVGLGTPKQDKVAAYLAEHY
SGIFACVGAAFDYTAGNLRETPKWIQEAGLGWLFRLAQEPRRLWRRYLFG
NARFIRIVAKQIATEQRTLRAGKLT
145225335YP_001136013.1 protein tyrosine phosphatase [Mycobacterium gilvum PYR-GCK]MCTGNICRSPIAERLAAAHGTLVGLPGFQASSAGTRAVIGHPIHQEAADV
LENMGGVASDFAARQLTRRIVFDADLVLAMTKAHRDKVLELAPHKLSSTF
ALAEAAALASMGDNNRNIADLAALRPHVAAHDWSDVPDPIGQSRAVFEAV
GSQIAELLTPVLDFCQRACADSPY
145225334YP_001136012.1 hypothetical protein Mflv_4756 [Mycobacterium gilvum PYR-GCK]MYTYSQLVVPRWVLLSGVGWHTFGASGTIARIRQLPGVNDDSIIFSDNGE
TTSNRPFIGPFGITDLAIVATPGASAGHGISFRVPDGRSGLAQDMTTLER
LVLRGFPGSGIYVRGGSPLRLDYITTLWNGRFGIEVEDTHVDTDNGSVHQ
LSMKHISGDGNMGGVADGGGSTVSLKGLMAHKAAVSLLDIKSEYRVRPIG
DSGDGSAMGNYHAVVIEDCACPIAATGVEHIATGSQTRKPGNAIQVKGPK
RPDLLWQSVTVRDDHPSQTVGGAPYRVFDEVLSRGSSAPHGVLGVSIESY
TPDQIATQVDTSRRDDLAIGESTLSRRVVTDAGVALTPGTLYLTYFTAMK
SEAITLVRTCSGSVTAAEATLCRIAVYEVDDKDDLTLVGATENDPSLWSA
ADTAYGLAFAESFTKRRGVRYAVGLLVAGASVGPTILGQSHILQDEAAQK
PRLSGALPGSTDLPADIMAESVAPTSVQVYAALTP
145225333YP_001136011.1 undecaprenyl-phosphate galactose phosphotransferase [Mycobacterium MTAINDRLDVAANIVSLPTKAPTWQQGYSRRLIVLDLVGVVLAVGLAHWL
RFGSETETISTYRAVDYTMVSVAIAVLWLAALAINHSRSTRVIGSGAEEY
RRVILATLAVFGAVAIVSMLFKLEIARGFLVIALPVGVVVLVVLRWLARK
VVVTVRRKYGRCITRVLVVGSPTAVRDLTMSLHREAASEYEVVGACTPGI
TPHSEIDVSGVGAIPTFGDESNVVGAVTATRSHAVAVTATERLGGRGIRD
LSWELEKLDIDLLVAPGVVDIAGPRLQMRPVAGLPLIHVEKPQYHGAKKF
QKRLFDVAFSSAVLLCGLPILLVVALAVKLSSKGPVFYRQERVGLDGRPF
EMIKFRTMVDGADGMLGKVAALNESEGGVLFKIREDPRVTPVGKFLRKYS
VDELPQFVNVLKRDMSVVGPRPPLATEVNSYDDYARRRLLVRPGITGLWQ
VSGRSDLSWEDSVRLDMFYVENWSMVSDLLIALKTVKAMLGHSGAY
145225332YP_001136010.1 GDP-mannose 4-6-dehydratase [Mycobacterium gilvum PYR-GCK]MVKRALITGITGQDGSYLAELLLSKGYEVHGLIRRASTFNTSRIDHLYVD
PHSPEAKMFLHYGDLSDGARLVTLLADIDPDEVYNLAAQSHVRVSFDEPE
HTADTTGTGTIRLLEAVRLSGVKTRFYQASSSELYGATPPPQNEDTPFYP
RSPYAVAKLYSYWITKNYREAYGMFAVNGILFNHESPRRGETFVTRKITR
AVAAIKAGAQNYLYMGNLDAIRDWGYAPEYVEGMWRMLQVDEPDDFVLAT
GVGITVREFLEVAFEHAGLDWEEHVRFDERYLRPTEVDALIGDPSRAAKK
LDWIPTVKSRDLARLMVDADIEAFSHAGTAWIDKVALESWKTPVAEQANP
145225331YP_001136009.1 NAD-dependent epimerase/dehydratase [Mycobacterium gilvum PYR-GCK]MTASEIVSPRELDRAATFYVAGHRGLVGSAIVRRLRVAGFDNIVGKTSAE
LDLKNRDAVFDFMSEIKPRYVVLAAAKVGGILANSNYPVDFLSDNIRIQV
NVLDAARDCGVERLLFLGSSCIYPKFAEQPIREDSLLTGHLEPTNDAYAI
AKIAGILHVQAVRRQYGLPWISAMPTNLYGPNDNYSPTGSHVLPALIRRY
DEAVASRAVSVTNWGTGSPRREFLHSDDMADACLHLLENYDGPEQVNVGS
GTDVTIREIAESVAAAVGFSGETHWDTTKPDGTPQKLLDVSKLTQAGWTS
KISLQEGIERTVAWYREHVGALRG
145225330YP_001136008.1 integrase catalytic subunit [Mycobacterium gilvum PYR-GCK]MPASGDHRVDVAPLDCPVRRHESQRGQTAQGTRSRERPAQEAGRQPGPRH
RHAQGDFGGKLLTPNRKRSAVIALRERFGVSERRACTVVGLHRSTMRLTP
APVTTEEAELRAWLRRFSTDRPRWGWRRAAKMARRAGWKANNKRIRRLWR
EEGLRVPQRRRKKRLTGIGVAVGAMSPIRPNVIWAMDFQFDTTADGRTLK
MLNVIDEFTREALAIEVDRAINADGVVDVLDRLALTYGAPHYVRFDNGPE
FVANAVADWCRFNSAGSLFIDPGSPWQNAWIESFNGRLRDELLNLWRFDS
LLEARVIIEDWRRDYNANRPHSAHGELTPAEFALQWTTTHQPQVA
145225329YP_001136007.1 di-trans-poly-cis-decaprenylcistransferase [Mycobacterium gilvum PYMFVAMSLSILPCPQAGRQSRITTGPLRRAHLIRTVSVYNLSRANLARPAA
ELAAVYNASIYFFSELIPTHFDPADCTIRLHGDRSLLPLDYVAAAEALEG
AAPRGDFCINILAAYDAFDELRGAHFRAQQQGCDIATAFDIPPVDLVIRT
TAEPLLSGFLPLQCQYAELTFLATPLNELTATDIDAVIAEHRRFPQRRGR
145225328YP_001136006.1 hypothetical protein Mflv_4750 [Mycobacterium gilvum PYR-GCK]MPRIYESSAHIGGLARTPTDGDWRVDPGGHRFFTQHEEIMDLWKSLLPHD
QWIAVPRRSAMLVDRHVVPYPLLGRDLLTQLGFRSGVRGAGGLMWSRLRR
GLRAVEREQTFREWGTEEFGRHWYQLFFDGYVRKTWLADPDHLSSDWANQ
RIKPIDWRRAGNRKATDQDVFRYPRLGPGQLWEAAAARLTEEGAAPSLES
PVVGLHHDGRYWTIELEGGKTATGDAVFSSMPLHMLVDMLKPAPPKHVRA
IAATLRHRSLITVAVALPREYDIPFNWVYTPGPEFRVGRVQNYGRWSPGL
APAGFSGTHIGLEYFTLPHDDLWLADDDELRAIVEQDLRMLGADAAPVHM
MIVRSQYAYPIYETGRERNVVRIRDYLRDQHPALHPIGRNGMHRYDNQDH
AMLSALRSVARYFGEQVDPWQVNTGPGYHETGLLRS
145225327YP_001136005.1 membrane-flanked domain-containing protein [Mycobacterium gilvum PYMLNPQYSAAVGYPENVLAKDEHVVLHRHPHWGRLVLPAVFLIIASAAAAF
IAGYVNTLNWEQAAKTIVFGVIAAIWLVLVGWLAVWPFLNWWTTHFVITD
RRVMYRHGLITRSGIDIPLARINSVEFRHGLVDRIFRTGTLIIESAAQDP
LEFQDIPRVEYVHSLLYHEVFDTLGSEESPS
145225326YP_001136004.1 GtrA family protein [Mycobacterium gilvum PYR-GCK]MSFADATIRRLPGPIRPYAERHHELIKFAIVGATTFVIDSAIFFTLKLTI
LEPKPVTAKIIAGIVAVIASYILNREWSFRDRGGRERHHEALLFFGVSGV
GVLLSMAPLWVSSYVLMLRVPMVSLMTENIADFVSAYIIGNLLQMAFRFW
AFRRFVFPDEFARNPEKALESTLTGGGLAEALEDEYELRHPHGPEPKGNV
TPMRMSRRRRNQRQRNDSDEPRVSKTS
145225325YP_001136003.1 phosphoribosylaminoimidazole carboxylase ATPase subunit [MycobacterMPHPAVTAGQRCGVGHDTMYAVSRRPSSPPVVAMIGGGQLARMTAQAAIA
LGQTLRVLAVRSDESAAQVTPDVVLGSHTDLDALRRVADGATAFTFDHEH
VPTEHLDVLIAEGVNVAPPPEALIHAQDKLLMRRRLSELGAPVPRFSAVS
SVEDAVAFSEQVGGPAVIKTVRGGYDGRGVVIASDTDEVRSAVEGYLADG
VPVMIEERVAMRRELAALVARSPFGQGAAWPVVETVQRDGICVTVLAPAP
DISDELGSAASELALHIASSLGVVGVLAVELFETVDGGLLVNELAMRPHN
SGHWTMDGARTSQFEQHLRAVLDYPLGDTSALAPTVMGNVLGAPETPAMS
MDERVHHLFARMPDAKVHLYGKEERPGRKIGHVNIVGGPSEPVESLRERA
ERAAHWLSHAQWTDGWDSHA
145225324YP_001136002.1 phosphoribosylaminoimidazole carboxylase catalytic subunit [MycobacMSSPRVGLIMGSDSDWPVMSDAAEALAEFEVPFEVGVVSAHRTPARMLTY
AQEASGRGIEVIIAGAGGAAHLPGMVASATPLPVIGVPVPLARLDGMDSL
LSIVQMPAGVPVATVSIGGARNAGLLAVRILGASDNALQQRMIAFQASLE
QMVLQKEEALRQKLLGE
145225323YP_001136001.1 putative GAF sensor protein [Mycobacterium gilvum PYR-GCK]MSISLPGFDTWLTDRLEECAGDSGEPVDTYVARAVASQMVTDCERVDRAS
AGRLKAHLSLTGLSGEATADGLSSVLADPTRLRALNATGLTDTSPDATYA
RLTRTTADALSVPAAALVLIAVDRQFVISAVGSIPPADQTGLTESFGKYV
VANGSLVSVDDARQHPLFKKYAAVARGRVVAYLGTPVADGAGNTVGALSV
SDTAARRWTSGEMQILGDLAAVAVARIFGS
145225322YP_001136000.1 putative outer membrane adhesin like protein [Mycobacterium gilvum MVYGNFVGRVGALAAALGIGIAIASLPVSASADTGASTSSESESSASREI
SRGASREARPEHVTPNSDDASSTTDSAADAPHTVSRRTATGRANGDAGDR
DLDDVVAASEEEAPEPKAIEAGSSTPSDSDEIATIDLAAKSPTPSESRTR
TGDILGTATTPSSTPNPPAPADSAIALAVLASVRRPVSAAETREHAPAGN
TSVVYAVPNTQPTISSISARAPGLFTGNVTGRVRATDADRDKLSYTATAS
QGTVKINSMGSYTYTPSVAARHAAARVGAQDQDTVTVTVTDGHGGVATTY
IGVMIRPKNTNPTAKATVGKGNPANGIVTGQIVGSDKDGDSVTYSVAETT
ARGSVVMTADGTFVYTPTAGAREAATSFFRRSDRFTVAVDDGHGGIKKLS
VRVGIVPPGKNSAPTVGNPSYTITNVSSADGTVTGYVSMADPDGFGLTFS
VAGGIDPTVGALAVNAATGSFSFTPTTRAREIAHGTAGEDFVRFAIAGSD
GLDRTTVEVSAAISPKAPPPPPPPPPPPTTRMRWPLGSVQVNRYFGGNGH
NGIDLNASINPKTPVYAAADGVISFEGYGQNHSWMTWQAGISVLVWHPAL
NVYSGYAHLSSTVINNGQTVARGQLIGYAGSTGNSSGPHLHFEVLPRTPN
FSNGYSGRIDPLPYLR
145225321YP_001135999.1 butyryl-CoA dehydrogenase [Mycobacterium gilvum PYR-GCK]MQAEKSVPRNSLPAATALKLPTSSKEMLMASWAGNPSFDLFQLPEEHQEL
RAAIRALAEKEIAPHAADVDENARFPQEALDALVANGFNAVHVPEEYGGQ
GADSVAACIVIEEVARVDASASLIPAVNKLGTMGLILRGSDELKQKVLPS
LAAGESMASYALSEREAGSDAASMRTRAKADGDDWILNGAKCWITNGGKS
DWYTVMAVNDPDKGANGISAFMVHVDDEGFSIGPKERKLGIKGSPTTELY
FENCRIPGDRIIGEPGTGFKTALATLDHTRPTIGAQAVGIAQGALDAAIE
YTKDRKQFGKSISDFQAVQFMLADMAMKVEAARLMVYSAAARAERGEGNL
GFISAASKCLASDVAMEVTTDAVQLFGGAGYTVDFPVERMMRDAKITQIY
EGTNQIQRVVMSRALLK
145225320YP_001135998.1 hypothetical protein Mflv_4742 [Mycobacterium gilvum PYR-GCK]MDRDDLEPRVAALEDQVRDLGARVSASERDAAAARVLAGAADRDVSEIRG
ELRDFRRATAASFNGMRQDFVDLRQDFVDLREEFGQLRGHVEQGFAEMRG
RLDGAAAGQQRIIDLLTTIIDNPGPHAR
145225319YP_001135997.1 biotin--acetyl-CoA-carboxylase ligase [Mycobacterium gilvum PYR-GCKMPTPERPALNVDVLRSAITGTEWHRVDVVDETGSTNADLIARADRGEDIA
GAVLLAEHQTAGRGRHGRTWSAPPRSQISMSFGVDTTGVPPAGWGWLPLL
TGLAVAHTLRESYGVNAGVKWPNDVMVGPRKLAGILAEVSGPVIVVGLGL
NVEMTVDELPDPNAMSLSMLNHHADRTQLTASLLQEFSSRLRRWRLAGGA
DAGLATDYRERSTTIGTRVRALLPGDSEIIGVATGIDDAGRLLIDTEGTT
VTVSAADITHLRPAQD
145225318YP_001135996.1 hypothetical protein Mflv_4740 [Mycobacterium gilvum PYR-GCK]MGPSVVAVAVVVTLGLWHLRNRRHPGWLASPDGRFSVMSGYSLTAVAVYW
LAAAPTATSWEWAFGNAWTLVAMVSFVYGFALLRQVTIAHAEPARTLESI
DASSDSAQSNPALS
145225317YP_001135995.1 hypothetical protein Mflv_4739 [Mycobacterium gilvum PYR-GCK]MSSTIVAIAVIIASCAVHARARRHAGWTASARGRFLMLLGYPSSAVAAYW
LTTASTGWEWVLGVGWAVAAAACFTAGVAALRCVTVDHAARAVAMETIEP
ATGALRF
145225316YP_001135994.1 hypothetical protein Mflv_4738 [Mycobacterium gilvum PYR-GCK]MTRSASTEVTNVSSAVLDPLMAANPAGPRITYYDDATGERIELSTATLAN
WAAKTGNLLRDELGATPGSRVAVLLPAHWQTAAVLFGIWWIGAEVVLSGE
ADIALCTADRIDDADAAAGMGEIAVLSLDPFGKPVADLPVGLTDYATAVR
VHGDQIVPERSPSPALEGRSTDDVLAAARASAAAQGLSGTDRVLSTAAWD
TADDIVDRLLALYVVGASLVQVANPDPASMARRADTEKITRATP
145225315YP_001135993.1 cell envelope-related transcriptional attenuator [Mycobacterium gilMPAAHMLRAVSVALAVAIVIGTGVAWGKIRSFEAGINHINPIALGGEGED
GAIDILLVGSDSRTDAHGNPLSDQERAMLRAGDEVSTNTDTIILIRIPNN
GESATAISIPRDSYVEAPGIGKMKINGVYGSVHLEEMKELVEQQGVDPAE
AEPEAQAAGREELIKTVANLTGVTVDHYAEIGLLGFALITDALGGVDVCL
NAPVYEPLSGADFPAGWQKLNGTQALSFVRQRHDLPRGDLDRVARQQAAM
ASMAHEVISSKTLSSPSTLSALESAVQRSVVLSEGWDIMDFVEQLQKLAA
GNVAFATIPILEEAGWSDDGMQSVVRVDPKEVKDWVTSLLNDQDQGKTEE
LAYSNDKTTVEVYNDSDVNGLAAAVAHVLTGKGFTQGNVGNNEGPKVTGS
QVRAAKVDDMGAQAVALDLGGLEVVEDSSVPPDTVRVVLADDYTGPGAGL
DGSDVTLMGADPSTSGVVSDTGAAVPAPSPIITAGSDDPKCVN
145225314YP_001135992.1 dTDP-4-dehydrorhamnose reductase [Mycobacterium gilvum PYR-GCK]MLAGQARRQGRDVVALTSRDWDITEQGSEPRLAAGDIVVNCAAITNVDLA
EAVPERSRAVNAVGAGNVARACAQVGASLIHLSTDYVFSGVFGGDSTRPY
DIDDEPAPLSVYGRTKLAGEHAVLAALPNAYVVRTSWIFEGGNGADFAAV
MRRAAAGSGDIEMVADQIGSPTYVGDLCAALLQIADGGVRGPLLHAANAG
SASRFDQAQAVFAELGADPGRVHPISGDRHPRPAPRPSYSALAATKSTAA
GLTPLRPWRAALAEALATMGGSLL
145225313YP_001135991.1 glycosyl transferase family protein [Mycobacterium gilvum PYR-GCK]MSDELFVVTVTYSPGPHLERFLATLAHATDRPVTVIIADNGSTDGAPEEA
VERHPNARLFRTGGNLGYGTAVNRAVTEYGLASSTDFFIVANPDVQWGPH
SIDLLCEAAQRWPQAGSLGPLIRDPDGAIYPSARHQPSIIRGGMHAVVAP
VWPSNPWTAAYRQDRAEPSERTVGWLSGSCLLLRTAAFAQIDGFNERYFM
YMEDVDLGDRLETAGWQNVYVPSAEVLHAKGHATGRDPARNLAAHHVSTY
TFLADRYPKWWQAPLRWAFRTALGARASLVVRRSRRKSRQS
145225312YP_001135990.1 nucleotidyl transferase [Mycobacterium gilvum PYR-GCK]MVNPAQVDAVVLVGGMGTRLRPLTLSAPKPMLPTAGLPFLTHLLSRIAAA
GIEHVVMGTSYKAAVFESEFGDGSKLGLQIDYVVEDEALGTGGGIANVSS
KLRHDTAVVFNGDVLSGCDLGALLDSHEERGADVTLHLVRVGDPRAFGCV
PTDSDGVVTAFLEKTQDPPTDQINAGCYVFKRSIIEAIPKGRALSVEREV
FPKLLSDGKKVCGYVDATYWRDMGTPEDFVRGSADLVRGIAPSPALTHQR
GEKLVHDGASVAPGALLIGGTVVGRGAEVAGGARLDGAVIFDGVKIGAGA
VIERSIIGFGAHIGPRALIRDGVIGDGADIGARCELLRGLRVWPGITIPD
GGIRFSTDI
145225311YP_001135989.1 hypothetical protein Mflv_4733 [Mycobacterium gilvum PYR-GCK]MGTILIGTEAVAEGLVTPGQLRYGYRRLFPDVYVPKAQPQSLADDAIGAW
LWSGRRGIVTVRAAASLHGARWVNSETPVELIYDCRRRPNGIIARNERID
WDEIVDNGQLSLATVERTAVDLGRHLPLGRAVAHLDALANATGLTAESVY
PLVDRYSGARGMKTLRKALDLMDGGAESPKETWLRLLLMREFPRPQTQIP
LVDEWGMPLIRLDMGWEAAKIAVEYDGAHHQENRSQYVTDERRLRLIQAR
DWLYVKVIKEDKPAEILARVRRAWALRETATTVAKRAS
145225310YP_001135988.1 NUDIX hydrolase [Mycobacterium gilvum PYR-GCK]MSLHQSTVDVLTAWNPPDPAQDSLRHSVLAFLAAREDACLRECAPGHITG
SALVVDHRGERALLTLHPRVGRWLQLGGHCEPTDETIVAAALREATEESG
ISGLTIEPEPAALHVHPVTCSLGVPTRHLDVQFVVRAPEGAEIVRSDESL
DLRWWPLDKLPEGVDFGLTQLAAAAASLY
145225309YP_001135987.1 F420-0--gamma-glutamyl ligase [Mycobacterium gilvum PYR-GCK]MTDHGTSARVEVLPVPGLPEFRPGDDLAAAIADAAPWLRDDDVVVVTSKV
LSKTEGRMVEAPTDPDERDALRRKLIDGEAVRVLARKGRTLITENALGLV
QAAAGVDGSNVDSNELALLPVDPDGSAAELVAALHERLGVRVAVVVTDTM
GRAWRTGQTDVAIGAAGLTVLHAYAGEHDQHGNELIVTEIAVADEIAAAA
DLVKGKLTAVPVAVVRGLAVRDDGSSARNLVRAGEEDLFWLGTDEALALG
RSQAQLLRRSVRQFSPEPVDGALIGAAVGEALTAPAPHHTRPVRFVWVQD
GALRVGLLDEMKERWRADLLADGRDAESVERRVSRGQILYDAPELIIPFM
VPDGAHSYPDERRTAAEHTMFTVAAGAAVQGLLVALAVRGVGSCWIGSTI
FAPELVRAALEVPGDWEPLGAIAIGYGTDPVTPREPVPTDGLLVRR
145225308YP_001135986.1 LPPG:FO 2-phospho-L-lactate transferase [Mycobacterium gilvum PYR-GMTCFRRVALWRVYHAPTGRPDGFAHRLLSFDVKVTVLVGGVGGARFLLGV
QHLLGLGQYGTDDTNENEATAVVNVGDDAWMFGVRICPDLDTCMYTLGGG
IDPERGWGHKNETWNAKEELAAYGVQPDWFGLGDRDLATHLVRTQMLRAG
YPLSDVTEALCKRWSPGLRLLPASDDRCETHVVITDPDDGEKRAVHFQEW
WVRHRAQVPTDSFAFVGADNATAAPGVTDAIEGADVVLIAPSNPVVSVGA
ILNVGGIRGALRSTKAPVIGYSPIIAGKPLRGMADACLSVIGVDSTSEAV
GRHYGARSATGILDGWLIHEGDHADIDGVNVKAVPLLMSEPSVTAQMVRA
GLELAGVAP
145225307YP_001135985.1 transcription factor WhiB [Mycobacterium gilvum PYR-GCK]MAFEQADFGDSIRFDSRLLGSVGSAPHIQTGPAPSGTNGRPQLSLVPERI
DSFGDDSGVLDEDQWQERALCAQTDPEAFFPEKGGSTREAKRICLGCEVK
DACLEYALANDERFGIWGGLSERERRRLKRGII
145225306YP_001135984.1 hypothetical protein Mflv_4728 [Mycobacterium gilvum PYR-GCK]MRGPLLPPTVPGWRSRAERFDMAVLEAYEPIERRWHERVATLDVAVDEIP
RLAPKDPESVQWPPEVVADGPIALARLIPAGVDVRGNSTRARIVLFRKPI
ERRAKDTDELTELLHELLVAQVATYLGVEPSVIDPTLDDD
145225305YP_001135983.1 hypothetical protein Mflv_4727 [Mycobacterium gilvum PYR-GCK]MLAPGHGHDRNGWASAAPWLRVSGVMQAIVHANLLLVNVPRRCCRPGCPH
YAVATLTFVYADSTAVVGPLATVSEPHSWDLCVMHAGRITAPRGWELVRH
AGPLPTHPDDDDLVALADAVREGREVPGAGVTAGFSAGLNTGFTDPVSGA
HGGALMAPPARRPETNGRRRGHLRVLPDPAE
145225304YP_001135982.1 phosphomannomutase [Mycobacterium gilvum PYR-GCK]MSRPAEAVQRVIKAYDVRGLVGVDIDEAFVADVGAAFARLVRDSLEQPAT
QVAIGHDMRASSPALSKAFADGVLAQGLDVVHIGLASTDQLYFASGLLDC
PGAMFTASHNPAAYNGIKLCRAGAKPVGRETGLAAVAEEVIAGVPGYDGP
HGSVSERDVLADYGDFLRSLVDIGGDRPLRVAVDAGNGMAGHTAPAVLGS
IASLTLKPLYFELDGEFPNHEANPLDPANLVDLQAFVLETGADIGLAFDG
DADRCFVVDERGQAVSPSAVTALVAARELNREIGATVIHNLITSRAVPEL
VGERGGTAVRSRVGHSYIKALMAETGAIFGGEHSAHYYFRDFWGADSGML
AALHVLAALGEQDRPLSEMMADYQRYEASGEINFTVTDAPEIVDSVLQAL
GGRIHAIDHLDGVTVDLGDGRWFNIRMSNTEPLLRLNVEARTAEEVTEIV
DEIGGYITSGARAST
145225303YP_001135981.1 hypothetical protein Mflv_4725 [Mycobacterium gilvum PYR-GCK]MTSPASAAEVDLDDGEGLLAADRHGLLRAASMAGAQVRATAAALTEGDLD
AVRSDSPPRTVVWVAGPGTAEAAGMMLAAILGGSVGAPIVVAAEAPPWIG
ALDVVVLAGDDPARPELVTAAATAVRRGARIVVVAPYEGPLRDATAGRSV
SIPPRLPVPDDFALVRYFAAGLAVLHVVLPGFSVDLPAIADALDEEAFRN
SAGRELFTNPAKVLAERMRDHDVVLAGDSAATISLARHACTVMLRVGHQV
VASAGLSDALVAIGTGWGRAGGGEASIFHDEELDGPLPQQGRTVVLTTDA
ERHNVSARLRGFDDVYVVNANDVPDVAAPGGNSEPGSATTPGSARPEQQL
ALLAVRLEMAAVYRRLVRG
145225302YP_001135980.1 mannose-6-phosphate isomerase [Mycobacterium gilvum PYR-GCK]MHLLRGAVRTYAWGSRTAIAEFVGGPSPTPHPEAELWFGAHPGDPAWLQT
DDGERSLLDALRADPEGELGSAVRGRFGDTLPFLVKVLAADEPLSLQAHP
STEQAVEGFAREDRMGIPVTAPDRNYRDPSHKPEIIVALSQFEALAGFRP
AARSVELMTALGVADLDPYIGLLSGQRDEDGLRALFTTWITCPQPDLDLL
VPAVIDGAINYVRSGAQEFAREAKTVLELGERYPGDAGVLASLLLNRLSL
APGEALYLPAGNLHAYLEGVGVEVMANSDNVLRGGLTPKHVDVPELLRVL
DFTPAEDVLVVPETIRGGAEIVYPTPAPEFAVSILHLDGESLGHEIDAPT
RHDGPQILLCTDGAATVQANGSAVALKRGAAAWVGAGDGPIRLSAQEPTK
LFRVTVGI
145225301YP_001135979.1 hypothetical protein Mflv_4723 [Mycobacterium gilvum PYR-GCK]MGRKHAIVIGASLGGLCAARVLSSAFDDVTVFERDPLPEGPANRPAVPQG
RHVHLLMARGAAEFETLFPGLLDDMVACGVPILENRPDCIHFGAAGHLLG
TTHRLQDEFTAYVPSRPHLEWQIRRRVLALDNVRLIDCGVDEPVYDGHRV
TGVRTADGATVDADFVVDATGRGTRLPTWLSQWGFERPREDTVDVGISYA
THQLRIPDGLIDEKVIVVGASRTQPRGLGMLYYEDGTWGLTTFGVGKVPA
PTDFNEMRELAEELLPAHIGAALYQTHPLGDVALHKYPTSRWRRFDELDR
YPRGILPFGDAVASFNPTFGQGMTMTSLQAGHLQRALQEPEPEATFLAAT
AKSTWPVWTMNAIGDLTMHGADGPAPWWYRPVGALFDQFLGAAESDPVLA
EWFLRRFSLLDSLYMVPSARLIGRTVRHNMTLWARSRRSPGTASSAPAR
145225300YP_001135978.1 amino acid permease-associated protein [Mycobacterium gilvum PYR-GCMTQEPVTQAPGRLRLKSVEQSIADTDEPGTKLRKDLNWWDLTVFGVSVVI
GAGIFTITASTAANITGPAISLSFIFAAIACGLAALCYAEFASTVPVAGS
AYTFSYATFGEFVAWIIGWDLILEFAVAAAVVAKGWSSYLGTVFGFAGGT
AEVAGFDLDWGALVIIAIVTAILAMGTKLSASVSLAITALKVSVVLLVVI
VGAFYIKMENFSPFIPAPEPGEAGGTGAEQSLFSLMTGAEGSHYGWYGLL
AGASIVFFAFIGFDIVATTAEETKVPQRDVPRGILASLGIVTVLYVAVAI
VLSGMVSYKDLRDAESPNLATAFSLNGVDWAAKVISIGALAGLTTVVIVL
VLGQTRVLFAMSRDGLLPRQLAKTGEHGTPVRITLLVGAVVAVTATVFPI
DKLEEMVNIGTLFAFVLVSAGVIVLRRTRPDLKRGFRTPWVPVLPILSII
ACVWLMLNLTGLTWIRFSVWMAIGVVLYFVYGRRHSLVARRQRERAGLHT
DTP
145225299YP_001135977.1 alkane 1-monooxygenase [Mycobacterium gilvum PYR-GCK]MTTHDMLDKPDALQWRDKKRYLWLMGLIAPTALFVVLPLVWALNALGWHA
AAQVPLWIGPILLYVLLPTLDRFFGPDGQNPPDEVMERLENDKYYRYCTY
LYIPFQYASVIFGAYLFTASDLGWLGFDGALPWPAKIGLALSVGLLGGVG
INTAHEMGHKKESLERWLAKITLAQTLYGHFYIEHNRGHHVRVATPEDPA
SARFGETFWEFLPRSVFGSLKSAWELEAKRLERAGKPTWHWSNDVLNAWA
MSVVFYGALIAVFGWALVPYILISAIFGFTLLETVNYLEHYGLLRQKLPS
GRYERCAPVHSWNSDHIVTNLFLYHLQRHSDHHANPTRRYQTLRSMEGAP
NLPSGYASMIALTYFPPVWRMVMDHRVVDHYDGDLTRINIHPRVRDKVLA
RYGVRGGVDA
145225298YP_001135976.1 rubredoxin-type Fe(Cys)4 protein [Mycobacterium gilvum PYR-GCK]MTAYRCPGCDYTYDESKGEPREGFPAGTRWADVPDEWCCPDCAVREKVDF
EEMGVKS
145225297YP_001135975.1 rubredoxin-type Fe(Cys)4 protein [Mycobacterium gilvum PYR-GCK]MSDYKLFVCVQCGFEYDEAKGWPEDGIAPGTRWDDIPEDWSCPDCGAAKT
DFEMVEVARP
145225296YP_001135974.1 TetR family transcriptional regulator [Mycobacterium gilvum PYR-GCKMTAQPIATSARVATRHADQRRADTRARGASLGPVRATVIVAPVGGGNDKR
ISYAEASRVLLRDSILDGMREMLLARDWSQITLSDVAKAAGISRQTIYNE
FGSRQGLAQGYAMRLADRLVDQIHAAIDNNVGDMYAAFLQGFRDFFVESA
ADPLVISLLTGSSKPDLLQLITTDSAPIINHCSSRLTESLMGSWVRCSEE
DAGVLSRAIVRLAMSYISMPPEADHDVARDLARLMTPFAERYGVVADPVE
GGNSQVTRRP
145225295YP_001135973.1 S-adenosyl-L-homocysteine hydrolase [Mycobacterium gilvum PYR-GCK]MTALTADVRNGIDYKVADLSLAEFGRKEIRLAEHEMPGLMELRREYHDVQ
PLKGARISGSLHMTVQTAVLIETLTALGAEVRWASCNIFSTQDHAAAAVV
VGPNGTPEEPKGTPVFAWKGETLEEYWWAAEQMLTWPGEPANMILDDGGD
ATMLVLRGAQYEKAGVVPPAEDDDSAEWKVFLELCRKGYEQSKDKWTKIA
ESVQGVTEETTTGVLRLYQFAAAGELAFPAINVNDSVTKSKFDNKYGTRH
SLIDGINRGTDALIGGKKVLICGYGDVGKGCAESLAGQGARVQVTEIDPI
NALQALMDGYDVVTVEQAIGDADIVITSTGNKDIITLDHMKAMKDHSILG
NIGHFDNEIDIAALERSGATRINIKPQVDEWTFGETGKSIILLSEGRLLN
LGNATGHPSFVMSNSFSNQVIAQIELWTKNDEYDNEVYRLAKHLDEKVAK
IHVEALGGTLTRLTKDQAEYIGVDVEGPYKPEHYRY
145225294YP_001135972.1 hypothetical protein Mflv_4716 [Mycobacterium gilvum PYR-GCK]MAHRFTAVLFGLALALTACQGQPASEEAFTDTGAATSRPAPEIRHDTEEL
AVTFPALGTPVSASWITWDNSGGSETSRLSLRWIDAVVRVSPETMAGLVD
RYHAEDVGHRPAVQKVLEPELPPGPFLTGVELNMFFGGPRRSTRVFLDPP
RDTVVLQSSVAGRA
145225293YP_001135971.1 alpha/beta hydrolase domain-containing protein [Mycobacterium gilvuMASADDSESTGSGSVTTSKTEARVSAKPAPARSDAPDGVGDENSTSDESA
DVSSSPLTRIRGRDGDDTQREPREAVADRDAPEDVEEVVEEVVPDPSPAP
PAAAPMADAPRHRYDAAAQNAVVFTDEPTLFDQVVVGSLYVMRAVSTALG
IDLYGVIGKILENDDPPWFVRAGLDVRRTEYPSSGEKPWDVWEFRPPNPT
GKTVIAVHGGGFIVEPLVTHWLDYAQMARQTGATVLVPMYPLATTPAGTA
VTAVPVMAQFIADQIASRGAHNVSIYADSAGPSLAMAAVRELILTGRPVP
ASLVLLSFAPDASLSNPAICDVRDPIIDVRTLDFYTRENHWSDGLDPQDP
LLSPLFFEDAVFAALPPSTIYVGELEYALPDTLLLHEKWSAAGGVVSTVV
GVGQFHDWALGGLPVNSQAPKVRPAVYRQLGLNDVASGPDTITTGPPTYS
DRLVADILRTLRWLNETTGITILSGLAGASIITDPPPLLMHGLTVTEREF
NGWTVWEIAAPRRSGEYVVALHGGGFESEANILHWSDYAQMARDTAATVL
VPIYPLAPPKNTGTAATLVPPMADYVSQLIAEHGVDNVSLYGDSSGGSYA
VLVVRELLRRCAIEVACVPSQAGPSRMVLISPALHLTLRGPEVDAIDDPI
LPRHAPGEGPRFNGDWSLDDPRVNPIAGDNLSGLPPTTVYIGTQEKLYPG
AIAFRDKVLAQDPAADLTVVIGDGQLHGWALGGIVVNSQAQIWRPNVYRQ
LGLLPTNSARYVTLTVA
145225292YP_001135970.1 thymidylate kinase [Mycobacterium gilvum PYR-GCK]MLIVIEGVDGAGKRTLTNGLRAAFESGGRSVATLAFPRYGVSVPADVAAE
ALHGQHGDLADSVYAMAMLFAMDRAGARDEIGHLTSAYSVVILDRYVASN
AAYSAARLHQGADGDVVAWVRDLEYGRLKLPVPTWQVLLDVPTELAAQRA
VNRAAEDAARARDAYERDDGLQRRTGAVYAELAAAQWGGPWAVIPPDVDA
AELAARLLG
145225291YP_001135969.1 hypothetical protein Mflv_4713 [Mycobacterium gilvum PYR-GCK]MLVESRIRSTSLPTLDQLLARIAAANQSFDQGRHTEATVLAGYLRAVLYG
SGGSDALHGMKETLTWVDTAGVPNPKTTACLTAGLTLMRIRSRHHGCGEY
VPKLAMYPPAPIRTHSGEQILSGSRIPFQDWWTNPVIQDVDGTHFSRKQL
VLALAPGEDREARAARRALARSRSLGEVVGGAMPADRLCASPVIASVRQI
GYEVLQSIAEQRDILEAAA
145225290YP_001135968.1 two component transcriptional regulator [Mycobacterium gilvum PYR-GMDSMRQRILVVDDDPSLAEMLTIVLRGEGFDTAVIGDGTQALTAVRELRP
DLVLLDLMLPGMNGIDVCRVLRADSGVPIVMLTAKTDTVDVVLGLESGAD
DYVMKPFKPKELVARVRARLRRNEDEPAEMLSIADVDIDVPAHKVTRQGE
QISLTPLEFDLLVALARKPRQVFTRDVLLEQVWGYRHPADTRLVNVHVQR
LRAKVEKDPENPQVVLTVRGVGYKAGPP
145225289YP_001135967.1 integral membrane sensor signal transduction histidine kinase [MycoMIFGSRRRIHRRSAPLIRGLAALGRALSLAWRRSLQLRVVTLTLGLSLAV
ILVLGFVLTSQITDRILEVKVGAATEEIERARTTVSGIVGGEETRSLDSS
LQLARNTLIDRKADAGAGLAGTFDAVLVVAGDGPRAATAAGPADQVPAAL
RDFVKAGQVSYQYATVHTDGFSGPALIVGSPTSSPVTNLELYLIFPLNSE
DSTIALVRGTMATGGVVLLGLLAAIALLVARQIVLPVRSASRIAERFAEG
HLTERMPVRGEDDMARLAVSFNDMAESLHRQITQLEEFGNLQRRFTSDVS
HELRTPLTTVRMAADLIHDHIHDSPDDLDPALRRSTELMVNELDRFESLL
NDLLEISRHDAGVAELAVEAVDLRSIVQRALDNVGHLAEGADVEMDVEMP
PDDVIAEVDPRRVERILRNLIANAIDHAEHKPVQIRMAADVDTVAVTVRD
FGVGLRPGEEKLVFSRFWRADPSRVRRSGGTGLGLAISIEDARLHQGRLE
AWGEPGKGACFRLTLPLVRGHKVTSSPLPVKPIETAAGAGRRVREPAGES
V
145225288YP_001135966.1 lipoprotein LpqB [Mycobacterium gilvum PYR-GCK]MTRTRFAALVTALVLAVAGCAGVPTSSSPQAIGTVDRPAPPSLPTPTPGM
DPDVLLREFLKATADPSNRHLAARQFLTESASSTWDDAGSALLIDNVVFV
ETRTPERVSVTMRADILGSLSDMGVFETGAGALPDPGPIELVKTAGGWRI
DRLPNGVFLDWQQFQATYKRHTLYFADPTGKTVVPDPRYVAVSEPDQLAT
ELVSKLITGPRPEMDKTVRNLLGSPLRLRGPVTRADGGKTGIGRGYGGAR
IDLENLSTTDPHSRQLLAAQLIWTLSRSGINGPYVINADGAALDDRFAQG
WDTGAVAATDPGAADGAAAGLHALVGGTLVRLDGDRAPRVAGPFGQMPGQ
TGAALSRSGQEVASVVTMRPGAPDMASSLWVGPLGGNAAQVMDGRSLTRP
SWSLDDAIWVVVDGNNVVRVIQDASGQPARIPVDATAVLTRFPGGIAELQ
LSRDGTRAAMVIGGKVILAGVEQTPGGGYALTYPRRLGYGLGENALSLSW
RTGDDIVVTRTDPQHPVSYVNLDGVDSDGPSRNLLMPVRSVAANPSAVYV
SDGRGVLQLSGSAAEDPSWVEVRPLMVAGALPVLPG
145225287YP_001135965.1 Rieske (2Fe-2S) domain-containing protein [Mycobacterium gilvum PYRMWRWRSPGRQCSSARASASPRSRWRHAREVRTRRDRRRGHLRRRARSWRR
RPTSDVPVGSGTIVGEVVVTQPVAGEFKAFSAVCTHTGCLVNKVADGTID
CPCHGSRFSLDGAVVNGPAEKPLQPVAVRVQGDSIVAD
145225286YP_001135964.1 hypothetical protein Mflv_4708 [Mycobacterium gilvum PYR-GCK]MGEPFIGSEALRAGRLTRHQLRTAHIAVYPDVYVPVATTLTAVAKAKAAS
LWTGREGIIAGQSAAAIHGARWVDARRPAEVLWHNRRAPRGVLVWSDRVA
DDEVTTVRGVRVTTPERTALDIACRYPQRRAVAAIDALARAAHMKLADVE
LLVDRHTGRRGIRAARAALNLVDPGAESPQETYLRLTVIGNHFPPPQTQI
PVWDCGALVAELDMGWEHMMIGLDYEGDHHRTTREAFNKGIRRHDAVTEL
GWTDIRVTCNDTEGAIIARLTTAWRQRLCALGENPDAGPPWTHVRRQRPG
Q
145225285YP_001135963.1 hypothetical protein Mflv_4707 [Mycobacterium gilvum PYR-GCK]MLDLILPKQCGGCGAVATGWCDACTDDLTVADDQPHLITPRLDPGVPVLS
LGRYAGARRNAIVAVKEHGRTDLRRPLADALRAGLDHLLTWGVLAAPLTL
VPAPTRRTAARRRGGDPVTHIATQAARPPDQSVATVLRFRAFTRDSVGLS
SAARQRNVAGRVVLTRPVAGPVVVVDDVVTTGATVTESVRVLQTAGIDVV
AVLALANA
145225284YP_001135962.1 sigma 54 modulation protein/ribosomal protein S30EA [Mycobacterium MRKRIELPSMSSNSVDSDSTMVMDGEQHDAQSSDLPSAEVVVKGRNVEVP
DHFRLYVAEKLARLERFDRTIYLFDVELDHEKNRRQRKNCQHVEITARGR
GPVVRGEACADSFYGAFEAAASKLEARLRKSKDRRKIHYGDKTPVSLHEA
TALDRLDAAFAKPTETSAVEAPVDDHEPGRIVRTKEHPATPMTVDDALYE
MELVGHDFFLFHDKESDRPCVVYRRHAYDYGLIKLA
145225283YP_001135961.1 preprotein translocase subunit SecA [Mycobacterium gilvum PYR-GCK]MLSKLLRIGEGRMVKRLKGVSDYVNTLSDDMEKLSDADLRAKTDEFRRRL
ADGKEDLDDLMPEAFAVAREAAWRVLNQKHFDVQVMGGAALHFGNVAEMK
TGEGKTLTSVLPAYLNALTGKGVHIVTVNEYLAKRDAEQMGRVHRFLGLD
VDVILGTLTPDQRRAAYNADITYGTNWELGFDYLRDNMALRLEDCVQRGH
NFAIVDEVDSILIDEARTPLIISGPADGGSNWYTEFARLAPLMEKDVHYE
VDIKKRVVGINEIGVEFVEDQLGIENLYEAANSPLISYLNNAIKAKELFE
RDKHYIVRNGEVFIVDEFTGRMLVGRRYNEGLHQAIEAKEHVEIKAENQT
VAQITLQNYFRMYNKLAGMTGTAETEAAELHEIYKLGVVPIPTNRPMIRA
DQSDLIYKTEEAKYIAVVDDVVERYEKGQPVLIGTTSVERSEFLSRQFEK
RRIPHNVLNAKFHEQEAGIIAEAGRLGAITVATNMAGRGTDIVLGGNVDY
LLDRRLRQRGLDPIETPDEYEKGWHEELPHIKEQVAEEAKDVIAAGGLYV
LGTERHESRRIDNQLRGRSGRQGDPGESRFYLSLADELMRRFNGATLETL
LTRLNLPDDVPIEAKMVSRAIKSAQTQVEQQNFDIRKEVLKYDEVMNQQR
KVIYAERRRILEGENLRDQAEQMLVDVVTAYVDGATSEGYSEDWDLEKLW
EGLRQLYPVGIDHRDLIDSDAIGEPGELTRAELLEALVNDAKSAYSVREA
EIEQIAGEGAMRQLERNVLLNVLDRKWREHLYEMDYLREGIGLRGLAQQR
PEVEYAREGYDMFIGMLDGMKEESVGFLFNVQVEPVAAPTVAAQAAPSGL
AEFAAAAAQQGSVATKERPTGGLRAKGIDDQSRPLTYTGPSEDGTPEVKR
SENAPAASTGMTRKERREAARQQQKAGRHAKRG
145225282YP_001135960.1 hypothetical protein Mflv_4704 [Mycobacterium gilvum PYR-GCK]MPSYPIPSVPSSSQGCGAWVTSPVIDYEPVPQPIAERPCPMPSGSALHRA
SLRPLRPPQRTPVRETPPPRSAVVFAEASLRRVIEVIDRRRPVSQLRPLM
TPFLIDCVIACAEAPRTGSATLRKVRVRSVDTGTEVGAAEVFASFTRAGR
VHAIAGRIERHRDSWRLVALQIG
145225281YP_001135959.1 hypothetical protein Mflv_4703 [Mycobacterium gilvum PYR-GCK]MVTRLSASDASFYRLENSSTPMYVGSLQILRRPRSGLSYETLLATVEQRL
PQIPRYRQKVREVTLGLARPVWVDDRDFDITYHIRRSALPSPGSDTQLHD
LVARLGSRPLDKTRPLWEMYLAEGLAKNRVAIYTKSHQALVNGMAALEIG
HVIADRTQKPPEFGEDIWIPGREPSDRQLLLGAVGEWITRPTQQAAAVRS
AVTETVSSTAQIVDLGRRVADVARTVARGTAPSSPLNTTVSRNRRFSVAS
GSLDEFRVVRARYDCDVNDVVLAMVAGALRNWLLSRGEPVRATTTVRAMA
PMSVYPDAEIDSTGPGQAISEVAPFLVDLPVGESNPVVRLSQISHATESH
PTAPSLVDARTIVTLSGFAPPTLHAMGIRVATSFSARQFNLLITNVPGAQ
SQMYIAGTKLLETYSVPPLLHNQTLAIGVTSYNGMLYFGINADRDAMSDV
DMLPSLLREALDELVEAAR
145225280YP_001135958.1 choline/carnitine/betaine transporter [Mycobacterium gilvum PYR-GCKMAGISEHEARAHADTSARSGTSTEEPALHPVLDRPLDEDRITRSRGIDWV
VFGVTAVFAVGFLVWGFLSTESLATASGSALTWVMNNTGWLFVLTSTGFV
VFVLYLALGRYGAIPLGRDDETPEFNGVSWVAMMFSAGMGIGLMFFGVAE
PLSHFTTPPPGTGAEGGSEAVQNAMATTLFHWTLHPWAIYAVVGLAIAYG
VYRKGRLQLISSAFEPLLGSRANGSWGKVIDMLAIFATLFGSAASLGLGA
LQIRSGLQIVAGIGETGNAILVVIISVLTVCFVLSAVSGVARGIQWLSNI
NMVLAISLAFFVFVVGPTVFILNLLPTALGSYFADLNMMSARTAAEGSDV
NEWLQSWTIFYWAWWVSWTPFVGMFIARISRGRTIRQFVGGVLLVPSLVS
LVWFAVFGGAAINVQQSGTDLAGEGGVEAQLFSLLDQYPIATIASVVVMV
LVAIFFVSGADAASVVMGSLSQKGTIHPSRGTVVFWGVATGAVAAVMLLV
GGEDALTGLQTITIIAALPFVLVMIGLAVSLVKDLRTDPMVVRRKYANEA
VESAVISGVTQHGDDFIISVEKDPHCDGGKPGG
145225279YP_001135957.1 hypothetical protein Mflv_4701 [Mycobacterium gilvum PYR-GCK]MADKAQRKADKPGKKTKKSKLPGDVYEAELFRLQTELVKLQEWVRATGAR
VVVVFEGRDAAGKGGAIKRVTEYLSPRVATIAALPAPTERERGQWYFQRY
IQHLPTSGEIVLFDRSWYNRAGVEKVMGFCTPAEHALFLRQAPIFEQMLI
EDGIILRKYWFSVSGEEQLRRFKSRHSDPVRRWKLSPMDLESVYRWEDYS
RAKDEMMAHTDTPLSPWYVVESDIKKHARLNMIAHLLSTIDYYDVEAPKV
TLPKKVVCSADYQRPPREASTYVDDHVASLMGDRE
145225278YP_001135956.1 hypothetical protein Mflv_4700 [Mycobacterium gilvum PYR-GCK]MTGSSAAGGYPLVVRVYVPATLAMLQRLVADGSLRPVNGTAFAVTPTLRE
SYSEGDDEELGEVARREAALASLRLLGHEDTGELPPRRVVVETDIDEAAD
GLTLRPDLDDAVVRLSGEIDLGRVIAAYVDNQAAEAAVRAAVEVIDAADL
GNEDAELTVGDAQDHDLAWYAPQELPFLLDLL
145225277YP_001135955.1 ferredoxin [Mycobacterium gilvum PYR-GCK]MAKSTIKNTAKVADTVRPAVAGAKERPLWHALRTVAGRITTPLLPDDYLQ
LANPLWSARELRGRVLEVRRETVDSATLVIKPGWGFSFDYEAGQYIGIGL
LVEGRWRWRSYSLTSPPAERPARSARTITITVKAMPEGFLSTHLVGGVEP
GAIVRLAAPQGNFVMPDPAPASVLFLTAGSGITPVMSMLRTLVRRDAIGA
PGHIVHVHSAPTEADIMFAAELAELARSHEGYRLELRATRTQGRLDVGRL
DDVVPDWRDRQTWACGPEAMLEDAERTWKSAGVGERLHQERFAVSRAPVH
GSGGTVTFARSDRTVTVDAATSLMDAGEDAGVQMPFGCRMGICQSCVVGL
VEGHVRDLRTGIEHEPGSRVQTCVTAASGDCVLDV
145225276YP_001135954.1 fatty acid desaturase [Mycobacterium gilvum PYR-GCK]MAITDVPEFAHLTDADIENLGRELDAIRQDIEDSRGAQDARYIRRTIAIQ
RGLEVAGRLMLAGSAKRSYWWAGTATLGVAKIIENMEIGHNVMHGQWDWM
NDPEIHSSSWEWDMSGASKHWRFTHNFMHHKYTNILGMDDDVGYGVIRVT
RDQRWTPMNLGNLFFNTLLCVAFEWGVGLQHLELGKIFKGRDDRKATMGR
VKEFGVKAGQQVVKDYVAYPAITSLSPRATFKSTLTANAVANVIRNVWAN
AVIFCGHFPDGAEKFTKTDMIGESRGQWYLRQMLGSANFEGGPLLRFMSG
NLSQQIEHHLFPDLPSNRYYEISLRVRELCDKYDLPYTTGNFLVQYGKSW
RTIAKLSLPDRFLSDTRDDAPETRSERMFDGLEPTERSGLKSAIAAVRSR
RRAKRAQKAAVKGQDLAA
145225275YP_001135953.1 2-5-didehydrogluconate reductase [Mycobacterium gilvum PYR-GCK]MTHVPAIELNDGASIPQLGFGVYQISPEDTADVVRQALEVGYRHIDTAQM
YQNEKGVGQGIRNSGIDRGDVFVTSKLNNGFHTPEDARRAFDETLKALEF
DYVDLFLIHWPLPTLYDGDFVSTWKTLEEFTKDGRARSIGVSNFQVAHLQ
RLADETDTVPAVNQIEVHPYFANDEVRAYGTEHGIATEAWSPIAQGKVLD
DPVVTRIAEATGKTPAQVVLRWHIQRGDIVFPKSVTLQRIKDNFALFDFE
LGAEDFDAVSGLDKGEAGRIGPNPDTFDYVPS
145225274YP_001135952.1 GTPase EngC [Mycobacterium gilvum PYR-GCK]MSPREYDETDVRVRPGRGSRPRTKTRPVHADAEHAMVVTVDRGRWGCVLG
NDPGRRVTAMRARELGRTPIVVGDDVDIVGDLSGRTDTLARIVRRGERRT
VLRRTADDTDPTERVVVANADQLLIVVALADPPPRTGLVERALIAAYAGG
LVPILCLTKTDLAPAEPFAEQFRDLDLTVLTAGRDDALETVDALLANKVT
ALLGHSGVGKSTLVNRLVPEADRATGAVTDIGRGRHTSTQSVALPLLHGG
WVVDTPGIRSFGLAHIAPDDVVMAFSDLADAIDGCPRGCGHMGPPADPGC
ALDALTGAAEGRVHAARRLLAALRES
145225273YP_001135951.1 3-phosphoshikimate 1-carboxyvinyltransferase [Mycobacterium gilvum MVGVSNWAAPSTATPVHATVTVPGSKSQTNRALVLAALAAREGSSRISGA
LRSRDTDLMIGALETLGLSVAASDSDPADLTVSGTLAPAAEARVDCGLAG
TVLRFVPPIAALSAQTVTFDGDEQARSRPIAPLLDGLRTLGVDIDGDGLP
FAVRGTGTVAGGTVEIDASGSSQFVSGLLLSGAAFTDGLTIVHTGDSVPS
APHIAMTVSMLRDAGVEVDDSAPDRWRVSPGPIGARDWVIEPDLSNSVPF
LAAAVVSGGAVRITGWPTVSIQPADTILKILAGLNGEVRKGSSYLEVQGA
TNYGGIDVDLRDVGELAPSVAAMAALADPGSVSRLRGIAHLRGHETDRLA
ALSTEINGIGGQCEETEDGLVITAREMHGGTWSSYADHRMATAGAIIGLR
VPGIEVEDIGTTAKTLPDFPQLWADMLGGQTDDLQQGPSARETPGR
145225272YP_001135950.1 hypothetical protein Mflv_4694 [Mycobacterium gilvum PYR-GCK]MGFMCGRFAVTTDPALLAEKIKAIDESTAASKDRPTADYPTANYPTANYN
VAPTTAVATVVKRHSEPEDESTRRVRLMRWGLVPPWVKAGEDGGPDTKSG
PLLINARSDKVTSSPAFRSSAKTKRCLVPMDGWYEWKGTKGAKTPYYMYA
GDGEPLFMAGLWTTWRPKPADTDAPKDAKPLLSCTIITTDAAAQLADIHD
RMPLTISEPDWDRWLDPDAPIDEGLLRGHGDLDRIEIREVSRLVNSVRNN
GPELIEPVTPQAEQGTLL
145225271YP_001135949.1 methyltransferase small [Mycobacterium gilvum PYR-GCK]MTGPLHAGSVVDAIAADMRSANYTTDGVADLLGADAGAAFSRGLWWSALR
ATDWAAADRQRLATLIRLFLLGTDEPRDRVGRAVPTSDVDALIDNGVLEQ
TPDGALRAALDIRPTSDGAADFLVVSDQDAALRAGPVRRDHVLGIGGASV
SLAHAVVRDPVGRALDLGTGCGIQALHLEAHCDEIVATDTNPRALALAAA
TARLNGMSWDLRCGSMFEPVAGERFDLIVSNPPFVVGTGSLDYIYRDSGM
AGDGLCQNLIAQVRDHLRPGGTAQIMANWIVRDPQNWQERVHGWLADTGL
HAWVVQREFADPVSYVSLWTSDAGESPEQAARRGGEWLDWFDAEGIAGVG
MGMITLRAPRDGETRSPDQVVEEITGAGEALTGPEVGAFFARREYLDRTG
DEQLLAAKLSTAPVFLEEQSLPGPDGWQVVGSAVRRPGGPAAVIGVDEVS
RALFAGCRGEVPLGTLIELLAGYHGVDADALADAAMPVVREAIGRGILYE
AG
145225270YP_001135948.1 type 11 methyltransferase [Mycobacterium gilvum PYR-GCK]MTSSTFWSAGRYDAVGDRIAPIAREVVDAADARRPLRDAAVVDLACGTGS
AALDAAARGARVTGVDITPELIAIAAERDGAAAVRWRTGDASDTGLPATS
FDAAVSNMGIIFVEPARQVAEVVRLLKPGGVFAFSSWVRSVSNPLFDPVL
AVLGPPATSTFSPDQWGDEAVLTERLGSQFDGVDVRRGDHRWEFESMPAA
MRFLTSESPMHVETFRRAETSQRARLAAEFEDALRPHLEPSGSVAFLSPY
VVVTATLRG
145225269YP_001135947.1 short chain dehydrogenase [Mycobacterium gilvum PYR-GCK]MSLAGKTMFISGASRGIGLAIAKRAAADGANIALVAKTAEPHPKLPGTVY
TAAEEIEEAGGQALPIVGDVRDGDSVVAAVAQAVEKFGGIDICVNNASAI
NLGSIEDVPLKRFDLMNGIQVRGTYAVSQACIPHMKGRDNPHILTLSPPI
LLESKWLRPTPYMMAKFGMTLCALGIAEELRDARVASNTLWPRTMVATAA
VQNLLGGDESMARSRKPEVYSDAAYAILTKPSSFTGNTLLCEDVLLEAGV
TDLSVYDCVPGSELGVDFWVDSANPPGYTGP
145225268YP_001135946.1 ybaK/ebsC protein [Mycobacterium gilvum PYR-GCK]MTGSDSRSAGQNNSGRGRACSRAAAAYAVPVARAATPAIAALVAAGVAHD
VVQYHHDPRTDSFGAEAVSELAGAGGLAPEQIFKTLVVSLPRGLGVAVLP
VPSKLSLKAAAAALGAAKATMADPAAAQRSSGYVVGGISPLGQRKALPTV
VDASALNWDRILCSAGKRGWDVSLDPRDLVRLTNAVTADICAL
145225267YP_001135945.1 ECF subfamily RNA polymerase sigma-24 factor [Mycobacterium gilvum MVPVMAMKAPSRSVFVLDVIGGAATEGTVFPTMTDTNGLAASPAPADAGE
AREETDAELTARFERDAIPLLDQLYGGALRMTRNPADAEDLLQETMVKAY
SGFRSFREGTNLKAWLYRILTNTYINSYRKKQRQPAEYPTEEITDWQLAA
NAEHTSTGLRSAEVEALELLPDSEIKEALQALPEDFRMAVYYADVEGFPY
KEIAEIMETPIGTVMSRLHRGRRQLRELLAGVARDRGFIRGEQLEAPEEV
TS
145225266YP_001135944.1 hypothetical protein Mflv_4688 [Mycobacterium gilvum PYR-GCK]MSGIEGGGGVTDNPEERWTPPVGPIDPEHPECAAVIAEVWTLLDGECTVE
TRDKLRQHLEECPACLRHYGVEEKIKRLIAMKCSGERAPEGFRERLRIQI
SQTTIIRQG
145225265YP_001135943.1 putative acetyl-CoA carboxylase biotin carboxyl carrier protein subMAEDVRAEIVASVLEVVVHEGDQIGEGDTLVLLESMKMEIPVLAEVAGTV
SKVSVSVGDVIQAGDLIAVIS
145225264YP_001135942.1 signal transduction histidine kinase [Mycobacterium gilvum PYR-GCK]MSTLGDLLAEHTILPGNAVDHLHAVVGEWQLLADLSFADYLMWVRRDDGH
LVCVAQVRPNTAPTVLLADAVGTLAEADDIPIVAAAFRSGDIGRATVDGE
FGAPGLNVEAVPVRHGSDVVAVLTHQTSLAPRQASPLEAAYVDCAGDLLH
MLSEGTFPNVGDLAMSRSSPRVGDGFIRLDEAGVVTFASPNAISAYHRMG
LSAELEGHNLVTVTRPLIADTFEAQELANHVRDSLAGGSSMRMEVDAGGA
TVLLRTLPLGVHGVGVGAAVLIRDVTEVKRRDRALLSKDATIREIHHRVK
NNLQTVAALLRLQARRTNNPEGREALMESVRRVSSIALVHDALSMSVDEE
VNLDEVIDRILPIMNDVAAVDSPIRINRVGDLGVLDADRATALTMVITEL
VQNAMEHAFDAETPQGCVTIRAQRSARWLDVIVHDDGRGLPEGFSLEKSD
RLGLQIVRTLVSAELDGSLGMHEAAEGGTDVVLRVPIGRRVRVSQY
145225263YP_001135941.1 transcription factor WhiB [Mycobacterium gilvum PYR-GCK]MDWRHKAICRDEDPELFFPVGNSGPALAQIADAKLVCNRCPVTAECLSWA
LESGQDAGVWGGMSEDERRALKRRNARTKARTNV
145225262YP_001135940.1 diacylglycerol kinase catalytic subunit [Mycobacterium gilvum PYR-GMRAVLIVNPNATSTTPAGRDLLAHALESRVELSVVHTDHRGHAIEIAQDA
ARGGVDVVIVHGGDGTVNEVVNGIVGQCGPGNPAPAVGVVPGGSANVFAR
ALGISPDPIEATNQLVDLLGAFRRGGSWRRIGLMDCGERWGVFTAGMGVD
GDVVAAVEAQRAKGRKVTASRYIRVAVREMLAATRKEPQLTLHLPGREPV
GGVHFAFVSNSSPWTYANSRPVWTNPDTTFETGLGVFATTSMNIWANLGL
ARQMNSRKPRLDAKHLIRDDDLAWVEVTSDTPVACQIDGDFLGPRDRMRF
TAVPGALQVVAPPARMGR
145225261YP_001135939.1 3-dehydroquinate dehydratase [Mycobacterium gilvum PYR-GCK]MTERRLLLLNGPNLNLLGTRQPEVYGSTTLAEIEAKVAEVAKDAGLQVRA
VQSNHEGVLVDAIHAARTECVGIIINPAAYSHTSVAIADALRSVGLPVAE
VHLSNIHAREEFRHHSYVSAVADMVVAGAGPLGYEMAVQYLADRLGP
145225260YP_001135938.1 hypothetical protein Mflv_4682 [Mycobacterium gilvum PYR-GCK]MTSRDSRMFTPRPVRLAGAIAALEGALALLMAVVLVVREAAGHHEDAISG
YGTAGWFTIMGSGVAAAGWALWTGRRWGRGIAVFANLVLLPVAWYVFSSG
WAGYAAVVAAAAITVLAGLFSPSGLHWLTQEPDPGTSREASSDRPGPDTR
145225259YP_001135937.1 N-acetyltransferase GCN5 [Mycobacterium gilvum PYR-GCK]MIHELAEFEHAAEECTVTESRLAKALFGPEPAVYGHIVEVDGQAAATALW
FRNYSTWDGVAGIYLEDLFVRPQFRRRGLARKLLATLARECVDNGYSRLS
WAVLDWNVNAIALYDGVGGKPQTEWITYRVSGPGLSELASRDVPGSGS
145225258YP_001135936.1 isochorismate synthase [Mycobacterium gilvum PYR-GCK]MTREPTFVFAGPDGVVVGEGVHTAFPHIADARAALASHSSPIVVGALPFD
LSRPAALMRPQSVRFTDVMPEGPGRELASTEITETSPDADEHRRRIGVAL
ARLRDPADPLDKVVLARALLLTAQGRLDARTVLDRLASADAQATKYLVDL
SAAGEGYSGTALVGASPELLVARHGRHVLCRPFAGSAPRRPDPEDDAASG
AALVESDKNRHEHQLVVDALRAALEPLCTDLQIAPRPQLTRTAAVWHLYT
PITATLRERSTTALDLAVALHPTPAVGGSPTDRAVALIDELEGDRGFYAG
AVGWCDQRGDGRWVVSIRCAQLSADRHTALAHSGGGIVAASDPDNELDET
TTKFRTILSALGVES
145225257YP_001135935.1 acid phosphatase [Mycobacterium gilvum PYR-GCK]MALPCACSPARSCDKPRRTAESDSVGLLQHRLILLRHGETEWSKSGKHTS
STELELTEHGRAQARAAADTLKQMELDDPYVVSSPRVRATTTADLAGLTV
DEVSPLVSEWDYGDYEGTTTADIRKAVPNWLVWTHGCPGGETSAQVCARA
DQAIDVALGHMESRDVVFVGHGHFSRAVITRWIEQPVYEGIRFAMPAASI
AVCGFEHGVRQLSALAQTGLPNPAVST
145225256YP_001135934.1 cobyrinic acid a-c-diamide synthase [Mycobacterium gilvum PYR-GCK]MGTVTRVLAVANQKGGVAKTTTVASVGAAMVEQGKKVLLVDLDPQGSLTF
SLGHDPDKLPVSVHEVLLGDVEPDVAIVETPEGMSLLPANIDLAGAEAML
LMRAGREHALKRALDKVSAEFDVVIIDCPPSLGVLTLNGLTAADEVVVPL
QCETLAHRGVGQFLRTVSDVQAITNPDLKMLGALPTLYDSRTTHSRDVLF
DVVDRYGLPVLAPPIPRTVRFAEASASGASVLTGRKNKGAMAYREFADAL
LKHWKTGKDLATFTPDL
145225255YP_001135933.1 hypothetical protein Mflv_4677 [Mycobacterium gilvum PYR-GCK]MAAVVWWTSDARATRSTPAAEPLPSLKPAVAVPDSLTQLWAARSGETTRP
LVVGGAVVTGDGQAMQGREPATGDVVWSYARDLDLCGVTWVYNYAVAVYP
DARGCGQVSTVDAKTGRRGPARTSYADRHVTLSGDGSTVLSQGETRLEMW
RSDMVRMLSYGALDAPIKPGVPATPLCRFVSAGASSDSVSVLEACESQDL
RLTLLRPSDEEDSPEAKYVQQTGVADGTGARVVAVSDTYTALYVPTPKPR
LDLIDDTGATVDTTIVDGPPSPEATMSKAGDLVTWWTGDALMVFSGNDLR
YKYTVAATGPDAPVGPATIMAGKLLVPVTTGYDVFDPETGTGEKHIPVQR
PPVDGPVVPAVAGTTVLELRGDDLVALG
145225254YP_001135932.1 DEAD/DEAH box helicase [Mycobacterium gilvum PYR-GCK]MTPVTTHPNPTFAQLGVRDEIVRALAENGIEHAFAIQELTLPLALAGDDL
IGQARTGMGKTFAFGVPLLHRITTDTERPLTGIPRALVVVPTRELCIQVY
EDLVHASKYLMADDTRKLTVTAIYGGRPYEPQIEALQKGVDVVVGTPGRL
LDLAQQGHLQLGGLNVLVLDEADEMLDLGFLPDIERILKQIPAKRQAMLF
SATMPDPIITLARTFMTQPTHIRAEGVQGSATHDTTEQFAYRAHALDKVE
MVARILQAEGRGATMIFTRTKRTAQKVADELGERGFRVGAVHGDLGQSAR
EKALKGFRNGDVDVLVATDVAARGIDIDDITHVINFQIPEDEQAYVHRIG
RTGRAGKTGIAVTLVDWDELPRWSMIDKALGLDTPDPAETYSNSPHLYDE
LNIPTEAGGSIGKPARSADKPKREPREPRAERPARDRTRRRTRGGQSVSG
HPEGTPDAADTSSSEASDSDSAGDGAPRPARRRRRRRPNKATAAGTSAGT
SAGTN
145225253YP_001135931.1 hypothetical protein Mflv_4675 [Mycobacterium gilvum PYR-GCK]MNSTPSEAAASAPTGELGSLSGHADAPPISLDHAGITELFALLAYGEVAA
FYRLAEEARMAPNLSGRINMAAMAAAEMQHYEVLRDALGRRGVDVVPAMT
RYASALENYHRLTTPSTWLEALVKTYVGDAMAADFYLQIADVMPDEAAEV
VRSVLAETGHSQFVVAEVRAAVTASDRQRHRLALWSRRLLGEAITQAQFV
MADHDELVDLVMAGGGLSQMTEFFDRLQNTHNARMQELGLG
145225252YP_001135930.1 hypothetical protein Mflv_4674 [Mycobacterium gilvum PYR-GCK]MNRPYTAQSPYSLTPTERIRSGRASGRRGGGYGGSDVDELDRYGDSDTDA
LPPYRDYRPGDHDAHDAYDSDDYTDVENYDEYLDEARIDRRWMWIAGVAG
AILFVAVITVSMILGGGDSGSVSATVAAPLPTSSAPEPSAAPSPRAAAPA
SPSLPAETVTTVTPTAETPAPAPVAPSPLLPAPQAAPPPAAAAPGTVTYR
ITGNRALLDLVTIIYTDEQGALKTDVNAALPWTKTVVLNPGVTLSSVTAT
SVSGQLNCAILDANGSLIAVQNNNSIITNCTR
145225251YP_001135929.1 hypothetical protein Mflv_4673 [Mycobacterium gilvum PYR-GCK]MEVKIGVTDSPRELVFASAQTPAEVEKLVADALSGEPGVLGLTDEKGRRF
LVQSTRIAYVEIGAADSRRVGFGVGAVGSEAV
145225250YP_001135928.1 TetR family transcriptional regulator [Mycobacterium gilvum PYR-GCKMSELAKTAPRRGGQPANGTGSSGAARRGNRLPRDERRGQLLAAASEVFVD
RGYHAAGMDEIADRAGVSKPVLYQHFSSKVELYLAVLQRHVDNLVSGVRQ
ALRTTTDNRQRVRAAVQAFFDFIEHDSQGYRLIFENDYVTEPQVAAQVKV
ATESCTDAVFDLISHDSGLEPHRARMIAVGLVSISVDSARYWLNNERPID
KDDAVEGTVQFIWGGLSHVPLTRS
145225249YP_001135927.1 hypothetical protein Mflv_4671 [Mycobacterium gilvum PYR-GCK]MTVLPLADPTPQDGARPRPHAGTPRARTSVARRTFTSLDLCHPVSVTYDP
GRGRVPVLRDEWREPLRAQRDPLAEHPGRVRSNRDEHRRWRKQTWIGRFV
STYGWRAYALPLLVVLTAVVIYQTITGTSAPQAVEDEGPVQGPPTIGVPS
TSIVGAPPKGLTEFDANLPTGILPQGGPFTEAGAGTWHIVPGALPQVGQG
TTKVFTYTVEVEDGVDTTTFGGDEGFARMVSETLANPKSWTHNAQFGFTR
VDAAAGVVPDFRVSLTSPMTIRQGCGYDIQLEASCYNPAFGGQPRVFINE
ARWVRGAVPFQGDIGSYRQYVINHEVGHAIGYQRHEQCTENGALAPIMMQ
QTFSTNNNDAARFDPGTVTPDGLSCRFNPWPYPIA
145225248YP_001135926.1 molybdopterin biosynthesis-like protein MoeZ [Mycobacterium gilvum MSTPLPPLVEPAAELTKEEVARYSRHLIIPDLGLDGQKRLKNARVLVIGA
GGLGSPTLLYLAAAGVGTIGIVEFDVVDESNLQRQIIHGQSDIGRPKAQS
AKDSVLEVNPLVTVNLHEFRLEPDNAVELFEQYDLILDGTDNFATRYLVN
DAAVLAGKPYVWGSIYRFEGQVSIFWEDAPNGLGLNYRDLYPEPPPPGMV
PSCAEGGVLGILCASIASVMGTEAIKLITGIGDPLLGRLMVYDALDMSYR
TIKIRKDPSTPKITELIDYEAFCGVVSDAAAEAAADSTITPRELRELLDS
GKPLALIDVREPVEWDINRIEGAELIPKGGFESGEALSKLDNDRTPVFYC
KTGIRSAEVLAIVKKAGFADAMHVQGGIVAWGKQLEPDMVMY
145225247YP_001135925.1 hypothetical protein Mflv_4669 [Mycobacterium gilvum PYR-GCK]MAVTAERPPEHVLAAFGLSGVQPAPLGSSWEGGWRCGEVVLSMVADHARA
AWSAKVRETLFVDGVRLARPVRSTDGRYVVAGWRADTYVAGTPEPRHDEV
VSAAVRLHEAMAKLERPRFLTQPPIAPWGDVDVFIAADRAAWEERPLHSL
PPGARVGPGAADGQKSIELLNQLATLRRPTKSPSQVVHGDLYGTVLFAGT
AAPGITDITPYWRPPAWAAGVVVVDALSWGEADDALIERWAQLPEWPQML
LRALMFRLAVHALHPRSTAAAFPGLARSASLIRLTL
145225246YP_001135924.1 methylated-DNA--protein-cysteine methyltransferase [Mycobacterium gMAAITDDQVEAVRALVAAIPAGRVATYGDIAGAAGLSSPRIVAWIMRTDS
ADLPWHRVIPVSGRPAPHLAGRQLDRLRAEGVLARDGRVPLTQYRHAF
145225245YP_001135923.1 alpha/beta hydrolase fold protein [Mycobacterium gilvum PYR-GCK]MTEQLCTYRFGPAGPARVLAIHGLTGHGKRWESLFTRHLSDIPAVAPDLV
GHGRSSWDAPWTIEANVAALTALLDAEAEGPVVVVGHSFGGAIALNLAAA
RPDLIAGLVLLDPAVGLDGRWMREIADEMYTSPDYTDREEARQEKIGGSW
GEVAEDELDRELDEHLVASAGGRVGWRISIPAMLCYWSELTRPAVIPRDG
TPTTLVRATRTDPPYAGDELVAALDAGLGPNFTLLEWDCDHMVPLARPTE
TARLIRDLLP
145225244YP_001135922.1 UvrD/REP helicase [Mycobacterium gilvum PYR-GCK]MSAPQTELTTDALGRRDLRGTVRVLGGPGTGKSSLLVDTAVAHIAAGCDP
ESVLLLTGSARLSVQVRASITSALLGAGGRAAVREPLVRTVHSYAFGVLR
LAAQRNGSPPPRLITSAEQDGIIRELLAGDVEDGPASPVRWPEQLRPALS
TVGFATELRDLMARCSERGIDPVALQRIGRHAGRPEWQAAGRFAQAYEQI
MLLRSAVGMAAPQATVPALGAAELVGAALEAFAMDADLLSAERSRVQLLL
VDDAQHLDPQAARLVEVLAAGAELTVIAGDPHQTVFGYRGADPALLRGDG
PALILNRSHRCAAPLADAIAAITRRLPGADASREFTGRAEQGTLAVRIAA
SPHAESALIADALRRAHLVDGVPWDRMAVIVRSVPRTGASLGRALAAAGV
PVEDPHPDVPLANQPAVQALLTVLEATAEKLDGERALALVTGPIGRVDPV
SLRQLRRTLRRGVTAPDRGFGELLVEALERDVAALPDEHARALRRLRAVL
TSARRSAEQGGDPRQTLWQAWNRSGLQKRWLAAAERGGPAAAQAERDLDA
VTALFDVAEQYVERTAGASLRGLIDHITGLSLPPARGDARSGDAVALISA
HAALSGEWDFVVLAGLQEGLWPNVSPRGGVLATQHLVDVIDGVAAPGQRL
SSRAPLLAEERRLLIAAMGRARSRVLVTAVDSDSGDEAALPSPFCHELAA
MATEPVPEPALPIRAPRVLSPAAVVGRLRSVVCAGSDEVSEDERVCAAAQ
LARLATAGVHGADPSSWYGARELSSDEPLWDGDDHVVTLSPSTLQMLADC
PLRWLLERHGGARGRDVRSTLGSLVHALVSESGTAESVLLDELDKVWGKL
PFDAQWHSDNERIRHLEMLATFLKWRSDTRGELTEVGTEIDVDGVVAGGE
GDGPGVRVRGRLDRLERDSEGRLVVVDVKTGKSPVSKDDAQAHAQLAMYQ
LAVAAGLIADGDEPGGGRLVYLGKTTGGRATERHQDAVTPEVRELWEARV
HEAAAATQGPSFVARVNDGCAHCPVRATCPAQNSRSQP
145225243YP_001135921.1 UvrD/REP helicase [Mycobacterium gilvum PYR-GCK]MSTPLYSPAELSRALGLFEPTEEQAAVIAAPPGPLVVIAGAGAGKTETMA
ARVVWLVANGYATPGEVLGLTFTRKAAGQLLRRVRSRLARLAGAGLTIPA
AGADLADDPVTIGTYHAFAGTLLREFGLMLPVEPDTRLLGETELWQLAFR
VVCEHPAALDTDKSPASITAMVLRLAGQLSEHLVDTEQLRDTHVELDRLV
HTLPAGRYQRDRGPSQWLLRMLATQTERTMLVPLIDALHRRMREERVMDF
GMQMASAARLASTHPAVGEQLRQRYRVVLLDEYQDTGHAQRVALSSLFGG
GADDGLALTAVGDPIQSIYGWRGASATNLPRFTTDFPLSDGTPAPTLELR
TSWRNPPEVLHLANAASVDARRRSVEVRSLQPRPNAEPGSVRAALLSDVE
AERDWVADQVAHRWHGGLAASGTAPTAAVLVRRNADAAPMADALSRRGVP
VEVVGLAGLLAVPEVADVVAMLRVAVDPTAGAAAVRVLTGPRWRLGARDL
TALWRRAVTLVDTGPSASDAVSATAEIVAKLEPDADDACLADAVCDPGPA
AAYSPTGYARIVALGRELTALRAHLSSPLPDLVAEIRRTLGIDAEVRAAQ
PISAGWSGTEHLDRFGDVVAEFASRGTPTASGLLAYLDTAEQVENGLAPA
EVTVSSDRVQILTVHAAKGLEWQIVAVPHLVGRVFPSTASPRTWLTDAAD
LPPLLRGDCATVSAHGVPVLDTSDVSDRKGLSDKIAAHKSSLDQRRTDEE
RRLLYVAITRAEHTLLVSGHHWGATESKPRGPSTFLTEIKDVIDASIEEG
RPCGSIAVWADAPADGETNPIRDRVVEAVWPVDPVAGRRGPVDRGAHLVA
EALSGECPEVGSDDDHGWVADVDALLAERDLAAQRAVPSLPAQLSVSAMV
ELGRDPEAVAHRLQRRLPRRPDSHALLGTAFHEWVQRYFQAEKLFDLDDL
PGAVDADRQDRGELDELQTAFAVSPWAARTPIDVEVPFDMMLAGRIVRGR
IDAIFADGDGSFTVVDWKTGEMPTDPEVLAHNALQLAVYRLAWARLHGCP
TSAVRAAFHYVRSGRTVMPDALPEEDDLIALLADRDDEDAA
145225242YP_001135920.1 hypothetical protein Mflv_4664 [Mycobacterium gilvum PYR-GCK]MRQPHQHNVIMTSSPSALQRISTSSRGARMGAWLVGMGVLHFAAPKPFDT
IIPEELPGSARFYTYASGVAEVGVGGLLLVPATRRIGALSAIALFVGVFP
GNANMVRMWFRDPTKNLAMRLGAIARLPLQVPMITQAWKIYKES
145225241YP_001135919.1 TrkA domain-containing protein [Mycobacterium gilvum PYR-GCK]MAEGRLRRRLRRFDQSLADMPVHALTDRVQIPTETVSPARRITVRVIYAL
GALFAAVLIVYLDRDGYRDSQENPLSFLDCLYYATVSLSTTGYGDITPIT
PEARLINVLVITPLRVAFLIVLIGTTVETLTTQSRQVYQIQRWRSRLRNH
IIIVGYGTKGRTAAAAMVGDEIAPGDIVVVDEDTSALDRAKSAGLVTVRG
TATDSEVLRLAGAQHAKTIIVAANRDDTAVLVTLTARELAPRAQIIAAVR
ETDNEHLLKQSGADSTVVTSETAGRLLGIAVQTPSVVEMMEDLLTPDRGF
AIAEREVSPKEAGGSPRHQTDIVLGVVRNKKLIRVDDPEVDALELGDRLL
YIRSADEDR
145225240YP_001135918.1 NADH pyrophosphatase [Mycobacterium gilvum PYR-GCK]MTPFRLRNIPLLSRVGADRADTLRTDIDAAVAGWSEALLLRVDRRNQVLI
SDGRAVLNRAVSVGPSPPENAVFLGKLDDGRHVWAVRSDLQPPEDETAPV
QVLDLRRTGDVFDDVSAQLVATATALLNWHDSARFSPVDGAPTTPIKSGW
ARINPVTGQEEFPRIDPAVICLVHDGHDRAVLARQTVWPPRLFSILAGFV
EAGESFESCVVREIAEEIGLTVTDVEYLGSQPWPFPRSLMVGFHAVGDPE
QPFSFNDGEIAEAQWFTRAEIRDALDQGDWSSDSSSRLLLPGSISIAREI
IESWAALD
145225239YP_001135917.1 glutaredoxin-like protein [Mycobacterium gilvum PYR-GCK]MSTDVPAVTMYTTSWCGYCVRLKKVLKNEGITFAEVNIEEDPAAAEFVGS
VNGGNHVVPTLKFADGSTLTNPTGAQVKAKLAS
145225238YP_001135916.1 UvrD/REP helicase [Mycobacterium gilvum PYR-GCK]MMVAMSPTASRDRLLGDLDDEQREAVLAPRGPVCVLAGAGTGKTRTITRR
IAHLVTAGHVAPGQVLAVTFTQRAAGEMRGRLRALDEGSGTGGVQAQTFH
AAARRQLSYFWPRVVGNTEWQLMDSKFAVVAQAANRGGLPTGTDNVRDLA
GEIEWAKASLISPETYADAVAEVSRDIPFDAAKIATVYANYEALKTRNEG
LVLLDFDDLLLHTAAAIENDPAVAQEFRDRYRCFVVDEYQDVTPLQQRVL
DAWLGNRDDLTVVGDANQTIYSFTGASPRYLLDFSRRFPEVTLVRLERDY
RSTPQVVSLANRVIAGARGRMAGSRLHLVGQRPPGPEPVFKEYPDEVAEA
AAVAKSIRTLIESGTAASEIAVLYRINAQSEVYEEALTEAGVAFQVRGGE
GFFSRQEIRQALLALQRVAERGAGDTGGSLPEIVRAILEPLGLTAEPPAG
TRARDRWEALVALAELVDDEVAQRPHLDLRALLTELRQRADSRHPPVVQG
VTLASLHAAKGLEWDAVYLVGLADGTLPISHALSHGPDSEPVEEERRLLY
VGVTRARVHLTLSWALARKPGGRQGRRPSRFLTGIAPQSQRDDGPSRSRK
PRGPAPRCRVCNAQLTSPTAIMLRRCESCPSDIDDELLAELKDWRLRISK
EMSVPAFVVFTDNTLIAIAESMPTDDAGLVAIPGIGARKLEQYGPDVLAL
VKGRQKS
145225237YP_001135915.1 transcription factor WhiB [Mycobacterium gilvum PYR-GCK]MSSPTCEMTPSSETRQPAVPCHVEDPDLWFAEDPRDLERAKALCADCPLQ
RACLNAALERQEPWGVWGGEILDRGSVIARKRPRGRPRKDSKSPVAA
145225236YP_001135914.1 hypothetical protein Mflv_4658 [Mycobacterium gilvum PYR-GCK]MDDGLVSEIKRGSVARNAKLASLPVGMAGRAALGFGKRLTGKSKDEVNAE
MMDKAAQQLFTVLGELKGGAMKVGQALSVMEAAIPEQYGKPYREALTKLQ
REAPPLPAAKVHRVLDQQLGTKWRERFQTFDDKAVASASIGQVHKAVWAD
GREVAVKIQYPGADEALRADLKTMQRMVGVLKQLSPGADVQGVVDELIER
TEMELDYRLEADNQRAFAKAYAGHPEFVVPRVVASAPKVVIQEWIEGIPL
SHIIREGTQEQRDLMATRLFEFCDDAPTRLEMVHGDAHPGNFMLLPGDKM
GVIDFGAVAPMPGGWPIELGQMLRYAVDKNYDKLLPTMEKVGFIQKGQTV
STREIDDMLKQYVEPLEVEVFHYTRRWLQKMTNIELEKAAGQIKAARQMD
IPPKLAIPMRVIASIVAISCQLDAHVPTRRIAMENVPGFADPDGV
145225235YP_001135913.1 hypothetical protein Mflv_4657 [Mycobacterium gilvum PYR-GCK]MTRCRTMTRYALSPATPVLSRPDGTVQVGWDPRKAVVVRPPAGLPGSVLA
ELLRALQGVATAPQLQRLAAGHGVDAPVVDGLVAHLVTRGVVTEAPRTPV
RSVAVRVHGDGPLADLLISSLRHANVRVSHSTRPNASSGRPDLVVLTDYL
VADPRLVRDLCDARVPHLPVRVRDGTGLVGPLVIPSVTSCLRCADLHRSD
RDAAWPAIAAQLSRTVGNADRATVLATAALALNEIDHIVRSLRPDHPGAV
AASPETLDTTLEFDVAAGTVQARRWTRHPDCSC
145225234YP_001135912.1 hypothetical protein Mflv_4656 [Mycobacterium gilvum PYR-GCK]MGMADLPFGFSAGDDPDRDKRNKDNSGSGPGSGADPFGLGMPGAGGEFDM
SQLGQIFSKLGEMFSGAGTSMSGGTSGGPVNYDLARQLAASSIGFVAPIP
EQTTSAIADAVRLAETWLDGVTPIPAGTTRTAAWTPTDWIDNTMSTWKRL
CDPVAEQISTVWAQALPQEAQAMAGPLLAMMSQMGGMAFGSQLGQALGTL
SKEVLTSTDIGLPLGPKGVAALMPEAVESLAEGLEQPRSEIVTFLAAREA
AHHRLFSHVPWLSSQLLNAVEAFAKGTKIDMSGIEEFARGFNPASLTDPS
EMEQLLNQGIFEPKATPEQTAALERLETMLALIEGWVQTVVTDALGDRIP
GTSALSEMLRRRRATGGPAEQTFATLVGLELRPRKMREAADLWVRLTDAV
GADARDGVWQHPDLLPSASDLDEPAAFIDRMIGGDTSDIDSAIADLERDF
RRGDSGPGESTE
145225233YP_001135911.1 PDZ/DHR/GLGF [Mycobacterium gilvum PYR-GCK]MNRRISTLVVALAPILIFGILLSAVTVPYVALGPGPTFDTLGEVDGKEVV
DIEGADVHATSGHLNMTTVSQRDGLTLGQALIFWASGRDQLLPRDLVYPP
DKTREEIDEANSQDFRQSEDSAEYAALHHLKYPMAVTVESIDEEGPSKGK
LQGGDAIDGVNGKPVATLDQFQELLKAYKPGDTIAVDYRRKNAPMGTAEI
TLGKHPDRDQGILGVNVLDAPWAPFTIDFNLANIGGPSAGLMFSLAVVDK
LTTGDVTGGKFVAGSGTISGDGKVGSIGGITHKVTAAQEAGATVFLVPAD
NCAEARTADADGIELLKVETLEQAVDGLRTLSAGGEPPRC
145225232YP_001135910.1 hypothetical protein Mflv_4654 [Mycobacterium gilvum PYR-GCK]MGMRPAARMPSLTQRSRFLIAVSAVLVLLLLLGPRFIDTYVDWLWFGELG
YRSVFTTQIITRLVIFFVVAILVGAVVFAGLALAYRTRPVFVPTAGPNDP
IARYRTAVMARLRLIGIGVPLAIGVLAGFVGQSYWQRVQLFLHGGDFGVS
DPQFGIDLGFYAFDLPFYRLVLTYLFVGVFLAFLANLLGHYLFGGIRLAG
RSGALSRAARIQLITLVGLLMLLKAVAYWFDRYELLSHTRGGKPFTGAGY
TDINAVLPAKLILMAIAVICAVAVFSAIFLRDLRIPAIGVVLLLLSSLVV
GAGWPLVVEQISVRPNAAQKESEYISRSITATRQAYGLTEESVTYRDYPG
NASATAQQVAADRATTSNIRVLDPNIVAPAFTQFQQGKNFYFFPDQLNMD
RYRDDSGNLRDYVVAARELNPDRLIDNQRDWINRHTVFTHGNGFIASPAN
TVRGIANDPNQNGGYPEFLASVVGANGEVSSPGPAPLAQPRIYFGPVIAS
AADDYAIVGESGTPREYDYETNTDTRNYTYTGSGGVPIGNWLTRSVFAAK
YAERNFLFSNVINENSKILFNRDPADRVEAVAPWLTTDTTVYPAIVNERI
VWIVDGYTTLDNYPYSELSTLSSVTTDSNEVAQNRLQLDKQVSYIRNSVK
ATVDAYDGTVTLYAQDEQDPVLQAWMKVFPDSVKPKSDITPELQEHLRYP
EDLFKVQRALLAKYHVDDPVTFFSTSDFWDVPLDPNPTASSYQPPYYIVA
KDLAENNGSASFQLTSAMNRFRRDFLAAYISASSDPETYGRLTVLTVPGQ
VNGPKLAFNAISTDTAISTELGQIGRDGQNRIRWGNLLTLPMGDGGLLYV
APIYASPGNTDAASTYPRLIRVAMMYNDQIGYGPTVRDALTDLFGPGADA
TATGPAATEPPAGQAPQTQGNNTAPPAAQPPNRQGQAPAGRPEVPVAVPP
TGPTQLSAAKSAALQDVNAALDALRGAQESGDFAQYGEALQRLDDAVNKY
QETD
145225231YP_001135909.1 transcriptional regulator [Mycobacterium gilvum PYR-GCK]MRYRLLGPLQVVHGEAAVDIGPRKQRSVLAALLLAQGRVVSTDRLVDVVW
GDDVPASATASLQVYISNLRRALRSGAGDRTVSSVAQPIVRQPPGYFLDA
GPDESDIAVFTAACARAAAAIDGERWDEALAEADTALSLVRGELLEDIGD
ADWIREDAARFAEMRTECLAGKVMSLLALGKIPAALTAASQLGALDPLAD
RGCRLQMLALYRAGRTADALEVYTRYARRLDAELGLEPGPELRDLQTAVL
RQAPELSGWPRSPGWTGAAAVTATEAVPVRLDTVESASHRAPLVGRRREL
AAAADVLDRVTAGAARWLVLSGPPGIGKTRLAEEIAGLVAAGDGDVVWVN
CPDERGTPPWWPMRQLVRALGADADEVLEIPPHADPDTARFLVYERIQRL
LESAPRLLAVVVDDVQWADTTSAACLAYIAGTLRDRPVLVVVTVRDGEHP
AEVSRLLSTVARGEANRLIEVPALSSEDVATLANEVAEEVVTAAEAAELA
DRTGGNPFFVSEYARLPREERAGNEIPRAVRSVLDRRLAALDPAVMQVLR
AAAVIADVLDSVTVPLLARTTALDLDTLADYLDEAADERIIVNSHTGDGY
VFAHGLLREQLLTGMPALRRQRVHAKVADVLADSALPDAPTWRAQHLVAA
QPLVEPTVVVPACRLAAEQATQQWSSDIAAGWWQAALDAYDRLPASERDD
ADRDALTVELLEAHSRAGRGQLVLDSVTRYLGEALRTGRAASAGRVASAL
LRASGGWPWLAPGNDPGELLTLLSRAATLSEGEPASAARVLPALAVGHCY
HPDPTIAPELLDRAERLAEATGDPDVIADVLIGRLITFSGVATLSAQSLE
WVQRLNALRHSRSREDAVIAHSVATMAAMNLGDVDGARRHVQAGIAGSEE
LQLPVLRAQLRWMEAVLAVWHGDFAEAGRHHAIAAHVHEQTELYEAGSGL
LARATLLRERGGPVDPSWTDLNAQQAGGLGMVGVVRTGVLTLLSGPKARA
EALATLRHWAQHTDRAHIWTTLGHHTLLAHLAVDHDLPDFAEPLLAQLDP
YRDRIAVIGQVGMAGPVALATARLHALRGDKAAALADLALARSIAERSAG
VPTLLRCRLLECELTEESPGRSTAASTLAAEAADLGMAAVAEAASRLL
145225230YP_001135908.1 hypothetical protein Mflv_4652 [Mycobacterium gilvum PYR-GCK]MRTSGGAAGTLPRPTEADMYARSSTVHARSSAVDAGITYIHDTVWPGLTE
LDGYVGLSLLVDRQTGRCIVTTAWDSEEAMHASRRTADTYRDHAAEILGG
SPTVDEWEIAALHRDHRSSPGACVRVTWARVAHENVERAVDGFRLATIPA
LEELDGFCSASLMVDRDSGFGVASVAFDSAEALRRNRQAMEELRSATIRD
AGAEILDECDCDLVLAHLRVPEMA
145225229YP_001135907.1 FAD linked oxidase domain-containing protein [Mycobacterium gilvum MTVPTDLRRDEALRSLRDQVATPVALPGEPGYERCRPWNVVAPVEPAAVV
LATSPEDVAGTVRFAAAHGFRVTVQATGHGAVGVGPDTILIQTSAMRHVS
VDVVNGTARVGAGARWQDVLDVATPHGLAPLCGSAPGVGVIGYLTGGGIG
PLVRTYGLSSDHVRSFDVVTGGGRLLRAAPDENADLFWGLRGGKATLGIV
TSAEIDLLPVPEFYGGAVYFAADDVADVLRAWAAWCVDLPETINTSIAIQ
QLPPLPEVPEPLAGRMTVAVRYAAVGDVDEAEQALAPMRAVATPVLDTVG
VLPYAAIGAVHADPVDPMPINEDQALLRELPPEAVEALLAAAGPESGSPQ
AIVELRHLGGALAREATHRSAFCHRNAAFSLAVIGVPAPEIADMVIAHAG
AVTGAVAPWSTGGQMPNFAPSYDPARPSRVYTDDTLHWLAGLADRYDPAR
TLATGQVIRTVV
145225228YP_001135906.1 heat shock protein 90 [Mycobacterium gilvum PYR-GCK]MAPHVEQLEFQAEARQLLDLMIHSVYSNKDSFLRELISNASDALDKLRLE
AFRNKDLDVDTSDLHIEIVVDKEARTLTVRDNGIGMSRDEVVRLIGTLAK
SGTAELRQQLREAKDANANEELIGQFGIGFYASFMVADRVELLTRKAGES
EATRWESTGEGSYTIETVDQAGGEVPQGTSVTLHLKPEDREDELHDYTSE
WKIRELVKQYSDFIAWPVRMDVERRTPASEEGGEETVTVETQTLNSMKAL
WARPRDEVSDEEYTEFYKHVAHAWDEPLETIAMRAEGTFEYQALLFIPSH
APFDLFQQNATVGVQLYVKRVFIMGDCDQLMPPYLRFVKGVVDAQDMSLN
VSREILQQDRQIRAIRRRLTKKVLSTIAEMQAERPEKYRTFWTQFGRVLK
EGLLSDTDNQETLLRVSSFASTRSDDEPTTLAEYVERMPEGQTQIFYAAG
ESRQQLLNSPHLEAFKAKGYEVLLLTDPVDEVWVESIHEFDGKPLQSVAK
GEVDLDSEADKEAQETERQQREKEFADVIAWLTEVLGDHVKEVRLSTRLT
DSPACLITDTFGITPALARMYRASGQPVPVEKRILELNPTHPLVVGLREA
HESRGADDELAGTAELLYGTALLAEGGALEDPARFAGLLADRLTRMVGEQ
S
145225227YP_001135905.1 hypothetical protein Mflv_4649 [Mycobacterium gilvum PYR-GCK]MDNNRTGRPGPQRPHDYFYSVPDHTDTLPDYTMRARETGERIAVTRPLAH
NGRVFWKLTDTDSEELVWLAFTRPDARSALARRKVWTLIPHLQEFLANWF
VSVDHVRTDQRQWVHTNIDVDEARELALLAPQPQAEDIKRITRPEAVLTI
DDIDRLKVTTVLGRGTAQALKARR
145225226YP_001135904.1 hypothetical protein Mflv_4648 [Mycobacterium gilvum PYR-GCK]MTRMDKQKFQAWAYDDLLANTTRGVLAEYIVATALGIDEVKRVEWHSHDL
DVDLDGVKVGVEVKSAAYVQSWEQTRPSVIEFGIGPAKGWDAHTNTYAPS
ARRSAKVYVFCLLNGSIGEPVDPLDVRQWTFYVMPTSELNRKVPEQKKIR
LGPLLALGPRQCSFDELKTAIHAAAGLNGLSGGA
145225225YP_001135903.1 putative transposase [Mycobacterium gilvum PYR-GCK]MPKKIDPNVRERCVRQVLDTLSQYPSVTAACEAVARREGVGKESVRRWVV
QAQIDGGQRHGATSEELAEIKELKAKVRRLEEDNE
145225224YP_001135902.1 hypothetical protein Mflv_4646 [Mycobacterium gilvum PYR-GCK]MGPPGRDRRRRSGWADQRGIRGPAQAAPGERRTQAGQRDFEGGVGFLRCR
ARPAVSVVVEFISAHQHMRVGADGLKWGVESMCAVLSEFGVVIAPSTYYA
HRARRGPSKADWTDAQVIDAIWRLRRSNKLFAVLGARKTWIVLRTNGLDV
SRCVVERVMREMGWRGACKRRRVRTTIADPAATRAPDRVARHFVAGAPDR
LWVADFTYCRTRAGWAYTAFVTDVYARKIVGWKVATEMTQKLVTDAINHA
IDTRKRSGAKFLDDLIHHSDAGSQYTAVAFTEHLAAEGILPSVGSVGDCL
LTG
145225223YP_001135901.1 phage integrase family protein [Mycobacterium gilvum PYR-GCK]MTIQHQLRLQAGTDVAWVLSGPGCGKYALVNEYLRYLADRNYSPRTLRAY
GYDLLAFCRWLGSVDVELSSVTTETVLDFMRHCRQTPIAGRPTNVVSMTG
TRLDRYSSTTINHRLAALTGLFTFRELRDPGLRTPIPSGREARRVSAEER
NGLLGHLVRPKRRSALRLREPRRLPRALNRRETAELLSSLRTWRDRALAG
LMLLSGLRSGELLTLDVTDVDIGARWVKVMGKGAKERRVPLDVEVAGLIQ
TYLLVERPESDSNRLFLVAKGPHRGQPLTAAGLRTIFRYHRIKSGVLAGH
PHALRHTFGTAMAEAGVDLAVMQALLGHAHIDTTARYIHLAPTHVKAEYD
AARTRLRSHT
145225222YP_001135900.1 phage integrase family protein [Mycobacterium gilvum PYR-GCK]MLPEHDYAPTPETPAQIYAAYLVHLQRRDRGNTAYAQAARSFLRRWPRVQ
SWADIPLDEQLAANCSTRPFVTFLMVSRRLQPGYDYLVHRKLSSLWHELT
DSCLQPDLDQFISAALELGFTERVASAIGSQIIARLLIQTGRPLTGLRES
DLQELLHACHVRQERTGRGAKHYRSTTHSARQILFHLGILDTQARPAVTA
LTLEQRMVDVPVALRPAFVAYLNRKYATCVPKTVSSLATRLAHFGRYLAA
ADPSLTSLNQLDRRRHIEPFITSLTTATNSVTGEPITVADRIRCIHAVGN
FLAEITEWGWDDAPPRRLIFRTDLPRPPRCLPRYLPVDSDRKLTAALAKS
PYRLAADALLVQRACGLRIGELLDLELDCIHEIPGQGSWLKVPLGKLNSE
RMIPVDDEVLTLVDRITTTRSSGRPMIHPRTGAPADFLFTHHGKRLSQNA
VREELNRAAQAASLGHITPHQLRHTYATALINAGVSLQALMALLGHVSTQ
MSLRYAHLFDHTVRTEYERALDLAKSHIGALPKTAVGLPITDITGTGWKD
TPAIKSRLAGGYCLRAPAQGSCPYANICEHCPSFHTDSTHLAVLAAQRID
AQDLAADAEKRGWIDEAERHHNLVSRLDALITGSASA
145225221YP_001135899.1 transposase IS3/IS911 family protein [Mycobacterium gilvum PYR-GCK]MAKKYQKFSPEFREETARLVVDGQKSIAEVAREHGLSDTTVGNWVRKYRE
THATDEPPLELSERARLRELERENREMAMELAFLKKAAAYFAKEPR
145225220YP_001135898.1 integrase catalytic subunit [Mycobacterium gilvum PYR-GCK]MSQKYAFIAAEHADGATFAGMAPTIVQMLKWLGVSKSGFYEWWGRPASAA
MCRREELKLKIAALFTSFGAVYGYRRIHAELVRAGERVGPELVRTLMREL
NLVALQPKPYKRTTIAGESATAVPDLVARDFTADRPGVKLVGDITYIRTW
AGWLYLATVIDCFNKEVIGYAMADHMRTELATGALEMAARNHALEPGCIM
HTDRGTQYTSTDYAIKIADLDMRASLGRTGICWDNALAESFFAALKNERV
HHMVYPTRKKARADIARYIELFYNRRRLHSALGYRTPHEVRIEYMNSQLA
A
145225219YP_001135897.1 hypothetical protein Mflv_4641 [Mycobacterium gilvum PYR-GCK]MATEVAHLRTAVEALAAGVKRHEEQIASSPNHPDDEPFRPTPRVHEPGLA
GQSFDNALAESVNSSYKTELIDHQPPYPGAAELSLATAEWVAFYNRQRPN
GYCQDLTPDREDVPSSVELRWRSGEHQAALT
145225218YP_001135896.1 transposase- mutator type [Mycobacterium gilvum PYR-GCK]MAVASYELFSSTEILGRLAMEKMLAGLSTRRYPVGLEPVGVQITEKATAT
SKSAVSRRFVAMTETALAELLSRDLSGLDLVALMIDGVHFAESCCVVALG
IDIEGTKHPLALVEGSTENATLVTELLVDLRERGLDVTRAMLVGLDGSKA
LRKAVLDVLDHPVIQRCQLHKVRNVKDHLPQRLRTTVGRRMTDAYHAGSA
LEAEAALLALAKELDRTHPSAAASLREGLDETLTVLRLGVPPTLARTLRS
TNCIESMISVCREHAGNVKRWRDGQMALRWCAAGMVEAGKQFRRVNGHLH
LPALRAALEREVAEHVVPVVHNDQVSAA
145225217YP_001135895.1 hypothetical protein Mflv_4639 [Mycobacterium gilvum PYR-GCK]MVGIGRSAKNSYSKGTTMKKSNQIQSVDVSASAVPERVSVAMSEIAENMS
EGLLALAVGAGLQVMAALMEADVTALAGPKGRHDQARTAVRHGRERGSVT
LGGRRVPVTRPRVRAADGTGEFGGRVL
145225216YP_001135894.1 hypothetical protein Mflv_4638 [Mycobacterium gilvum PYR-GCK]MLTGPPPKFHGTRDILREEYGMRYRRYIERMGAWAVALGMGVALASCPPP
ALADPTEQGPSDTHSSSTTGTTATENTSTSTTTEPTSPRSPSAGSTVIGR
STLVLPGSNGYAVNTTWYFPNHDEAPIGLIFMQHGWTRTDTNLSALAQQL
ADQTNSIVVSPTVSSNPSDRYYILNDPINRAVAALFVGDRSELTASAAAA
AGHPVSLPQHFVLAAHSAAGTLATAGYLVDAGAASNLKAVILFDSVADGD
ATTGMAKLAGANAVPVMLIAADVPVTCNDGGAATNTTINSAPDKFVAIML
DHGSHLDAEGANTDSLATWVCGPAPTPQNAAAVQIISAAWINDAFTGSHT
GIYAPAGTVIAVDGATARVLAVKGLN
145225215YP_001135893.1 transposase- mutator type [Mycobacterium gilvum PYR-GCK]MVGIGRSAKNSYSKGTTMKKSNQIQSVDVSASAVPERVSVAMSEIAENMS
EGLLALAVGAGLQVMAALMEADVTALAGPKGRHDQARTAVRHGRERGSVT
LGGRRVPVTRPRVRAADGTGELAVASYELFSSTEILGRLAMEKMLAGLST
RRYPVGLEPVGVQITEKATATSKSAVSRRFVAMTETALAELLSRDLSGLD
LVALMIDGVHFAESCCVVALGIDIEGTKHPLALVEGSTENATLVTELLVD
LRERGLDVTRAMLVGLDGSKALRKAVLDVLDHPVIQRCQLHKVRNVKDHL
PQRLRTTVGRRMTDAYHAGSALEAEAALLALAKELDRTHPSAAASLREGL
DETLTVLRLGVPPTLARTLRSTNCIESMISVCREHAGNVKRWRDGQMALR
WCAAGMVEAGKQFRRVNGHLHLPALRAALEREVAEHVVPVVHNDQVSAA
145225214YP_001135892.1 transposase IS3/IS911 family protein [Mycobacterium gilvum PYR-GCK]MPKKIDPNVRERCVRQVLDTLSQYPSVTAACEAVARREGVGKESVRRWVV
QAQIDGGQRHGATSEELAEIKELKAKVRRLEEDNEILRHVGRFSYLSASS
V
145225213YP_001135891.1 MMPL domain-containing protein [Mycobacterium gilvum PYR-GCK]MPFILSSRTLFGPQSGEQRARQPLLQQLSATAPAVDQAIQSGPGLRPLAN
QAQNAITQLDPLVGALNTSPWCATTPQCAQIRDQVKILVTLRDSGFFTQI
ADLGDRYDPATNATVGGTLANVQNAVASLDKAFGALGDPADLATNLRRLQ
DGIGQLASGAQALATGVRTLADSNIEMLSGMSQIATQLQNSSRAAADSDS
SSGFYLPANAFENRQFTDVAEQFLSPDGKTARFMIESSHDPYSVEAMDLA
SRITDTANTARPNTSLADATVSVAGFPAVNSDIQRFLWADFAQLAIATII
IVGVILVLLLRALLAPLYLLGTVVLNYLASLGIGVVVFQWGLGHEIAWPV
PLLAFIILVAVGADYNMLLVSRLREESGTNIRVGVLRTVANTGAVITSAG
LIFAASMFGLMVGSVAIMIQAGLIIGFGLLLDTFLVRTLTVPAIATLLRE
ASWWPTKATNPRRGDPKQKA
145225212YP_001135890.1 transposase IS3/IS911 family protein [Mycobacterium gilvum PYR-GCK]MAKKYQKFSPEFREETARLVVDGQKSIAEVAREHGLSDTTVGNWVRKYRE
THATDEPPLELSERARLRELERENREMAMELAFLKKAAAYFAKEPR
145225211YP_001135889.1 integrase catalytic subunit [Mycobacterium gilvum PYR-GCK]MSQKYAFIAAEHADGATFAGMAPTIVQMLKWLGVSKSGFYEWWGRPASAA
MCRREELKLKIAALFTSFGAVYGYRRIHAELVRAGERVGPELVRTLMREL
NLVALQPKPYKRTTIAGESATAVPDLVARDFTADRPGVKLVGDITYIRTW
AGWLYLATVIDCFNKEVIGYAMADHMRTELATGALEMAARNHALEPGCIM
HTDRGTQYTSTDYAIKIADLDMRASLGRTGICWDNALAESFFAALKNERV
HHMVYPTRKKARADIARYIELFYNRRRLHSALGYRTPHEVRIEYMNSQLA
A
145225210YP_001135888.1 MMPL domain-containing protein [Mycobacterium gilvum PYR-GCK]MTDGSADAPSQAKRPGRRANGSTDPADTREYSERLATLARFTLRHKALVI
GVWLGAAVVLALLFPQLETVVRQQSVDLIPRDAPSLQTVDRMSAAFGEEG
SKTMVFVAMEDPTGLTPTARQRYGELVRRLQAEGDHVLLVQDLLADPITE
AQAVSADRKAWYLPVGVTGTLGDPTAAESLNAVRDIAAEVFTGSTTTVQV
TGPPATFSDMIASAEHDLLLISIATAGVIALILLIVYRSVFTALLPLLVI
GLSLAVGRGVLSALGEMGMPVSQFTVAFMTAILLGAGTDYTVFLISRYHE
QRRAQVPADQAIIHATASIGRVILASAATVALAFLAMVFARLSVFAALGP
ACAIAVLFGFLATVTLLPPVLSLAAKRGIGEPKPDRTRRYWNSVAVAVVR
RPVPLLIVSLVILLALSAAAATIKISYDDRKGQPDTTASNQGYHLLDRHF
RKDVVISEFLVVENPTDMRTGKGLADLDEMASRVSQIPGVTKVSGVTRPT
GERLDQAELAWQNGQIGDKMAGAVAEGNSRKDDLAKLTGGADQLADGLAQ
LDSTVRTALTPLAGILTQAQSAGTQVNQFRPGLLRAFRTADFAGIMPRAV
NSCIRCGLHAACGSPTRSEVCADYRTVRYSGQYQLLLSSASDTPCGAHVH
FSGLQRMILRARYPNIFRSAPARLSYQGRRF
145225209YP_001135887.1 TetR family transcriptional regulator [Mycobacterium gilvum PYR-GCKMGADATKVLRPTVVCQDGHVRTRSKRWGGRTGAERRAERRQRLIDAATEI
WSESGWAAVTMRGVCAKTGLNDRYFYEDFKTRDELLVAAWDGVRNEMLGE
VSATLAERIGQPPMETIRVTIAAVVDRIAEDPGRAKILLAQHVGSSPLQD
RRAVALQEATHLVIAASEPHLRPEADETALRMDTLVAVGGFVELITAWHA
GLLDVIQGEIVEHTSRLAETLAERYLVDDAGL
145225208YP_001135886.1 TetR family transcriptional regulator [Mycobacterium gilvum PYR-GCKMSAEERHRNRRTRLIEAAMELIGTHGVAAATVTAVCAESGVTSRYFYQHF
PDRDALLRAVYQQLYATFQEVIVDAIPDAGAPPEVLAYAPIRGLVSMINN
DPRLGRILFVESATEPLLRELRSDMMTGFTDLVLREARLHLDIADSAVGV
AHLASTLGVGGLFEVLRRWLDGELEFTTDELVQHCAGFLGSLGSYVLLQN
AVESATTKAKPQS
145225207YP_001135885.1 metal-dependent hydrolase [Mycobacterium gilvum PYR-GCK]MSDDSSTRPTTRVVPKPRRVRFDMPAETSRQHFVDGDLVMSHFVSTLSAT
FPEGEDFFIRSVREYRDHISDADLKEAVKGFIAQEATHRHQHRLLNDRLQ
AMGYPTEGIDRHIKKLVGRLEKRFSPKMRLAVTAALEHYTATFAEIILTS
DEAQELIGYTEVRPILLWHALEECEHKAVAFDVYETVGGSERTRVWGMRI
ASLLLFTELVIQTTRSLAGDRAAYNPVRLLRSLRAFRHNPLFSRAAIERF
RSYTHAGFHPDDWDSAEILERWTKELFDADGGQQLRSNV
145225206YP_001135884.1 hypothetical protein Mflv_4628 [Mycobacterium gilvum PYR-GCK]MCRGRIARSGIPLMRAEGPLPPSRQRPKTSRQICTQVGAVSASAHVFYEL
LSGVAMPFASVIGPVPAATGWGMSTAVVLRMAERADKRHEAVLGVVNGLF
LTTVLAHFIHWPKRWRFGVPSLSECEGLCGPILVPYNGILYISGLSAVAG
LLENGRRGAVRGAIVPLLGVPVLLRLQRMEFRRLSLQARRNPRWWNRRLQ
MQPPDRSTSSDPDQQVLGAES
145225205YP_001135883.1 carboxymuconolactone decarboxylase [Mycobacterium gilvum PYR-GCK]MLALTDARERAAQCGIPDAMAELSVFRIALHQPPVAVALHGMLEALLWKG
ALDARLRELIIMRIGWVTDSVYEWTQHWRVARLLDVPERDLLGVRDWQNA
GHFGEAERAVLAATDETLRDGTISDETWAECQRALHGDPAVLVELVAAIG
NWRLFSALLRSLHVPLEDGLEGWPPDGVRPSVD
145225204YP_001135882.1 alcohol dehydrogenase [Mycobacterium gilvum PYR-GCK]MNADALVLTKPRTLERRHLPVPRIDDESGLLRIEACGLCGTDHEQFSGHL
PTGFAFIPGHEIIGVIEGIGDAARERWGVSVGQRVAVEVFRSCRECDSCG
RGEYRRCSSNGLATMFGFVDVNIPPGLWGGYATHLHLPFDSMPLPVPDGL
DPIVATLFNPLGAGIKWAAMLPETSPGDVVAVLGPGIRGICAAVAAKEAG
AAFVAMTGVGPRDRTRLAAAHQFGVDLTIDVTEDDPAQALQMATGRLADV
VVDVTAKAPAAFADAVALAQPGGRVVVAGTRGGGGAPGFEPDLLVFKELR
IFGSLGVDYPAYQSAIELLVSRRWPFEELHREITGFAGLPRLLDLLAGNE
PDRVPALHNVFVPIA
145225203YP_001135881.1 acetyl-CoA acetyltransferase [Mycobacterium gilvum PYR-GCK]MIPRDNPASRIAEATGLTPDHRISCPVGGNTPQYLVEVLGRRIWRGVSDA
ALIVGAESGASARKVASGSALLEPKPIAAQDESLGDTRPGLSEAEVGAGL
HWPHEVYPIFESAIAARSGRTFDEQRRWLGDLMAPFTVEASRHLEQAWFP
RARSADELSTVSPANRMVCEPYPKLLNSIIAVDMAAAFVIMAAEVAEELG
VPSDRWVFPWSSATCNDVYFPVQRPDLGRSAGIRAAGKAVLAASGLHIDD
IRWFDFYSCFPSAVEAAIDALDLDPADDRGFTVTGGLPYHGGPGNNYVSH
SIVEMVRRCRSDPDAVGLVSGLGWYITKHSLGLWSATPPPTGWQTPDMAD
AQSAIDGTSLPVASPADASGEATIDGYTVVHDRDQGPSWVPIFARMTDGR
RVAARSDDAEVAVAMSRDMCVGHQVAVRQADGHVEFELS
145225202YP_001135880.1 TetR family transcriptional regulator [Mycobacterium gilvum PYR-GCKMARDRLLDAAETCLQGKGLSGTTMEDIARHAGVSRATVYRYFASRESVVS
GVIVRAAERYLHRTSGRILAHTDLGSAILDFVAVTVRAARREPIIGMLFA
SDDELAGVGLAEGTSVALFELVAEFLRPVFAAHWHQLEAGVSVDDAAEWI
LRIILSLLAVRGPRHRSPEGIDAFLRRFLLPALLADTHSCIAATTAE
145225201YP_001135879.1 thioesterase superfamily protein [Mycobacterium gilvum PYR-GCK]MDFPQFNKQIAEELQHAGGTSGGLAKYLDFRHIEFSAGRLVVEMDARADL
LTPFGTLHGGCLSAMVDHCLGVVFYPVIPPGSWVATTEFKLNLLRPVSSG
VCVAVADIIALGKRSGVARIDITNTGRPVCAAQGTVTVVAQSAS
145225200YP_001135878.1 alpha/beta hydrolase fold protein [Mycobacterium gilvum PYR-GCK]MTSTFERVRNEDGTALAADVYRHESARAVVILLHGGGQNRHAWATTARRL
HARGYTVVAYDARGHGDSEWDPDGRYDLDRLASDLLSIRRYASDGRPPAV
VGASLGGMTVLGTHLVAPADLWGAVVLVDITPRMEFHGARRVVSFMGAHP
DGFDTLDAAADVIAQYNRHRARPKNLDGLRKVLQQRDDGRWIWRWDPAFI
ASNFEFLQGDPATGAKEFGAISDLLIEGARRVRAPTLLIRGVHSDVTSQQ
SVEEFLEVVPHAEAVDVSGTGHMVAGDDNDAFTSAVADFLDRTLNDSSD
145225199YP_001135877.1 hypothetical protein Mflv_4621 [Mycobacterium gilvum PYR-GCK]MLDSSEVQDTPGHAVHHLFRDLGDLVRELPESIHGLLIEQVAELAADQQL
KELLSDTVAANVDTWFSVVRHSIPFDRMESPTAALEHARRMAQREVPVNA
LLRAYRLGHQYGLNLIIAGLRSADLPPEEKLALIEHITRVSFRYIDWMSE
QVLETYQTERAEWDERRRSLRAQAIRDILNGRDVDLTEASSAMRYFLGAT
HVALMVWLDRDAGADTDEFIAMERFMQHAVSATGAKQSVYFSIDRLVGCA
WMTVHRPSDYLSQLRDFVRAQPDGPRLSVGEPLPGIEGFRRTYRQAEQAR
VVAVAADGSSRHRIVAARDPGVALASMLMTDDATLKEWIHDVLGPLAQNT
ASDQRLRDTLRVFLRAGSSFKAAANELQIHANTVKYRVNRALERRGRPIA
AERLDVEVALLMCYWLGEVALNPTQALGRS
145225198YP_001135876.1 integrase catalytic subunit [Mycobacterium gilvum PYR-GCK]MSQKYAFIAAEHADGATFAGMAPTIVQMLKWLGVSKSGFYEWWGRPASAA
MCRREELKLKIAALFTSFGAVYGYRRIHAELVRAGERVGPELVRTLMREL
NLVALQPKPYKRTTIAGESATAVPDLVARDFTADRPGVKLVGDITYIRTW
AGWLYLATVIDCFNKEVIGYAMADHMRTELATGALEMAARNHALEPGCIM
HTDRGTQYTSTDYAIKIADLDMRASLGRTGICWDNALAESFFAALKNERV
HHMVYPTRKKARADIARYIELFYNRRRLHSALGYRTPHEVRIEYMNSQLA
A
145225197YP_001135875.1 transposase IS3/IS911 family protein [Mycobacterium gilvum PYR-GCK]MAKKYQKFSPEFREETARLVVDGQKSIAEVAREHGLSDTTVGNWVRKYRE
THATDEPPLELSERARLRELERENREMAMELAFLKKAAAYFAKEPR
145225196YP_001135874.1 TnpC protein [Mycobacterium gilvum PYR-GCK]MDPGVLSRRDPDTGAWISDAEVAETTCTAFSSTKTPITARLIVRRVKDAR
YPDALFPVWRYHPFFTDTDEPVDVADITHRRHAIIETVFADLIDGPLAHM
PSGRFGANSAWILCAAIAHNLQRAAGILAGGAHAVARGATLRRRLITIPA
RLARPQRRPILHLPAHWPWATHWLRLWRNTIGHSPPATAPT
145225195YP_001135873.1 TnpC protein [Mycobacterium gilvum PYR-GCK]MFSTHLSAQLGKALPVQVSHRFAASSAVFDDERLVSCAGLVPVMALAEQT
GLSSSLADKVRFSCERVKSGAANPSPKLTTLIAGMCTGADSIDDLDVVRS
GGMKTLFGEVYAPSTIGTLLREFTFGHARQLESVLSEHVGALCERVDLLP
GADGRVFIDIDSLLRPVYGQAKQGASYGHTKIAGKQILRKGLSPLVTTIS
TEHCAPVITGARLRAGKTNSGKGAARMIAQAVATARGAGVTGRILVRGDS
AYGNSSVVTACRRAGARFSLVLTKTAAVVAAIADINDTAWIPVCYPAAIP
TPVPGSPMPKSPKPPAPLSVPRRLRSRHG
145225194YP_001135872.1 AMP-dependent synthetase and ligase [Mycobacterium gilvum PYR-GCK]MDRGIGQWVTKRAFLNGQRTALVQGDTSFTYSDFDRRTNQVASSLLRLGV
RKGDRVAILLVNSVEFLEVLLGCAKIGAITIPINVRLAGPEIGYILADSG
ADVFVFHAPLAAAAVSALTEPGVRVRHTLRAGGAPADGEIPYTDLLSDGA
PAPLDSDVEGRDPAFIMYTSGTTGRPKGAILTHDNLRWNAINVLGAEQGL
TGSDVTVAVAPMFHIGGLGVHTLPLLYVGGTSVILPSFDPVGTLKAMAES
RATVQFMVPAMWSALTQVPDFDSYDLSALRLAMGGGAPMPLTVIDFMHQR
GVPFTEGFGMTETAPMVSVLDAANITTRAGSIGRVAMHVDARIVDADDRD
VPADTVGELLVRGPNVFVGYWMKPATTAEAFRGGWFHTGDLGRIDADGYI
TLVDRKKDMIISGGENVYPIEVEQVLFRHPGVLDAAVVGGPDDKWGERVV
AVVVADPAAEQEPSADELIAWCRERLAHFKCPREVHLLPELPRNATGKLL
KTELRKRFTGVEGGVVQR
145225193YP_001135871.1 acyl-CoA dehydrogenase domain-containing protein [Mycobacterium gilMELHETEERRALRKAVSEIAKDFGHDYYVAKSLGGEKSSELWHAVGEQGF
LGINIAEEYGGGGGGIYDMQIVGEELAAAGCPLLMTVVSPTICGTIIQAF
GSDELKARWLPGIASGEVIMAFAITEPDAGSNSHNISTYAKRVGGDWILN
GTKYYISGVDEAEAILVVTRTATDDRGRGRLSLLVVPTDAPGLTKTLIPV
QAVTPEKQFTLFFDDVRVPAENLIGAENDGLRQVFMGLNPERIMGAALGN
GIGRYALDKASAYARERKVWDVPIGAHQGLSHPLAHAKIQLELARLMTQR
AASLHDADDPGSAEASNMAKYAAAEAGILALDQAIQTHGGNGLATEYGLA
TLWGPARLMRTAPISREMILNYVAQHSLNLPRSY
145225192YP_001135870.1 carbamoyl-phosphate synthase subunit L [Mycobacterium gilvum PYR-GCMPVIKKLLVANRGEIARRVFRTCRELGIATVAVYSDADADAWHVDDADEA
VRLPGSSPAETYLDGDRVIAAALLTGADAVHPGYGFMSENAGFARACADA
GLVFVGPPPDAIDAMGSKLTAKAMMADAGVPVLPGGDATGLDPDKLRKLG
AEIGYPLLVKASAGGGGRGMRVVESADDLDGAVASASREAMSAFSDGTVF
LERYVQRPRHVEIQLLADMHGTVVSLFERECSVQRRHQKVIEEAPSPVVD
DDLRARMGAAAVAAAQAVGYVGAGTVEFVLDANGGDDDGTFAFLEMNTRL
QVEHPVTELVTGLDLVRLQLLVAMGRPLPAEVSKPRITGHAVEARLYAED
PTKGYLPQTGTLRTMQIPDHVGVRVDSGVRDGSVVSHHYDAMLAKVIAWA
PTRAEALGALSAALAGARIHGLTTNRDLLVRVLRHDEFAGRGTDTGFLDR
HDVADLGAALIDRDGEGLHAIAATLAQVAGRRAAAPVQPTLPAGWRNNPS
QLQSTGWLTADGRERRVGYALLRDGVEVEVDGKPVEDVSVLVQRPDRVVL
ETGGVRRGYDVVLDADIAYVDSPAGSTAFTQVPRFLDPSALKPAGSLTAP
MPGSVIRLPVAAGDVVTAGQALVVVEAMKMEHTIVSPIDGIVAELSVEVG
QQVSTGDALAVVGAAAGADQD
145225191YP_001135869.1 carboxyl transferase [Mycobacterium gilvum PYR-GCK]MSPGGKLIDVLPDRVDTRAPVYLENREGLIAQLHALAEQLALANGGGGEK
YVARHRSRGKMLARERVELLLDPDTAFLELCPFAAWGTKFPVGGSVVVGI
GIVEGVESMIIAHDPTVRGGASNPYTFRKVFRGMAVARENRLPIINVVES
GGADLPTQAEIFVPGGQLFNDLTQHSALGLPTLALVFGNSTAGGAYIPGM
CDYVVMVRNRSKVFLGGPPLVKMATGEVSDDESLGGADMHARTSGLADYM
AEDEQDAIRIGRRIMARLNWRKLGPGPTQPPTPPLRDPDQLLGIASVDPK
VPFDPRDVIARIVDGSTFDEFKPLYGTSLVTGWASIHGYPVGILANARGI
LFSEEAEKAAQFIQLANQIDTPLVFLQNTTGYMVGAEYEQGGIIKDGAKM
INAVSNSAVPHLTIVMGASYGAGNYGMCGRSYSPRFLFTWPNSRSAVMGP
AQLAGVLSIVARESAADRGLPFDEEADAQMRAAVEGQIERESLALANSGR
LYDDGIIDPRDTRTVLGFCLSVVHNSEIRGQRGYGVFRM
145225190YP_001135868.1 acyl-CoA dehydrogenase domain-containing protein [Mycobacterium gilMKQPDQREAEAAAADPWMTPERISLRNLAMSFTQKEIVPHLQDWEDAGEL
PRELHRRAAAAGLLGIGFAEEIGGSGGDLRDLVLLTEAVMEAGGSSGLLA
SLLTHHIAVPHMAAQGDPEQIRSFVAPTLAGEKIGSLGITEPDTGSDVAG
IRTTARRDGDHYVVNGAKLFITSGVRADFVTTAVRTGGPGPSGISLLVVE
RGATGFLVSRALKKMGWLCSDTAELGFTDVRVPVVNLVGPEGSGFLQIMQ
QFQVERAFIAVQCYATAQRCLDLTLDWVKKRETFGRPLSTRQVVRHKIVD
IATAVDVARTYTRAAVDRIVAGDTDVRMVSMAKNQAVEACALAVDTAVQL
YGGMGYLRETEVERHYRDSRILGIGGGTTEIMKEIIAKQIGL
145225189YP_001135867.1 TetR family transcriptional regulator [Mycobacterium gilvum PYR-GCKMRRSCLCQDVFVRTKAARWGGRTGAERRADRRRRLVNAATEIWTESGWAA
VTMRGVCSRAALNDRYFYEEFKTRDELLVAAWDNVRDEMLGEVSATFAER
VGQPPIETIRAAISIVVLRIAQDAGRAQILLTQHVGSSTLQDRRAVALQE
ATQLVMAASKPHLKPDADEMALRMDTFVAVGGFVELISAWHAGLLVDVSQ
VDIVEHTSRLAETLARRYVVDKFG
145225188YP_001135866.1 short-chain dehydrogenase/reductase SDR [Mycobacterium gilvum PYR-GMDILRWDRPPRLSRRANAVVTGAGSGIGRAFAVELARRGGRVVCADIDPV
RAKETVGLVVQAGGEGLDIACDVTDEEQVRELADSAEKWFGAAASLVINN
AGIGIGGNVIGATPKRDWEATLSVNLWGVIYGCEIFVPRLRAKGSGGIIN
VASAASFGAAPRMGAYNVSKAGVLSLSETLAAELSGTGVAVTVLCPTFVK
TNIVDNPGIEESAAKLATNLMKWTGVSAESVARKTLDANDRGQLHVLPQV
DAKILWLFKRAVPATYTRALGLVERIAR
145225187YP_001135865.1 hypothetical protein Mflv_4609 [Mycobacterium gilvum PYR-GCK]MAFKYSDMLETIKNRQWALADIDWDAPGADKITDEQRPELKQFMADVVWI
EHVGARAFAAMAPKAPFEALGDIYRYFHAEEQRHANAELALMQRWGMLEE
GEIPVPNKNIRLVIEWIDRYAEALPLTVIGAAIPALETALDGALLKFLLD
EVQDPLCAEVFNKVNNDESRHLAVGFQVLNDLGASPMRIHATQTMGALID
PRILLGGVLYVPLLTRMLTNLNAMGLSEEKLYNAVMRYENVGDRSEFTRR
VPGYHILKAHMSASIKRSQPLHFISQRLGTAIDHFPTEVLGKSPTWTEEL
TYEPVAR
145225186YP_001135864.1 FAD dependent oxidoreductase [Mycobacterium gilvum PYR-GCK]MSDTTTVLIVGAGFAGLGTAIRLLQQGIDDFVVLERADEVGGTWRDNTYP
GAACDIPSLLYSYGFEQNPDWSRAYSGSAEILGYIKTMVDKYSLSRFIRF
GVNVTGLEFDEESALWTAQTADGSQFTARTAVMASGPLANASLPDIRGLD
TFDGHKIHSARWDHDYDMSDKRVAVIGTGASAVQIIPELVKTARSVKVFQ
RTPGWVLPRPDFSHPQWVRTAFRRLPRVQNVGRQAWFWGHELMAVGMVWD
TPVTTGIQLLAKANLRRQVSDTWLRRQLTPNFRAGCKRMLMSSDYYPALQ
RDNCKLVSWPIATLSPNGIRTADGIEHELDCIVFATGFDVCKAGTPFPIR
GAHGRELSDEWSQGAYAYRSVTVAGYPNLFFTFGPNSGPGHNSALVYMEA
EINYIVKAIGAIIANDLSTLEVREDRQNNYHGEVQQRLGSTTWNSGCKSW
YLTNDGYNGTMYPGFATQFKRALSKVDMGDYVTTPTTARTEHHPTEHAQN
GSNVAKVAQGRKAKVAQGRKSAGALPTRSDVKADILDVGVGKVPPKRAAS
RVRKDA
145225185YP_001135863.1 cyclohexanone monooxygenase [Mycobacterium gilvum PYR-GCK]MSVHVAGDENAPTSGAPTYEVPTHEILVIGAGFSGIGVGIKLLKEGFSDF
LIVDEAQGVGGTWYWNTYPGIAVDIPSYSYQFSFEKRPSWSRTYAPGIEL
KNYAKHCVKKYGLASRIRFGVTVVRAEFDEESTLWRLFTSTDEELTARFV
INASGVLTRPKSPDIPGVGDFGGVTMHTSRWDHQQTLTGKRVAVIGTGAS
AVQLIPSIAKDVDTLTVFQRTPIWCLPKFDFAVPRPLSALLRLAPGAQIA
ARGASQAFVELTFPVAAHFHTAIPLASAIERAAISYMRRQVTDPVVREKL
TPRYALGCKRPSFHNEYLKTFNRENVLLETNPITRVDETAVITADGVRHE
IDVLVLATGFKVMESDSMPTYSLRGVAGRDQAQWWDENRLQAYEGVSVPG
FPNHFSVFGPYGYNGSSYFALIEAQAGHILRCLRHARTADSNYVEVREEA
NQRFFAEMLARRHTQVFWQDSCAGANSYYFDKHGDVPLRPTTTVESIWRS
RRFDLADYRFERRPAKKADTAPQKVDTAG
145225184YP_001135862.1 alpha/beta hydrolase domain-containing protein [Mycobacterium gilvuMSSPARPNPSMASHLVAATARRVLRPLTQVIPANDHGFAVMDRVLRGTLV
VSRPRRAISVEKVDTPFAGERVRGDWVKAANVASDAPPILYIHGGAFSMC
SPETHRGLISELSAAARRPVFAVRYRLVPRYPFPAAADDALIAYRWLTEG
SAITASSGTVALAGDSAGGQLAAATALGAREHRLPTPDAMLLMSPVLDLT
CQLAMDRDLRRRDPFASAISASRTIGLYVAGADPADPRISVLDADLTDMP
PTLIQVGGREMLLDDSRVFAKRLQTAGVSSQLQVFRGQIHVFQAMFRLLP
EAREALRLGGEFLATSATVR
145225183YP_001135861.1 FAD dependent oxidoreductase [Mycobacterium gilvum PYR-GCK]MKPVKREPTQDNPPGNPSIVIIGAGFAGITLALRLKRAGFDRVLIVEKGD
GVGGVWRENTYPGAACDVPSQLYSISSAPNPRWGRRYAEQGDILAYLRRV
ADESGLLSLLRTKTEIAKAAFDERTNTWRLTTTTSQELECDVVISAVGQL
SRPSVPDIPGISGFAGPSFHSANWDHDLNLSGKRLAVVGTGASSVQFVPV
VAAGAEHLDVFQRSAPWVLPKFDRQYGGRHHQLLRKLPILRLSERLMIWT
IFEFLALALVDAKPVARVLGVIALRHLGRQVSDARLRSHLTPDYAPGCKR
ILFSSDYYPALARPNVLLVTDDIQAVEPGGIRTVNGDFHAADVIIYGTGF
SATEFLSPMEVYGRSDRKLSDVWADGAHAYYGLSVPEFPNFLMMYGPNTN
VGSGSIVYMLESQARHIVRLMKVLRAHPGSVIEVRADVEKRFNDRLSRRL
DRSVWTMCTSWYRSARGSISTNWPSPTFLYRLRARRPKRRAYVLSRPAPA
NSSRRGTPEPANTHLADMPYAPSGADSVD
145225182YP_001135860.1 cytochrome P450-like protein [Mycobacterium gilvum PYR-GCK]MIFLMMAAHDTSTITTAAVAYFLAKNPEWQDRLRAESDRLGDDLSDIEDL
EGLTAMDLVIKESLRLVAPVPLVMRKTVTDTLIDGYYVPSGVLVVITPAV
NHFAPTVSTEPDRFDPTRLEPPRREDQAHRFAWLPFGGGAHKRIGMHFGT
LEVKAILHEMLREFTWSLDDGYRVRWDNTSLPVPCRRPTYYVVSPMISRS
FHETFECLAEHIALTGRRRNRRSPPSGLGDPQQTPANRSRQTYANCRKGW
SC
145225181YP_001135859.1 short-chain dehydrogenase/reductase SDR [Mycobacterium gilvum PYR-GMVMLEPSTAVVTGAGRGIGLEIARQLAAAGHKVLLTDVDGDAAERAATEV
GGGAWSATHDVRDPSGHREVAAQALAAGPLAVWVNNAGILLAGNSWSHSD
AEIASILDVNVRGVVAGSHAAVVAMGAGGGAILNIASLSALAPIPGLAMY
AATKAAVLSFTTSLQGDLDHAGLPIHARALCPDVVSTKMVTDRVADPGAA
LLFAGPRPMDAAAVARAGLELLESRQIFRVVPRWRGVVARTSDAAPSLGL
KAFALMRGVGERRQRNHR
145225180YP_001135858.1 TetR family transcriptional regulator [Mycobacterium gilvum PYR-GCKMDTTAVRRAASRLPGRELRREQIIEAALSAIEENGPHALTGQIADKAGLG
RTHFYRHFASKEELDLAVARHVHRELTAKIRLTLDVQGSPLDVIRAPVTQ
HVMWADEHPNLYRFLVNRHYRRSTEKTAPGSSAFASELAVAGARYFPRYG
EDSEAADRNVAAIMGLMDASVLWWLDHRDSTRDELVIRLTRQTWLIINDR
LQELGFQLDPHLPLCEPKT
145225179YP_001135857.1 acyl-CoA dehydrogenase domain-containing protein [Mycobacterium gilMAANRSSWMDDDLDALRDLARTFCEKEVAPHSARFIEQHHVDRDLWTRAG
DLGLLCMSIPEQYGGGGGTFAHEAVLIEEQARIGDSAWGAPLHSGIVAHY
LLEYGTDEQKERFLPRLATGEMVGAIAMTEPGTGSDLQSVTTKASRVGDE
YVVNGSKTFITNGAQADLIIVVAKTDPSAGANGISLVLVEGDRPGFRRGR
VLDKVGQRGQDTSELYFEDVHIPVENLLGTTEGQGFIQLMQQLPQERLIL
ALGAVTVLETALEFTVEYTKDRHAFGKPVFAFQNTKFKLAEVATDAHISR
VFIDDCVARHLRGELDIPTVAMAKWWTTERAMVALDDCLQLHGGYGYMTE
YPIGRMWADARVQKIYGGTNEIMKEIIARSL
145225178YP_001135856.1 putative adenylate/guanylate cyclase [Mycobacterium gilvum PYR-GCK]MLVSSRPTPLVTTMLDLIDSASANDLPSLRIGVASGSAVSRAGDWFGNPV
NLASRVSAAARPGAVLVGLHAGDRRRRRPPVVVRRRISSEGRQQQGQPVS
GAARPGRPSKAPV
145225177YP_001135855.1 TetR family transcriptional regulator [Mycobacterium gilvum PYR-GCKMNKVVVAGRTRVGGERRERILASATELIAERGYHAVSMADIGVASGVVGP
AIYRHFNSKSDLLAALFERVVDKLLKRATAIVEQSRDEAEALTLLVSDQV
ALVMDQRELAMVYYREVHNLSDQHQSRLRRKQRLYLEEWVHLVGELRPAV
DEIELRAMVHGAIGAIQSILHYRGTGLAPEQTSALLVAMGHAVLGVPASS
HQVRGVNTEPSCPRPGTPQH
145225176YP_001135854.1 hypothetical protein Mflv_4598 [Mycobacterium gilvum PYR-GCK]MRDPVRIGNCSGFYGDRIAAAREMVEGGTGEQSIDVLCGDYLAELTMLIL
AKAQAKDPAGGYARTFLTQMEQVLGTCSDRGIKIVANAGGLNPAGLAVRL
RELADRLGITVRIAHIEGDDLRGNLSAITPAVGEVKPVSANAYLGGWGIA
EALGAGADVVVTGRVTDASLVVGPAAWWHGWERTDWDRLAGAVVAGHVIE
CGPQATGGNYAFLDEITDRRYPGFPIAEVAADGSSVITKHADTGGLVSVG
TVTAQLLYEIAEPAYLGPDVVTHFDTISLAQQAEHRVAITGVTGSPPPET
LKVALNEVGGYRNTMTMVLTGLDLEAKAAFAQQQLFDILGGRGSFAEVDV
RFLRFDTPDAPTNDQACAHLRITVKDTDPRKVGRAFSSAIMEIALAGYAG
FHTTTPPTSESVFGVYRPATVPRSSVTQVVVLPNGERRRIADPPTGSVPA
AKVRGSAAAAPPTEPTCRAPLGAVLGARSGDKGGNANIGLWARDDAGYAW
VREHLTVERLRGLLGPEAAQLRIERFELPNLRALNVVVHGLLGEGVASST
RPDAQAKGLCEYLRSRIVDIPQSLVGAT
145225175YP_001135853.1 wyosine base formation [Mycobacterium gilvum PYR-GCK]MAVPMESLITDIGAETAELWSLIAELPEGQAGWDAPTPAAGWAVRDQISH
LAFFDDAAVRSATDPEGFTAEVLPMLADGRISPDTIAERYRPMPTAELLS
WFDGARRALVAAFAAIDPSMRVPWFGLPMSAASSLTARIMETWAHGQDIA
DALGVTRVPSARLRHVAHIGVGARAFSYMANGLEVPEEPVRVELTAPGGT
LWTWGPDGVPNRVTGTAHDFCLLVTQRRHRDDTALHVTGPLADQWLSIAQ
AFAGPPGGGRTAGQFDGGVS
145225174YP_001135852.1 enoyl-CoA hydratase/isomerase [Mycobacterium gilvum PYR-GCK]MSEEAITYEVVDGVAWLTINRPEARNALNGAVRQGLFHSVHRFNADDSAK
VLVLTGAGDKAFCAGGDLKEMAETALTVPPPDFAPQFGRNIQVAKPTIAA
VNGVAFAGGFLLAQQCDLVIAAEHARFAVSEVKVGRGSPWAVPLSWLLPP
RIALQILMTGDPITAERAREVGMVNEVVPAAELRVRVQEIALRIASNAPL
SVLAAKKTVYLSAAHHLTEAYAHADQIWEPVYLSADALEGPAAFREKRTP
VWKGR
145225173YP_001135851.1 type B carboxylesterase [Mycobacterium gilvum PYR-GCK]MPAKTVRTELTSGAIEGFTRDGVNRWRSIPYAKPPVGALRFKAPQPVEAW
DGVRPCHRFRYCAPQPRRYTIVGPGKFQPMSEDCLTLNVVAPDGGSDRPL
PVMFFIHGGAYFLGSSATPIYDGASLARSGCVYVSANYRLGALGAVDLSS
LSTADIHIDDNLYLRDLVSALRWVRENIAAFGGDPDNVTIFGESAGAHAV
TTLLAVPAAKGLFAQAISQSPAGALSRSQELAAEFAAKFASILCADEREP
ARLLLAARPAQLVNAFDRLLTTSASDLAGGYPVGCTFGTDYLPSEPIQAM
RDGKAYRVPLIVGTNADEGRLFTRFLKLLPTNEAKIEALLAGAEPTCRER
ITAAYPEYPAPDACIRLGADFTFGSTLWQLADSHSRHAPTYLYRYDFAPR
TLQWAGLGATHATELLAVFDAYRTPLGRLLSAGADRRSALRVSDDMQGRW
DAFARTGVPGDGWPRYTSDARPVLVFNRASRVDNDPHADRRKAWEGFQVL
GR
145225172YP_001135850.1 helix-turn-helix domain-containing protein [Mycobacterium gilvum PYMDWAQGARSVKFSNAGVPPVAFVQMLESQALDPDAVARLRTIMAREGTDE
ATLMQHDVQAPLRWFRDLYPDLDVDRATLLGFSFAGQAQLTSFGPLSVPL
VSAGSVAEIVELLTYLPLITTAINAQFRPNDQGLTVGLWGHTGDRALDCL
AVTYTGSALLRLLDMLVSDALTVTLHLSWSAPVSLNKLAAEMVLAGRLFF
DAPMSYLHVPVNALNEVCRFSDPLAYRLAVAELRRTLDEQSGATSFSKKV
RRLLDEDPGQRSCQRVADELSVSTSTLKRRLAEEGTTFRELRQSCLRESA
MMLLITRSMSASQIATELGYGDLANFSHAFKRWTGRSPSEYRRSQR
145225171YP_001135849.1 ferredoxin [Mycobacterium gilvum PYR-GCK]MAVVTFVSHDGDKHQVPLDEGQSLMQVATNNAVPGIDGDCGGEAACGTCH
VVVDPQWSDQVGSSGVGEEEMLAMNPERQPTSRLSCQMTASEAWDGLIVH
LPEFQM
145225170YP_001135848.1 cytochrome P450 [Mycobacterium gilvum PYR-GCK]MVKISEKVAEKVQATIPIDLQIQGAHAYDKTRRWVTGTNGKKLFVERPIP
PAEEVELADIDLSNPFLYRQGRWQSYYERLRNEAPVHYQRHSAFGPFWSV
TRHADIVAVDKNHEVFSAEPLIVIGVPPRFLDIKMFIAMDPPRHDLQRAA
VQGVVAPKNLREMEGLIRSRVREVLDNLPVDQPFDWVHDVSIELTARMLA
TLLDFPYEQRRKLVEWSDLATSMEQTNGGPSDLDETFVGMRAMARDLSRH
WHDKAARTGAGEEPGFDLITMLQSNESTKDLIDRPMEFLGNLLLLIVGGN
DTTRNSMSGGVLALNRYPDQFEKLKANPDLIPNMNSEIIRWQTPLAYMRR
IAKADTMLNGQFIRKGDKVVMWYASGNRDERVFDRPDDFIIDRDNARNHI
SFGFGVHRCMGNRLAEMQLRILWEELLPRFEKIEVIGEPEYVQSNFVRGI
SKLMVRLTPKAGA
145225169YP_001135847.1 FAD-dependent pyridine nucleotide-disulfide oxidoreductase [MycobacMTLHRAVIVGASHAGAQLAASLRQEGWDGEIVLVGNESALPYHRPPLSKA
YLAGKCTVDELAIRNAEFYTKQRIKLMDATVEVLDRSAGHLSLTTGDALP
YDKLALCTGARPRRLSIPGADLPGVCYLRTAADVAMIRERTSPGRRAVIV
GGGYIGLEAAASLRALGLEVTVLEATERVLERVTAPAVSAFFDRIHREEG
VDIQTDALVDAMSGDGRVREVILASGESIPADLVIVGIGVEPNTDLAAAA
GLAIDNGVVIDDQARTTDPDIVAAGDCTSHHMARYGRRIRLESVPGAGEQ
AKVAAATICGKSKKVAALPWFWSDQYDVKLQIAGLNTGYDEVVLSGDPTR
DRDFTCFYLRAGELIAADCINRPRDFVFSKRVITQQVPIERAELMLAGPA
145225168YP_001135846.1 hypothetical protein Mflv_4590 [Mycobacterium gilvum PYR-GCK]MAVFKDEDEVYAFLGGIFGRGLEKEGLGDKLASSGVVLRVHYTDPDAVVT
VDMPNKVVETGASSTAVPSVELFMSADTGNKFWLGKVNLTMAMAKGTVRA
KGPVPKLIKLIPQAKNLFPEYRSMLQSQNRQDLIDA
145225167YP_001135845.1 long-chain-fatty-acid--CoA ligase [Mycobacterium gilvum PYR-GCK]MQDVALTVPAIVAHAAAVHGDREVLTARGPQQISGVSYHELGQRAARLAN
ALREIGVRGDERVATLQWSNQEHLDCYAAVPSMGAVLHTLNLRLPPEQLT
WIANHAEDQVIIVDGTVLNLLAGALPSMTSVHTVLVTGTGDLAAVQGCGK
DVLRYDDVVGAQSSTFDWPDVDEQSAAAMCYTSGTTGRPKGVVYSHRSTW
LHSQAACTSNALGIGHDDTVLAIVPMFHANAWGLPYAAMMAGAQLLLPDR
FLQAGPLVEMIEAARPTMAGAVPTIWTDVLHYLRDNPGHDLSSLKMVACG
GSAVPRSLMTAYDELGIRIVQAWGMTETSPLAAVALPRDTDTPERSLYLR
GTQGRVVAGVQARIVDDSGAEQPWDGKSVGEIQIRGPWITQSYYEYDSPA
VSPDGWLCTGDVGTISADAFITLTDRAKDVIKSGGEWISSVELENELAAH
PAVRTATVIGVPDDKWQERPLAVVVLAADCTATAAELTEFLRARVAKWWL
PERWAFVADVPLTSTGKFDKKKLRSQHADGDLAVETLA
145225166YP_001135844.1 alcohol dehydrogenase [Mycobacterium gilvum PYR-GCK]MKTRAAVLWGLGEKWEVDEIELDPPGVDEVLVQLTASGLCHSDEHLVTGD
LPFPLPVVGGHEGAGTVVEVGAGVEDLAVGDSVILTFLPSCGHCSYCARG
MGNLCDMGAAIMMGPQIDGTYRFHARGEDVGQMCLLGTFSEYTVVPKASL
VKVDHGTPLDKAALIGCGVTTGYGSAVRTGEVRAGDTVVVIGAGGIGMNA
IQGARIAGALTIVAVDPVEFKREQAGGFGATHAVATIDEAWSLISDITRG
KLADVCVLTTDVAEGAYTAEALSLVGKRGRVVITAIGHPEDTSMSGSLLE
LTLYEKQIRGALYGSSNAAHDIPRLVELYNSGQLKLDELITREYTLDEIN
EGYDDMRSGRNIRGLIRF
145225165YP_001135843.1 hypothetical protein Mflv_4587 [Mycobacterium gilvum PYR-GCK]MAKVQIPYRHRMGGHCGSGALRDLSEWAELGWGTEALSEGLVFALGGALD
FSYVRSAQLFPQVYLVGRGSDLERDYLTRVGANFVVQSTDDPHEGWAFVT
DEIDEGRPVMVWADIGELPYLRVRLQMSRHDIVIVGYDDEQRVAYVVDND
RDTTQLVPYDALRRARSSVGFPTPTRHTTYHVDWPDQMPDLRPIAGAALA
ASAAFMRGDAAGAPLLRVEAADVESSGLNGVHDFAADLRRWPTLFDDDAL
AAALFGLGAFIEKAGTGGGLFRTLQAQGCQSIADQLHDAAAADAAAAAKH
ASEAWSALAAAATNVDAPLRSRSLATADVAAMIPEAEVRLVEALEKASRS
VSAVEIDIESN
145225164YP_001135842.1 hypothetical protein Mflv_4586 [Mycobacterium gilvum PYR-GCK]MSEIPSDSTFLETSEFLDWQHDDVQRFTDEAVGDARAPVEKARLIFAAVR
DRIWYDPYSTDDDPEHYRASYVATASKAYCVPKAVLLTAAARAAGIPARL
GFADVRNHLQTPTLRARMGGTDLFVYHGYSELRLNDRWVKATPAFNAELC
ARFGVPPIDFDGHSDALLHAHDGEGSKHMEYLNDRGWYHDLPFTDIVTEL
HNRYGPLMQKSAPERDAFSQ
145225163YP_001135841.1 thioesterase superfamily protein [Mycobacterium gilvum PYR-GCK]MAWWHDFKSRAVVEDGDDLQQHHPWCLGCGKDNPHGHGLRARRRGNGVIA
RHVFDGRHRGAPGIAHGGAVITVLDDMVGMLLYVVGEMAVTRKLNTEFFA
PVLLHTQYLVSADLVSRTGRRLEVRAELREETTQKLVASADGLFVVVTLV
HFTDAAGKGPPARNGENDDSREAMGNRHP
145225162YP_001135840.1 TetR family transcriptional regulator [Mycobacterium gilvum PYR-GCKMHDTPSQICDRHPASADLSAEKGPNDSKFEDVAAVTGVPKATLYYYFAGK
EDILAFLLEDLLKDISEAVTAIVHTDGTGAERLELVIRAQLRAMAQRPAV
CRALIGELGRAARMPAIAEMINTAYQQPVEILLIEGARDGSLVAQPDARS
TSIALFGAVTINALMYLVTENHLDETVVASTLSAVMFDGLRPRTGDQS
145225161YP_001135839.1 luciferase family protein [Mycobacterium gilvum PYR-GCK]MSTYGLSVLGADLKSLAQTAQAADAAGFDAVWASEFYSRSGSISMAAMAN
STQNCRIGSSILYGVGRSPLVLATEARDLDELSNRRLVLGIGNGTKRMMS
DWHGVPDTSAPALRMEELVMLLRRIWNLHEGPIHHEGRFYRMNLTPTGDV
GPPSRPIPIVTAGVRPRMCEAAGRVADGLAGHPLFTTTYVEEIVRPAIAR
GAARTGRDPNDVEIISMVMCAIHDDAEVARRELAQQIAFYSSVKSYETVL
DVNGFASEGRTIREAFAKGDFPAMFAAVSEEMIDTMGVAGTAHEVREQLR
RYDGVLDHIMLYSPSVGIAAERVQQNLDSIIGECSPASMSPGQSGPGST
145225160YP_001135838.1 hypothetical protein Mflv_4582 [Mycobacterium gilvum PYR-GCK]MYTQWIENLVVQRLSLRGGLVLDFDDYNEIVISCPLLLTLPAVGTYPIEA
VRIDPLRIATHERPLLNLAGAVCTQAWSSDDGGLHLSFSGGHRIDVEPDV
EQTAWELYGMRHGYMACLPRGRVRVVRHDLPDTDDANILNSATQSSAGSA
RQTH
145225159YP_001135837.1 TetR family transcriptional regulator [Mycobacterium gilvum PYR-GCKMTFPQARSHGKTLPSEANSVATEKRAANASRSRASARRRETILDAALTVA
AAGGYEAVQMRTVAERVGIAVGTLYRYFPAKTHLLVAALTREFRRLDSAG
DWASGEGPPLERLERLTAHLHDRWQRDPRLTTAMTRAFAVADTRAAAELD
RAADEIQILLARTLRGGEPTPTDLHVAGVISDIWLANLVAFSGHRATAAD
TRERIDRATRRVVTSAARPTANR
145225158YP_001135836.1 thioesterase superfamily protein [Mycobacterium gilvum PYR-GCK]MPKSVLPPERLPSHTTTCMGCGPDNPHGLRLVVHRSGDAVFTDVTFDERH
IGAPGLAHGGAVAAACDDVLGFTLWIAGTPAVTRTLTVEYLRPVPLHQTH
RITAHIVSREGRALHVTATGTGEGGIARFTASAVFIVVSPEHFAAHGDVS
AFGDLLEQFSRRGGLDPGPS
145225157YP_001135835.1 TetR family transcriptional regulator [Mycobacterium gilvum PYR-GCKMSDSQSVPVPDDDVDPRRIRSRTRLLDAAATLLSTGGVEAVTIDAVTKAS
KVARTTLYRHFHSSSHLLAATFERLLPQVTTPAPTSGPLREQLIELLSRQ
AALFNDAPLHVTTLAWLSLGPTGSNNEADDRHTSVALRARVVDQYRQPFD
AILTSPKAQAELDDFDRELALCQLVGPLAFARMTGIRTITHNDCANIVDD
FLTAHRKTDSDAKESKIATKQTGRPARLAR
145225156YP_001135834.1 ABC sugar transporter- periplasmic ligand binding protein [MycobactMRRSRTALLGAVGVTMSLVAASAGAANASPDAGDVTMVNVVKVEGIPWFN
RMAVGVENFASRTGVHASQVGADDTSAQKQVQLIADLIPRRPTAITVVPN
SVDALEDVLGQARAQGITVVSHEATGIRNADIDIEAFDNAAFGRQTMQSL
AQCMEGQGEYVQFVGSVAMTTHMQWVDAAHDMQLAEFPSMTRIEGPVETA
NDEPTAYARATELLVKYPNLKGFQGAASTDVPGIARAVRDAGLQDRTCVM
GTAVPSVASTFFADGSIDKIFFWDPAMAAEAQLQIALMLVQGEKIETGTD
LNVPGYDSLTKLDGYDNVFVGNAALEADANTISQNQF
145225155YP_001135833.1 phosphoglycerate mutase [Mycobacterium gilvum PYR-GCK]MPDPRTCRVRRILIAALSAVLLVLVSAIPSWAMTLTFVRHAESLANEAGI
IDTRVPGPGLSEAGELQARAIAPVLAGMGFDGIYVSSMLRTQLTAQPMLD
LLPGSSYQVLPGLREISAGIFEGSSENEGLGRLGYALAPVTWMLGARFVP
VPGGEDGNAFDARVDGAIAEIADNGDENAVAFAHGATIMFWVMMNVDNPD
LLLMLRHQLDNVESVVVEGSPEEGWTLVSWAGQAVSADPSLATKLLVNVR
DLVVAPQTALYNVGTAFSSGDFETLVNAVRDGLIEVTRAVVRFIPDTVRD
IVDEFRPSVTEDSLDVTELHRAVVTAAPQDDDEAEPQSVAVAEAETRNGS
GVAPAGSTPPSGDEVTGSTDDDEATASDVVLEDTVDVDTIDVDTVEEDTG
ASDHAVGNHPDAEADDAAPANGSAKSSDDDGDSDDDASERAAA
145225154YP_001135832.1 hypothetical protein Mflv_4576 [Mycobacterium gilvum PYR-GCK]MTSYVRHPLTAVWAVLTAVTIVSWLTARDGGASHHLNATVTVVVLVIAAV
KTQLVIWHFMEVRHAPQWLKVTANGWLIAVVGLLLGFYFAAL
145225153YP_001135831.1 cytochrome c oxidase subunit III [Mycobacterium gilvum PYR-GCK]MTGLGVAEAHETPRKAKGRGHLPGEPSMWFFVIGDLIIFGVYFVVYMYYR
GQDHQLFLESQARLNTDIGAVNTVVLLTSSLFVALGTSALRTGKVADAHR
LFLMALVAGSVFPVLKAFEYVPEVASGLTPGTNLFFMFYYVMTGMHLCHV
LLGLAILYFVVRDLRGPAEPRLSLAATGATYWHMVDLLWIILFALLYLMR
145225152YP_001135830.1 hypothetical protein Mflv_4574 [Mycobacterium gilvum PYR-GCK]MSTDTAPAHAGGRARRPRRPAKLDQWIAFWSVPVFFSLFGLVFIPLSWMM
PPRSPSSPQDEIVAFMQSPNLLIACVILILAFGLAPVSNACYLNQIRRMS
VSPALRYALMAGATTGTIVGMLFPMFCFGLGAFRPGYDPAILAMLYDFGY
LAFIGSLGCFCIMWMAFGLAIILDKNTILPKWLGYYTVWQYVTELMAAPV
WIAKTGPFAWNGLLTFWFAMALYVSWQMIVYVCIFRAIKNQPDDELDNAA
LIAPPTGPPVRSGADS
145225151YP_001135829.1 hypothetical protein Mflv_4573 [Mycobacterium gilvum PYR-GCK]MTTTTAAPSAAMNTRGQRILLWTVPPAAALFVLAYFLFPVFSAPLSPTMT
PEQVAAFFADNVTGILGVAILCNLIACSLVPLFAVTAVQISRIGTSSNVF
TYAYMLCVGVGLTAFILADYCWAMAAFRTDRDPQLISLLNDMAWFFFIAP
VGTIVVANLCLAVSIYLDARPEPVFARWVAHFNVATAVLLVPSAFSLLYK
SGPLAWDGAVSFDLRMIVLAVYVAVMFVVLVGVVNRQGAERDETV
145225150YP_001135828.1 TetR family transcriptional regulator [Mycobacterium gilvum PYR-GCKMRQNGRVPNSATQREVQRQNTRARLLDAAIVEFQRSGTGGADINAIVKAA
GVARSTFYFHFPTKEHVLLELIRRDERHLAEELDRFLETRHDLPTVLTTI
VELVLDLESRWGGALFHDVIRLYFSPARPEREQWINHPIFVLLAAEIERS
RIRGELYDDVDAYHSAAFFLLGLYALLTTVGESRSERDLALTKFVTSTLR
SLRPASPR
145225149YP_001135827.1 diguanylate phosphodiesterase [Mycobacterium gilvum PYR-GCK]MRGLRPTVPGLSGGNIVRDLVGELIASIDPQSLLQRIVEQVCVRMPTASG
ASVALKTPGDFLEVLATYGATGTLKGRVVPIDDTFQVYPLGSGRPEIVDD
TATDARITPQVRELSQQLGVRSCLSIPLISEGSAIGTLSVVAHEPYAFGA
SDVAPVSAVAEFLGVLISASTQLAALLKDLLGAGSIRVDSRAAADLLASV
LLPELSERDELRRVIDDVVMAGEIVPVFQPIFDLITGEVIGFEGLSRFRC
EPTRSPDKWIALAHNVRRGIDVELKALRALLKGALSIPDKYLVSVNLSPL
ALADPIIQQELLSYPRGVVVELTEREPAPELLGESVEPLRQSGIRLAIDD
AGSGFAGLTTILRLRPDIIKLDRELTVGIDTDPSRRALATALTHFAREID
AYTVAEGIETEVQMQLLRDIGIRYGQGYFLGRPQPVDVFEESLFSRA
145225148YP_001135826.1 thioesterase superfamily protein [Mycobacterium gilvum PYR-GCK]MSDDPAIELAGSVRRLIDATIRTLADDATIRAVQSQIDSLTAQLTVETIP
GAVGVHHIAGISRVAGNVIIGERNAIAPPLTMHHRDDGGVATDFALGVAY
EGPPGHVHGGVCAMILDHVLGAAVHQPGRPAVTGTLTLRYRRPTPLDAAL
RAEARIRETQGSKTFVEGFITHGGEVTVEADGIFLFPRR
145225147YP_001135825.1 flavin reductase domain-containing protein [Mycobacterium gilvum PYMTTHPELLVPDPATMRHVLGHFCTGIAVITGHDGVRPLGFACQSVTSVSL
EPPYVSFCPASTSATWPLIRSTGKLAVNVLAREQRELCAQFATSGGDKFR
GVSWSPGHNGSPVLDGTVATIEAEVEYEHGAGDHTIVVAHVTGLRAARDT
EPLLYFRGAYGGLDASAP
145225146YP_001135824.1 PadR-like family transcriptional regulator [Mycobacterium gilvum PYMTDSADSGSGRKPGLAATSYALLGLLSYEQELSGYDIRKWIGWTMRFYYG
SPAYSQIYSELKKLESLGLVTSRVESTGGARSRRLYKIAPAGLDEVIRWA
NDEPFDPPSLKHGPLLRMTFGHLSTPARLKELLNEHIAYADEMEREAAKD
ARLAGADPSWAYARVALRWAERYYANERELALQMIKDLDEAEAEFPRAAH
GDQAAVAWPEPAYWYEVEQRAQSEADS
145225144YP_001135822.1 Rieske (2Fe-2S) domain-containing protein [Mycobacterium gilvum PYRMGMTVQPPADEVRLIEADAAPTRFARGWHCLGLIRDFGDGTPHQVNAFGQ
KLVVFRAEDGSINVLDSYCRHMGGDLSQGTVKGNEIACPFHDWRWGGDGR
CKQVPYAKRVPRLARTQTWPTLEQDGMLFVWNDPQRKPPPDDVTIPRIEG
ATSDEWTDWHWYTTVVHTNCREIIDNVVDMAHFFYIHGSLPTQFKNIFEG
HTATQFMSSGGRPDLGQAEGGVKLLGTTSLAAYHGPSFMIDDLTYHYEHG
DTKTVLINCHYPIDANSFVLQYGIVVQKSADLPEDLAVQTAVALGDFVKM
GFEQDVQIWRNKARIDNPLLVEEDGPVYQLRRWYEQFYVDVEDVTPDMVD
RFEFEIDTTRPRESWMKEVEDNIAAGRIPKLASGTT
145225143YP_001135821.1 hypothetical protein Mflv_4565 [Mycobacterium gilvum PYR-GCK]MTVRPDNRLADGPMAPVQCNRCAATVLVRKSSWHQTSVQWDATATARCEE
RHDARQLAGEGGLFLTCSALGDSVADAVVRGTLHTVDDA
145225142YP_001135820.1 hypothetical protein Mflv_4564 [Mycobacterium gilvum PYR-GCK]MAEYDVIVVGFGAAGAAAAIEAADRGARVLALDRGYGGGATALSGGIIYA
GAGTAEQHAGGHTDSVDNLRAYLTQEVGDAVGEDTLTRFCAESPGLIAWL
KAQGVEFRGGPVSSYKTSYPTDDFYLYYSGNEKAYPYAQHAAPAPRGHRV
LAPGMSSGRVLYERLRDSAKAKGVTVIPLARVHGLITDAGRVVGVRYRVL
DQGHPNAHRHRVLTRATAKLGTWMPGLVNGVVARAERLWAEAAVQTEARA
PSVILAAGGFIFNREWVQAHAPKFTKISPLGTAGDDGNGIALGLDAGGFT
DKMGNVAAWRFLAPLSAFLEGLTVGADGRRITNEDLYGATHSNVMMREFG
GTGWAIYDARTWAKIRGQVRTQTQLFQRLQLIYLFTTGHRKSSTLEGLAR
KNGIDPAGLRRTVDAYNSGIVSGTGDPAHKDPGLCAPMTTGPFYSIDISA
ASSMFYPVPGLTLGGLVVDEKTGEVMHRAGGTVAGLYAVGRTAVGICSNS
YVSGLSLSDCVFSGRRAGAHAAG
145225141YP_001135819.1 hypothetical protein Mflv_4563 [Mycobacterium gilvum PYR-GCK]MMLTEERRRELSDVLRPAAPPVEVDGVYTEDQKRRLLDVVHDRGPWKLII
AQHFASADELMATMSGAFPEGFEPSLDLFLTPTFRGYLANYGAVLYPELH
DVIYNEKFLSHAKSYWGAQYAKPELMLFNINGPCANRDPGHLDSPSFRGV
RHENAPTWLCSVMGKSGLFSDYLIKMAQVITWFSLDEGSGFTYWPEGPLA
APKRLLPPINNRGVVVQNEMMVHRGEANGPLEQQMPAGLAFDTVFAGDPA
DRDRWVLKNGDDVIARHHTDDLRFLVHWSAEVFSDFDELKKNMDGSDDLT
IDKAIDMLVDNLRKQGINLDIPSAPLHDPAFIGALNAAYDIGAPTTYPAE
APLSAFQLA
145225140YP_001135818.1 alpha/beta hydrolase domain-containing protein [Mycobacterium gilvuMPGPTLDPDAAARVASFGPIPPMHERGLDAVRAGVENTPVPDDMPAMASI
EERCAPGPDGPIPLRIYRPTDATDASVVVYFHGGGMVMGSNRSFEPLARA
LAAGSTATVVSVDYRLAPEHPAPAQFVDCSAVTTWVAENATSLGVDPARL
AVAGDSAGGSLAAAVTLAARDCGGPVICAQVLMYPGLDRDMAAPSMVAMP
DAPLLSRADIDYMHELADDGVGAPHDAYRIPAYAEDLSGLPPAIVVTGEC
DPIRDWGERYAQRLRDARVQTTLTRYPGMYHGFLMRPDGTARGRLAMAEI
GALLRAKFAEPLPF
145225139YP_001135817.1 short-chain dehydrogenase/reductase SDR [Mycobacterium gilvum PYR-GMSARGTFAGGVAVITGAGAGIGAGLARYASSLGMTVVLVDIDAGAVAGLR
AELEAAGGVAVDAMCDVRDPVAVQELADRVYRDVGPVRLLVNNAGVEQFG
YLWDTPVANWNRIMDINVDGVFHGVRAFLPKMIDAGTPAWVWNMSSIGGV
AVVPLQAPYIVTKHAVLALTECLHLEVRHAGHDHIHVQAVLPGAVVSNIF
ESARGVDDSDSEAVTAAESQRAAMLDIKAAAMDPVAAAEVVFDQAAAGEF
YLLTQPGYVSSAMTERARVLSTRQAPQLRTERRFDPAKH
145225138YP_001135816.1 hypothetical protein Mflv_4560 [Mycobacterium gilvum PYR-GCK]MSNEITLPEVQEFIAGFWYHYDQGHFEELASRIGDEMEYVSRSDSGNCPF
EELLAAELHGGEQTLAWLTQHRNENPYPLRHHATNIFRTGVSGEVTTARF
YLYVNQVTNNVPFDVSSGVVDVGIRRGEGGLVFTSMSVVLDAEDSIPFAE
YRTKNSAAVVSGS
145225137YP_001135815.1 acyl-CoA synthetase [Mycobacterium gilvum PYR-GCK]MPEDLLAAQIRRVRSQTVGDIPRRSARRHPHKLAIVDGTTRLTFAELDAH
VDRVASALRDSGFGKGDRIALLSHNCWQYAVLAFATARAGVVMVPVNFML
GPDEIAFILGHSKVTGFVVETALVPVADEAMAAAGEDCAVTTRIAITSGD
PVPAGWQDYAHWSQSAATPAPAVEIADDDVLRLMYTSGTESRPKGVMHTS
RSLMWQYISSIVAGSMSGEDVEIHSMPLYHCAQLDNFLITDVYLGATSII
LPGPDPEAILRTIEAEQVTNFFAPPTVWIALLRCPAFDRYDLTSLRKGYY
GASAMPREILHELRDRLPNVSLWNFYGQTEIAPLASSLGPDEQDRHGGAA
GRPAVNVETAILDDSDNPVPPGTVGEIAHRSPHLMVGYLDDPQRTAEAFR
GDWFHSGDLGYYDEFGLLHVVDRKKDMIKSGGENVASREVEEVLYQHDDV
QEAAVFGLPHPVWVEAVVAAVVPREGRVLDPDAVIAHCRSRLAGFKTPKQ
IFTVAELPKNPSGKLLKRELRERFASAMN
145225136YP_001135814.1 acyl-CoA dehydrogenase domain-containing protein [Mycobacterium gilMRRVHYTDDHLAFGELARDFAAKAVAPHYEAWEDAGIIPRDVFTEAGALG
LLGFAAPEQYGGVGTADFRYNQILVERFMDAGCGGVGLSFAVHNDICLPY
LADLTTPEQKKRWLPGFVSGRLIAAIGMTEPGAGSDLSGIRTSAVDKGDH
FLVNGAKTFITNGQNADLVITAVRTSPDRHRGLTLLVMERGLDGFERGRN
LDKLGLHCQDTSELTFTDVKVPKENVLGEVGDGFAHMMRNLAQERMQIAV
GSLGRIRAALDWTVTYVRERTAFGKPIGALQNTRFSLADVATQLAVTQAF
IDNCVIELNEGRLTAADAAMAKLWASETEFRCLDACQQLFGGYGYMREYP
IARAAIDARITRVYGGTSEIMREIIGRDLRLDRSPSAKEATHA
145225135YP_001135813.1 hypothetical protein Mflv_4557 [Mycobacterium gilvum PYR-GCK]MTAAPETASASRYDPAELRANLMQADAGVLVCVLAQLTGDAGVADRFGPL
IEHVADPPERIGVTDEQTRSALADAIIAALDAPATDAAEKVTDREFFALL
LSTGLGSEVDDEQVDLLLEQGGFRPSAPTLPRTVAIPDTTTMAIIGAGIA
GIAVALAAAEEGVSFEIFDRNHEVGGTWLTTTYPGIGVDTPSAYYSLSRE
VNPNWTNYYPQGAEYQDYLVALADKHQLREHIRFGTEVEALWWDEERGQW
QIHTVGADGTRSVSHAGVVVTAAGYLNRPRWPDVKGRDTFAGVSVHSAQW
DSSLDLTGKKVAVIGAGCTAVQIVDACVDEVEHLTVFQRQPHWVAPRKRP
SDDVPEHRRYLGKHLPYYANWHRLKSYWATADNNYPVILQDPQWAAEHLS
ISPANDVLLQLCRDYIDRTFGAGSELAKKVTPDFAPYGKRIIRDPGGYYA
ALTRDHVDVEASEPAEINARGIVTADGRQIDLDVIIYATGYHLDFLSTVD
IRGRDGRKLSEEWGDSPRAYRGGTVPGFPNLFITSAPNYSPGHGAGANFS
MEVLAHYIIECLQLMALRGATTMEVTREAYENYVAGIDEAMSRTVWCHTP
NAHTYYRSSSGRVVVSTPFRLVDLWQQHRAPIEEDFTLR
145225134YP_001135812.1 short-chain dehydrogenase/reductase SDR [Mycobacterium gilvum PYR-GMTGLLTGRTALVTGSSRGIGRAIAQRLAAEGATVAVTARAHQPSESVRAG
VSAALPGTIDETIALIEQSGGTAFGLAADLENSEDRAALVDRVVERTGRV
DILVNNAGFADYSVVADMSMATFERTVEHYVRTPFVLTQAAVPHMKTQGQ
GWIVNIGSVTGLAPARPYREYNKTSGDVIYASMKAALHRFTQGVAAELLD
ADIAVNAVGPSSAVRTPGAAALIPDSFPTEPVEYLAETVLAMCHRPAAER
TGLVAFSLHYPWSQKLPVHSLDGATVLPPLEPPATANPNILPAGL
145225133YP_001135811.1 stress responsive alpha-beta barrel domain-containing protein [MycoMSTGCAMYSVIRLLDVAEPERDRVLRDVQAAAARTGAHRTVVEPTLPGSR
NGGDVLVHLRFQDEDEWRCHTADFEGALQDSAITRVNGAEYPGRPQPGHP
GPSGVYRTLLLRVLPGTEPSVVARFEDELRLMPRYVRSITAWQLSRAQDP
TGDAGWTHVFEQQFTDEAGLMGPYLMHPIHWAVVDRWFDPETTDVIIRDR
VCHSFCALPAPVLD
145225132YP_001135810.1 hypothetical protein Mflv_4554 [Mycobacterium gilvum PYR-GCK]MASSRWPGTDREAGSSGAYPHDMAEVFVVDRVITRPGCARKFVDRYLAEY
APGALTRGMVLRDILVSPPIWFEDQPNIVTATWVLSGPQAWWEMTWKGRP
DPTLGPWWDSVGEFISERQRSVAAAAAHVDGLCDV
145225131YP_001135809.1 NADH:flavin oxidoreductase [Mycobacterium gilvum PYR-GCK]MSPNPPEPFSPVSLGPVTLRNRVIKAATSEGRSPHGLVTDDLIAFHRAFA
DGGVGMTTVAYCCVSPQGASAPGQIVMNEAALPGLRRLTESVHEGGAAIS
AQLGHAGVVAPKKLTGVTAVAPSRFVNPTSFAYCRQITRDEIRSVTAQFA
AAAQIAVDAGFDAVELHFGHLYLPSSFLSPLINRRKDDYGGSIDNRSRFV
REIAARVRDTVGGRIAVIAKLDMDDGLPGSIWIDEALRTAALLDADGALD
ALELTQGSSVYKPMYLFRGDVPVREFATVMPPAMRPAVRLVGKQTMGVYP
YQDLYMLDAARQFVPVMRNTKLVLLGGITERSHIETGLREGFDFVAMGRA
LLREPDLVNRIRSDPSTRSRCTHNNKCMVTVFGRTHCVLDPDQRYGGVSP
VQQRGELLA
145225130YP_001135808.1 alpha/beta hydrolase domain-containing protein [Mycobacterium gilvuMRLDPQIAALIDALDGGFPAVHTMTGAQARATIRSRFTPAAEPEPVHSVH
DMAVPVDDGEVPVRVYRPAGPAPLPALVFAHGGGFVFCDLDSHDGLCRNL
SNRLGAVVISVGYRLAPEHRWPTAAEDMYAVTRWVSGDADALGVDPARIA
VGGDSAGGNLAAVTALMARDRGGPALRAQLLLYPVIAADFDTESYRLFGH
GFYNPEPALRWYWDQYVPALSDRQHPYASPLHGELTGLPPAVMVMTGHDP
LRDEAVAYAQALTDAGVPVVRCEFDGAVHGFMTMPMLDIAHEARRRSCQE
LTALLHG
145225129YP_001135807.1 regulatory protein IclR [Mycobacterium gilvum PYR-GCK]MTTPVETPSAVIDRVSLVLDAFDGPGRLTLAQIVRRTGLPRSSAHRMLER
LVQLRWLRRTGRDYELGMRLVELGSLAVHQDRVHRAATPLLHDLHRATGL
VVHLAVLDGSDVVYLDKIGDGMASAIPTRVGGRQPAHCTAVGKAMLAFND
DVDVDLQSRMTKYSIGTAAQLAAELAKVRAHGVAYEREESLPGFGCVAAA
IGRPGEAVAAVSVCGPMNRMAFERLAAPVRVTAMGIWRNAEDGPARVTPT
LQPLRPLRGGPAARPVAVRNDALQYA
145225128YP_001135806.1 hypothetical protein Mflv_4550 [Mycobacterium gilvum PYR-GCK]MSVAPIPASSVSSWDDEADVVIAGYGIAGAAAAVEASRAGADALVLEHTG
SWGGAAAMAGGFIYLGGGTATQKACGFDDSAVNMAAFLNTALGPGADERR
IADYCENSVAHYDWLVGCGVVFKPEFFDEPGWEPMGDQGLMYSGGENSYP
FNTIATPVPRGHVPQMQNKKQGEASAGFMLMKPLVETATAAGARARYDVR
VQALVVDDGRVVGIRARQYGTDVFIRARRGVVLAMGSFAYNDAMVAQYAP
RIAGRPAASVEQHDGQAIRMAQALGADLAHMDATEVAIFIDPQQLVRGIL
VNERGQRYVAEDTYPGRIGQLTLYHQNNTAYLIIDGDAQDEAMASLSPRL
MMRPATWVADSVADLESEIGLPPGSLQSTVTAYNDAAVRGEDPLLGKKTQ
WVRPIGAPLGAIDLRESTGGFTLGGLHTTLDAEVLHVDGHPIPGLYAAGR
CAAGLAAWGYASGISLGDGSFYGRRAGRTATH
145225127YP_001135805.1 glyoxalase/bleomycin resistance protein/dioxygenase [Mycobacterium MSDIKSLGYVKVQATDLPRWRQFAFGVLGFAQGSGPEPDALYLRMDERAA
RIIVVPGDVDRIVTAGWEVRDRRGLEAVMRALDAAGTPFKELSLAEADAR
RVEEVIAFEDPAGNSLEVFHGAVLDHSPVVTPYGARFVTGAQGLGHVVIP
ALDVNGLFDFYTQVLGFKSRGAFRVPTPPEYGPVRVRFLGVNQRHHSLAI
CPAATVRDPKLVHLMVEVDTLDAVGQALDRVHKDGFQLSSTLGRHTNDKM
VSFYVRAPGDWDIELGTEGMLVDESSYTAEEITADSYWGHEWVTDLPIAM
QP
145225126YP_001135804.1 acyl-CoA dehydrogenase type 2 [Mycobacterium gilvum PYR-GCK]MSERVLDRLNELAGQFKEQAVEAEKLGKLPDATVKSMKSIGSIRLLQPKK
HGGLEVHPREFAETVMATAALDPAAGWVNGVVGVHPYQLAYADPKVGEEI
WADDIDTWVASPYAPQGVAVPTDGGYIFTGRWQFSSGTDACDWIILGAMV
GDAKGVPLMPPQMLHMILPRKDYQIVDDSWDVVGLRGTGSKDVIVDGAFV
PTYRTMDGMKVMDGSAQIEAGMTEPLYKMPWSTMFPLGISSATIGICEGA
LAAHLDYQRERVGANGTAIKDDPYVMYAIGDAAAEIEASRNTLLSNVDRV
YDIVDSGREVTFETRAAVRRSQIKAVWRAVAAVDQIFARSGGNALRMDKP
LQRYWRDAHAGVAHAIHVPGTVYHASALSSLGVDPQGPLRAMI
145225125YP_001135803.1 ferredoxin [Mycobacterium gilvum PYR-GCK]MSSAERVTEAVATVRIDLDGDRHQLRWPRDKTLVEIMLDAGIAVPYSCRE
GHCGSCVTTVTSGEVSMDTCDILDEADLADGLVLACQARPVDDDITVEY
145225124YP_001135802.1 FAD dependent oxidoreductase [Mycobacterium gilvum PYR-GCK]MGAGFAGLYALHKLRSQGLVVRVFEAAPEVGGTWYFNRYPGARCDVESVD
YSYSFSEELEQEWTWTEKYATQGEILRYINWVADKLDLRPGITFDTRVVS
ATLDEKTLRWTVVTDAGETVTARFVIMATGPLSAALTPAFPGLDTFAGEV
YHTAHWPHEPVDFSGKRVAVIGTGSSGIQSIPLIAEQAEQLYVFQRTPNY
SVPAGNRPLTDTDVAEVKSNYAERRAMSWRSGGGSPHIAHPKLTMEATPE
ERRAAFERRWELGGVLFSKTFSDQMIDPVANEEARRFYEEKVRAVIDDPE
VADLLIPDDHPIGTKRICTDTNYFQTFNRPNVRLLSVRKTPIESIDATGI
TTSDAHYDIDALVLATGFDAMTGALAKIDIVGRGGQSLREDWAEGPRTYL
GLGVDGFPNLFLVSGPGAPAVLANMVLHAEAHVNWIADAITHLDSHGHTA
LEATAESVDNWIAECNRRAEATLFPRANSWYMGANVPGKPRVFMLFIGGF
GVYLDICAEVAAAGYKGFQILDAS
145225123YP_001135801.1 short-chain dehydrogenase/reductase SDR [Mycobacterium gilvum PYR-GMTKYGPWAVIAGGSEGVGAEFAKALAEDGANLVLIARKPQPLDETAQECR
RLGAQVRTIALDLLDADSTSRIVDATSDVEVGLLIYNAGASTCNERFLDA
ELSEFGKVIDLNTTRMLELTQHFGRRMAAMSRGGIVLVGSLSGYMGAERH
SVYAGAKAFSRVFAESLWLELREHGVDVLELVLGVTRTPAMERAGLNFDA
PGIIVNDPADVAREGLRHIADGPVFIAGGNAERAARSSAPDRAAVVLGSH
EMIKRLRGMRP
145225122YP_001135800.1 luciferase family protein [Mycobacterium gilvum PYR-GCK]MRIGLSTPVVVQTPAAASPWEAGAGIGDIARIAETADDLGFDYLTCSEHV
AVPVGDAAVRGATYWDPLATLGFLAARTARIRLATSVLVLGYHHPLEIAK
RYGTLDRVSGGRLILGVGVGSLQPEFDLLGAPWEERGARADDAIRALRSS
LSVAEPSYDGDFYTFGGMVVEPHAEQPRVPIWVGGRSRRSLRRAVGLADG
WMPFGLRTMQIADMLATVDIPDGFDIVLPAGPLDPREPSGCLTRLRALRD
VGATAVTCSVAADSTDHYCAQLASLRGIVDEL
145225121YP_001135799.1 hypothetical protein Mflv_4543 [Mycobacterium gilvum PYR-GCK]MGSDRGDLEARLQQVEDRLRVVEDERDIARLIATYGPSVDAADAVAAAAL
WSADGVYDVEGLRMSGRDEIAAMVRSGGHRRLVDNGCAHFLGPAVVTVRG
DDAVALCESLVVLRAAHGYAERESGATGEQLPAPGYVVWRAAANHFRLRR
IDGRWQVIERTSRVLDGNAHAHELLRAGIAGESVRAEPT
145225120YP_001135798.1 hypothetical protein Mflv_4542 [Mycobacterium gilvum PYR-GCK]MKLRTAAAVLVSAGTVMSAPPAHAEPFFANYSLNIQGRYDFHTWTWAVTY
CTPAATDCARIKAIPMPTAKAFEYSGDARLADGRYTLAVDVPDGLRCGNV
YYGPVIPTHDVYEWDAATLQGTMTSSFAHGCDGAPGGAFTYPFTLVRL
145225119YP_001135797.1 short-chain dehydrogenase/reductase SDR [Mycobacterium gilvum PYR-GMRYSGRRVLITGGGSGIGQACALRILAEGGRVAAADISGDGLADTVQKAG
DLATNLMTVVMDVGDEPSVSSGVAEAIAALGGLDTLVNAAGILRSAHLAD
TTLADFEQVLRINLIGTFLVTRESLAALRDGRGPAVVNFSSTSAHFAHPY
MAAYAASKGGVLAMTHAWALEFAKAGIRFNCVQPGSISSGMTDGTGASRQ
SVGPGLPEDADYALFGKVAPMLPLDDGAIFAAPDAVAGVVAMLGSSDAYF
ITGTEVRIDGGSHM
145225118YP_001135796.1 hypothetical protein Mflv_4540 [Mycobacterium gilvum PYR-GCK]MVNKAADRWSTGLPGLRSGMSTPMQGIGGLLSMSADAVKFLFRRPFQTSE
FLLQSWFVARVSLAPTLLVAIPFTVLVSFTLNILLSELGAADLSGAGAAF
GAVTQVGPMVTVLIVAGAGATAMCADLGSRTIREEIDALEVLGINPVQRL
VTPRMLASGLVALLLNSLVVIIGIVGGYVFSIFVQGVNPGAFAAGITLLT
GVPEVIISCVKAALFGLIAGLVACYRGLSISTGGAKAVGNAVNETVVYAF
MALFVVNVVVTAIGIQMTSG
145225117YP_001135795.1 hypothetical protein Mflv_4539 [Mycobacterium gilvum PYR-GCK]MVAIRTLHPQLVRRLGRPVDTLGGIGEHTAFYGRALAGVPHAVVHYRREI
IRLVAEISMGAGTLAMIGGTVVIVGFLTLAAGGTLAVQGYSSLGDIGIEA
LTGFLAAFINVRISAPVVAGIGLAATFGAGVTAQLGAMRINEEIDALETM
GIRPVEYLVSTRIVAGMIAIAPLYSIAVILSFLASKLTTVVLFGQSAGLY
NHYFTTFLNPRDLLWSFLQAILMAMAVLLVHTYFGYFAGGGPSGVGVAVG
NAVRTSLIVVISVTLLVSLAVYGANGNFNLSG
145225116YP_001135794.1 virulence factor Mce family protein [Mycobacterium gilvum PYR-GCK]MTTRPGRPLIGLATVLALAAVIAVAVGLFRGSFTSTVPVTVLSQRAGLVM
DADAKVKWHGAQVGSVESIESLPDGRASIQLAMDPSYMGIIPSDVRVDIA
SSTVFGSKYVELVPPAEPSTQALRAGQVLTADHVTVEINTVFEQLSHVLG
KIEPAKLNQTLGALGTALDGRGDQIGQTMVDFDAFLAQIEPSLPALEREL
ALAPTVVGTYAEVAPQLVDTLDAATTISDTLVAEQGNLDSLLVSVIGLSD
IGNEVVGGNRQAITDVMELLIPTTDLLNQYHQALNCGIGGAVQLAKAPGT
PVPGGLLLQTVVLGQERYRYPQNLPKVAAKGGPQCTDLPRVPFEKHPPFV
ITDVNANPAQYGNQGIILNSDGLKQMLFGPIDGPPRNGGQIGHPG
145225115YP_001135793.1 virulence factor Mce family protein [Mycobacterium gilvum PYR-GCK]MTDVGKAATKFAAFGLTMVVLTAGLFMIFGEYRSGAANRYSAVFTDSSSL
TSGDSVRAAGIRVGTVRGVTLQDDNTVVVDFDADDNVRLTEGTRIAVRYL
NLVGDRYLELLDEPGSARIQPSGSRIGLERTEPALNLDLLLGGLKPVIQG
LNPDDVNALTSSLIQILQGQGGNLESLFSRTSSFTNSLADNGQTVERLID
TLNETLATVSADGQNLSSAIDQLEQLATGLAQDRDPIGDAITALDSGTAS
LAGLLTEARPPLAGTVDQLNRLAPLLSNETDLARLDLALQKTPQNYRKLV
RLGSYGSWLNLYICGVSIRVSDLQGRTAHFPWVIQNTGRCGEP
145225114YP_001135792.1 virulence factor Mce family protein [Mycobacterium gilvum PYR-GCK]MQKYRGASLVRAGFLGAVLIALVIVVGLQPQQLWAMATSVRYQAVFAEAG
GLAAGNEVKVSGVTVGSVSDVALDRGSALVTFSVDSAVRVGDATTATVGI
STVLGERVLVLKPDGSRSLGSMGVIPLTRTGSPYSLTDAVGEFTTNTEGT
DTAAINQSLDTLSETIERVAPQLGPTFDGVSRLSKSLNSRNESLGALLDA
AADVTGVLSERSAQVNTLLLNANDLLAVLQDRRYAIVNLLASTTAVAQEL
SGMVEDNEQELAPTLEKLNTVSEMLERNRDNISASLKGLAKYQVTQGEAV
NNGFFYNGFASNLLPGPAIQPFLDYALGFRRGVNAGQPPDNAGPRAEFPW
PYNGIPGGSR
145225113YP_001135791.1 virulence factor Mce family protein [Mycobacterium gilvum PYR-GCK]MTARVRQSSAARMVLLVTLGALAVAGAAVVVYQQFFSPYTVVAYFRSATA
IYAGDEVRVAGVRVGTIESIEPQGTRAKMTMAIDHDVPVPADAEAIIVAP
NLVSARYVQLTPAWGATPETSGPTMVDGAEIGQDRTAVPVEWDEIKQQLT
RLATELGPSGGVSETSLGRFIDTTAAAMDGNGNKLRETISQLSGVARVLG
EGSGDIVEVITHLETFVTALRDSNVQIVQFQDRLADVTQVVDGSRSELNS
AITTLSEAVGEVQRFVEGSRSQTAEQVQRLANVTQVLADDSLVLKNILHA
APNALVNGYNIYNPDTGGPRGSFAMNNFSNPVTLICSAIAAVENVTAEES
GKACAQYLGPALRLMNFNYLPMPFNAYLGPAPQNVIYSEPGLAPGGGGTP
PAPAEIPPAVSAYTGAGDIAPPPGWSDPPQPPGAFAPHGLPANPSGALYP
GAPVPPGVPSPPPAAGPAGIAEMLLPAEAAPSPGGNP
145225112YP_001135790.1 virulence factor Mce family protein [Mycobacterium gilvum PYR-GCK]MTRPTVRRTRRWAAAACCVALTATGCSFDGLNSLPLPGTVGTGSDAVTYR
VQLANVGSLESNSPVMLDDVVVGAVGKMTFEDWHAAVDISVRPDVVVPAN
AVATVGQTSLLGSMHVALDPPVGETPTGRLAPGANLPLNRTSTYPSTEQT
LSSLSVVVNGGGLTQIGDIISNFSAALDGRQGQIRSLLTRMNDVVGILDD
QRDNINATISALYRLSETFAGQREVLSAALKRIPEALAVLNQQRPRIVTA
MRKLGDFSDTATQLIDESQEDIVGNLRNLEPAVRALADVGPDLATALSYL
PTYPYTQEFIDRGIRGDYMNQFIVFDFTIPRLKSGILLGTRWGEPGASMV
PAPGDPWYSMYTRDPLQAPITPIPAEVATIPPLVDLPPAPAGEPAGGGS
145225111YP_001135789.1 virulence factor Mce family protein [Mycobacterium gilvum PYR-GCK]MLTRFVRTQLIIFSIAAVVGLGSMVFVYLQAPVMLGIGRMTVTLKLPNTG
GLYEFSNVTYRGIEVGKVTGIEPTGDGVTVTMSLKSSPKIPTDLKAHVRS
VSAVGEQYVDLEPRSDAGPYLQDGSVITGDRSSIPQAVGPMLDQMSALVD
SIPTGTLSGLLDESYAALNGSGYELGSLFDSSARLAADADSTGDRMRNLI
TDSEPLLDGQAQKADAITTWARSLAGITRQIADDDQAVRTILQTGPGAAD
EASRLLTDVKPTLPVLLANLTTVGQVGVAYHPSLEQLLVLLPPYLAATQS
YGSSLNNPTGMALSEFSLTLGDPPACSVGFLPPSSWRSPADLTDVDTPDG
LYCKLPQDSPIGVRGTRNFPCMEQPGKRAPTVEICQSDRPFEPLAMRQHV
TGPYPIDPALIAQGVPPDDRVTLDEQIYGPLEGTPMPAPAPGAAPASVPG
PVPAAGGPPVAVATYNPETGQVATPDGEVFTQSNLAAPNPAAGEGKSWQD
MLPR
145225110YP_001135788.1 hypothetical protein Mflv_4532 [Mycobacterium gilvum PYR-GCK]MIRVPSAAGAVAAVVICGAAWGAPPAAADNPEWGLNGTYIATSNGEWARK
NEVFYDQASLRSTWTVSTQCSYPGECTGTVDSEWGWSAPIYQKSGVWYVK
HTVENWIPCPDGTSAPGLQVFRFKAMNAEGAMADPTATTLVGEDVTTGVS
GACGVSRSVYINMPFKLVKVG
145225109YP_001135787.1 hypothetical protein Mflv_4531 [Mycobacterium gilvum PYR-GCK]MASLSAGLGTAAPGAAQPASCDDAFCTPGIRPAVVLGAPCADTANYVFGT
TSWGRLVFCGSPRRYEPRYFRSPSMAGVKALDSSCAGYENWVAQSPDGLF
LTCQSRNGAPNWSRGDDG
145225108YP_001135786.1 hypothetical protein Mflv_4530 [Mycobacterium gilvum PYR-GCK]MTGRAPAVASAMLLAAVLSAPAAAADPPAPRLVTYTVTADRHVSADIYYR
DTDPPTWADYSHNPYQFSPRARVDVGPGQPWVRSLVLADPQRWAMVSATS
GPLPVESGFRCELAVDGEVVATGDGPRGALCSLRHW
145225107YP_001135785.1 hypothetical protein Mflv_4529 [Mycobacterium gilvum PYR-GCK]MSDPLEESSDAAPRSGRRRPRWQAVAGVVAVLCSAAMVTAGGVIWSEHRD
AVRGQQSRVEFAAAAEQVAVTLMSLDHADPQTGVQRILDNSVDPFLSEFR
STTGDFVKLSKDAEVTTKAVANAAAVQSISGDAAVVLVAATSTVTNADGV
TEAPRSWQLKLDLRRDGDRIKMSKVEFLQ
145225106YP_001135784.1 hypothetical protein Mflv_4528 [Mycobacterium gilvum PYR-GCK]MRIGGAVASRWRIVAVSLLLIASGALLATLYVTQYRIDSQTDGAAAEAAV
EAASSATATLLSYTPETIDADMAAARSVMTGEFATYYGGFTSEVVAPAAR
DRGVKAQAHVIDSALMDIQPDQAKVLVFLKQETASRERPEAAVTASSVAV
TVTKVDGTWLISAFDPV
145225105YP_001135783.1 lipid-transfer protein [Mycobacterium gilvum PYR-GCK]MSPEPVYILGAGMHPWGKWGRDFTEYGVVAARAALADAGLNWQQIQLVAG
ADTIRNGYPGFVAGATFAQKLGWNGIPVTSSYAACASGSQALQSARAHIL
AGLCDVALVIGADTTPKGFFAPVGGERKNDPDWQRFHLIGATNTVYFALL
ARRRMDLYGATTDDFATVKVKNARHGLANPNARYRKEATLDDVHASPVVS
DPLRLLDICATSDGAAALIVASKAFTEKHLGSAAGVPSVRAISLQSPQYP
QHLPELPDIATDSTAVVPGPDRVFKDQILDAAYTEAGIAPQDLSLAEVYD
LSTALELDWYEHLGLCAKGEAEHLLRSGATTIGGRIPVNPSGGLASFGEA
IPAQAIAQVCELTWQLKGQATGRQVENATVGITANQGLFGHGSSVILAR
145225104YP_001135782.1 hypothetical protein Mflv_4526 [Mycobacterium gilvum PYR-GCK]MTVLPAVENWWRTDESGDTYLIGGKCTGCGTYVFPPRENNCPNPGCASDE
LALVPLSRRGTLWSYTENRYAPPPPYPSPDPFEPFAVAAVELAAEGLIVL
GKVVEGTLAADLHVGMEMELTTMTLYVDDDGVTRTTHAWRIAK
145225103YP_001135781.1 alpha/beta hydrolase fold protein [Mycobacterium gilvum PYR-GCK]MHSIDYQESLREVATPAGVLRYHEAGDGPPLLLLHGSGPGVTGWRNYRGN
LAVFAQHFRCLVLEFPGFGVSDDFGGHPMLDAQSSVVAFADALGLDRVDI
IGNSMGGGVGINFAVNHSHRVGKLVTIGGIGVNIFSPGPSEGIRLLQEFT
EDPTRQRLVDWLNSMVYDPALVTEQLIEERWELATDPETLAAARRMYGKA
AFAAMMEMMRDADFPLPWATMHKVKAPTLLTWGRDDRVSPLDMALVPMRT
IPNAEFHVFPNCGHWVMIEAKAAFERTVLSFLTESSAAAR
145225102YP_001135780.1 major facilitator transporter [Mycobacterium gilvum PYR-GCK]MTTATPSDPATLRRVALSSLLGTAIEYYDFLVYGTMSALVFGRVFFPDSD
PAVATIAAFGTLAAGYVARPVGGILFGHFGDRLGRKRMLVLTMGLMGAAS
FAIGLLPTFAAVGVTAPLLLVALRVIQGIAIGGEWGGATLMVTEHAEPHR
RGFWNGVMQMGSPIGSLLSVTVVTAITLLPDEAFVSWGWRVPFLLSVVLL
AIGVYVRVSITESPVFEQAKPKVVESRRIPLIEVLRRPRNLVLACAVGIG
PFALTALISTHMISYATSIGYHRTDVMTSLVFTSLSALIAIPVFSALSDR
VGRRPVMLVGGVAIICYAWPFYWLVDMRAMAWLVVAMMVAQIVQSLMYAP
LGALYSEMFGTTVRYTGASMGYQLAALVGAGFTPMIASSLLVDEVTSVPL
VVLAMGCGAVTVLAVWRIRETQGVDLAGIDSGRNAVRTP
145225101YP_001135779.1 hypothetical protein Mflv_4523 [Mycobacterium gilvum PYR-GCK]MLRDHRALVVTFADKAAVRDYVAHRVGDRYLPYVHGIVDDPAMLPELPES
FVIKPTHGSGAAIIAAPNAPADARLPRVAQSWTYAHIRPEFADRAQILAI
ATDWLTRLYGQGPNAEWVYGQVQRRILVEELLTRADGGIPDDYKFFVFHG
RCAYIEVDAGRFGSRTQDFFTADWTHLPLSGGLPWAQPEPRRPRTLDEMI
EVAEHLGAETDFVRVDLYDVDGRIVFGELTSFPAGGNSPFDPESFNAEFG
RHWTVPRRYR
145225100YP_001135778.1 extracellular solute-binding protein [Mycobacterium gilvum PYR-GCK]MVNARRRALLTVILMVAGMVTASGLAGPAAAQPSAVTVAVAPVTPFVINN
DGIWSGFTVELWQAIASRERWTTDWLAVDTLDQQLAAVAEGRADVAAGAI
SVTADRRQQFDFSQPILDAGMQIIVPDHDPQPSSPGLREFLRLVFSGTMV
TWLAAALAITILPAHLLWLIERRHADPAVSKSYFPGIVEAFGWGLGTLAA
SDAASPRHWVGRAMGIGWAFIGIIFVAFYTANLTAALTVEKLDAQINGPN
DLYGKSVCTEAKTTSAAYLTRIDVKPVLVPVIEQCYDGLRDDTYEAVVFD
APVLRYYVTHDGNGIAGMTGPVFHDEDYGLAMPVGSPLRARIDQALLELR
EDGTYDLIEEKWFGDDQDTEAGSGR
145225099YP_001135777.1 putative GAF sensor protein [Mycobacterium gilvum PYR-GCK]MADDRNLPAFRRHGRQEGDRTDAEFDELIAARNQMDHLVRAIVAIGSDLD
FSVTLERIVTAARELSGARYAGLGIRAAGGNLVSFVESGDEFDVAALAGL
PIDGGLRIDDLRDHPEITDLQALNRPIRALLAIPVTVRGADFGSLYLADD
RPGRVFSDAQESAVRALATAAAAAIDNARLFEREREAARWTKASREITTA
LLSGDPQTGPLQLIVNRALELAGAEQAILLVPLEPDVPAEDVDTLIVAAT
AGRYSSEVIGRQVPMAGSTTGGVARRGLPMITDSFQYPIEGFTDVGERSA
IVMPLIVDDAVLGVIAVARRPNQPAFDEDYLELVSDFARHASIALALAAG
REHALNRQLAQADSVSEAMAGAAEELRRLWRARRVLAVTFPTRSEAADVE
PVVVSAGEHTTWRELPDGIRQILLSMRRGDLLTPNAAEPGTAGIAVQHPE
GILVVWIELAEHRSFTLEDQTLLTVLAGRLSAGLQRVHQVDQQRETALAL
QHAILGPAHLPPGFTVRYQAASRPLQVGGDWYDVVDLDDGRIALIVGDCV
GHGLAAATVMGQVRSACRALLLENPSPGAALSGMDRFAARLPGAQCTTAV
VMVLDPASGEIAYSSAGHPPPLVVHADGEVETFDDAHTIALGLRLNWVRP
ETRRTLEVGSTLVLYTDGLVERRRIPLEEGISRATDVVVEHRAAPLDDLA
NAIMSELAPSVGYQDDVALLLYRHPAPLELTFPAHADHLAPTRTALRRWL
SGAKVEQGRVMEVLVAAGEAVANAIEHGHRHGPPGTVRLRATALVDLVEL
IITDSGSWKPPSAIPDTYRGRGIGIMRGLMQDVTIAHDSDGTTIHLYARI
S
145225098YP_001135776.1 anti-sigma-factor antagonist [Mycobacterium gilvum PYR-GCK]MPTFLTFDTVRAADGREVRLIAAGEIDLSNVDDLKSALSAAIGETAAAGA
VLVVDFAAVEYVDSAAINVLSADSEMIHKIVVHPFLLTTFRVSGLTELVT
VEAAAI
145225097YP_001135775.1 putative GAF sensor protein [Mycobacterium gilvum PYR-GCK]MTGPGPAGLDASDGLVAVGTPIDLDNCAREPIHIPGSVQPRGVLVVVREP
EFEVRQVSANVEELLGHPVESVLGRHLSALMGASQAARVQQAASIVGDLH
RRNPVECVLDVRGKSLEFDAILHREPGGVLLVELEVAFGARPYSFPNTYQ
AVRSSVEALNRATTMADLYDTAARSVRELTGFDRVMVYRYDEEYNGEVVA
EAKRDDLNSFLGLHYPSTDIPAQARALYEKNWLRLISDVDYAPVPLVPAV
DPAVGKPLDLTHATLRSVSPIHIEYLQNMGVHASMSISLLRHGRLWGLIA
CHHYAGPHLPPFGNRAAAEFLGSTLSLRLVDQYEDDQLHRRLDAQAVLVK
LTAATMNDGKPLVSALLGAPDLLDLVPADGVVVDIGGHHRTRGSVPSPEV
VAAVAAWARAAEDEIARSDSLSRTLPDLDVDPALAAGALVLNLPDGQFAA
WFRRESLRSVDWGGDPHNKAIAVSEGGEVRLSPRKSFERWQEIVRDRGEP
WTPTEIESADMLRRHLVETLYHRTRGALRVAELVQRSLIPDSIPDLESWE
LTAHYEPAAGERVGGDWYDAFELRDGRLIVVVGDVAGHGVTVAGTMAQLR
NALRAQLFAGAAPAEAVRQLNDFCVHLLRSAFATVLVARVDLDSGLVEAT
SAGHLMPYLTEGSATAVAAPIRLSPPIGLSSARYTQSTFTIEPGQCLVLY
SDGLVERRGEVIDDGMDRLARGLGECAEPAAYPIWAALASGHTEDDVTVV
TLRRP
145225096YP_001135774.1 hypothetical protein Mflv_4518 [Mycobacterium gilvum PYR-GCK]MRKTGVVCGTVFASAALALSSSSLGQAANTALVIGGISTPSMADALMSPL
LGGKFKDQQRVSVKWPAQAGPMTGKGDLTLGASIAQGATNLNAQIDAALA
QLKSGEKVTVVGLSAGSLVVNEILRELDESADAPGKDKITFVVVADSSRQ
KVISRTRYNANLDYTYQTAPETKYDIIVVTGEYDGMADFPDRLNLLAIVN
AVAGGIFVHIPVMYADLSKVPARNISVEMNSEGGTTTHYLVPAEKLPLVR
LFPSLANREAELKAKIDAAYSRNDVVAVSAPKAAVFAAAPAPAAPTAVVQ
TPSAAQVPGSVAASLRTAKADAAVEDAVVSEDAAVEDAVVSEEAAVSEEV
DVKGADSADADIEETDTADQADIDSGAEKEAAQEDSDAGAQSGDDADKDG
SVSSDSGASTDRSPSKPSATSDS
145225095YP_001135773.1 alcohol dehydrogenase [Mycobacterium gilvum PYR-GCK]MRTVVVDSQRSIRVDTRPDPRLPGPDGVIVDVTASAICGSDLHFLDGHYP
IDQPVPIGHEAVGVVVETGSDVTRFTNGDRVLVSSVTGCGRCAGCLTLDP
VKCVHGPQIFGTGLLGGAQSDLLAVPAADFQLLAVPDGIGTEEALLLTDN
LPTGWAAAKRADIPVGGTVAVIGAGAVGQCALRSALALGAARVFAVDPVV
ARRERAAAAGATPMDSPAAQTILEATDGLGADSVIDAVGTDASIDDALAG
VRTGGTVSVVGVHDLTPYPLPALVCLLRSLTLRMTTAPVQQTWAELVPLL
QAGRLSVDGIFTDAMPLAEAEAAYAAAFSRSGEHLKVHLVP
145225094YP_001135772.1 amine oxidase [Mycobacterium gilvum PYR-GCK]MWLAELGYRVTLLESNGSLGGRTIGLTSGHGDAIENGQHVFAGSYENIFR
YLDSIGTRHLLEFPDQFGVRYPGGHAEKFGLRLANLRRMMLGRVRGLGLP
TLLRASPAWARLMRDVIRFDDSLDDITVDEWFDRVGFPPEVRRVVLNSMV
IGLLNEQPHLASAHAFAALLRTGADRVRSFGGSAVRIGYPTVDLDTLYLD
GARRVMAERGVDVRLRTRAVTVTTDAGRATGVTLSDGATVAADAVVLAVP
SWNLRSLLDDVPSSEDARLSAKKLEPIPIMNAYVLLDRPLGTVAPWESLL
DSDIGWVFDRDRMHGPRDDGNHLYALTTCAAYDLMPLKNSEVADRLVRAL
RDSYPAAADAEVLDVTVVPWPRATFSSRVGMSTIRPQNRTALPNLALAGD
WTHNDWPTTMEGAAQSASHAVDLVHAELGGSG
145225093YP_001135771.1 diguanylate cyclase [Mycobacterium gilvum PYR-GCK]MSASAVTSPVEGRVTDTPDAEYVRGMARLLQAVQELSLARSLPEIQRIVR
TAARELTGCDGATFVLRDNGKCYYADEDAIAPLWKGSRFPMEICISGWAM
LNREAAIIPDIYLDGRIPHEAYRPTFVKSLVMAPIRKLDPVGAIGNYWAQ
ERQPTPREVSLLQALADATSIAMENVQIYAELEQRVRDRTAAVEQANEEI
RQLSLTDDLTGLNNRRGFRLLAEAALLAARTHGHDCALAFLDVDGLKRVN
DGIGHDAGDSLIVDVARVLRETLGPSAIVARLGGDEFCTLVPEYSDGAAA
LTARVQDAFRRFDARSSRPYQVMISVGVVEIPPTDVSPLEDLLSRADELM
YAQKKAKSCAEIA
145225092YP_001135770.1 acyl-CoA dehydrogenase domain-containing protein [Mycobacterium gilMSTTTAPATKAVYAPLELFDTARLLEQDEREIAATVRKFVDSELKPNVED
WFESATLPKELGKRFGELGLLGMHLQGYGCAGTNAVSYGLACMELEAGDS
GFRSFVSVQGSLSMFSIHRYGSEEQKNEWLPRLASGDAIGCFGLTEPDFG
SNPAGMRTRGKRDGSGENADWILNGTKMWITNGNLADVATVWAQTDEGIR
GFLVPTDTPGFTANAIHRKLSLRASITSELVLDNVRLPASAQLPEAVGLS
APLSCLNEARFGIVFGALGAARDSLETTIAYTQTREVFDRPLAGYQLTQE
KLANMTVELGKGMLLAIHLGRIKDAEGVRPEQVSLGKLNNVREAIAIARE
CRTLLGGSGITLEYSPLRHANNLESVLTYEGTSEMHLLSIGKALTGHAAF
RA
145225091YP_001135769.1 hypothetical protein Mflv_4512 [Mycobacterium gilvum PYR-GCK]MLTLTAGTFGNVLRFLPPLSISDELLTEAFDVLRDGFASLKPRRV
145225090YP_001135768.1 isochorismatase hydrolase [Mycobacterium gilvum PYR-GCK]MDISSAMSETALLVIDMFNTYDHPDAEPLADNVAAIVDPLTELIRRSNER
DDVAVVYVNDNYGDFAAEPSDIVEAAVNGARPELVRPLVPGPEARFLTKV
RHSAFYATSLDYLLTRLDTRRIILTGQVTEQCVLYTALDGYVRHYDVVVP
PDTVAHIDDKLGTAALEMMERNMKAELPESTASLP
145225089YP_001135767.1 hypothetical protein Mflv_4510 [Mycobacterium gilvum PYR-GCK]MKNTKLLLGIGAAAVLPAAGLVGAGSAAAQPCTGPSTVIAGHGGGRCDSP
PAPDGSFTRCDTVYVFGLGGTNCYQVPAGTPPV
145225088YP_001135766.1 hypothetical protein Mflv_4509 [Mycobacterium gilvum PYR-GCK]MEVLRSVVVLLHIVGFAVIFGAWAAEAAARRFRTTRLMDYGVLVSLLTGL
ALAAPWPAGIELNYPKIGIKLVILVVLGGVLGMSNARQRKTGQDVARPLF
YSVGALAFTAAAIAVLW
145225087YP_001135765.1 short-chain dehydrogenase/reductase SDR [Mycobacterium gilvum PYR-GMWAILWRVVKGLAGKGVLVTGAASGIGLATVRRLLEEGAAVVGMDVCTEA
PADVPGDFTYHRGDVLDAAAVGRAVTAVVERTGRLDGVVHSAGVGGGGPI
HLLPDDEWDRVVDVNLKGTFVVLRAALAQMTTQDRVTGERGSIVTLSSVE
GLEGTAGGSAYNASKGGVVLLTKNAAIDYGPSGIRINAICPGFIETPLFD
SVMGLPGMEGPRDGLRHEHKLRRFGRPEEVASVATFLVSAEASFVSGQAI
AVDGGYTAGRDHHVTELLGLGEQ
145225086YP_001135764.1 alpha/beta hydrolase fold protein [Mycobacterium gilvum PYR-GCK]MTETLGAPEPFLTDGHGGIVIAADRRGEPTARAVVFLHGGGQTRRSWDRA
AAAVAQRGWQSVTVDMRGHGESDWSPDGDYRVASFAADVREILAQLPPRP
VLVGASLGGITAMLLAGELARGIASAVVLVDIVPDMDPTGAERIHAFMAD
KMVDGFASLDEVADMIAEYNPHRPKPTDLDGLRKNLRHKGGRWYWHWDPR
FIDGTAPHPPMEVTDTDRLHAAVGRIVDDGVPVLLVRGQVSDLVSRDRAA
AFLSRFPQIDFVDVDGAGHMVAGDRNDLFADAVLSFLTRREVAKP
145225085YP_001135763.1 cyclohexanone monooxygenase [Mycobacterium gilvum PYR-GCK]MPFLTGEHVRSPELTALTGLPFDDDDEVLRAAIDDASVPALLMSMVHMTG
DPGILDRLPRPYMLIAMDLQGGMSEPDKQVVRDKAFEVAREYRDRGCPPP
FVPDEHQLRVMLDVITGGQVGSELIEYIAADLRVTDADQNGPPLASTARQ
RADFPVLVIGCGEAGLLAGIKLKAAGLPFTIVEKQSGVGGTWLANRYPGC
RVDIASQYYTYSFEPTDHWEHHYATQPEILRYLRDVMDRHGIADHVRFDT
EVVGARWDELSATWRVRVRTGGGAVEELTARALICAVGQFSNPVIPDIDG
ADTFEGPTCHTADWDDTLDLTGRRVAVIGAGASGFQLVPAIAGTAAHVDV
YQRTPQWMAPNVHYHEAVSDGARWATRHLPYYGRWLRFVSWWPIADALDE
QITIDPDWDTGGLSVSAGNQMIRDMFIAWMQAFTDDEDLLAKVTPKYPPM
GKRTLQDDGTWLRTLQRDDVELINDVIAAITADGVTDVHGVHRRADVLVW
ATGFDVNHQLGPIDIRGRDGLSLNEVWGDAAYAYLGMTVTGFPNFYCMFG
PGTNAVNGASLIYNSECQMRYILGCIDMIIASGAAAAEPRAEVCRDYDRR
SQQRLQTMVYAHPAVTSSYYKNSTGELPTLFAWRIADYWKWTRYPDPADY
QLETAAPQEVS
145225084YP_001135762.1 short-chain dehydrogenase/reductase SDR [Mycobacterium gilvum PYR-GMTGRLAGKVALISGAARGMGASHARVMAGHGAKVVCGDILDSDGEAVAAE
LGDAARYVHLDVTSPDDWDRAVAAAVADFGGLDVLVNNAGILNIGTVEDY
ELSEWHRILDVNLTGVFLGIRAATPTMKAAGRGSIINIASIEGMAGTVGC
HGYTATKFAVRGLTKSTALELGPFGIRVNSVHPGLVKTPMADWVPEDIFQ
SALGRIAQPHEVSNLVVYLASDESSYSTGAEFVVDGGTLAGLAHKDFSAV
DVDQQPEWIT
145225083YP_001135761.1 regulatory protein LuxR [Mycobacterium gilvum PYR-GCK]MRAALPAAMMNAMSDASPQAADDPQVAGFLCTATSAPTGLIIEGDAGIGK
TTLWLSLLQTARMRGFQVLTARVGQAESVMAFAALADLLGAVSDEHFAAL
PPLQRLALDRVLLRAGADGPATDQRVVAAGFVSLLHILAADAPVLIAIDD
VQWLDASSRTAIEFAVRRLKGAFGVVVTERCVPGDGTTAGWLTLERPDGL
IRVSVPPMDAGRLHALISHRLGRTLTRPVVLRIAEMSGGNPFYALELAHT
HVNSGDSPPAAEPPLPATLADVVRRRVGLLDDATRTLLLGVACVADPTVE
LLARAHGASTDEITAGLERAEAAGIVVLEGNRVRFTHPLLAGGVYTDAGP
TARRAMHRAIASVESHPELRARHLALAASSGDDEIFAALDQAADSARARG
APAAAAELMDLALGLGAHDPMRRLKAAENHFLAGDTAKAAAALGEVGSIE
PPILRAMATSLLATVRMYDNEHRQAVDLLRSALDDAADNVPVQVQVLLRL
SFALNSIGELDDARRYARDAVKLAEELGFPGATSAALAWAVHVDFQCGRG
LDETALARAMKLYDSTFDVPIIFRAPFVHALAMSWTGRLEQAHQELTAVR
GVCLERGAESDMMAIAGFLAINHLWRGQITDAEAEAAEAVERAEQLGGDD
VLIIPMTVRGAIAAYAGRVDDARADARWVLAAVRNRKASHIADWPGMTLC
FLEESLGNHREALAALDDSFIAAGPPTTELMYAWHLPDAIEAMVGVGRLD
DAEILTAALERNGVEHDRRWMRAVGARCRAMLLAAHGDVAAAEQMAHRAI
SEHDHLPMPFERARTRLLLGQLQRRLRQKATAAKNLTDALHTFEQLGTPL
WAQRARSELARAVVAPAEGLTPSEQKVAEMAAAGATNKDIAAAMFISSKT
VEHNLTRIYRKLGISSRAELGRRMDQPGL
145225082YP_001135760.1 alcohol dehydrogenase [Mycobacterium gilvum PYR-GCK]MRAIQIAELSGPGAARLVEIDEPAADDGTVLVEVHAAGVAFPDALQSRGL
YQYKPEMPYTPGAEVAGVVRSAPAGAHVKAGDRVAGLTMLCGAMAEVVAL
QPERVFALPDSVSFEAGAGILFNDLTVQFALRTRGRLAAGETVLVHGAAG
GIGTSTLRLAPAFGASRTIAVVSTEEKADVARAAGATDVVLADGFKDAVK
ELTGGRGVDIVVDPVGGDRFTDSLRSLAPGGRLLVVGFTGGDIPTVKVNR
LLLNNVDAVGVGWGAWTMTHPGYLQEQWAELEPLLASGTVPAPEPVVYPL
ERAAEAIASLEDRSARGKVVVAVR
145225081YP_001135759.1 alpha/beta hydrolase fold protein [Mycobacterium gilvum PYR-GCK]MARSSSTRSRRAGSGPAVELPRGRVVDVRSRDGVRLHAEVFGPEDGYPIV
LAHGITCAIPVWAHQIADLSRDHRVIAYDHRGHGRSGVPPRRGGYSLDYL
ASDLDAVLEATMAPGERAVIAGHSMGGIAISSWSERLPHRVAERADGVAL
INTTTGDLLRNVNLLPVPARFADARVRAAGGVIRTFGGTSMVRVADLPSR
RFVSMIAVGRDADPAIADFVFELFHRTPPAGRGGWARVLVDHLGPRHIGL
DNLTVPALVIGSTHDRLLPVSSARHIASAAPNLARFVELAGGHCAILERP
EEVNQQLRWLVDSVSRSTRASAATGDQARASEATGDQARASAATGDQARA
SSR
145225080YP_001135758.1 amine oxidase [Mycobacterium gilvum PYR-GCK]MAEVVVVGAGFAGLAAARELSRLGRDVVVVEGRDRVGGRSYTGSVGGVPV
DFGATFVGPTQDAVLALAAELGVESVPTYGEGKNLIRWRGRVRSYRSTIP
RLSILELLDVSRIQWRFDRISKRVPVDQPWASPLAGQLDDISLDAWLRSV
HAGASTRDLMAIMARVTWGAEPGDVSMLHAVRYVNAAGGLNRMLDVEGGA
QQDRFPAGTQKIADLMAAELGDRVVVGAPVRRITRNPDRTVTVTTAGAEY
QAGAVIVAVPPEHRSGIEFDPPLPAEHRELSRHWPQGRLSKAYAAYETPF
WRADGHSGESLSDEGPVFITFDCSPGDDGPGVLLGFTDPRSFDPLPGEQR
REIALAGFSALFGAAAAHPIDYVDHCWGAEPFSPGGPTAAVPPGAWTAHG
RWLRAPVDGIFWAGTETADSWTGFLDGAVRSGLRAADEAHRELARA
145225079YP_001135757.1 hypothetical protein Mflv_4500 [Mycobacterium gilvum PYR-GCK]MTALFGPIDAVERARALREAGAAGVFTFEGPHDVFTPLTLASTVGGLDLM
TNVAIAFPRNPIHLAHQAVDHQLLSGGRFTLGLGTQIRTQIEKRYGTDFD
RPVARMRDLVGALRAIFHTWSTGDRLAYRGEFYRHTLMTPTFTPRAPFDP
IPIYVGALGPRLTRMTAEVADGLLVMPFGSRRFLTEVTMPNVAEGLAAAG
RTRADLAVVPEIIVSVADQDPDHMSARRLLAFYGSTPAYRPVLEVHGWGD
LQPELNALSKQGRWEDMGRLIDDDVLHTIAACGTPADVAKHIRDRVDGVS
DRICLYQPGPIAVNSLAEIVDALRG
145225078YP_001135756.1 FAD dependent oxidoreductase [Mycobacterium gilvum PYR-GCK]MDQLYPETESTDVLIVGAGISGIGAAYRIQERNPQLTYTVLERRSRIGGT
WDLHRYPGIRSDSDIFTLSFPWEPWDRPENVADGEDIRQYLVDAARKHGI
DRHIHFDTRVLSADWDSTADVWTVRTECNGVPRTYRTRFLFFGTGYYDYD
NPYRPEFPGLESFEGPVVHPQHWPEDLDCTGKKVAVIGSGATAISMIPAL
AESAERVTMVQRSPTYLLSGQRINPVVNLLRKVPPRKLGYRLAWLYNVLF
IVAVYGVARKAPRISRRLIRAVAKHYLPEGYPVDTHFKPRYDPWDQRLCL
ILSGDFYDAIARGRAEVVTDEIDHIDAHGLVLKSGRRIDADVLVTATGLQ
LQALGGIEISIDGTEVKPADRFVYKEHLLEDVPNLAWCVGYINASWTLRA
DLTARAVAKLLAHMDSHGYTHAYPHLGGVPMEEKPAWNINAGYVHRAPHV
LPKSGTHRPWNVRHNYVLDAVDQRFDRIDESMVFGRVSPKLHSSSEMSSE
DLLERNFGA
145225077YP_001135755.1 hypothetical protein Mflv_4498 [Mycobacterium gilvum PYR-GCK]MLGPMDEFPVHQIPQPIAWPGSSDRNFYDRSYFNAHDRTGDIFVITGLGY
YPNLGVKDAFFLVRRGDTQTAVHLSDAIDQDRLNQHVGNYRVEVIEPLRK
LRIVLDETDGIAADLTWEGLFDAVQEQPHIMRRGTRVTLNAQRFAQVGSW
SGQLSIDGTDIAVDPAQWIGTRDRSWGIRPIGEAEPAGRPDDPPFEGMWW
LYIPMAFDDFGIVIIIQEDPLGFRSLNDCTRVWKDGRVEQLGWPRVKIQY
RSGTRIPTGATVEATALDGSPLHFDVESKLAVPIHVGGGYGGDSDWLHGV
WKGPNFTERLTYDMTDPAVIGRAGFGVIDHVGRAVCREADGTEREGWGLF
EHGALGRHDPSGFADWLTVAP
145225076YP_001135754.1 aminoglycoside phosphotransferase [Mycobacterium gilvum PYR-GCK]MTSEPAVDNVDRLQRSSRDLSDVPAALSRWLSTKLPGVTPDAPVDITVED
GIDANGMSSETILLRGRWSDGGDPVEHRWVARVAPTDADIPVFEHYRLDH
QHEVMRLVAESTDVAVPAVRWLEDTGDVLGRPFFLMDRVDGVVPPDVMPY
TFGDNWLYDASPEQQRALQDRTVEVLAALHSIPDAQRTFGFLQEIDPPGE
TALHRHFGWLTRWYAFSSADLGSSPLVERAISWLEEHFPHDVAASEPVLV
WGDSRIGNVIYRDFRPVAVLDWEMATIGPREFDLAWISFAHMVFQELTKL
AGLPGMPDFLREDDVRDTYRKLTGVEVGDLHWFHVYSAVVWCCVFMRTGT
RRVHFGEIERPDDIESLFYHASLLKRLIGEAD
145225075YP_001135753.1 TetR family transcriptional regulator [Mycobacterium gilvum PYR-GCKMKTDSSAGGKATGAGRPRDPRIDAAILAATADLLVEIGYSNVTMAAVAER
AGTTKTALYRRWSSKAELVHEAAFPVTPTAIQSPPGDIAADLRAMIEVTR
DVFLSPVVRAALPGLIADMSANADLTGRIGARFTDLFAAVRARLQDAVER
GEVRESVDPDRLVSLVGGATLLALLQTPDALASPSWVDSTTDILLRGVVA
GA
145225074YP_001135752.1 enoyl-CoA hydratase [Mycobacterium gilvum PYR-GCK]MTEDLVLTADHDGVRVITLNRPAARNALSRDLIRATYTALTSADDDDAVR
AVVLTGADPAFCAGVDLKEAARDGLSYFAEFRTQSCIAAVAAMRTPVVGA
INGATFTGGLEMALGCDFMIASERAVFADTHARVGILPGGGMTARLPQLV
GAAMARRLSMTGEVVDAARAERIGLVTEVVAHQHLLQRAIDLAHQIAEVP
RPTMRGLKEIYTAGASAVVDPALAAEERIAFAQHRDLEGLGDRFSAVSQR
NRDQIGGA
145225073YP_001135751.1 NADH dehydrogenase subunit N [Mycobacterium gilvum PYR-GCK]MNTLTPLPTPTVEYFFLSPMLIVLGAAVLGVLVEALLPRHLRYRAQAGLS
LAALLAAFVAVVMVARDLPADGAVSAVMGAVAVDMPALFLQGTILAVGVL
GVLLIGERQIGVVEDSENGRGLDAFTPQASAVAGSVAEKVAARAGNIQTE
VFPLTMFAVAGMLLFPAADDLLTMFIALEVLSLPLYLLCGMARRRRLLSQ
ESAVKYFLLGAFSSAFFLYGAAMLYGYAGTLSFPGIADAVADGTGTTSLG
LIGVALLLVGILFKIGAVPFHSWIPDVYQGAPTPITAFMAAATKIAAFGA
MLRLFYVALPGLRDDWRPVLWAIAILTMVVGTVTAVTQTDVKRMLGYSAV
AHTGFILTGVIAGNDAGVSSTLFYLFAYGFSTVGAFAVVGLVRNSDGEED
TAMARWAGLGKRYPLVGIVFSLFLLAFAGIPLTSGFVGKFAVFKAAGEGG
AIPLVVVGVVASAIAAYFYVRVIVLMFFTDSPDDAPAVVVPSVLTTAVVT
VTAAVTFMLGALPQPLLDLADSADRFF
145225072YP_001135750.1 NADH dehydrogenase subunit M [Mycobacterium gilvum PYR-GCK]MVGAVAVLLLPAAARHLAKWTALVVSLVVLAVTGVIAVGFDPAGDQFQFV
ENYRWIPSFGTGYILGIDGIALALVVLTAVLLPLLIIAGWNDAGDRLSWG
GRSTHIYFALTLAVEGMVLISLVSLDILLFYVFFEAMLIPMYFLIGGFGG
EHRGRAAVKFLLYNLVGGLIMLAAVVGLYVATATSDAFDAGTFDFRAIVA
AVSSGEFAVDPVVMHLLFGGFMFAFAIKAPLWPLHRWLPDSAVEATPASA
VLMMAIMDKVGTFGMIRYCLPLFPDSATLFGPAIITLAVIGIVYGAVVAI
GQTDVMRLIAYTSISHFGFIILGIFVMTSQGQSGSTLYMVNHGISTAALF
LIAGFLVSRRGSRLISAYGGVQKVAPVLAGTFLIAGLATLSLPGLAPFIS
EFLVLIGTFTRYPVFAVLAASALVLSAIYILWMYQRMMTGPVPPSLSEGE
NRIRDLVPRELVVVTPLIALLLLLGIYPKPALDIIDPAVAHTLTTVEQTD
PAPRMAEGPVR
145225071YP_001135749.1 NADH dehydrogenase subunit L [Mycobacterium gilvum PYR-GCK]MTLPVWLLIAVPLAGAAILLLAGRRCDAWGHLLGTAAALASFGCAAVMFT
GMLGRDPEQRAVHETLFSWVPVGELRVDFGLQLDQLSMCFALLITGVGSL
IHIYSIGYMASGAQPAERPDDPGRSRRLFFAYLNLFVAAMLLLVLADNYL
GLYMGWEGVGLASYLLIGFWSHKPSAATAAKKAFVVNRVGDVGLAVALMV
MFASVGAVGFDAVFEAAPQLGDGTLTAIGLTLLLAACGKSAQVPLQSWLG
DAMEGPTPVSALIHAATMVTAGVYLIVRSGPVFDLAPHAQTAVVIVGAVT
LLFGAVIGCAKDDIKKALAASTMSQIGYMVLAAGLGPAGYAFAIMHLLTH
GFFKAGLFLGAGSVMHAMNDEVDMRRYGGLRTALPITFVTFGLGYLAIIG
IPPLAGFFSKDGIIEAALGAGGVKGVILGGVTILGAGITAFYMTRVMLMT
FFGTRRWEGSGAHPHEAPAVMTWPMILLAIGSVTAGAALAIGGTLEHWLE
PVVGAQEIHHVLPVWVVTVIVLSVVAVGVAIAYRMYGARPVPADVPPGSA
LTVAARRDLYGDTVNERVLMRPGMTFTRHLVELDDEAVDGAGAGLGAGVS
RVSERLRQWQTGFARSYALSMLAGTALVVGMILAVNLW
145225070YP_001135748.1 NADH dehydrogenase subunit K [Mycobacterium gilvum PYR-GCK]MNPDNYLYLSALLFTIGAAGVLLRRNAIVMFMCVELMLNAGNLAFVTFAR
VHGNLDGQVVAFFTMVVAACEVVIGLAIIMTIFRTRRSANVDAASLLRH
145225069YP_001135747.1 NADH dehydrogenase subunit J [Mycobacterium gilvum PYR-GCK]MILFWVMAVVSVGGALGVIAAPKAVYSAMSLAATMIALAVLYIAQGAPFL
GVVQIVVYTGAVMMLFLFVLMMIGVDSSESLVETLRGQRIAALAVGLGFG
ILLIAGIGSVSATGIVGLDQANGGGNVEGLAALIFTKYLWAFELTGALLI
TAALGAMVLAHRERFQRRKTQRELAVERFAPGGHPTTLPNPGVYARHNAV
DVPARLPDGSGSELSVSAILQVRPVPTDERSPGGEE
145225068YP_001135746.1 NADH dehydrogenase subunit I [Mycobacterium gilvum PYR-GCK]MPKFLDAVAGFGVTFGSMFKKPVTEEYPEKPGPVAKRYHGRHQLNRYADG
LEKCIGCELCAWACPADAIFVEGADNTEAERYSPGERYGRVYQINYLRCI
GCGLCIEACPTRALTMTNDYEMADDNRADLIYGKDKLLAPLEPGMGAPPH
AMAPGATDEDYYRGTVSPSAEADAR
145225067YP_001135745.1 NADH dehydrogenase subunit H [Mycobacterium gilvum PYR-GCK]MTYPDPTLFGHDPWWLILAKSLGVFVFLLLTVLAAILIERKILGRMQLRL
GPNRVGPRGLLQSLADGIKLALKEGLVPAGVDKWIYLAAPVISVIPAFMA
FAVIPLGPEVSVFGHRTALQLTDLPVAVLYILAVTSIGVYGIVLAGWASG
SVYPLLGGLRSSAQVISYEIAMALSFVAVFIYAGTMSTSGIVAAQNDVWF
IFLLLPSFLVYLTSMVGETNRAPFDLPEAEGELVGGFHTEYSSLKFAMFM
LAEYVNMTTVSALATTLFLGGWHAPWPISIADGANSDWWPLLWFTAKVWL
FLFFFMWLRATLPRMRYDQFMRLGWKLLIPVSLAWIAIVATTRAMQNQGY
QGWVTALIGVAGVAAILASLLAWRALRARRRRTSHSPPAQSSDHGAFPVP
PLPVKEPADA
145225066YP_001135744.1 NADH dehydrogenase subunit G [Mycobacterium gilvum PYR-GCK]MTIAERASDAPPVEMVTLTIDDQPVTVPKGTLVIRAAELIGVQIPRFCDH
PLLDPVGACRQCLVEVEGQRKPLASCTTTVSPDMVVHTQHSSAVADKAQQ
GVMELLLINHPLDCPVCDKGGECPLQNQAMAHGRAETRFTDVKRTFPKPI
NISSQVLLDRERCVLCARCTRFSDQIAGDRFIDLLERGAQQQVGIAPGVP
FQSYFSGNTVQICPVGALTGTAYRFRARPFDLVSNPSVCEHCASGCAQRT
DHRRGKVLRRLAGDDPEVNEEWNCDKGRWAFTYATAGDRLTTPLVRDEDG
TLRAASWSEALTVAGAGLAASRGRTGVLVGGRSTLEEAYAYAKFARIVLA
TNDIDFRSRPHSAEEAAFLAAYVAGRPKSVTYADLENAPAVLLAGFEPEE
ESPIVYLRLRKAVRKNGVQVMSVAPLRTRSLDKLSARLITAAPGAEAGVL
DGLADDELLTMPGAVILVGERLATSPGALSAAGRLATATGARLAWVPRRA
GDRGAVEAGALPHLLPGGRPVDDVGARAQTALAWHVDELPAHPGRDGTGI
LDAARTGELGALLVGGVELADLPDPDHAAAALDAVPFVVSLEVRRSAVTD
RADVVFPVAPVVEKGGAFVNWEGRIRPFEPSLHTNSVTDLRVLSLLADEI
GVDLGVPTSVAAAEEHARLGLWAGDRPAPPQTEEHRAPAAHGEAVLAGWR
MLLDAGRLQDGEPHLAGTARTPTVRLSERTAADIGARGGDVVTVSTDRGA
ITLPLTVTDMADGVVWLPMNSPGSQVHQTLGVTTGARVSIGCAEQREPA
145225065YP_001135743.1 NADH-quinone oxidoreductase subunit F [Mycobacterium gilvum PYR-GCKMTSLTPVLSRFWDEPQPWTMDTYIRHGGYQALERALAMSPDDVIGTVKDS
GLRGRGGAGFPTGTKWSFIPQGGEGAAAKPHYLVINADESEPGTCKDIPL
MLTTPHFLVEGAIIAAYAIRANHAFIYLRGEVVPVLRRLQAAVAEAYAAG
HLGHDIHGSGFDLELTVHAGAGAYICGEETALLDSLEGRRGQPRLRPPFP
AVAGLYACPTVVNNVESIASVPPILLNGVDWFRSMGSEKSPGFTLYSLSG
HVTTPGQYEAPLGITLRELLDYAGGVRAGHELKFWTPGGSSTPLLTADHL
DVPLDYEGMAGVGSMLGTKALQIFDDTTCVVRAVRRWTQFYAHESCGKCT
PCREGTYWLAQIYERLETGRGTEADLDKLLDISDNIFGKSFCALGDGAAS
PIMSSLKHFRDEYEAHLGNACPFDPYASMLAAPEGVGV
145225064YP_001135742.1 NADH dehydrogenase subunit E [Mycobacterium gilvum PYR-GCK]MFLELGQRPDEPGPPIHGPATYPAAVHERLTADAATIIARYPQTRSALLP
LLHLVQAQDGCLTPAGIAFCADRLGLTDAEVTAVATFYSMYRRTPTGEYL
VGVCTNTLCAVMGGDAILESLEQHLDIAPGQTTADGRITLEHVECNAACD
FAPVVMVNWDFFDNQTPASARELVDGLRSGQTPAPSRGGSLCTFRETSRI
LAGLDGPDSATAGTVGEATLAGLRFAREHRMAAPAAGSPSDTTAGGGGQE
QAVAAESVKNEPAPAPEADVPARSGTAETDPEATDAP
145225063YP_001135741.1 NADH dehydrogenase subunit D [Mycobacterium gilvum PYR-GCK]MTTSAQRPERVIVVGGQDWDQVVTAARQMSNSSSRAGDAAEHAGERIVVN
MGPQHPSTHGVLRLILEIEGETIVEARCGIGYLHTGIEKNLEFRTWTQGV
TFVTRMDYLSPFFNETAYCLGVEKLLGVTDDIPERASVIRVMMMELNRIS
SHLVALATGGMELGAMTAMFLGFRERELILSVFETITGLRMNSAYIRPGG
VAADLPEEGLPQIRELLTLLPTRLRDMENLLNENYIWKARTLGVGYLDLT
GCMALGITGPVLRSTGLPHDLRKSQPYCGYQTYDFDVITDDRCDSYGRYL
IRVKEMRESLRIVEQCVERLERSTGEPVMITDRKLAWPADLKVGPDGLGN
SPEHIAKIMGHSMEGLIHHFKLVTEGIRVPPGQVYVAVESPRGELGVHMV
SDGGTRPYRVHYRDPSFTNLQAVAAMCEGGMVADAITAVASIDPVMGGVD
R
145225062YP_001135740.1 NADH dehydrogenase subunit C [Mycobacterium gilvum PYR-GCK]MTEPTGDQTPEIIGVRRGMFGAKGSGDTSGYGRLVRPVALPGGSPRPYGG
YFDEVVDRLAEAVGDDAFTESIERVVIHRDELTLEVHRDRLVEVAQALRD
DPALRFELCLGVSGVHYPDDTGRELHAAYPLMSITHNRRIRLEVAVPDDD
PHIPSLFGVYPTVDWHERETYDFFGIIFDGHPSLTRIEMPDDWVGHPQRK
DYPLGGIPVEYHGAEIPPPDQRRAYN
145225061YP_001135739.1 NADH dehydrogenase subunit B [Mycobacterium gilvum PYR-GCK]MGLEEKLPGGILLSTVEKVAGYVRKGSLWPATFGLACCAIEMMATAGPRF
DISRFGMERFSATPRQADLMIVAGRVSQKMAPVLRQIYDQMAEPKWVLAM
GVCASSGGMFNNYAVVQGVDHVVPVDIYLPGCPPRPEMLLHAILKLHDKI
QQMPLGVNREEAIREAEQAAMALTPTIELKGLLR
145225060YP_001135738.1 NADH-ubiquinone/plastoquinone oxidoreductase- chain 3 [MycobacteriuMNLYTPILVLGAIAAVFAVGSVGIALLIGPRRFNRAKLEAYECGIEPMDA
SDPAVAATAQRFPMRYYLTAMLFIVFDIEIVFLYPWAVAFDSLGMFALIE
MLLFMVVVFVAYAYVWRRGGLQWD
145225059YP_001135737.1 response regulator receiver protein [Mycobacterium gilvum PYR-GCK]MVVPSAETRGVLRVLVYSDNPRTREQVRLALGRRIHPELPELDYVEVATG
PMVVRQMDAGGFDLAILDGEATPVGGMGIAKQLKDELDVCPPILVLTGRP
DDAWLARWSRAEAAVPHPIDPIRLGDAVVSLLRPAA
145225058YP_001135736.1 regulatory protein LuxR [Mycobacterium gilvum PYR-GCK]MTAGLGLARTQVESAIVASRLRAVLVGAAGVGKTSMARKLARDYARKHPR
LTSHWVSATASARDIPFAAFSHLIDVSGGEEPTTLLRAARESLRSAHGLL
LVVDDAHHLDTLSATLVHQLAVTDNAHIMLTVREGEPVPDAVTALWKDSI
LSRHDIAPFDRRESGLLLEQILGGTVEDVSTVRMFEISQGNPLYLRHLVD
AALGTGSLRQVEGVWQLRGEMTLSPQLTTLIDAHLTNLPEPVRSVLEFLA
IDDPLSVDDLAALTGIDAVDAAETCGVVTITDRAGALYAHPFHPIYTERV
RSSLGLLAMRRLRKLLAGRMSVRAPGNLSTRLRMAALAMGTDEPPSADEL
VGLSWEAMRLGDLALGERLARAALDQADGLAARLPLAHSLSWQGRGRDAD
DVLNPVDPDTLTQWDLMAWTLPKAANRFWMLSESEEAVEYLRQMRARITE
RGALHTIDALAATFAMNAGDPAEAVTVAKGILAADDAQDLAVAWASAAAT
LSSARMGRFAEVDGLAQRGLDAAHPGLLRFTLGLGQTLALIMNADVASAE
HLARHYLSFSEFQQPGRAIGEVLLGHTLLASGRFGDAVTLLRQAAAALTY
TGYSWGPLALTGLAQALGQQGRAADASAVLTRAEASHGMRSALYAPDLAL
ARAWTLAAARDLRGAVASARDAVHAAVQSGQDAVALRALQDCARLGDTHG
LATAVRLSDRIGCVTGPLCVAHLRALAAGDGAALDAVSADLETAGLPAAA
ADAAAQATFAHQRRGDRAGEVASRSRASRLSQVCGAPATPALEQVLNPMP
LTGREREVAVMVSQGLTNKAIAQRLSVSVRTVEGHVYRACMKFGVPDRAA
LASTVGGMHGREGTA
145225057YP_001135735.1 hypothetical protein Mflv_4478 [Mycobacterium gilvum PYR-GCK]MGVFSVSASLRQSGVSLRSPDGVTLPEVETVWFETEDRMRLNFRHLPPVP
GTEDKGPVMFVHGSGTRADLFCPPSTITLPALLSAAGFDVWLLNWRGSID
VEPTSYTFDDAAVFDFPAAVSEILQRTCSTVGGIKAVVHCQGSHAFMMSI
ASGLLPEITTVVANSTAMHPRVRWSASVKLPFALKTLGKTTEWFNPQHGL
YASSFSARVLDLLVRLFHHECDNAVCKHSSFIYGVGFPTLWSHHHLDEVT
HDWIKGEFAHVPVSLFRQTHRCLAAGRLVPVRGYPGIQPGVAIHEPKTDA
NFLFMCGSDNKTFHPSGMRKTFEHFTTRTRGTQEHWEITGYGHLDPFLGK
YAAEDVFPRVIAFLEGQ
145225056YP_001135734.1 hypothetical protein Mflv_4477 [Mycobacterium gilvum PYR-GCK]MMPKVSLVCHVGLLLVLSILVFPGMFGGDVPRAVPLAVVALVLAVVLAVT
EVFSGLRWVALVALAAAVAGLIATVCDDPVSGAALWGWGLAWMAVVVWFA
VLASRARSNR
145225055YP_001135733.1 hypothetical protein Mflv_4476 [Mycobacterium gilvum PYR-GCK]MTGLRFRETMTGRIALRARDPVDGYGRVDGYAAVMHITIEIPDVAAFTAG
RVDAARLRADVLIPVLGGRFQTSGGEFVCFRSGEGPDGTPVQQMIYTATL
TNDDRVLEMSARKVLEPRGWRIWRVWPDTTTLLVTLVDVTPDDDKERPRH
LAGMLFITVRGFARQLTTMRPYGSRRWSEKLGALFGYLSFFAGRLIRIYL
SRRMAAE
145225054YP_001135732.1 GMC oxidoreductase [Mycobacterium gilvum PYR-GCK]MELQNGPCVDEVNYLIIGSGFGGSVMAAELATRRRGVCLFERGKAYPPGS
FPRRVKEIDDSIWAPGSGKHGMFDLWSFDGIDAVTASGLGGGSLIYANVM
LEKPAQWFTQPVPDGNGKTETWSFTHRDLRDHYRAVREVLQVQEIPRSLH
EEHSKKTTKFLDAGSVLAPLAVRFDGAEGPAKGAPLPPADYPNIHGDDVE
RTTCTMCGECDVGCNRGAKSSLDHTYLSVAAHHGAQICVRTEVREIAPCT
DDSDYLFEVAYVVHPECRNKSEPVERVIRAKRVILAAGTLGSTYLMLRSK
KLGLSDCAALGKRFCGNGDLLGFALPDGDDDELLPSGGPVITTYRSFDAG
DRRILLQDGGLPNLATWGWGPDDLREALAKLSVPRFASAWLWRLRWPLPL
LGMGADIPDGQLCLKDSDDTKMTCTWKKHTSDNHFQDVARRMEALTKDLG
AGFLPNFLWDFINEVITVHPLGGCPADTSAEEGVVDSYGRVRGVPGLWIA
DGSVMPGPVGANPSLTIAAFARRAAHELRKEDLATPSLPAPFIPQPYGDS
DRSG
145225053YP_001135731.1 regulatory protein LuxR [Mycobacterium gilvum PYR-GCK]MPVTVLGAQPTKFADRHADPVTARALHVPVQQVWGYRSDRSAVSSDRPPA
VHRPMSEERGDEYVVSFVESMTRRPAALVIQGEPGIGKTTRWMDVCEEAR
RAGVRVLSTRSGVGESALDFVGVDDLLADVEPEVFDALPIAQRTALRQVL
VRSGADGTEIDRRAAIGAFRALVAELATRTPVLIGVDDVQWLDEATRDAL
VYTMRRVRGPVAVVVTERAVTGRGSAVSWLDLGEAGSVTRLVVRPMSVAE
LHRLVAGRTGRSLSRPAMARLAEMSGGNPYYALELAQAMDSAGWVWSAGL
PSSLVDATGLHRERLDADVNEVLLAAASVVGPTVDLLAAVLHRPVEQIVG
SLEKAENLGIASIEAGRVGFSHPLLPHIIYSQARPGERRRIHRAVASVEP
SPQRQARHLALAATTGDPEILRALDSAAETARADAAPATAAELTEFAIGL
GGDTPVRRLHAARDHLLAGDIDRSLALLEPTAQGLPDGLMRAHARVLVGG
ALAVRGTFGRAVDELRVALADAAGDPGLTVQIQLALAMTLSAAGDHDGAD
DHVRQARMHAEGMADHVLTSQALAAQVLVRTANGEVADEVSLRRAADLEQ
RVHHTSELPAGVHTAAPFSARVVKALVSVWTGRLNEGRAQLAEAQARYAA
RGSDVDVLWIQFHSAMTDIWLGRHGDAARLAEDMLLGAEQLGGTAARALA
AEPRALLATLEGRESDARAEVDQVLEQVSDDVPPSNGLRTVLGFLELSLG
RHAAAVDVLSPLLARSRTGGSIEIATLRFLPDLLEAAFSVGRVDEFAAWV
DALEDAGTRLNRPWIVAVAARCRTMQLAARGELAAAQVTALRALDAHRGL
PMPFELARTQLIVGQLQRRLRQKRLARTTLTEALTIFEQLGTPLWAARAR
TELARTAESPQQHLLTATEQRVAELVASGLTNKDVAAALYISPKTVEHNL
GRVYRKLGIRNRTELGRQMDSLRDGPN
145225052YP_001135730.1 hypothetical protein Mflv_4473 [Mycobacterium gilvum PYR-GCK]MPTFLAEWQRSTFSDPTISKFVTLLESCAAQIAAPESPVRLIMVLAVAAD
LGVCAVFEADSAQTVLRVCRNAGAMPQRLTPDVEARILASESASS
145225051YP_001135729.1 hypothetical protein Mflv_4472 [Mycobacterium gilvum PYR-GCK]MPDTAVVADRLFAAITRSDIDTVAQMFSPGVAVWHSGDDRDCDHRRAVKV
IDWFVRATVDRRYEITDRRFFDGGFVQQHILHATARSGEAIAMRVCIVIV
VGDDGLITRIDEYFDPAEMQPLLVGGS
145225050YP_001135728.1 type 11 methyltransferase [Mycobacterium gilvum PYR-GCK]MDMDQTPTLSRFDDFYKDEDKTPPWVIGEPQPAVVDIERAGLITGRVLDV
GCGTGERTILLTAAGYDVLGVDGAPSAVEQARHNAKTRVVDARFDVADAL
DLGDEPAYDTIIDSALFHIFDDADREKYVRSLGRATAPGSVVHLLALSDT
GRGFGPEVSEETIRAAFADPGWDIEALTTTYYRGVITAPHADAMGLDVGT
VVDEPAWLARIRRL
145225049YP_001135727.1 hypothetical protein Mflv_4470 [Mycobacterium gilvum PYR-GCK]MTALTGRPTTAELVAAVADFLDHDVRGVGGQVGFHARVAANVLRIVEREL
LDDTDDAVRDAISGLGADDESALAQSIREGRLDDRPEEVMTALRTLVRHR
LGIDHPGYADG
145225048YP_001135726.1 aminoglycoside phosphotransferase [Mycobacterium gilvum PYR-GCK]MSDDLARALEDVLRPVLGDTTVEDLQRLTGGASRTTWAFTSRSDGRSRHL
ILRTGARDDIHASMELEAKVQQRAAAAGAPVPHILAADNSPDAVGEPYLI
CDAIAGETIVRKIFRMLDDTGRARLLTQCATALAAIHRADPDGVGLAAPD
ELAGWRTRLDEIGDTTATFEWTFRRLADERPDPSPMRLVHGDFRMGNLIV
DDSGLAAVLDWELTHIGEIYEDLSWFCIRAWRFGAAESLGAGGLGSVETF
LQAYESAAQIVLDRSTFRWWLTVATLRWGVICRHQAERHLSGEARSVELA
AIGRRVSETEWDLLDLLSGKGPQ
145225047YP_001135725.1 acyl-CoA dehydrogenase domain-containing protein [Mycobacterium gilMDFTLPDYLPGLLAEMDAFIEAEIKPLEREHIQYFDHRREHARTDWDNGG
VPRREWEELLDEMRRRADAAGWLRYGLPSQFGGRDGSNLDMAVIREHLAA
KGLGLHNDLQDESSIVGNFPQVIMMDRFGTEEQKREWTDALVTGKRSMAF
GLTEPNHGSDATWLETTAVQDGDEWIINGAKRFNTGVHRATHDLVFARTS
GEAGQARGITAFLVPCDSPGFTVPYYWWTFNMPTDHGEVLLENVRVPSGA
ILGEVDRGLEVGQTFLHENRIRQAASSLGAAQYCIDRAVTYANDRKVFGK
PLATHQAVQWPLVELQTEAQMVRLLVRYAASELDRNHHMEVSDKVSMANY
RANRLVCEAADRAMQVFGGVGYSRHEPFEHIYRHHRRYRITEGAEEIQIR
RVAQRLFGFGRK
145225046YP_001135724.1 TetR family transcriptional regulator [Mycobacterium gilvum PYR-GCKMPPGSSDALSAKGRQTRDALAQAARKLFAERGFHGTTLSDITSAAGKSPA
AFYRYFSDKEDLLAALAESFLHEVVAPSGLSVPLPESPDDDAFFTAVVTG
YWTMFKQNIGIMIAVAQLAATQPRFTLVQNEFRRFGMDIVAASVRRAQEQ
GYGTELNPEHTAAAIALLFENFTTVFVGASGLGVQMTDQDAIATLSRIWK
KTLYGY
145225045YP_001135723.1 pyruvate carboxyltransferase [Mycobacterium gilvum PYR-GCK]MTELPTHVDIRDVSLRDGLQIEDPIPLSAKLELLASIAATGVTEMEATAF
VSPSKVPALADAAELAAELHNFPGIEFSALVASPNGAKRAIAAGLRSIEY
VVSAADGHSRANVGRASAEATAQIAEITAIAHDSDASVEVIIATAWDCPF
DGPTAPQRVIDIVTAATDAGADRMAIADTIGTATPRRVGDLIALVRPLVG
DTPLGAHFHNTRGAGLASAFAAVSAGVTRLDASVGGLGGCPFAPGASGNI
AVEDLVYLLRDSGIHTEVDLDAAIAAARVAQDVVGHSLPSSLLRAGDRIL
G
145225044YP_001135722.1 formyl-CoA transferase [Mycobacterium gilvum PYR-GCK]MTTGPLDGIRVIEVGTLISGPFAGRLLGDMGAEVIKVEPPGAPDPLRTWG
QAELDGHHFFWTVHARNKKAVTLNLRVPEGRDLFLDLVERSDVIVENFRP
GTLEKWNLGYDVLRERNRGIILVRVSGYGQTGPDAHKAGYASVAEAASGL
RHMNGFPGGPPPRLALSLGDSLAGMFAAQGALAALYRRSVTGEGQIVDAA
LTESCLAVQESTIPDYDVGGVVRGPSGTRLEGIAPSNIYPTADGSWVVIA
ANQDTVFRRLCAAMGQPELATDERFADHVARGRNQDEIDKIIGGWAAQRQ
PDEIISTLSEAGVISGPINTVAEVVEDPQLQARGMIADHWDERIGRNVKG
PGVVPVLSETPGTIRSAGSARPGQHNDEIYRDLLGRSAAELDKLQEEGVL
145225043YP_001135721.1 hypothetical protein Mflv_4464 [Mycobacterium gilvum PYR-GCK]MTKYEYDRIPYLVAYQNNSAVRDVYGGVAELVVLESYLLKPKTVESAAGA
APAATSDTVLVFMHPIGGGAYLPMINALARAGHHVIYCNSRFRGTDSALL
MEKVVEDLGECIKDAKNRLGYQKVVLAGWSGGGSLSVFYQQQAQHPTVTA
SPSGDGPDLTKLGLIPADGIMLLAAHISRHGTMTEWMDASILDESDPSKR
DPELDLYNPDNPHQPPYTQEFLERYHQAQIARNRRITKWVKEKLAELKAA
GRPEDEFAFVVHGTMADPRWLDPTVDPNERAPGTCYLGDPQVVNMSPVGL
ARFCTLRSWLSQWSYDDANGDAVKAGPDIAVPALVIGNLADDACTPSHTR
RIFEAIRHEDKEMHEIAGANHYYAGADQRDKLREAVGIVTEWLQRHDFAG
AR
145225042YP_001135720.1 homogentisate 1-2-dioxygenase [Mycobacterium gilvum PYR-GCK]MESFVHLRKGKTPKRIHADLDGLKDDELGRGGFVGRTANMYRRNDPTAYR
TVGPLRPTDVLSSELKPSDATDPRGGPLLMFSNADCQVLLSRRTEEMPFF
VRYVDGDLLSFVHRGSGSLETEFGPLTYRQGDWIYIPKACTWRQIPDPGP
TGTTTLLMVQATEEFRVPPAGTLGRHFPFDPAQAVIPEPQPIDDDGRDEY
EVRLIHEGGPTSLFYKHHPLDVEGWRGDNFPFTFNIDDYTVITSDSVHLP
PTVHLFMQATGVYIMNFLPKPAESVPGTERTPWYHRNVDFDEIAFFHDGS
LYGIPMPPGLVSHAPQGVHHGAPEKARERARRKFDDYDRVDWSVIAVDTR
RRLIPSPEILANDLGQH
145225041YP_001135719.1 hypothetical protein Mflv_4462 [Mycobacterium gilvum PYR-GCK]MAETTRDRVTKFFQKNIANRVMRHIPIQTLLETTGRKSGLPRTTPLGGRR
IGDEFWFVSEFGDRSQYVRNIMADQNVRLRLRGRWHRGIAHLLPEDDAQA
RMRMLPRYNNVGVRTFGTNLLTIRVDLID
145225040YP_001135718.1 acyl-CoA dehydrogenase type 2 [Mycobacterium gilvum PYR-GCK]MSSKVTAPAAVTDQFIADLSDRADDAERLRRLPAETLTDASASGLFDLLV
PSRYGGQEAPFPAILEPVRRMAHGCASSAWTLGFYTLHNWMLALFSEEAQ
QEGFAARPFLAPAPLAPTGHGVACEGGIRVTGRWSWATGVMDGNWIMVGA
LCERTAGDPSTLYPVLALLPIDEARIEDVWHTDGMRATGSNDVIIDGAFV
PSHRIVKVTDIYTGAAPGAALHDADTYRWPMVPALALLAAMPALGSAERA
VEIYTERLSQRFLAYEGVMQKDKPVASIHLGSASVRLRALDALLADTVGE
IENIIAAGDPVERPVRAHARLAAAHIVHESRAVIGELLGASGASAHFLDN
PLQRVKRDVDVIAGHVVFDYDTSRELAGAVTMGAPIPRTAMV
145225039YP_001135717.1 TetR family transcriptional regulator [Mycobacterium gilvum PYR-GCKMAKSGESAGRLSVDDWIQAGYAIIADEGRSALKIDRLCTRLGVTKGSFYW
HFRDMAAYRAALVQAWAELRDSDRSHFGDLGDLTPRERLTRMMASLLGER
QWTLERAMREWARTDPVVADSVHNADLLVLGAVRDAFLAAGFDDDDADVR
ANATFAAGIGFLHLSAAPPDARLTEQRERFLDLMLSR
145225038YP_001135716.1 putative esterase [Mycobacterium gilvum PYR-GCK]MRLLDRIRGPWARRLGIATLAALLLPGVVGLTGGSVTAGAFSRPGLPVEY
LMVPSPSMGRDIKVQFQSGGPNSPALYLLDGLRAQDDFNGWDINTQAFEW
YLDSGISVVMPVGGQSSFYSNWYKPACGKNGCLTYNWETFLTQELPAWLQ
ANRDVRPTNNAAVGLSMAGGSSLVLAAHHPGQFSYAGSMSGFLNPSEGWW
PGLINISMGDAGGYKANDMWGPAETDPAWQYNDPMVQIPNLVANNSRIWV
YCGNGTPNELGGGDLPATFLEGLTIRTNRTFQDNYLAAGGKNGVFNFPNN
GTHNWAYWGRELQAMKPDLQAHLLG
145225037YP_001135715.1 alcohol dehydrogenase [Mycobacterium gilvum PYR-GCK]MTQINAMVAHEDAEGGIVLRREILDESALPDGDVEIHVEFSSVNYKDALA
VTPKGGVARSYPLVPGIDVAGTVTSSSSPDFAVGDRVIAHGQDIGTGRHG
GYAQTARYPADYLVKLANLSTADAAAIGTAGFTAAMSVLALRTHGVEPSD
GPVLVTGATGGVGAVSVDLLAGLGYEVVASTGKSQAHDLLRDLGAAEVID
RVPGPDEKVRALGKAHWAGVVDCVGGKTLAYALSTLKYGGVAAISGLAGS
PELPTTVMPFILRGATLAGIDSVLLPIESRREIWTQIESGLAPRHLARIT
RDVPVRDVADVLGTIIGGGVTGRTRVVVHDGF
145225036YP_001135714.1 molydopterin dinucleotide-binding region [Mycobacterium gilvum PYR-MEHRVTCPLCEAMCGLKITVSDGVATSARGNADDVWSRGHLCPKGASLHQ
IHHDPDRLRLPLVRSRSGEHVQVSWDDAFTETERVLRPVIDRYGARAVTV
YLGNPVAHNLGLQTYIGALVGMAGAVGMPAYYTPGTVDQWPLNVVSALLF
GGMWNAPIPDLDRTDHLMMLGANPSASQGSMLSAPDIMGRLAAIRARGGT
VVVVDPRRTPTARRASEWVPVHPGTDALLLFAILHTLAERGWIRRPPHLQ
DLVAGLDDVVGLAARFSPERVEVATGVPAGTVRRLAADLAAAERPVLYSR
IGACTQEFGTLATWLVFVLNVALGSVDAPGGALFPKAAVWSPMFMKPPDQ
DGPGWRFGRFHSRVRRVPEVLGQFPVSCLAEEIDTPGDGQIRGLITVAGN
PVISAPGSRRLDAALSGLDAMISVDNWLNETSRHAHVVLPGLSPLERAHC
DDLYWMYSVASCVKWTEPVFPTRPDRPQEWEILLRLAGAVLGTAVPDVDV
RAMDDLYSQGIIHTACQADDTPLSGRDPGEVFEALDGVGPERMTDLGIRV
GPWGDDLGRRPGGLTLDEVRRHPDGLRLAELEGGRLPDVLTTPSRRIELL
HPLLEADIPRLVSRIDRGRDDLVLTSRRHLRSNNSWMHNVAALMRGKDRC
TLLIHPDDALRHDVADGGQVEVSTTEGSIVVVAEVSDEMMPGVVCLPHGW
GHGIDGTRLAVANAHPGVNSNLLSPPALVDVPSNTQVVNGVPCRLRSRRE
PPHASAR
145225035YP_001135713.1 acyl-CoA dehydrogenase domain-containing protein [Mycobacterium gilMAINLELPKKLRAVIEKGHQGAAEILRPISRKYDEKEHAYPVELDTVATL
FEGISEAKTISFAGAEAFRDGDDDPKGNINGGNMSAVLNIIEVSWGDVAL
VLSIPYQGLGNAAISGVATDEQLERLGKVWAAMAITEPGFGSDSAAVSTT
AKLDGDEYVINGEKIYVTAGSRATHIVVWASLDKSKGRAAIKSFIVPREH
PGVTVERLEHKLGIKASDTAAIRFDNVRIPRENLLGSPDINVEKGFAGVM
ETFDNTRPVVAGMAVGVARAALEELRKILTDAGIEISYDKPAHAQSAAAA
EFLRMEADWESGYLLTLRSAWQADNRIPNSKEASMGKAKAARVASDITLK
TVELAGTTGYSEQALLEKWARDSKILDIFEGTQQIQQLVVARRLLGLSSA
ELK
145225034YP_001135712.1 acyl-CoA dehydrogenase domain-containing protein [Mycobacterium gilMTNTLPPKRGDRESAVGLQKHRRTAIDVGMALLTPLMGQEFLDKYNLRDP
LNRGLKYGVKHGFSAAGAATRQFKRVQGIGKPATRLTENRPKGSDYFDLT
PDDDQKMIVQTVEEFAEEILRPAAHDADDAATYPPDLIAKAAELGITAIN
IPEDFDGIAEHRSTVTNALVAEALAYGDMGLALPILAPGGVASALTHWGS
ADQQATYLREFAGESVPQACLAIAEPHPLFDPTALRTTAVRTPSGYRLDG
VKSLVPAAADAELFIIAAALGGKPALFLVEASTPGLTVTADPSMGIRAAA
LGRVELAKVTVPLSARLGEEDASAADTAQIYSDAIALSRLGWAALAVGTS
HAVLDYVIPYVKEREAFGEPIARRQSVAFMCANIAIELDGLRLITWRGAS
RAEQGLSFAREAALAKKLGADKGMQIGLDGVQLLGGHGYTKEHPVERWYR
DLRAIGVAEGVVVL
145225033YP_001135711.1 histidinol-phosphate phosphatase [Mycobacterium gilvum PYR-GCK]MSTLADDVTLALQLADEADVLTMQRFGAVDLRVETKPDLTPATDADLDAE
RLLRARLGEARPQDSVFGEEFGGTKEFTGRQWVVDPIDGTKNFVRGVPVW
STLIALLVDGVPVVGVVSAPALGRRWWAGQGQGAFTSFAGTTRRISVSGV
GDLASASLSYSDLTTGWDDKRARFVELLDAVWRVRGYGDFWSYCLVAEGA
VDIAVEPEVKLWDLAPLDVLVREAGGRFTDLSGGAGPHGGSAVATNGRVH
DAVLAALDV
145225032YP_001135710.1 hypothetical protein Mflv_4453 [Mycobacterium gilvum PYR-GCK]MFEFAMILLLVGALVLLARPLLARRRGVGNGWVPGTLLVTGVSPRPDGVS
GEQFVTITGVINGPTVNEYTVYTRMTSDVNSWPTMGQLIDVMYNPGNPEK
WAFGSRPEPLPPTDPPPPAPPAPYN
145225031YP_001135709.1 FAD-dependent pyridine nucleotide-disulfide oxidoreductase [MycobacMPPLRPYYVAIVGSGPSGYFAAASLLKSGGADGNRDVCVDMLEMLPTPWG
LVRSGVAPDHPKIKSISAQFDKTSADPRFRFFGNVVIGEHVHPDELAERY
DAVIYAIGAQSDRALGIPGEDLPGSVPAVDFVGWYNAHPHFVDMAPDVSG
GRAVVVGNGNVAIDVARILVSDPDVLAETDIADHALESLHARGVEEVLII
GRRGPLQAPFTTLELRELGDLEALGDVDVIVDPGDFADITDEDLEAAGKT
VRNNIKVLRGYAETTPKGAKRRIVFRFRTSPIEIRGDGKVESIVLGRNEL
IRGDDGRISAKDTGERDEVAAQLVVRAVGYRGLPTPGLPFDDRAGTIPHV
DGKVEGRRNDYVVGWIKRGPTGVIGSNKKDSADTVATLLNDLSSAELADF
GSDHPDKVQQWLQERQPKLITSEHWKLIDTHERTAGEGSGRPRVKVTSVE
DLLRIGHA
145225030YP_001135708.1 peptide chain release factor 2 [Mycobacterium gilvum PYR-GCK]MDPDRQSDIAALDTTLTTVERVVNVDGLRGRIQQLESDASDPKLWDDQAR
AQKVTSDLSHAQNELRRVEELRSRLDDLPVLYELAAEEEGAGSSEAFAEA
DAELAKLREDIAGMEVRTLLSGEYDEREALVNIRSGAGGVDAADWAEMLM
RMYIRWAEQHDYPVEVFDTSYAEEAGIKSATFAVHAPYAYGNLSVEQGTH
RLVRISPFDNQSRRQTSFADVEVLPVVETTDHIDIPEGDVRVDVYRSSGP
GGQSVNTTDSAVRLTHIPTGIVVTCQNEKSQLQNKVSAMRVLQAKLLERK
RLEERAEMDALKGDGGSSWGNQMRSYVLHPYQMVKDLRTEYEVGNPAAVL
DGDIDGFLEAGIRWRNQKVDDE
145225029YP_001135707.1 mechanosensitive ion channel MscS [Mycobacterium gilvum PYR-GCK]MAQPESRRRITLNTTVLAFDMAGAWRGFWQGDTGVWILGRGVPIALLLIG
GLLAARFINWSARRITRRIDAQYLESDQLVRTESAKHRQAVASVISWVSV
ALLFVMVAVQITDILAIPIGSLVAPAAVIGAALGFGAQKLVQDLLAGFFI
ITERQYGFGDLVELNMVGAPQAAQGTVEEVTLRVTKLRTSEGEVFTVPNG
NIVQSLNMSKDWARAVVDIPVPTTVDLNRVNEVLHRVGETAMQDDELRAL
LLDTPQLMGVESIEVDTVNLRMVARTLPGKQFEVGRRLRILIIAALAGAG
ISTQEHTPVVSNISADGDTASSEADARSRAEQKS
145225028YP_001135706.1 hypothetical protein Mflv_4449 [Mycobacterium gilvum PYR-GCK]MTLPSFLQRLQPKNRHSRAYLFGGRMRVSTVGLVLVFFALYWVNQNYQPE
PPAPAMDPAQQVVPPGFVPDPNYTWVPRTNVETRAPEPTTTTTTTTTTPT
TTTTTTPSPTPDTPTTSPETSTPPPAGPLFPSEPTTTVIDPDGPGPLAPQ
TFTQAPPVLTPTTVAPPGPVLPPTPPQP
145225027YP_001135705.1 type II secretory pathway family protein [Mycobacterium gilvum PYR-MITLDRVSKQYKSSARPALDNVSVKIDKGEFVFLIGPSGSGKSTFMRLLL
AEENPSSGDIRVSKFHVNKLSGRHIPGLRQVIGCVFQDFRLLQQKTVFEN
VAFALEVIGKRADTINRVVPDVLEMVGLSGKANRLPGELSGGEQQRVAIA
RAFVNRPLVLLADEPTGNLDPDTSKDIMDLLERINRTGTTVVMATHDHHI
VDSMRQRVVELELGRLIRDEQRGVYGMDR
145225026YP_001135704.1 hypothetical protein Mflv_4447 [Mycobacterium gilvum PYR-GCK]MRFGFLVNEVLTGLRRNVTMTVAMILTTAISIGLFGGGMLVVRLADQSRA
IYLDRVESQVFLTPDASADDPTCDNDPCKALRQTIEDRDDVRSVRFLNRD
EAYEDAIRKFPQYKDVAGRDAFPASFVVKLDDPEQHQNFDEAMVGQPGVQ
SVLNQKDLIDRLFAVLDGISNVAFAVALVQAIGAVLLIANMVQVAAYTRR
TEIGIMRLVGATRWYTQLPFLVEAMLAAFIGVVLAIVGLILVRALFLEKA
LDQFYQANLIAQVDYADILYYSAPWMLFLGLAMSGITAYVTLRLYVRR
145225025YP_001135703.1 SsrA-binding protein [Mycobacterium gilvum PYR-GCK]MAKKPKSVKDTNNMVVASNRKARHNYSILETYEAGVALVGTEVKSLRDGT
ASLADAFATVDDGEIWLRNLHIPEYHHGSWTNHAPRRNRKLLMHRREIDN
LVGKIRDGNLTLVPLSLYFTGGKVKVELALARGKQAHDKRQDMARRDAQR
EVTRELGRRVKGMTN
145225024YP_001135702.1 hypothetical protein Mflv_4445 [Mycobacterium gilvum PYR-GCK]MAALGYGVSDFVGGIASRRVAALRVVVISYPVALLLLVLAAVPFGGQLST
AAILWGLSAGIVQAFGVWWFYAALGSGPISVVSPLTAILVAGIPVLAGLA
FGERPGTLAGVGVVLALIAVVLVSRDSAGDAEAARTGARFTAKVAWLTVG
AGVAFGLNFVILHRIPKEAQLWPLVFGRAAAVVVVLIAAVATANLVIERG
VPLRLAVLAGGLDTVANIATLVALQSSLLSLAGVLIALYPAATVVLAIAV
LRERVSRSQCVGMVLALAAVGMIAAG
145225023YP_001135701.1 diguanylate cyclase/phosphodiesterase [Mycobacterium gilvum PYR-GCKMTGYRIRASVVLAATLLVLVNGFAPWGQAAALRVDAILQVCTAAVAVVYG
LWVARRVHGVSRTWRLLAVGAVAGLLVGELVWWERAGLLPLVGVIPYLLF
LILGLASMLVLVGAGRGISVPADGSLRYTAVITVLDGLVAAAAFAILVFL
VRYGAYSSSSWPHSSSPPIEIGYAVFQLVVVVVAAVVGMMYAADRPFRSN
FLQLACGVVMAISSDRVIAYFDSIGNEGAQIWAGVGLVLGPLLIAFSFRE
RTDATREPAETMRPMDWAQMTLPYAGFIGITILQAYHLLTGHTIGRGVVA
TTLVMVVLVAARQTVAMGTQRQLTRKLYEAQRGLAHQVHHDALTGLPNRL
MFAQRLEAAVQHGDFVLIFVDLDDFKEVNDRFGHAAGDELLCAVGERLRR
HVRSEDTLARIGGDEFAILIDGVRDIPELIADRLRVALRDPFPVHGSSLR
VRASMGLVRSGGAGGLQTPDDLLRQADISMYAGKRLGKDTAVVYQPSAGV
RAEFPAALREAQGGVPDGFTLAYQPVVHLPDQTPAALEALARWTAPNGIL
IAPETFVAVAEASGLGATLDAMVLRLACREVKDAGLDVDIHVNVGAARLG
NPTFEEQVHRTFDECGMEPSRLVLEITETVPIVDLADAAAQIERFKALGI
RIALDDFGAGYNSLTYLHALPVDIVKLDRSLAVGADPERDLALYRSVIGL
CTDLGMDVVAEGIETQLQADTVHAAGCAFAQGHLFGKPVAISELTRGWHE
RSGQIGGGRGVNQPS
145225022YP_001135700.1 hypothetical protein Mflv_4443 [Mycobacterium gilvum PYR-GCK]MGARTATFGPIRRHWGAAGYPSARLGAMTESGASRVAVYLDFDNIVLSRY
DQVNGRNSFQRDKAKGFDEVRDKLDRATVDVGAIIDFASSFGTLVLTRAY
ADWSAEINARYRGQLVGRAVDLVQLFPAAAYGKNGADIRLAVDAVEDMFR
LPDLTHVVIVAGDSDYIALAQRCKRLGRYVVGIGVAGSSSRMLAAACDEF
VTYDTLPGVPVFEPEPVADEKPAPKRRSTRAKATSEEAATETPEEPEQPD
PQTSATGLLTRALRIGLEKDDADWLHNSAVKAQMKRMDPSFSEKSLGFKS
FSDFLRSRSDVVELDESSTIRMVRLRENA
145225021YP_001135699.1 hypothetical protein Mflv_4442 [Mycobacterium gilvum PYR-GCK]MEAVSSVGQGREPLRHTVLADADSAAYHSLRQRPVTRAERYALGKSLRKR
VPRKSLADWAPRPDRPDPVRLIEVNHRGRLEQLVPVRVGRMIASPYGFLR
GTAVVMADDVARLPSTGIMPVVCGDSHLGNFGFYASPERDLVIDLNDFDE
AHPGGWEWDLRRLVASIWVAGRHNGASEDDCEAAVRSCVSAYRLEVRRLA
DEPLFSRSFTRIDVDRLAGEAAGPLADEVRRSAARARNRTSDRALPRFTQ
EVDGVRRIIEEPPLITRLPAQEADALAEALDAYLPTLASHWRRVLGGYTL
LDVAHKVVGVGSVGLRAYVALLEGSSPEDVVFLQLKQARRSVLARYVHGE
SAWHAHQGQRVVEYQQALQTVSDPLLGWTTVNGLQFYVRQFRNMKGTIPL
DAMHPKALIDYTGVVGQLLAKGHARTSGASMIAGYLGRSEKVDIALSTFA
RRYADQTEADHAALVAAVEDGRLPVERGV
145225020YP_001135698.1 putative short chain dehydrogenase [Mycobacterium gilvum PYR-GCK]MSAIDPDKLSTCLQVLADIEALPPEHPDAVAVRRATASIFKSVRKARRHA
KRDAVAAADRAVIAATATGAPGRIDDETAGLPLVSTADGATAGTLQRSRA
CYVCKTHHTVVDAFYHQLCPSCAALNRAKRDARTDLTGRRALLTGGRAKI
GMYIALRLLRDGAHTTITTRFPNDAVRRFAAMPDSADWLHRLRIVGIDLR
DPAQVVALADTVAAQGPLDILINNAAQTVRRSPGSYAALVEAERAAPAEL
GLVDVISFDRVSDAHPAALAGSLAEQHTPHAVTELALAARSASPERIAAG
TAIDAGGLLPDTAPVNSWTQRVHEVDAMELLEVQLCNQTAPFILVSRLRP
AMAASSARRKYVVNVSAMEGQFSRAYKGPGHPHTNMAKAALNMLTRTSAG
EMLEQDGILMTAVDTGWITDERPHPTKLRLADEGFHAPLDLVDGAARVYD
PIVRGEAGEDLYGCFLKDYSPGNW
145225019YP_001135697.1 hypothetical protein Mflv_4440 [Mycobacterium gilvum PYR-GCK]MGSARLAAVLWILGATVYLVCETVAAAAVPGYSYITDYISELGVREVMNV
GAFMVHGILFGLAAVVLVRGCPLMGARVFLIAAVANTAGNILVGTFQSGT
PNAHWHVIGAGLAIVGGNVALITAGIAGGAVRAPTWFRRASVTLGGFGLV
CLIALITDGANGSRALPAGMVERGSVYPIIIWELLAGITLLRRR
145225018YP_001135696.1 cutinase [Mycobacterium gilvum PYR-GCK]MGLSECLSGVTAPGLALAAGLLLAPHAFAQPALTPAPGPAPPPIAAPAPE
PLAAPVAGCPDVEIVFARGTTEAPGLGAMGQAFVEDLRSRLGGKTVGVYA
VDYPASPDFPTAVEGIADASTHVQQIAMNCPDTKLVLGGYSQGAAVMGFV
TTELIPDGVSLSEVPAPMPPDIADHVAAVALLGAPSDRFMDMIKQPPVTI
GALYQPKTLELCVPGDFVCSPGNDLGAHARYISDGLVVQAADFAVGKLAE
TPAESGGAPA
145225017YP_001135695.1 hypothetical protein Mflv_4438 [Mycobacterium gilvum PYR-GCK]MTTGDMYFIPRAYPHHIENIGTDEWHFLIFFDQPFPADIGYRASASAYSR
EVLAAAFNTHIEDLPRFPFTPADPLIVSRINPVD
145225016YP_001135694.1 cupin domain-containing protein [Mycobacterium gilvum PYR-GCK]MTTSVTRSRHTTSLHDGEIVEESDLGSMRRVTADNLPILQGLSIKRVLLN
PGAMRTPHWHANADELTYCVSGTALVSILDDHSSFSSFVVTAGQMFHAAS
RSLHHIENIGEDVAEFIIAFRNERPEDFGLGATLGAFSDAVLGNTYDLPA
SDFATIRRDTGTRASGPATDRRLAARIGDPEIPSCAHFNDPHKFDVEAQA
PGLNYVTGNARFARNQFWPALKNMSMYSLRVSESGMREPHWHPVTAEMGY
VKHGDARMTVMNPDGSWTRGR
145225015YP_001135693.1 hypothetical protein Mflv_4436 [Mycobacterium gilvum PYR-GCK]MESGSPPIVSTVARPHPARLDTACYPVHRAVDTRFGDMDANGHLNNVALE
SLHENTRAMLNRQVFPNVYDRTTRRLRIVTSTIVVHYLREAPWPSVIDTA
IGIGHVGRTSYVASTALFHDGACVSLCDTVLVVLGDDGPTPIPDENRDRL
ESLTLRVA
145225014YP_001135692.1 hypothetical protein Mflv_4435 [Mycobacterium gilvum PYR-GCK]MTNPRDPETRRLPRPGGPDAPTEQIRARRPDAAPTERIRRPVPPSSLPLP
PPSPPALRDNRGGRGLFTRRTSRLLAVIAVAALAGGLAGAELYARHRADA
VLVGIAECVVEDGTTISYGVNPPFLWQHITGRYTNISVRTAGDRVQSADG
MTADVTLEDVRLSGSGDSKGTIGALHATLTWTAAGIKDTVAANLPGVGAL
VTDVTTDPSAGTLEMAAGSASVIAKPVVVEGNLNLEVLDVTGPFPKDAVQ
SALDDLTRKLNDNYPLGIRADSVEVTDAAVVGSFSSRDASIPDGESDPCF
ARL
145225013YP_001135691.1 AsnC family transcriptional regulator [Mycobacterium gilvum PYR-GCKMTRLDRTDARLLLALCDAPRATGVQLAAMLNLARNTVQARLARWDQDNVL
APIDRCVSPRDLGYPLKAFITVVVDQHKLEDVIAELATVSQITQVTGLSG
AADLLIAVVATDADDLYRVAGLVLAVPGVERTTMSIAMHEVIAYRTRPLI
EELARGR
145225012YP_001135690.1 indolepyruvate ferredoxin oxidoreductase [Mycobacterium gilvum PYR-MTDLDVRPPDPHPYDLDNRYRAGSDAVLLTGVQAIARALVEQHERDARAG
RRVATFVSGYQGSPLGGVDRMLYGMPDVLQAHDIVFVPGLNEELAATSVW
GSQAELPAGTPTHDGVVGVWYGKGPGLDRATDALRHANMYGANARGGMVL
LVGDDPASKSSTVPAVSERSLAALGIPVLFPRNAREIVTLFLHGVALSRA
SGCVVAVKIVADVADGAWTVDADDLDLEIVDPEVEWQGKPFVYRQRPMAA
PADSLLAEADLYGPRAEMVQAYSSANRLDVVEIDPPDARIGIAAAGTTFD
SLRQALTDLGADDSALRAAGVRLLRIGMVSPLCADTVLGFASGLDEILVV
EDKTAFVEAQMREILYGATNPPRMMGKKDAAGRSLIPADGELTAGRLLAP
LRRVLGDRLELRKPPPPALPLEVLPTRRTAYFCSGCPHNRSTAVPEGSLA
GGGIGCHTMVTMSGRADSAVTGLTQMGGEGSQWIGQAPFTDIAHLFQNIG
DGTYFHSGQLAVQACVAAGVNITFKLLYNEVVAMTGAQHAEGALGVASLT
HKLKLEGVAQVIVCADEPRRHRRRDLAAGTLLWHRDRLDEAQRRLRDVPG
VTVLIYDQHCAADARRQRSRGTLPSRTTRVLINEAVCEGCGDCGVKSNCL
SVQPVDTEFGRKTRIDQTSCNTDYSCLDGDCPSFVTVEVTPGRARKPGSA
PTPPPVPDVCVEPVTSTHNVLLAGIGGTGIVTANQVLATAALRAGYDVES
LDQIGLSQKAGPVVSHLRFAADRLEPANRLTPGTADCILAFDLLAAADEK
NLGYGDPATTVSIASTSRTPTGEMVYDASVAYPDTSSLLHRLGRASRRVQ
EFDASAAAKTLFGNTAAANFLLIGAAYQAGALRIPAAAIEEAIGINGVAV
ATNVAAFRWGRVAIADPAHFHDVAVPVPAGPVGTAPVHLLAGTGISGRVG
DLIARRAADLIAFQSEAVARRYVSVLQRVWTAERRIGSRTEFSEAAAKGL
YKFTAYKDEYEVARLLTHPRFLAQVRAEFPAGENLTYKVHPPTLRALGRR
KKIGLGPRSHVVLRALAAGKRLRGTVFDPFGYAHVRRVERRLLAEYTDLI
TGVADTLDEHNYDRAVQVAGLADTVRGYEGVKLASVEVYRARLREMGF
145225011YP_001135689.1 cutinase [Mycobacterium gilvum PYR-GCK]MTARTMSAHAQKTLLAALSAFTVLFAGSAVGTPTASAAPRCSDIELVFAR
GTDEPPGLGVVGKSLFDSLKPMVRGKSIGTYAVKYPATWDFAQVAVGAND
ASRRIQTIAAACPDTKIVLGGYSQGAAVIDVVTTAPIAGLGYTAPLPRAV
VPHVAAVAVFGNPSARIGRPLTLLSPDFGSRTADLCNTNDPVCSRGTDFD
AHVRYPQSGLVKLAAQWITKHVEQRV
145225010YP_001135688.1 hypothetical protein Mflv_4431 [Mycobacterium gilvum PYR-GCK]MTWDDPDAASLRNLLDEHRLRALVHRYCRAVDRGDVEALRTLYHDDADDA
HGDFSSGSVRDFIAGIAAARPYLRSMQHHVTTTNFAIAGNVAEGEIYMIA
THTLIADGRDVDVVVGGRYLDRYEKRDGTWKFVARAIVTDTAHVLDPSTR
DLSHPVTRGTPLGSMGDDDPAHAFFTLLKLLQE
145225009YP_001135687.1 aminoglycoside/hydroxyurea antibiotic resistance kinase [MycobacterMMAAWSLQADGQEYARTRAYVAPVRTSDGQAATLKIAAPGPGTAHEHLVL
RRWDGHGAVRLLRADPHRRAILVERAGRDDLTAAPDRRACEIVAQLYRRL
HVPAMPQLSSLTEDVRRRTLALADLPRSAPLPRRLVEQAITLGRELTVEP
AERVVLHGNLHYRNALAADREPWLAISPRPCNGDPPYELAPMLWHRFDDL
AGNVRDGVRQRFHRLVDGAGFDEDRARAWTLVRVVHAAADDLRTEPASAT
TQLTRYVAIAKAIQD
145225008YP_001135686.1 luciferase family protein [Mycobacterium gilvum PYR-GCK]MRFGNFMAPFHPVGQNPTLALERDLDLIVAMDRLGFHEAWVGEHHSAGFE
IIASPEVFLGVAAERTKHIRLGTGVSSLPYHHPLMLADRMVLLDHLTRGR
VMLGCGPGQLTSDAHMLGIPADEQRPRMEQCLDAIVRLLRGETVTMHTDG
FTLQDARLQLKPYSEPCFDIAVAASFSPTGPRGAGRHGIGMLSIAATARQ
GMDLLAQHWNTWDEVAREHGHQADRSKWRLVGPMHLAETREQAERDVEYG
IAEFSRYFTHILPSGPVQGDTPEEIIANNRQSGFAVIGTPDDAIAKISEL
VEASDGGFGAFLLFDHDWAPPAAKLRSYELFAQYVIPHFTGQLSAPIASR
DWVTESGRVFVDQATHAIGRAIESHAAEQQAKQSRTSD
145225007YP_001135685.1 hypothetical protein Mflv_4428 [Mycobacterium gilvum PYR-GCK]MDVSGSLARTGRQLATMYRRSGADLPFGDPLPTHGTEMEGWFWRLSDAAS
GRVAIALCSANRHPDGDWSTAAIAVHPGGTVRSAAIDGVRAARDRFLVTA
DSGGHCLHADRDRLHMVIDDCAIDMTMRESVDWPKAFGGGGVFSSVPFLN
QYWHPYRLGGRAIGTVRTGAQTWTFTDATLYCERNWGAGFPRRWWWGQAH
DFGDADVSVAFSGGLLELGPLRRDVTGVVVRLGDRIIRITPPAPVRSDCD
VDRWRITARTPRFHVELDGQAVPGGPHVLPVPLPGERRNIDTDYEYLAGR
LRCTVRERGRTLFDGISELAGLEVGSRPS
145225006YP_001135684.1 amino acid permease-associated protein [Mycobacterium gilvum PYR-GCMSVDTAEGTAEPTRLARRITGPLLFLFILGDVLGAGIYALMGELSSEVGG
VLWAPMTVALGLALLTAGSYAELVTKYPRAGGAAVFAERAFGKPLISFLV
GFSMLAAGVTSAAGLALAFSGDYLATFVDVPVALAAVVFLALVACLNARG
ISESLKTNVVMTAIELSGLVLVIAVVAMMVGRGDGEVGRVTEFPDGTTPA
LAILGGAILAYYSFVGFETSANVVEEIRDPRRVYPRALFGALITAGVVYA
LVGLASAIAVPTDELSQSSGPLLDVVAASGAAVPDWLFSLIALIAVANGA
LLTMIMASRLTFGMSDQGLLPSVFARVLPNRRTPWVAIVATTAVAMALTL
VGDLSMLAETVVLLLLVVFLSANVSVLVLRRDHVEQDHFRVWTFVPVLGI
ASCLLLLTQQTAKVWLLAAALLAVGVVLYLLAKRFGGQGVQDTGDAAPSR
SE
145225005YP_001135683.1 alpha/beta hydrolase domain-containing protein [Mycobacterium gilvuMTERRIRPSIGRASAWAGAWTVAVGAGAVIACSATAPAWASEDDTSAEPR
TAAAAPSKPSQDRPSRASAERRADTDTGADPSETRVSLRPSRTRATDGDG
GDPDTTTVELAVADEPSDPGDVEEPAPESPVAAPALWSLVGSARPQDSGD
TATAAVPGTATEAPPTADTTDTDTVPAAADAPVVDQPVYTGRPSFVQQVV
IAGLNVLKVVLKPFGGLLAFTSLKIPFFTDGVPPFFLTPGLDVERTEFDG
MKVWSLAPRRDQTDKVVVALHGGAYVATASIFHWWTYADMARDTGATVVV
PLQTLVPRGGTAATEVPRTADFLTEMIDAHGAHNVSVFGDSAGGGLALAA
VQELNRRSAATPSRLVLLAPWLDVSMSDPRSAEIRDPLLDIPNLVRSGAK
WAGSAGVTDPLASPLFGSLEGLPPTYVYSSSRDLLSVDTLRLRERVGAEG
IPNVEFRLRAGLIHDWFTFPFLPDAHEDRAGVYSDLLGAASPVS
145225004YP_001135682.1 putative PAS/PAC sensor protein [Mycobacterium gilvum PYR-GCK]MRLKKVLKWNNAEMPDTGRVVGSELDEMVRTHGNLRLGSFRFWFVGQRWE
WSDEVARMHGYEPGTVTPTTELLLAHKHPEDRQHVQELLDRALHSGGSFS
SRHRFIDTRGGEHTVLVLADRMTDADGAVVGTEGYYIDLTDTLDEARRDA
LNSTLPDLFAARASIEQAKGALMLVYGVGPDQAFELLQWRSQQTNTKLRT
LAGRIVADFPTLRAPRDELRRQFDHLLLTVHQRVE
145225003YP_001135681.1 anti-sigma-factor antagonist [Mycobacterium gilvum PYR-GCK]MAERVGLLEIGQEVHDVAVVVRAGGEVDSGTVETLAAALDSAVAAAAAHP
TRTVVVDLDGITYFGSAGLNALLTCREEGEGRGVVVRLVATTAEVTRPIE
VTRLARILRPYPSVGEAVAAPEDPPEDPR
145225002YP_001135680.1 multi-sensor signal transduction histidine kinase [Mycobacterium giMNWAQTPLGPTSEWPQSLQTAANILLSSRFPMWMAWGPDLTFFCNDAYRN
VTLGRKYPWALGRPASEVWAEIWDDIGPRIERVLSTGVATWDTSLLLFLE
RSGYTEESYHTFSYSPLRDDDGAVVGMLCVVSEDTLQVIGERRMATLRDL
GSDPSVVRTEGEILSFVDRQLAQNLRDLPFTLTYLFDDDGSAHLAGMSGI
TGDHPAAPDVLTGADGELWPVGPPAGGETVLLEVDTAPYPAMPTGDWREP
PRQVLIVPLLQQGAAPTGFLVAGLNRYRVLDDAYRGFVALVAGHIAAGIG
LSRSYRTQQMRAEELAELDRAKTTFFSNISHEFRTPLTLILDPVSELRRA
DTLGDAARQELDVVWRNGLRLNKLVNTLLDFSRIEAGRTQAHYQPVDLGA
VTAELASVFRSAIERAGLVFDVDCPPLGEEAYVDLDMWEKVIFNLLSNAL
KFTFEGSVSVTARRDGRGAVITVSDTGTGVPADEMPRLFERFHRIENTRA
RSNEGSGIGLALVKELVGLHGGTIEADSAESRGTTFTIRLPWGAGHLPAD
AVASQPRERRPGNTVDAYVEEALRWTPDGVREYVAESAQPTTGPEKPIGT
GTLARVLVADDNADMREYLGRLLRSDGYAVEAVVDGWQALEAIRAEPPDL
VISDVMMPRLDGLGLVAELRADRRTAAVPVLLLSARAGQEASISGLQAGA
DDYLVKPFAAAELLARVRANIQLARLREGHARWRTALVDSLQEAFFVCDE
HGAVVEINPAFTEILGYDSTGLPYPLMHPWWPLKGSDAEANRRVEEAFGS
FMRDPHGTLTEVPVTHRDGHRLYVTVTFSHADDPETGRDVIVGTLRDVTA
ERYIVQRESALASLNEKLAQADTLDDAVLAAAEEFSSIWSARRVVAATWP
DEPDGEHESDAPSLTVVGAPATWDGLPGSARELILTLRRDHLLAPHTSDA
GAAGVALRHPRGVLVLYVELPEQRLFTAEDDTLLTVLAGRLGQGLQRVHQ
IDQQRETALALQHAILGPSLSSAFAVRYQPATRPLQVGGDWYDVVDLEDG
RIGLIVGDCVGHGLAAATVMGQLRSACRALLLEHPSPAAALSALDRFAAR
LPGARCTTAFCAVLDPRIGEVVYSCAGHPPPIMVTADRTTELLEGARATP
LGLKNPPHRTEARVTMPARATLLLYTDGLVERRRESIDDGIARATDVVQG
NRATDLDQLANVIMARLAPADGYHDDVALLLYRQPEPLDLDFPADVAELA
GSRTVLRGWLDSAGVPQDQALDVLIAVGEALANAIEHGHRDDPGGRVRLR
AVALPDRVQLTIIDTGSWKAPDDVPALHRGRGIALMKALMQDVTIDSQTT
GTTVHMNTRIA
145225001YP_001135679.1 anti-sigma-factor antagonist [Mycobacterium gilvum PYR-GCK]MATPLQLRTERHDGELVLVAVGELDLSNVHTFAGAIGSAVAGTDGAPLHV
DLSEVDYLDSGAINVLFDHAESIDLVVNPMLLPVLSVSGLTDVVTVKPAA
VS
145225000YP_001135678.1 DNA primase- small subunit [Mycobacterium gilvum PYR-GCK]MGTSENRDGVDLTNLDQPLSDDADATKRDLVDYLDAVADRILPVLAGRPL
TVLRALRGRAPFMQKNVPKYTPDWVRTVPIWAEASRREIRYAVCDDRRTL
LWLANQRAVEYHPALGPADDVYRPTHLILDLDPPDDGDFASVVAVAHLVR
RALADCGLDGAVKTSGSRGLHVFVPIDDSAPVDDVAAATRALAARTEALD
PTVATTAFIVADRAGKVFVDATRAGGATVAAAYSPRLRPGTPVSFPVAWD
ALDRIHPSDFTVRTAVSALAGRDPWADAMPAPTRLPTDLIEQGRAIPVAR
VAAMHEGKRRARARRKDDEAGADQTG
145224999YP_001135677.1 TRAP transporter- 4TM/12TM fusion protein [Mycobacterium gilvum PYRMDRTTASTVESTALGQVDDQDKPGRELRGWTYGLVAVVAFAVAVLTIWQV
FRPLSQGSQYYLIVFLSGTLPLVYLVYRSGWRWSDPEDRPGVLDWALAFV
AVLVCLYPVLAPAIGAAGGGYNAFLDRQGMLDPLDVVMGALLLVLIIEAC
RRTTGWALPIVCAAFLVYGYYGGLMPQGWAIAHAGLDFDQIVDALYNSGS
GFFGTPLDVAATYIVLFTIYGAVLELSGGARFFVNLSVAAFRRSRSAAGR
TAVASGFLLGTVSGSGTATAVSVGAVTWPIMRRAGYTPERAGGVLAAAGV
GALLSPPTLGAAAFIVAEYLEVSYLTVLGWAMIPTGLYYLGILLAVEIDA
RRFGMKAANLDAESPWKLLGRFGYHFSSLIAIVVLLAVGMSATRAVIFAT
ALAFVLSFADRRFRLTPRRLFGALSSGVLGVLPVVAVCAAAGVITAMTTK
TGLGAQFSSVLVGGVDAITDNRTVMLALTAVFAAVALALLGLAIPVTASF
VIGWVIIGPALLALDVPAPAAAMFVFYYSVLSEVTPPTALAAVGASAVTG
GQAIPTMWQALRYAAPAFLVPIAFVLTGPGEYLLARGPVLGVLWASAAAC
VGIVALSFAAGGWVLGVGAMGPPARVLTAVAALLLLYLHPVSIAAGFTCL
LCAVAFTFITDKRRRP
145224998YP_001135676.1 TRAP transporter solute receptor TAXI family protein [MycobacteriumMTAFATLMLAATAATACGGRQDAPAADSGGEITCEVGTETRVSIATGNST
GVYFSLGNAFAEQVSAATDGTVKATAAETGASVQNIQQLVAGSYQVAFSL
ADTASDAIEGTGSFDGKEQPIQALSRIYPNYTQVIARTDSGITSIADMRG
KRVSTGSPGSGTEVIANRLLESAGLNPQTDVAAQRLDLTKTVDGMKDGSI
DAMFWSGGLPTPGITDLFTSAREDVTFIDVTPQLGRMAEISPAYEEGLIP
ATTYQLPSDVATIVVPNMLLVRDDLDANLACVLTRTLFEKQPEMAQVVGA
AKGIALDNARDTDPVPLNRGAEYALDELNAPR
145224997YP_001135675.1 transporter [Mycobacterium gilvum PYR-GCK]MADAGRSGIGRIIRVLAVPIVLGWVLLTVLTNVAVPSLEKVGEEHTVGMS
AGDAPSMMSMKRVGANFEEFDSDSSAMVVLEGEQPLGDAAHRYYDQLIDE
LEADTANVQHIADFWGDPLTASGAQSTDGKAAYVQVYLQGNQGEPRANEA
VAAVREIVDRTPAPPGIKAYVTGGAPLVADQHSAGDTSVLRVTLITIGVI
AVMLLIVFRSVATMVLILFMVFAELGAARGIVAFLADAEIIGLSTFATSL
LTLMVIAAGTDYAIFAIGRYQEARGAGEDRETAYYTMFRGTAHVVLGSGL
TIAGAMLCLSFTRLPYFQTMGVPCAVGTFVAVIAALTLGPAVIVIGSRFG
LFDPKRAISSRGWRRIGVSVVRWPGPVLAATLALALVGLVTLPGYKTNYD
ARDYLPEDIPANVGYAVADQHFGSARMNPELLMVESDHDLRNPADFLVID
KIAKSVFRVPGVARVQTITRPDGKPIKHTTIPFQMSMQGTTQRLNEKYLQ
DRMADMLVQADAMQTNVDTMTRMQSLMGQMSATTHEMVLKTKKTEIDIIE
VRDNLADFDDFFRPVRNYFYWEPHCYDIPVCWTMRSVFDTLDGINPLTDD
ISELIPDLERLDELMPQLIALLPSQIETMRSMQAMMLRQYQTQKGQLDQN
AAMSEDADAMGEAFDDSMNDDSFYLPPEAFDNDDFKRGMENFISPDGRSV
RFIISHEGDPATVEGISEVVPIKTAAKEAIKGTPLEGSTVYLAGTAATYK
DMSDGAFYDLLIAGIAAVTLIFVIMLVITRSVVAAAVIVGTVLLSLGASF
GLSVLLWQHIIGLALHWMVLPMAVILLLAVGSDYNLLLVSRFKEELSGGL
KTGIIRAMAGTGSVVTSAGLVFAFTMASFAFSDLKVMAQVGTTIALGLLF
DTLIVRSFMTPAVAALLGRWFWWPQKFRSAASERRLARIGVQPATAGR
145224996YP_001135674.1 HAD family hydrolase [Mycobacterium gilvum PYR-GCK]MSTQSVSPAVLFDIDGTLVDSNYLHVHAWMRAFDDENLPVSAWRIHRCIG
MDGTTLVRTLSGDAGQGVLDRLKDAHSRYYKENSSLLAPLPGARDLLRRV
AATGLQVVLATSAPDDELTLLREVLDCDDVVAAVTSSADVDTAKPKPDIV
QVALDRAGVGAQDAVFVGDAVWDCEAAGRAGVTSIGLLSGGVSRGELREA
GAAGVFEDAGDLLAKLDSTVIGDLAARVSDPR
145224995YP_001135673.1 hypothetical protein Mflv_4416 [Mycobacterium gilvum PYR-GCK]MNSPLRKALIAAGGTTVLMLAVGCGGSDGREETTTSTTTESSVTTTTTTA
PSTPETTMAPETTGAPAPGDPSQPGGGGSIPGGPTGSGGPEGGGGSIPGG
PTGSGGPDGGGGSIPGGPTITGGPGGGSGSIPGGPTINIPVP
145224994YP_001135672.1 hypothetical protein Mflv_4415 [Mycobacterium gilvum PYR-GCK]MSGGLFALLDDVAVLAKLAAASVDDIGAAAGRATAKAAGVVIDDTAVTPQ
YVHGIAAERELPIIKRIAKGSLRNKILIILPVALLLSQFVPWLLTPILML
GATYLCFEGAEKVWGMIRGHKSHGTLVAGSGEAAEKAMVAGAVRTDFILS
AEIMVIALNEVADQSFLPRLIILLVVAVVITIAVYGVVAAIVKMDDIGLS
LTQRSSGFAQKIGRGLVAGMPKLLSALSVIGTVAMLWVGGHILLIGADEL
GWHAPYALVHHAEELVHHVAGVGGVLGWLVNTAASAVIGLVVGAIVVAIV
HALPFGKKVGKKNEAHG
145224993YP_001135671.1 hypothetical protein Mflv_4414 [Mycobacterium gilvum PYR-GCK]MQFRRWRRGGGATVRISTDRGPHGRTLLVAATHGRFIGRVGGLAVALGIG
AAIAAASPTAAAEDTPSSAASTGTEASGTEASGTEASSSPSSDSESPARQ
RKPSRSEVETAGEDRDARASERSDGDADDAGADRLRADEGPDDEDPADDE
RETPEPADEEPATAVAAATAPTATTSTAATPAKPSDPDRSPAAPVSPLAT
PQQLEAERIATETVGTWPVRLMKQVLSAGWRATAAREYRQISGPDPENLV
TLRRAVDEYALAAAFQQLLLNSMTPTVVAQVAPPHTWYRQSVSGSRILYD
NPDTVYRFMGVNMTSTYVIRGRFTDAHPADTNFSVLTGLSGITADNLSGR
QIDVGPDGSFTITVSGAAAAPGQRNHLQLTPDSTLVAVRNTLSDWNTQSP
MTLSIERLTGPRNSLFSQLGGFAIPGLGPLVTRSPLLTSLVSSIPPMKEP
PPFLRGVFTAVIMALGLGQESKYIKVATTDAETGERVPPNVLRDPSRNAE
FLATQLQSAGYFHLADDQALVVTITPANARYFIVPVTDLWTVTGDYWHQQ
TSLNNAQAVPDPDGKYTFVISPTDPGVHNWVSTGGLNKGTVSIRFQDLDL
ASSQTPTLTSAVVAVSDLDSVLPPTTVCVTPAQRAAQLTERATGFARRFG
SPV
145224992YP_001135670.1 hypothetical protein Mflv_4413 [Mycobacterium gilvum PYR-GCK]MDAAHAVATAAIFVWLGMVLAISFLEAPLKFRAPGVTLPIGLGIGRLVFR
ALNTCEVVLGVAAVAALVSGEGSTAALIASIVAVAMLLSQIVFVRPALTR
RSDQVLAGADGPRSRAHYVYVALELVKVVALIVAGVLLLTHSA
145224991YP_001135669.1 hypothetical protein Mflv_4412 [Mycobacterium gilvum PYR-GCK]MSCCSPTARKPSLTYIRVGSALTMTDALPLLPRELTDLSDAVRAVPAPPI
PQLAAPYAMRLVDPDTDAAMISEWMNRPHLAEAWEYDRPVEWWDGYLRAQ
LAGEYSRPLIGTFNGEPQGYVEVYRAAKDSIAPRYDADPYDLGLHAAIAD
LGLVNRGFGPLLLPRLAANLFEIEPRCRRILFDPDHRNTGARRLCEYAGC
EFLGEHEMSNRRMALYALHRPA
145224990YP_001135668.1 long-chain-fatty-acid--CoA ligase [Mycobacterium gilvum PYR-GCK]MSVLATALSEAMTASTRDLVLLDRASGQWVRHPWQELHTRAENIAEHILN
DRDGAVGLVGEPTAELVSAIQGTWLAGRALAILPGPIRGADEREWAAATA
QRFAGIGVGQILTYGEHLELLRPNVFGITVHDLAVVGHAQRSTTLVSAPA
APGTPAVLQGTAGSTGTPRTALLSQDAVKHNVAGMLRHTDVDPGRDRGLT
WLPLYHDMGLTFLLTGFMSGSEMWLAPTASFAASPFRWLAWLSESRAGLT
AAPNFAYSVIGKYARRVPDVDLSNLRFALNGGEPVDCDGFELFLRELSRF
GLDPGVAAPSYGLAESTCAVTSPRPGTGLLVDDITDPDTGTPRRHAVLGE
PIPGMELRIAPSEGRRSGEREIGEVEIRGTSMMSGYLGEEPLAPGQWFPT
GDLGYLTDAGLVVCGRVKELITIAGRNIFPTEVERVAAEVRGVREGAVVA
VGTDSGSARQGLVIAAEFRGADESGAKSEVVQRVASQCGVVPSEVVFLKP
GSLPRTSSGKLRRLAVKNDLDGLRAPVS
145224989YP_001135667.1 acyl carrier protein [Mycobacterium gilvum PYR-GCK]MSTSPAPAAPSPDGIDAALADILRDDLNVDISRVTRDSRLIDDVGLDSVA
FAIGMIAIQDKLGVTLNEEDLLSCDTVGDLETAVLAKVPESR
145224988YP_001135666.1 hypothetical protein Mflv_4409 [Mycobacterium gilvum PYR-GCK]MTDIVTLTAYFAERHRSGDSFLADAILGLCDERQIATSVMLRGIASFGPT
QVIRSDRSLSLSEDPPVTITAVDTAARIGSLAEQVSALVDRGVLTLERGR
ALPDAGRPDDPVRLSLHLGRRHRIGGLPGYVAVCDLLHRHGFVGAQAYLG
VDGTVAGRRCRARFFGRNADVPLTIMGVGTNAQAAAAVDELGDSLPEARF
AVAPVAVCKNDGRDVQGPPAADSAFQALVVHADESSLSDGRPIHRALIER
LKESDHASGATVLRAIWGFRAPGRPHGDRFIQLTRHVPVTTVMIDTASNI
EATYPIVDELTRGEGLVTVSALTGMLEVHSGRRHGALDLGDGNPTQGG
145224987YP_001135665.1 camphor resistance protein CrcB [Mycobacterium gilvum PYR-GCK]MTDALVWVGVFLVGGLGAVCRLTVDKAVSHRARGSFPYGTLVVNISGAAL
LGFLAGLTLPAHVALLAGTAFVGSYTTFSTWMLETHRLAEERQIRSALGN
LGLSVVLGLAAAFAGQTVGSML
145224986YP_001135664.1 camphor resistance protein CrcB [Mycobacterium gilvum PYR-GCK]MALDRRELAAVFAGGAVGTLARAAFEELAAADPGRWPWPTFTVNIVGAFL
LGVFVTRLLERLPVSSYRRPFLGTGLCGGLTTFSTMQVETIRMLEHGHHW
LALGYVAASIAVGLVAVYLGTVLTRRVRVRS
145224985YP_001135663.1 phosphoglucomutase [Mycobacterium gilvum PYR-GCK]MPTRGVPCGRWASRINGMAANPRAGQPAQPEDLIDVASVVTAYYTVSPDP
DNVDQQVTFGTSGHRGSSLDAAFNEAHILATTQAIVEYRAAQGITGPLFI
GRDTHALSEPAWVSALEVLAANDVVTHIDSADRFTPTPAVSHAILAYNRG
REGNLADGIVVTPSHNPPRDGGFKYNPPNGGPADTDATGAIAKRANEILR
DGLKGVHRVPLARAMRSVHRHDYLNAYVDDLPNVVDLHAISAEKIRIGAD
PLGGASVDYWGAIAERHNLQLTVVNPLVDATWRFMTLDTDGKIRMDCSSP
NAMASLIANRESFQIATGNDADSDRHGIVTPDGGLLNPNHFLAVAIDYLF
AHRPEWAAETAVGKTAVSSSIIDRVVAGLGRTLVEVPVGFKWFVGGLLDG
TIGFGGEESAGASFLRRDGSVWTTDKDGIILALLASEILAVTGSTPSQRY
AELAETYGAPTYARIDAPADREQKARLAKLSPEQVTATELAGEPITAKLT
AAPGNGAPLGGLKVTTENAWFAARPSGTEDVYKIYAESFRGPEHLAEVQD
AARDVVSKVIS
145224984YP_001135662.1 major facilitator transporter [Mycobacterium gilvum PYR-GCK]MSSTKEGDCPTTKQRLPREVWVLVVANVVVALGYGVVAPVLPQYARHFGV
SIAAATFVITAFAVMRLVGAPPAGFLVQRLGERRVYTSGLIIVAVSTGAC
AFAETYWQLLLFRSLGGVGSAMFTVSALGLMIRISPADARGRVAGLFSSG
FMIGSVGGPILGSLTAGFGLAAPFLIYGAALLVAATVVFVSLRNSAVVGQ
ADDDVQVPIPFRTVFRHRAYKAALFSNFATGWASFGLRIALVPLFVVEVL
GEGPGAAGLALTAFAVGNIAVVIPSGHLSDRLGRRKLLIFGLMLAAVSTA
LVGFTTSLPVFLVAAVIAGAATGIFVSPQQAAVADVVGNKSRGGPAVATF
QMMADFGSIGGSLLVGLIAQYTSYGWAFLVSGIILAVAAIGWFFAPETRP
TPSTEHTPGRPLGPEAGGEVP
145224983YP_001135661.1 hypothetical protein Mflv_4404 [Mycobacterium gilvum PYR-GCK]MSEDPSIDVPPNHLSIDPNSPFYSEEALLRDVGIRFNGAEKTNVVEYDVA
EGWVRVEVPTAKDRRGNPMVVKVNGTVEPYFRQSK
145224982YP_001135660.1 zinc/iron permease [Mycobacterium gilvum PYR-GCK]MMMTIAVVLAVSGALIAGAAWGIYGTLPEGLEGFIVALAGGALIFSVVLE
LVEPAVRDLHLLLVALVVLTGAMVFAGLDRLVKAKARNSGGAGLLVAITL
DGVPENLALGVALIGAGPLHVAALSGSIFLSNLPEAAGGAKEMSEGGRSN
GKVFALWGATAVLLSVAALAGNFLLAGAPAALLAAIKCFAGGAVVSSLAT
EVFPQAFAKDSYQAGIATALGLVLAVSLDHLA
145224981YP_001135659.1 luciferase family protein [Mycobacterium gilvum PYR-GCK]MPLELASFFRTTLPLDLKGLDAADDGRYHSLWMPDHLVSFWPDSIWTPEF
TDLAEVSPSPHRYLDTIALAGAVAARTTRTRLATSVLDTVRRHPVMLAQS
ALTLSHLSDGRFILGLGAGERENLAPYGFDPRGTVSRFAEALQLIRLLWN
ADGPIDFTGRYFTLEHARLDTEVHRSGPPPIWIGANGPRMLHLVGEYGDG
WWPTGSAGPETYARQLTRIREAAERAGRDPQAITPAKMVVCLIGEPDELR
EILQRPLVKSLVLQLTADALADTGHRHPMGQRWRGIQDIDPRVLTRDRLL
RLFEQVDPAAILSVVPHGTPTQVAAQVAEFGEAGARVVSVLDYSGMAGQA
YAAESARKVREVEMQLTGSGA
145224980YP_001135658.1 hypothetical protein Mflv_4401 [Mycobacterium gilvum PYR-GCK]MTILDSDVLIADAKESAGVTDFGDDTLPERVALVVDRLNNADLDETGSRA
AALTINGLLTSRLHFMADRARMPLAAERITAPLFATGEPRSGTTLLHALL
AEDETSRALRFWEVMYPSPPPGPAVGASEATGEHSADDPRRAQADADWRE
ILDRIPPWIVSHPYNDLLGDGLPECERTWAFDFRATNPSAWWRVPVTIQN
FAQDHHAQYALHHMMLQHIQYARPPKRWVLKGFHGRRLGALFDTYPDARI
VWVHRDPVQVLASQIVAFGQINESLAGALDWTQYAKATIEGSRANFHAYL
IDPFVDDPRIHHVRYRDFVADPVATIGGFYDFAEVPFTAHAEQAMRDYLA
TNRSDRYGKFTYSTDVLPVPVQQLHDEFAPYRERFGIDIETRR
145224979YP_001135657.1 hypothetical protein Mflv_4400 [Mycobacterium gilvum PYR-GCK]MAFGDTDDDAQLRAAWHEFCDRLKTAGDLAFKDTSPPNALQRADAFRYLT
QNLGQAYDLALETKNTRYPMIHPFCGPTRKLGGDNADFVYLQAWIDGAST
YRIAGDRGTARFLNFTVQGPRPEKDVYYGADHPNLHEPFGDTPEANIAGD
DLVTEPDGSFELYVGGPRRESNWLPTTPGSRKLFMRQGFDSWTERSAQFS
IERIDMDEPRPAPTPQDLIASMRWAGDFLTGVMTDWPDRELQIGSLFGEP
EPNVFPGARFAGTAEQRDARRGRLIVTMPWHLEPDEALIFEFADDGEFWM
LTNMGAFWNSMDYLYRPVSHTPSRSAIDADGRVRMVMSHNDPGVHNWIDT
QQFSEGYLTMRVIGSRQLPEVSTRVVAAAELDTVLPPDTRRVTPEERVVH
LHERFDAIRRRYRI
145224978YP_001135656.1 hypothetical protein Mflv_4399 [Mycobacterium gilvum PYR-GCK]MDPTLQALAASAFDNVYHVGHVVPELVSAMESLADAMQIRWAPPFEMRSG
FVRPDGSADDQIVRLAFSMSGPPYLELIEVVPAADSIFAEPTLGGMHHVG
YYAQRWRDDAARLQDEGWELERTGAGVAFLRDPRSGLRVEVVSVKGRDFL
ARVLSGEMASAYPLSERP
145224977YP_001135655.1 type B carboxylesterase [Mycobacterium gilvum PYR-GCK]MTTVARTSFGALRGEALDDVVVFRGVPYAASPTGERRWRPAQPVSTWTDV
RDATAFGSIPPQDISPERLAKRGLTMSEDCLTLNVWTPAADDTRRPVLVF
LHGGGQAQGHGSAPLLDGARLARRGGIVVVTMNFRLGVLGSLYAPDWHGA
DSTNLTVRDQQYALQWVRDEIGAFGGDPSAVTVAGQSSGAIAISVMLAGG
CGLFDRAILQSGGLERVRSTEAAVAVAARLRALMRDDEPGVDEILAAQRG
IDPGFVPPQGPFHPCIDGDVIAEHPLVVARTRSMPAIPILAGTTRDEWRI
FDAAFDDGVFTEQYVRDRAQALAGDRHDPDAVVDRYRADHGPLRDVASAM
VTDYHFTAPTEQFVRAHAERGNAVLRYELQWPSPRAGFGACHDSCLALVF
GNLDAAPALAGNDEAARHMSDVVQSLWVDFIRGGEPWVRYDGSGGSTMLL
GRESGVTRDHRSEQLAIWEGRYPAYG
145224976YP_001135654.1 hypothetical protein Mflv_4397 [Mycobacterium gilvum PYR-GCK]MSGGDLQTSIAALRAAFEEVAAADVDLLTRPDLVAALDELEELSCQLPAV
GHRLLARLQVETSAREMGAKSWNQVLAVRWRISTGEAHRRLTEAALLAPR
QSLTGTPLPPALPATAVAQSRGLINAEHVEVIRKAVKKLPGWVDVATREQ
FEVNLVRTAVGNGPKELRDAAELTLFLLDQDGPEPDDTERARKRGLTKGK
QRPDGMIDLAGTLTPEAWAVLEVIFAKYAAPGMCNPADPEPCTYGTPTQA
QIDNDQRSLAQRQHDALVAVGRIALMSGELGQLNGLPVSIIIRTTLQDLE
SRAGVGTTGGGTVVPIKDVIRMAGHANHYLAVFDRATGSALDLFRTRRVA
SPAQRVMLIARDGGCTKPCCTVGAYGCQVHHAETDYAHGGNTNIDELGLA
CGPDNRSVTEGGWTTRINDRCEVEWIPPPGLDTGQARVNTYHRPERLLAP
PDDPEPPNQTRTTATEPVEDQAIDDPETDAPPPLDDPGEPGGPAPPDNRA
A
145224975YP_001135653.1 transposase- IS204/IS1001/IS1096/IS1165 family protein [MycobacteriMTDVVIGERDVEVTLRPTARLLTCPCGKRQPSVYDRRRRRWRHLDLGVKR
LWLVNEIRRLNCPDCGVITEAVPWARPGSRFTRDFEDMVLWLAQRSDRTT
VSTLMRCAWESVTAIINRGVAELLDKRRLQTLYRIGVDEICYRHPHRYLT
IIGDHDTGTVVNIRPGRSEQSLTDFYTAQPDSMLKQIQAVSMDVSKPYIG
ATRSKVPEAIICFDGFHIMRWINRALDAVFSEAAAGPDKVHMSSAQWRTT
RWALRTGENRLTDTKRELVNQIAKQNRRVGRAWALKEQARDLYRYDHQPG
VARALLKAWITAAKRCRIPAFVALGKRLAVYFDGILAAIELGISNALAES
INAKIRLINARGYGHHTAETLTSMIYLCLGGLQVKLPTRT
145224974YP_001135652.1 hypothetical protein Mflv_4395 [Mycobacterium gilvum PYR-GCK]MWRSDTPAGTVVLRYRRRERSERRESARICRRHHRCVPGQSRGRSRHRPP
STQRLREIVAYARVHSPHYRRLYRDVPESISRIDQLPPVTKAELMSHFDD
WVTDRAVTKERVEEFLADPGTIGRDFLGRYVVCTTSGATGEPAILLHDAV
ALRVYNIVGYARSVPVALLSPRTVWALLRGRARMAAVFVTGGHFLATR
145224973YP_001135651.1 coenzyme F390 synthetase-like protein [Mycobacterium gilvum PYR-GCKMTPLAELIADLNAFQPVVLGGYPSALVTLARAQQDGRLCIHPVMISAAGE
SLPSVTRRLLGAAFGCRVGNYYGSSEAVGLTFECREDRLHVNSDWYIVEP
VDEHNRTVPAGQLSEGVLVTNLANRIQPIIRYQLGDRVTVDPEPCPCGSP
FPTIDVVGRTDDTLTFTTPDGGQVEILPLAVATVAEEAAGVVGCQLIQRA
PTALSVRLRVEPPEEQDAVWPVLKDLLAAFLSEHGATAVTIDKDDEPPAL
NPRSGKYRQVYVDIAETA
145224972YP_001135650.1 peptidase S9 prolyl oligopeptidase [Mycobacterium gilvum PYR-GCK]MALPDLIPVEDLFNPPTRAAAKISPDGTRMAFLAPSNNRLNVWVENLDPE
SGGLRRVTDDDNRSVLHFEWTDDPRWLIYLQDTNGDENWHVHRVDLDDPE
APAVDLTPFPGAMALPVREVKNGRTTVMVNNRDATLLDIHELDIATGDLT
LIAKNPGHVNGWLSSDDGDLFATALTADGDLELSRWDRDDEALRPIIRFD
GTDYPIGIHPLVLTPDGTGVWLGFNRGTDRTRLVHVDLATGEETDVDSHP
TFDVDPRAAVSPLLPAPLIQDRRTGELLGVRYYGERQTIRALDSRFGDIL
ANLEKLSDGDLGNLSSDENGVRWIVGFNHDRDPGATYLYDHSTGESRLLF
RPLPQLDPSQLAPMRPVTITARDGLPLQSYLTLPVGVEAKSLPLVLVVHG
GPWFRDSWGFDGHVQLLANRGYAVLQVNFRGSTGFGKAFLKAAIGEFAGK
MHDDLIDGVNWAVEQGYADPDRVAILGGSYGGYAALVGVTFTPDVFAAAV
DYVGISNLANFMRTLPPIARPQLANNWHAYVGDPDDPEQLADMMARSPIT
KVDQIRTPLFVIQGANDVRVVQAESDNLVNALRDRGVEVDYLIQTDEGHG
AVNAENTIEMWEAVVRFFARHIGGRA
145224971YP_001135649.1 TetR family transcriptional regulator [Mycobacterium gilvum PYR-GCKMSRIACDLFWERGVAATTGDDIAAEAGLSTRTIWRYFRCKESCVEPVLAL
SAKRFIGLAERWPAELSLAEHMAADMIENPLSEREIADEVAALRIATMSA
TEPALRTSYLMVHDEMERAFVPVIARRLGLPDDDLTARLCAAAVTAAFRV
VDEDVGRRAIVDKEKVTQEEALALIDRAIRDATNGRLGGPVTVK
145224970YP_001135648.1 hypothetical protein Mflv_4391 [Mycobacterium gilvum PYR-GCK]MTSTTATKPGVAPGLLLGLGLGGFIDGIVLHEILQWHHMVSHVEDYPVDT
LAGLEVNVLADGFFHVATWLLVWAGTIALLMSWRRGRLAPNWSFHFGLLL
AGWGIFNVVEGLIDHQILQIHHVRDDLGGPMSWDIGFLAFGALLVLGGWL
IYRRGARRMGDQAGADIR
145224969YP_001135647.1 hypothetical protein Mflv_4390 [Mycobacterium gilvum PYR-GCK]MTVDTLAAAPSTESPTAETVAKPPTKRAGRKAKTIELTLTVTGTADGEWH
AELKQGSTYVVRNLPVAAAAVSRAAGELHEDLATPIDAVIEQARSQQAAR
VAALEAELDAARRALANLD
145224968YP_001135646.1 aldehyde dehydrogenase [Mycobacterium gilvum PYR-GCK]MTQIVDTAGVFVGGEFRRTDRTVPVFEAATGEILGEGPSAAAADIDDAVA
AARGEGAAKWRAATVDERADGLKRFATALRGRAKHTSTLVSRENGMPITL
SRAVNGAFPSVLVNYYAKLIRSWTAEEVRPALIGHTVVRREPIGVVGAIT
PWNYPQALAVMKIAPALAAGCSVVLKASPETSLDALVFAEAAAEAGLPPG
VLNVVPGDAAAGAHLVTHPGVDKVAFTGSTNAGRVIGAECGRLIRPVTLE
LGGKSAAVILDDADLDTTVNGLRTASFVNNGQTCHLSSRILVPAKRYAEF
VSAIAELADSLTVGDPLDEKTEIGPLVSERQRERVLDYVQVGRDSGARLV
AGGSVPTGLERGWYVAPTVFADVDNSDRLAQEEIFGPVITITAYADDADA
VRLANDTEFGLAGTVWSQDSARATEIARAMHTGSVGVNHYQLDIQSPFGG
IKSSGLGRELGPEGLDAYLVTKSIYQADPFPE
145224967YP_001135645.1 CRP/FNR family transcriptional regulator [Mycobacterium gilvum PYR-MDEVLARAAIFQDVDPGAVAALCSQLQKVSFPRGHRVFNEGDLGDTLYII
TSGRAKIGCTSPDGRESLLTLMGPSDMFGELAIFDPGPRTSSVTALTALH
AVMMDRDALRFWIAERPEIAEQLLRVLARRLRRTNDALSDLIFTDVPGRV
AKQLLDLARRFGVQQEGSLRVDHGLTQEEIAQLAGSSRETINKALADFVQ
RGWIEQRGRTTIIHDPARLARRAQQ
145224966YP_001135644.1 hypothetical protein Mflv_4387 [Mycobacterium gilvum PYR-GCK]MSQDDLREALRRAASALKADGPPFALAGSYALWVHGAPEPVHDVDFVVAE
HDAEAAAATLSKAGFDIRRPPEEWLFKAAFSVDGPVLIDVLHQINRVPVD
AELIERAEVTDVLALTIPVLAPTEVVTQKLRALHEHHCDFEKLFGPVRAV
REQLDWAQLRRATAENPFAVAFLSLCDSLGIAEHH
145224965YP_001135643.1 endonuclease/exonuclease/phosphatase [Mycobacterium gilvum PYR-GCK]MGRGVPMKLVTFNILHGRTPGAEVDLDRFVDCVAGLDADILALQEVDSIQ
ARSGLADLTALAAEAMGARSHRFVAAIAGTPGATWMAATGEEQPGTAAYG
VALLSRYPAVSWQVARLPRIPFPFPLYLREPRKVVVVHEEPRAAVIGRFD
TPLGELTVANTHLSFVPGWNRYQLHHLMRDVRGLPSPWIVTGDLNMPAKP
ARRWSRLRCLASAPTFPADRPTRQLDHVLTDEPAFTIRSYDTPEMAISDH
RPLVVDLGRIGHENDSAAR
145224964YP_001135642.1 hypothetical protein Mflv_4385 [Mycobacterium gilvum PYR-GCK]MASLAADCPLDAEVLHTRAREATGLDDFGPDDYRERLEMYLAELREIDMH
APGVVNFHVQLVQWLKNRLLLTDLLTRHPEIEEIELLPPVVIAGLPRSGT
THLHNLLAAAPTFRSLPYWESVEPFPLPAEQGVEPDPRIGRMDLALQTMD
LLMPHFALMHEMTTDHAHEEIQLLANDFSTMLMETLAHVPRWTEYYWNRD
QTPTYEYLVTQLKALQFLRGGGRWVLKSPQHLAQLPVIGRVLPGVRVVFT
HRDPVPVALSMIAMVTYSARMHRDHVDVPVVAAAWVDRLEKLLDACVRDR
EVIAPDRSLDVRFDDFMADELGVAESIYALTGEDFDGRSRAAVAQYLQSH
RRGRHGRVHTSADMFGLDPEELRERFAPYSARFLS
145224963YP_001135641.1 TetR family transcriptional regulator [Mycobacterium gilvum PYR-GCKMPSVVSVTESYVTLSIVMTTDIGRPRNRAIADAVLRATVELLAESSYAEL
SLDAVAARAGTSKPAIYRRWRGKAHLVHEAVFPLGADTAIPGSGSLEADV
REMTRRTLAVLSTPAALAALPGLVGEMASDPTLHTALLERFGDILVRGLT
EFLESAVRRGDVRPDVTASDLAEAVAGMTLLALLTRGTAVDEVWLDRTAR
LITKGISA
145224962YP_001135640.1 hypothetical protein Mflv_4383 [Mycobacterium gilvum PYR-GCK]MTTESHEATAAWRELLDTLRTLDASFMSGPKAVGDDRHVADGYRMLATTL
GVAFDTYLFADPSRPHWVELNSPFRPDRRWGGDNTDAIYFMCPVDPHRRY
RISGNRGDSVYFSMTAYNEPAPGAWSDKIVAIVRDDDLDIDAEGNFSFEF
GPQPGAAVLMTRDYQADPLVGRAATWTIEALEPPDPFRHGEAETAAALRA
SAAWMRTMFAILPLSVGVKNADAHELGHETALVANDFADPYQVPDANFGW
SARDACYSYGSFDLAEDEALVITHRPPACRFWNLVVWNQFMAVPGVEDAR
SSVNGYTAAPNGDGSVTVVLSRGMTAHPNSLTTLDYPRGNLAFRWFLADE
VPARPEVRLVKVSDAPTAVT
145224961YP_001135639.1 UspA domain-containing protein [Mycobacterium gilvum PYR-GCK]MSTQPAPLGIVVGVDGSAASRVAVDWAARDAALRQVPLTLAYVLPGAAVQ
SWIQVPLPASFYEDEKAEATRVLADARAVVDAATQAHPLPAVTEKVLSGQ
PVPTLADLSRDADMIVVGSRGMGKWERRVLGSVSSGLVHHARCPVAVIYD
EDPLIPHPAQAPVVVGIDGSPASERATAIAFDEACRRGVDLVAVHTWSDA
GYELPGVEWTEVQPEEEMLLSERLAGWHERYPDVTVHRVVRRDQPARRLL
EEAEKAQLLVVGSHGRGGFTGMLLGSVGSQIVQSSRTPVIVARTA
145224960YP_001135638.1 hypothetical protein Mflv_4381 [Mycobacterium gilvum PYR-GCK]MKASGAGVAALALAATVIGYRTRLRPWIYRWGATYEESVAGLPGDELVAG
GARTTRAITIDAPPTQVWPWLAQIGEDRGGFYSYSVLERAVGADIRNASR
IHREWQDLAVGDTVWLARRGGDRGRQIVAALMPNSHLVLMSPADYERVQR
GEKASGSWSFHLKAQGGRTRLLARGNGGYGGNVLYDVVHFIMERRMLLGV
RDRAEVRESSVGRSA
145224959YP_001135637.1 acyl-CoA dehydrogenase domain-containing protein [Mycobacterium gilMDFTLNDEQELLRGGLTRFLATRYDLEKSRTAAKTGAGWQPEIWRAFAEE
LGILGAALPEENGGIGGGPVEMMLIAEALGHALVIEPYVDTAVVAAGLLR
RAGGEIADALLEEIVAGSAIVSLAATEPTSGDFWQDVRTTAVRDGDEWVL
SGEKIVSSATPLAGHVLVTARTTGERADTAGISLFLLDIASAPSGVEVHH
YRTVDDRRASDIVLDGVRLPATALLGAEGDAWPSLARARDEGAAAISAEA
VGCMRKVLADTVEYCKQRQQFGQPIGSFQVLQHRMVDMYMEVEQAAAAAL
LATLKLDEDETTRARAVSAAKATVGRAAQFVGQQAVQLHGGMGMTEELAI
GHYFKRLTALQFEFGSTDHHITRYGRLTTP
145224958YP_001135636.1 acyl-CoA dehydrogenase domain-containing protein [Mycobacterium gilMDLGWSATDLEFRDEVRAFLEEKLAPELRQAGRLMTSVYADHDASMAWQA
ILHERGWAAPAWPVAHGGCDWSLTQHYIFSRESTLAGAPSLSPMGIRMVA
HAIIKFGTDEQKDFFLPRILTGEVFFCQGYSEPEAGSDLAALSMAARDDG
DHLVCTGSKIWTTHAQEANWMFALVRTTRTDKKQRGITFVLIDMATPGIE
IRPLVMTSGEEVQNQVFFDEVRVPKSNVIGQIDDGWTVAKYLLEFERGGG
AVAPGLQVMAENIATVAADQPGPGGGRLLDDPAFARKLADVRIRTEVLEI
LEYQVLAVVAGGGNPGAKSSMLKVLGTELSQAITELAMEAAGPRGRVYQP
HATYPGGPIAEFEPPEGDYVSGEPWQAVAPLRYFNDRAGSIYAGSNEIQR
NILAKAALGL
145224957YP_001135635.1 hypothetical protein Mflv_4378 [Mycobacterium gilvum PYR-GCK]MSVNDPEWDDEVDVVCTDTGLAALATAISATEEDGEVFLADPSRAPRHGW
FGLVRPDGEVDREDDETAAYLAELTADLDLTSLTRQDAALPVRRAGAVVP
VRRRPIPAFEGRRLRDWAARCIPSPTGYLYTQVTDWTSTTMDCGDGELFK
VLDIGAVDVGDDPIGAVTDWLAGEAQDRGLHGVEVTRFEHLVFDEGVVAG
AVFSTPDGPLAVRARHGILMGPGTAVPAEASADSAAAGHGVRVALVGKEA
SRFGRVELLTADAASDPEA
145224956YP_001135634.1 GAF sensor-containing diguanylate cyclase/phosphodiesterase [MycobaMSESLDLVVTSVATRLMGAGAATWAEASQQVLADLVEHFGVDVSFLRRND
HTIRASVLVAEWPVRPGIPDPDPLAVVYFADADPVFALAEFQKEPLVFRP
DANTDEYQKTIEEGRQVPQVSMAAVPLLSGDVTTGVLGFVKFGDRDWTGV
ELNALKAIASLFAQVQARVEAETQLRYLAEHDDLTGLNNRRALLSHLDGR
LAEGQPGPVSALFFDLDRLKAINDYLGHTAGDWFIRVLAERLREGADPRA
LIARLGGDEFVVVPAGPMDGEAAESLAHQLQSTLKERVSIDGEMLTRTVS
IGVAVGIPGQDTTSDLLRRADQAVLTAKNSGGNRVTVFTEEMSLKQEFNN
DIELHLQSVIENGALLLHYLPEIDMRTGDILAMEALVRWQHPTRGLLSPE
SFIGVAESINLAGELGRWVMRSACTDFARWRALGIGKDAIMRINVSPVQL
VTDGFVESVAGIVDEFGLEHGSVCLEITESVVVQDIETTRVTLNGLKKAG
VLVAIDDFGTGYSALSHLKSLPVDTLKIDKSFVRELGSDPGDLAIVRAII
ALAEAFGLELVAEGVETDVGALTLLRHGCHRAQGFLLSRPIPTDAMETLL
AQGRIPVSFSKG
145224955YP_001135633.1 hypothetical protein Mflv_4376 [Mycobacterium gilvum PYR-GCK]MTHADTDRTGHRAVVLDESEPAHVQTLARLRADSGIEFLDPLPAGGGTPT
RWVYYAWRRAVVRVPEPGLFRRERLDRHRNLVTLDEIATLGTLRIGVVGL
SVGHAIAHTLAAEGLCGALRLADFDELELSNLNRVPATVFDLGVNKAVAC
ARRIAELDPYLPVEVVTGGVTADTVDAFLDGVDIVVEECDSLDIKVLVRH
AARTQKVPVLMATSSGGLLDVERFDLEPDRPVFHGLLGDVDAAVLARLSS
KDKVPHVLRVIDATALRPRMQASLIEVGTSLTTWPQLSSEVAIGAATVAE
AVRRIGLGEDLGSGRVRVDVPALLDDVHDPSPPPGDRGDATLSATAADDT
AARAPGTAGTDAMTAIAAAAVRAPSGGNTQPWQVEVGDTTLTIRLDTDLT
STMDVGYRASAVAVGAATFNARVAASAHGLRADVTFETFEQGPQGPPLTA
TVRTAPGQEPELARLYDGMLRRETNRHTGERAEIDDETIDALTRVAESEG
ARLHLVTGTEDIRKIASVLGDADRIRYLTPALHAEMIRELRWPGDPDPHT
GIDIATLELDPADTVFLDILRSGPVMAHLAAWGAGSALGDTTRGAVASAS
AVAAVTVRGDTLADYARGGAAMEAVWVRAQEHGLAVQPISPAFLYARDRR
ELDALSPAFTQRLADLQYSLQASIGVDSDESLILILRVFRGPRPSAPSRR
RKIPGRSTPT
145224954YP_001135632.1 hypothetical protein Mflv_4375 [Mycobacterium gilvum PYR-GCK]MDDDMTTPEFHSAAFDRASLTESPSYWDPATQCTVVYATPARERELWRDY
ARGACASYEKHGVAAALDLDALRTGHDTVLFAALVNSAGAVVGGLRARGP
YRSADECHAVNEWDGQDGQAAVHKMVTDRIPFGVAEMKTAWVTDDPDENR
RLTTAIARTPLHAMTLLDIQFIVATAASYVLKRWLSSGGLLATKIPATPY
PDHRYDTKLAWWDRTTFTKHAEPSQVSAFFSEQRQLAETVPHLMGAPVTA
PAL
145224953YP_001135631.1 dehydratase [Mycobacterium gilvum PYR-GCK]MKRFDNLAELVAAQGTQLGPTEWLEITQERVNLFADATDDHQWIHVDPAR
AADGPFGGTIAHGLLTLSLLPRFTHQLYTVDNVAMAINYGYNKVRFITPV
RVGAKLRARAEISAVAQLENAVQATLSTTVEIEDSEKPAAVAESIVRFIG
145224952YP_001135630.1 flavin-containing monooxygenase [Mycobacterium gilvum PYR-GCK]MLQTPPYVAVIGAGISGLTAGKMLKDYGIDYTTFESSDRIGGNWAFGNPN
GHSSAYRSLHIDTSKDRLSFKDFPMPEHYPSFPHHAQIKAYLDDYADTFG
LLDHIEFENGVVHAGRTDDGGWIIRDQGGADRHFDLLVVANGHHWDPRLP
EFPGSFDGESIHSHAYIDPATPLELTGKRILVVGIGNSAADITVELSSKA
LRNQVTLSTRSSAWIVPKYIAGRPGDTLFRTSPHLPLSWQRKAVQLIAPM
LGTDPTMYGLPPADHKLFEAHPTQSVELPLRLGSGDVTPKPNVARLDGST
VHFVDGTHSDFDVIIYATGYNITFPFFDPDFVSAPDNAIRLYKRMFIPGI
ENLVFMGFAQAVPTLFPFVESQSRLLAAYAVGRYALPPVDEMERTIDADQ
QLHAGHCTDRPRHTQQVDYFVYEHDLRTRELPAGLKRAQRAVAVAR
145224951YP_001135629.1 alpha/beta hydrolase fold protein [Mycobacterium gilvum PYR-GCK]MSRTEVAFPSGGDTCSAWHFAADGVRRPVVVMAHGFGGTKDSGLEPFALR
FAEAGFDVFAFDYRGFGASEGTPRQSLSVRRQIDDYHAAIHAARQLDGVD
PDRVALWGASFSGGHVVRVAAERADVAAVIALTPLTSGVAVSRSAMASRD
TVTSLKWTLTGLKSRIAVGRGGSPTLMPLVSPVGQPGALALEGAYESYTA
LAGPTWRNEIDSSIGLQVVGVRTTAAAKKLRCPLLVQIADFDQYVPADAV
AKTAAHGRAQVHHYACDHFDVWPGNDWFDKTVTDQIAFLRRTLTRQ
145224950YP_001135628.1 short-chain dehydrogenase/reductase SDR [Mycobacterium gilvum PYR-GMRLEGRVAFITGAARGQGRAHAVRMAKEGADIIAVDIAGPLPPCVPYDHA
TADDLAETVELVKATGRRIIASAVDTRDGDALTAAVDSGVAELGRLDIIV
ANAGVTAPQAWDDISAEDFRDVIDVNVTGTWNTVMAGAHKIVDGGRGGSI
ILISSAAGIKLQPFMIHYTASKHAVTGMARAFAAELGKHSIRVNSVHPGP
VVTDMGTGDMVTALGKAMETNPQLSNMMTPFLPTWAVEPEDIADAVCWLA
SDESKFVTASAISVDQGSTHY
145224949YP_001135627.1 acyl-CoA dehydrogenase domain-containing protein [Mycobacterium gilMASPPANAAEAGIPSAEVNDEDFQAILAATREFVRTAVVPREQEILSTDQ
VPDDLREQTKSMGLFGYAIPQEWGGLGLNLAQDVELAMELGYTSLALRSM
FGTNNGIAGQVLVGYGTDEQKKTWLERIASGEIVASFALTEPGAGSNPSG
LRTKAVRDGDGPHSGWILNGQKRFITNAPNADLFVTFARSRPADDKGAGI
AVFLVPADTPGVDIGAKDKKMGQEGAWTADVNFTDVEVPDTALVGGSEDL
GYRAAMTSLARGRVHIAALAVGAAQRALDESVAYAATATQGGTPIGDFQL
VQAMLADQQTGVMAGRALVRDAARLWVTGQDRRIAPSAAKLFCTEMAGKV
ADLAVQIHGGSGYMREVPVERIYRDVRLLRLYEGTSEIQKLIIGGGLVKG
AKGK
145224948YP_001135626.1 3-ketoacyl-ACP reductase [Mycobacterium gilvum PYR-GCK]MSLLTGQTAVITGGAQGLGFAIAQRFVDEGARVVLGDVNLEATQEAAEKL
GGADVAHAVRCDVTSSAEVDALVAAAVDTFGALDIMVNNAGITRDATMRK
MTEDDFDKVIAVHLKGTWNGLRAAAAIMRENKRGVIVNMSSISGKVGMIG
QTNYSAAKAGIVGMTKAASKELAYLGVRVNAIQPGLIRSAMTEAMPQRIW
DSKVAEVPLGRAGEPDEVAKVALFLASDLSSYMTGTVLEVTGGRHL
145224947YP_001135625.1 acetyl-CoA acetyltransferase [Mycobacterium gilvum PYR-GCK]MTREAVICEPVRTPIGRYNGMFKSLTAVELGVVALKGLLERTQVAPEAIE
DVIVGHCYPSMEAPAIGRVIALDAGLPVTVPGMQLDRRCGSGLQAVIQAA
MQVASGTNDLVVAGGAESMSNVVFHSTDMRWGGARTGITVHDALARGRTT
AGGKHYPVPGGMLETAENLRREYGISREEQDELAVRSHSKAVRAQQDGLL
AETIIPVTVSGRSGDAVIDVDEHPRADTSPESLAKLKPVLAASDPEATVT
AGNSSGQNDAASMCLVTTPEKAAELGLVPLVRIVSWGVAGVAPKIMGIGP
VPATEVALRRAGLQLPDIDLIELNEAFAAQALACLREWKFTETDLERTNV
HGSGISLGHPVGATGGRMLATLARELVRRDGRFGLETMCIGGGQGLAAVF
ERVEG
145224946YP_001135624.1 butyryl-CoA dehydrogenase [Mycobacterium gilvum PYR-GCK]MSRLAQTLGLTEFQTEIVSTVRQFVDKEVIPTAQELEHADTYPQAIVDAM
REMGLFGLMIPEEYGGLGESLLTYALCVEELARGWMSVSGVINTHFIVAY
MIRQHGTDAQKSHYLPRMATGETRGAFSMSEPELGSDVAAIRTRAKNNGD
GTYTIDGQKMWLTNGGSSTLVATLVRTDEGADKPHRNLTAFLIEKPTGFG
EVAPGLTIPGKLDKLGYKGIDTTELIFDGYRADAGDILGEAPGQGFFQMM
DGVEVGRVNVSARACGVGIRAFELAVKYAQQRSTFGKPIAEHQAIAFQLA
EMATKVEAAHLMMVNAARHKDSGERNDVAAGMAKYFASEVCAEVTQQSFR
IHGGYGYSKEYEIERLMRDAPFLLIGEGTSEIQKNIISKRLLADYRV
145224945YP_001135623.1 GntR family transcriptional regulator [Mycobacterium gilvum PYR-GCKMTTPEFAARPQLAEDVARFVRRRIFDGTYPAGRYIRLEQLAAELGISVTP
VREALFGLRAEGLLTQQPRRGFVVSPITERDIADVSDVQAHIGGVLASRA
AELITDEQLAELERIQDELEAAYDAVDHEAAVRLNHAFHRGVNIAAGSPK
LAQLMGQITRFALESVYPTVEGWPAHSMNDHRVLLAALRKRDGTAARDAM
SEHLCAAAGPLIDHLTTRGVIG
145224944YP_001135622.1 L-carnitine dehydratase/bile acid-inducible protein F [MycobacteriuMTGVLDGIRVLDYGRFIAAPWCSALLADMGADVIRVEKREGGEDRWVQSI
ADSGEGGTFLQCNRNKRSLTLDTTTAEGREVTRKLVAGADIVVANMPAVG
MRTSGLDYDTLRTIKPDIILASATAYGEGGPYSDRIGFDGAGQVMSGAVY
RQGLPDQPIRTVVPYADFGTALTLTIGVMMALYHRDRTGEGQHVEGALLP
TAMMLSNAFLIERDLLGTDKPRMGNQGTSVAPCDLYRTSDDGWVLLQIAG
PSMFRRWCRLVGRPELFDDPRFADDDLRWQHGEELNGIMAQWCADKTKAE
VLELLEAAKLPAAPMHSTQEVLEDPHVQAMGYLKRVPFPGTPKDVPLIET
PFRLSATPGEIRRRAPLLGEHTDEILEEIGYSSEAVVGLRDRGVV
145224943YP_001135621.1 AMP-dependent synthetase and ligase [Mycobacterium gilvum PYR-GCK]MTDTVDALLRAQAERHPDTEAVVDPAERITYRELDAATRELGAAFVASGI
TKGTRVGLLMPNGVEWARTALALMRIGAVLVPLSTLLTPPELDAQLRTAS
VQHLIAVEEFRGHRYLDRLDADLPALSTVWTTDQITGLRPGPGTAAVSDA
MSRGVRAADPMAILFTSGSSGPPKGVIHSHGNAIGAVRSGLDARCIDDRT
RLYLPMPFFWVGGFGGGLLSALVAGATLVTEAVPQPDSTLRLLTAERVTL
FRGWPDQAEALARHLPASGVELNLRPGSLEALLPPNLRARPGARANLFGM
TESFGPYCGHPADTDMPETAWGSCGTPFDGMQVRITDPGTGEELPAGATG
MIQIRGPHLMRGICRRTREDVFTPDGFYPTGDLGHLDSDGFLFYHGRCDD
MFKVRGATVYPAEVEQALRTVDGVRAASVTNLPGPEGNRVGAAVVCDASL
TVDVLRRAAREVLSSFKVPSVWALLPDEAAIPRGATGKVDTARLRELLQD
145224942YP_001135620.1 AMP-dependent synthetase and ligase [Mycobacterium gilvum PYR-GCK]MSDPCTVAEVLRAQRRHGDKPLLICDDERLSYAEADERSAVLAARLTTLG
VGKGSHVGILYPNGAQWVVAMLAAARIGAVVVPFSTFSTAVELRRQLRDS
DVGVLLATRAFRTHDYVRALGEAVGVPLDDGPLLSAEVPVLRHVVFDAEC
GGAADVSALEGDVDGSDVLAIIYTSGSTSDPKGVVHTHTSLLAHQRGLNE
IRGLTAEDRLFCNSPFFWIGGFAFGLLATLVAGSTLICSTASDAGRTLDL
LEAEKPTMTNGFVAGITHLTRHPSFARRDLSSMRRGNLYSIMAPDVRPAD
PELRHNMLGMTEAGSVVLLSGDESDQPEARRGSYGFLAPGFDARVVDPDT
GSDTDGAVGELVLRGPHLMQRYYGRSREECFDADGWFHTGDLVRRDDDGV
FYFVGRAGSMIKTAGANVAPAEVEKALSAALQAVDAGVAVHVVGLPDPER
GQIVAAVIATDNGTVFDEPAVKEALSTQVSAYKIPRRVLSLRHTEIPTMS
SGKIDLAALRRLFDD
145224941YP_001135619.1 AMP-dependent synthetase and ligase [Mycobacterium gilvum PYR-GCK]MHPLSRRIAEVMALDASAPAIQFERRWVTWGQIAESARHVSTVVGSGTAG
IMLRNTPSHVAALLGVLSGGGTVVVINPSRGDERTRADIEALQLPTLIGL
AEDLESLAPGTTATTMALGDIDTTPEITGGSPSEGQHRPGVAVRMPTSGT
TGPPKRVDLTYDMLARSVMGRDPDTAPSPTELRQGVAIVNSPLVHVGGVF
RILLCLAEARPFVLLPKFELHSWAEAVREHRPAAVSLVPAALRMVLHSDL
TRDDLAGVRVVTSGTAPLSADDAEAFTAKFGIPVLTSYAATEFGGGVAGW
TLADHRKYWQDKRGSVGRANPGARLRVVDDNRDPVPPGEPGLLEVIPAQL
ADTGEWMQTTDVARIDEDGFLWILGRADQAIIRGGFKVMPDDVRSALESH
AAVAGAAVVGRPDPRLGETPVALVELRPGATASPEELSAYLQTRLARYEI
PTALILTDAIPRTPSGKPDLTAVRARLAQP
145224940YP_001135618.1 enoyl-CoA hydratase/isomerase [Mycobacterium gilvum PYR-GCK]MPMTFETIDLDLDHDVRVATITLNRPEALNSFNRAMCREMRDAWHLVKSD
ESINAVVLRAAGDRAFSAGLDVKSSYGQPDIVWNHEDPGELLSPKWQKMW
KPVVCAVQGMCTAGALYFVNEADVVICSDGATFFDSHVSAGLVSALEPIG
LMRRVGLGDTLRMALMGNDERVGAQTALRIGLVTEVVPEDELWSRAHEIA
TAIAAKPPTATQGTVKAIWESLDKPYRAAMDQGLIYTRLGNPIAKAELAE
RPIPKTAPRIR
145224939YP_001135617.1 enoyl-CoA hydratase/isomerase [Mycobacterium gilvum PYR-GCK]MSSSPSYDTITYDVDGHKATITLNRPEALNALSPHMVSELRAAYDEAEND
DDVWLMIVTGNGRAFCTGADVKEIPEDGRVIYERPYLSTYDQWEAPQEGT
PPFRRMAKPVLAAINGICCGAGLDWVTTGDIVIASDKATFFDPHVSIGLV
AAREMVRLARALPRSVALRMALMGKHERMTAERAYELGMITEVVPHDTLL
ERAHEIADIVNSNAPLAVRGTRLAIHKTLDLPLLEGEILAETFRERVVRT
EDAQEGPLAFVEKRAPNWQCR
145224938YP_001135616.1 enoyl-CoA hydratase/isomerase [Mycobacterium gilvum PYR-GCK]MRDDADAGAVRLTRDDAVLHITLDRPSRRNSLSRTMIGTLVDTLTEAASD
DSLRAIHLTGVGKDFCAGSDWVATNSGGGKPRPGNLLRRVPHQANRVVEL
LATIQLPVVCTVRGWAVGLGCNLALAADFTVATPEANLWEPFIDRGFSPD
SGATWLLPRLAGVARAKRMLLLGEKVTGADAADWGLIHQAVPQDEIAGVA
EDLMHRLAAGPTVAIGLAKRSIHYGMHATLPQSMDHELSDLELACRTSDF
KEGLAAFRDRRAPGFTGR
145224937YP_001135615.1 regulatory protein GntR [Mycobacterium gilvum PYR-GCK]MASRLRDDILTGRLKEGDVLPSQESLFAEFGVSPPAVREAIHILEADGLI
SVRRGNVGGAVVHLPSAERTAQMISMVLQTRAATPGDVSEALLHLEPICA
GMCASREDRATEVVPHLQAAIDAQVEQFDSPSQYVPNARRFHEAIVSHCG
NEPMILLIGSLQVIWSAHESSVWSDEYHPSDPMEPKTMRAALRDHQRLLD
AIAEGNSARAVKLAGDHLAAARRNTLAAASQKTIEAKLISN
145224936YP_001135614.1 enoyl-CoA hydratase/isomerase [Mycobacterium gilvum PYR-GCK]MTTTDDDRVLFDVDRDTRIATITLNNPKQRNSYDAAMRNLLARHLDEVAE
DDDITVVLLRGAEGVFSTGADMNNAYGWYGPEDPAGAGKPRKSRPSQRRR
LTVDRKSFGFYHNLMGFPKVTVGEISGYALGGGFEMALMTDISVIARDTR
IGMPATRFLGPALGSLHLFFHRLGPVQARRLLLTGDIIRAADVEHLGVFT
ETCDADAVTARARYWAEKAAKMPADGVVIAKEAFRLVEQSQAYQGEEVAS
YLFHAYGTNLQFADGEFNFVKTRAQHGTKEAFRLRDEHFHVPEP
145224935YP_001135613.1 acetyl-CoA acetyltransferase [Mycobacterium gilvum PYR-GCK]MSTPVIVGAARTAIGRSFKGTLVNTPPETLITTVLPEVIRRSGVDPADID
DIIFAESHYGGGDLARYAADAIGLQHVPGQSVNRHCAGSLTAIGNAAAQI
GSGMERVMIAGGVQSLSMTPLVNWRIPGPELKFEERWMPPTHVETPDAPT
KDMSITVGWNTAQAAGITREDMDAWAARSHQRAVAAQDDGKFLDEIVPLK
VEQFDGSVIDFSVDEQPRRDTSVEKLAGLKVLHPEIEGFSITAGNASGTN
DAAAGVALVEADYAAANGLTVMAKVRSWGAVGVAPRDTGLGGVKVIGRVL
DKAGLKPSDVTLWEINEAFASVPIAAVREYGIDEELVNFSGSGCSLGHPI
AASGARMITTLIYELQRRGGGIGVAAMCAGGGQGGGVVIEV
145224934YP_001135612.1 TetR family transcriptional regulator [Mycobacterium gilvum PYR-GCKMARQATAEKRQRRERGSINPDDIIKGAFELAEQVGIDNLSMPLLGKHLGV
GVTSIYWYFRKKDDLLNAMTDRALRQYAFATPYVEARDWRETLANHARTM
RKTFNGNPILCDLILIRSALSPRAAKVGVQQVEKAIGSLVEAGLSPEDAF
DTYSAMSVHVRGSVVLQRLREKNLAGDDGHGDIDDTMAIDPETAPLLAAV
TQKGHHLSASDDRNFEFGLDCILENAARLIEKAKTTRKAPARKR
145224933YP_001135611.1 enoyl-CoA hydratase [Mycobacterium gilvum PYR-GCK]MSDEVLLERRDRVLIITINRPEARNAFNLAVAQGLADAMDELDDTPELSV
AIITGAGGNFCAGMDLKAFMAGEVPAIEGRGIGFTERPPRKPLIAAVEGY
ALAGGTEIVLATDLIVAAKNAKFGIPEVKRGLVAAGGGLLRLQKRIPYQK
ALELALTGDSFTAEEASAWGFVNVLTEPGGALDGALALAERITANGPLAV
AATKEVIAKSADWTEAEMWKKQGEIVFPVFSSKDAMEGATAFAEKRKPNW
TGT
145224932YP_001135610.1 short-chain dehydrogenase/reductase SDR [Mycobacterium gilvum PYR-GMDLGLRDATVVVVGGGRGMGLAAAHCFADDGARVALVGRTRDVLDEAAAQ
LRGRGSPDAVGVVADCADEAAVQRAFGELAERWNGELNVLVNAVGPTVRG
TFDELSDADWRQAVDEGAMGMVRCVRAALPLLRAAEWARIVNFSAHSTQR
QSVILPAYTAAKAMVTSISKNLSLLLARDEILVNVVSPGSIASEALVGWA
DSVGVDGSDPYALMAAIDEHFGHPAHLPRAGLPTEIGSVVAFLASRRNSY
MTGADINVDGGSDFT
145224931YP_001135609.1 dihydrodipicolinate synthetase [Mycobacterium gilvum PYR-GCK]MATAAEARDWARVALRGIGDSLYTPFCGVDGDDIDWEAYRTLVRYCVGDL
GHPLLWCTSGIAEFWALTLDERKRLLEIAIEEGRAVNPDVVIQACTAATS
AKDCLELTRHAQQAGADIVYIQTPMMETHGGEGVLRFFRYIAERTDIALG
MFNSPSSGYVLTPAEGARIYEEIPAVCATKEGAFRPAASRMLHDLAPDLV
LWECDKTVYRAGWLREGIVCAAQLGTAGYLFETPRRPIFSEYWELIVAGE
LIEAMDFARESGLDQFDLDMGSWFTCYPARADYFTHWGGAFKFAASVLGL
PIGAYPHSRPPQAELPDLAQNQIRDAYRHLGLIDG
145224930YP_001135608.1 enoyl-CoA hydratase [Mycobacterium gilvum PYR-GCK]MSAVDRAVDRRAEPVLFDLHDSGVAVLTLNRPDRMNSWGGGLARAFYECI
DRAEADPDVRVIVLTGNGRAFCAGADMGDLDSISGASDSSDTDVTQLVGE
RHPHFVTQLRTPIIAAINGACAGIGLTQALMCDVRFAAAGAKFTTAFSRR
GLIAEYGISWILPRIVGWGAAQDLLLSGRTFYAEEAKSLGLVNDVVAPDE
LMAHTLSYAEDMARNCAPSSMAVIKRQLHKDALRNLHDASAEAETLMHES
MLRPDFIEGITAFFEKRPPSFPPLSTQKEETP
145224929YP_001135607.1 amidohydrolase 2 [Mycobacterium gilvum PYR-GCK]MTIQQEERVAAQRLDYRAIDVDNHYYEPIDSFTRHLPKEFRSRGVQMLND
GKRTYAVFGGVINHFIPNPTFDPIIEPGCLDLLFRGEIPEGVDPASLMKV
DRLSEHPEYQNRDARVKILDKQNLETVFMLPTFACGVEEGLKHDIPATMA
SVHAFNLWLDEDWGFNRPDGRILSAPIISLADVQKAVEEVEFVLSRGAKI
VCVRPAPVPGEVRPRSLGDPVHDPVWARLAEAGVPVVFHLSDSGYTAIPA
LWGGSGVFKGFGKRDPLDMVIMDDRAIHDTIASMIVHQVFTRHPKLKVAS
IENGSYFVYRLIKRLKKSANNAPYHYKEDPVEQLRNNVWIAPYYEDDVKL
LAETIGVDKILFGSDWPHGEGLADPTSFTADIPQFPEFSHEDTRKVMRDN
ALTLVHGA
145224928YP_001135606.1 acyl-CoA synthetase [Mycobacterium gilvum PYR-GCK]MPEWTIGGVVDAIAEAIPDRLMTVCGSRRSTYAETAERTRRVANFLSANG
IGAHQERDTIDGWQCGQDRVALIMHNDLYPDMVIGALKARAVPVNVNFNY
TPREVDELLAYLRPRAVIFHRSLGAKFADVLPRTGVEVMISIDDGSDAPE
LTGAVTLDDALAAGDADQPITPSPDDVMMICTGGTTGRPKGVMWRQSDTY
VVSMNGADHESVDEIHAKVQHAGPPWFAVSPLMHAAGMWTAFAALLNGQT
VILYDKPTLDAAAVLETAEREKVGLMTMVGDAYARPLIAELQRRPYDLSS
LFAIGTGGAATNQRHQDALLELLPQITLINGYGSSETGNMAFGRSLRDDR
KDTFERRDGVVLLSEDRTRFLEPGEDEIGWVAREGRIPLGYFDDADATAR
TFPVVDGRRVVISGDRASLEADGTIRLYGRDSLVINTGGEKVFVEEVEEV
LRAHHGVADALVIGRDSDRWGQEIVALVQKQPDAVVDPSALLDACHEALA
RYKAPKEFLFVDRVRRLGNGKADYRWAKSQVAPQDTLAGQP
145224927YP_001135605.1 amidohydrolase 2 [Mycobacterium gilvum PYR-GCK]MSDRVIDCLVNVHFGETANQPEFMLKVRDDYFKGPQSLYDQVELPALLDE
MAEHGVEKAILMDNLVKPSVTARKFAEERPDKFALAIGGVNLLRPMPSLR
ELSSVVADLPVAYAAVGPSFWGDGMYPPSDAVYYPLYTKCAELGLPLCIN
TGLPGPPIPGEVQNPIHLDRVCVRFPELKLCMIHGADPWWDVAIRLLIKY
ANLRIMTSAWSPKRLPDSLLHYMRTRGKNKVIFASDWPVLRQSRVVPEAL
ALDLPPDVLDNYLYNNANDFFFGTDEQEI
145224926YP_001135604.1 acyl-CoA dehydrogenase domain-containing protein [Mycobacterium gilMDRYELRRLDYSLSEDHQALQAAYKDLFATRCTIDTVRAAEESGFDKNLW
ERLCAMGATTMALPESVGGDGATLVDLTLVAEEIGRSLAPVPWIDHVVAA
RLLARLGSVDADVVNGKNLVALDPAPDSAGVRLIPAGSIADRLLVRDGDE
IVALSFSSRPARVDNIGKLPMAWVDPAAADSRTVLASGAAALAEYQRALD
EWQLLTAAALVGLVEETMTIAAEFSKTRYTLGVPISTLQAISHPLANIAI
VVQGGRNLARRAAWFLDNEPDERRELAPSAFVFMAEEAAKAATMAVHVQG
GLGVSAEAAATAYLVRARGWAIAGGDPGVTAKYIAQIVADREGRS
145224925YP_001135603.1 acyl-CoA dehydrogenase domain-containing protein [Mycobacterium gilMDFSRVQLSDDEQKFQDEVRTFLSEIVTDEVIRRDRETGDNFDEGVHLAL
GAAGYLDRDWNPATERPFSRVERRIWELEKRRAHVPWVTSGTTAMITKSV
EKFGSPELKDEVLPRVYSGHVRLCLGYTEPEGGSDVATCKTRAVRDGSSW
VINGSKMFTTGAHNCQYVFLITNTDPSAPKHKSLTMFLVPLDTPGVEIQG
IRTVDGDRTNIVYYSDVRVDDRYRLGEVNGGWTVVREPLNAEHGDVAAAD
DGLADVSIMMHQAMFMAKAVDTAAQKSTIPDPNGRRLIDDGAVAYRLGRS
VARLEASLSAPSIFGRVALAQTMRDISPDLMDILGTASALPVGTDGAADD
GAAEYVYRFAPLVGIYGGTLEVFRNMIAQYVLGLGKPNYSPPRKAS
145224924YP_001135602.1 thiolase [Mycobacterium gilvum PYR-GCK]MHDVAIIGVGLHPFGRFEGKTAMQMGVDAITAAVADAGVSWNDIQFGVGG
SWTVANPDAIVGMLGLSGIPFTNVFNACATAASATKTCADGIRLGDYDIG
IAVGLDKHPRGAFTEDPGLVGMPSWYAENGQYLTTQFFGMKANRYLHTHH
VSHRTLAKVVNKNLRNGALNPNAFRRKPMDEDAILNSPMLNYPLTQYMFC
SPDEGAAAVVMCRADLAHKYTNKPVFVRAVEVRTRKYGAYEVNTTFAPVD
EDVAPTVYASRAAFEKAGIEPSDVDVIQLQDTDAGAEIIHMAEAGFCADG
EQEKLIADGATEIGGTMPVNTDGGLLANGEPIGASGLRQLHEIVRQLRGQ
AGDRQIPGDPKVGFAQLYGAPGTAGATILTT
145224923YP_001135601.1 hypothetical protein Mflv_4344 [Mycobacterium gilvum PYR-GCK]MTDAYYELVDPDDPRGERFASSDHVISTWGRSMQNAAPVSALLVRAIERC
APRDDTRISRVVIDLLGPVPVTDELWVQARIDRRGRQIELLGADMTAPGP
DGAPRVVATASAWRFQRVPTPTLPETPIEPMRPVSEGRRRLPDDGTDRTY
IHSLDWLWLNDILHSVEAECWATPLVDLVVGEQMTPAQRLFAVADIANGM
GSRLDPADFTFLNTDLAVHLHRLPEGDWIGVRSESRYGADGVGVSRGTLF
DENGPVAAIQQAQLVRPRR
145224922YP_001135600.1 cytochrome P450 [Mycobacterium gilvum PYR-GCK]MDVVGQSVADVHFDPFSADFYDDPHACYPRLRAEAPVYYNQTYEFYALSR
HADVAAGLKDFATYSSAYGVDLGMVRRGEKVPAKMIISLDPPEHRAMRSL
VNKVFTPRAIEELRAMVSDTVGRFLAAAVGDAGSEGSEFDVVQDFSAYFP
VEVITQMLGVPERFRQQVRLWIDESLHREPGQIDISESGKQAMAEMWLMY
YELIQQRRDDPGDDMISALIAAEVQREDGAVDRLRDSEIAGFATLLGGAG
AETVTKLIGSAAVTFARHPDQWQQLLADRGKIGVAIEELLRYDAPVQYNV
RRSNVDVTVHGVTIPAGAPVFLLGASANRDPEAWTAPDTFDINRDRSEAQ
NLAFGYGIHSCLGAALARLESAIALDKLLDLMPRYEVRWDRCRRVSMQNV
SGWSHVPVRILP
145224921YP_001135599.1 molydopterin dinucleotide-binding region [Mycobacterium gilvum PYR-MVTHTEHKATFCRICEPLCGMIATVEDGKLVALRPDKDHPLSAGFACQKG
IAFTEVVNDPDRVTTPMRRTADGFEPVSWDEAMSDIATRLSGVLHRHGPG
AVGWYMGNPGAFSYAHVMAIMAFIKGIGSGTHFYTASSQDTNCRLMASQL
LYGTPTSVPIPDLARTDLLVVIGANPVVSHGSFLTAPRIKDRMHDIVKRG
GRVVVIDPRKTETAAQFEWCGIVPDTDALLLLSLLQVMFSEGLAHTREIE
SVADGVDWLRAQVAPFTPEATQPHTGIDPDTVRALARDLATTPRAAVYGR
LGTCVGRYGTLTSYLLDVVNLVAGNLDVPGGSVIAGLGMPAQRVVNIGMG
AALRRTYRRGRSRIGGFRAIIGSEPAAVMAKEMTTPGQRQIRAMFISAGN
PVLSVPNGEELESALDSLDLAVGLDFYLTETTAHCDYVLPVTTMYERDDF
PLVFQQFQATPFRQVTEAVIAPVGQARQEWEIIGELITRMAGESRVFAGL
TAAGKALRRIGAPFTPRMFADLVIRSSAGGDRFGLRRGGLSFGRLSRDHA
HGKVLSPNLATGVLKDAIAYLRGRIRLVHEDIEAEIAMLLRNELPEAYPL
KMIGMREPRSENSWMHNAPLLMRGERSHHGLMNADDAAELQIGDGSEVHV
SSPYGTITVPVTLTKDIMPGVIAVPHGWGHKGTGGWTVANKAGGANVNQL
TSSEPDDVESMAGMAWLTGVPVRVERA
145224920YP_001135598.1 L-carnitine dehydratase/bile acid-inducible protein F [MycobacteriuMIKVMEGVRVLEVAQFTFVPAAGAILADWGADVIKIEHPVRGDTQRGFIN
MGGFQLDPNRHPLIEHPNRGKRSVGIDVSTPEGQEVLYEIAKTADVFLTN
YMPQARQKNKFDIEHIRAVNPNIIYARGSAYGDKGPERLVGGFDGTAFWT
RSGVGHALTPEELGGALPQGIPAFGDSIGGMNIAGGISAALFHRERTGEA
VEIDVSLLSTAWWAAGASVTQGMETGETMRSLMPGTTTSVNPFMANYQTS
DGGTINLCIVSPTGYIRDTWEHLGLPELADDPRFSDVMPLIQNAEEGVRL
ITEAIAAKPFEYWRRHLKTMKGQWAPFQSLVDLGTDEQAIANDMIVEVEA
SDGGKPFKVVRGPVQFNHEPLETTRAPQASEHTEIVLMELGLEWDRIEEL
KDKGAIA
145224919YP_001135597.1 aldehyde dehydrogenase [Mycobacterium gilvum PYR-GCK]MSATPTERTETSLEWGRRAAQRAENRMLIDGELVGAASGEMFDNLSPATG
AVLGATAAAGADDMDRAIAAARRAFDTTDWSTDKELRRRCLQQLQAAIES
EKEDLRTELVAEVGCPVMTTESAQLDWPLAEALRYPAGLIDDFEWERVLD
AGGLFGERNIRMVVKEAVGVVAAVTPSNFPLEVILNKLGPALAAGNTVVL
KPDPHTPWNATRLGRLIAEKTDFPPGVVNVVTTPSNAVAGLLGTDARVDL
VSFTGSTAVGKLLMRQGADSMKRMFLELGGKSAAIVLDDANPAVIVPTAV
GVCVHAGQACAATSRMLIHRSLYDQAVADITMAYQYVPVGDPTDPGTLVG
PVISAAQQERVLSAIEGARRDGAEITAGGGLVAGLPDHLAGGHFVAPTVI
TGVDNSAAIAQQEVFGPVLVLLPFDDDDEAVRLANDSAFGLAGAVMSRSA
ERGMNIARRIRTGAFGVNGGMFYGADAPFGGYKSSGVGRQCGIEGFSQYL
ETKTIARRERRKG
145224918YP_001135596.1 cytochrome P450 [Mycobacterium gilvum PYR-GCK]MRVDTPVQDVEMDGPIDLRDPYPMFARHRAEGGVFRGSVMDWSKTPESLM
PEKLYAAVSFDAVNRVFRDGKVFNSKIYDATIGLFIGPTILAMEGKPHWE
HRNLVSAAFKTRSLARWEPEIVRPVVNGLIDEFIDRGSADLVRDFTFEFP
TRVISRLLGLPEDDLPWFRKRAVELISYTINHKRAFEASAALKDYFLAQI
EKRRCAPTDDIIGDLVSAEIDGEHLTDEAIFSFLRLLLPAGLETTYRSSG
NLLYLLLTHRDQFDAVDADHELIGQAIEEGLRYETPLTTVQRFTTEDTEL
EGVPIPAGAVIDVCIGSANRDEKRWERSEEFDIFRKRVPHLSFAAGEHTC
MGLHLARMETRVAVETLLTRLSDIRLVTDDDPHIHGQPFRSPTALPVTFS
PAAAK
145224917YP_001135595.1 short-chain dehydrogenase/reductase SDR [Mycobacterium gilvum PYR-GMTRMGGKTVITTVEITRLVVPTMEGYQEGSAMSAEGRRVVVVGAGSGIGA
ATAAWFHSRGDHVLAVDARPRSGPFAEWLVCDLRSADEIEGALGRIGHGW
DVLAHVAGIPGTADARDVLTVNYLGARLMLDGMLPLMNHGGSMVAVASTA
ALGWDSNIGLLSGLLDARDTTAVTRWLEAQDPSMAYYLSKQALVLYAKRL
SGVAWREYGVRVNTVSPGPTETPILGDFEESMGRDMLDGVRTTIGRHGTV
DDMTPAIGFLSSPEARWINGQDIHVDGGFTAALVHPMPERAQV
145224916YP_001135594.1 hypothetical protein Mflv_4337 [Mycobacterium gilvum PYR-GCK]MTRGDKTLCVIYAAVALVALVATWWHNVAFILSGQGESLLDFIRAAYANH
AGASLTNDLLLLGVAVFVFMVVEARRLGIARIWLYLVISIGVAISVGLPL
FLIVRQVALARTRGAEKGAQA
145224915YP_001135593.1 aldehyde dehydrogenase [Mycobacterium gilvum PYR-GCK]MTTTEQVTVTAESMSSMLERQRAAFVADGPPDVALRRNRIDRLMALVLDN
VDDFVDAMGRDFGTRPKQGSLFTEIMGMISVIEHTRSHVPQWMKPNRMMR
PARMFGLRAEVEPTPLGVVGVIGPWNFPLNLVVLPAVAAFAAGNRVMIKM
SEVTPRTAELMRRLSAEYFEPTELCVVTGGADVAAEFAALPFDHLFFTGS
PSVGVLVQRAAAANLVPVTLELGGKNPVVVGPGADMRRAATRIAQGRMIN
GGQVCVCPDYVFVPAARIDAFVAVARETLQAMFPTIVANDDFCSSVNEAN
FERVVGLIEDARAKGARVESVAPAGESLPDPGTRKIAPTILRDVDDSMLI
ASEETFGPVLTVRPYEKLADVVEYVNARPAPLVTYWFGPDDHDFRSFVRQ
TRSGGVARNDFAAQMIPSAAPFGGVGRSGMGAYHGKAGFDAFSHYRTVVG
SDLPFTITGRAAPPFPLTMRATTALALRIAHRRTHRRLSRLRNR
145224914YP_001135592.1 acyl-CoA synthetase [Mycobacterium gilvum PYR-GCK]MTEPNQFTVPAAADAVAAVIGDREFIIQGERRYTYAQIVERSNRLAAFLH
AQGLGCHTERSELPGHEVGQDLLGIYAYNGPEYVEGMLGAWRARVAPFNV
NYRYVKSELQYLLADAGATALLYHSAFAPRLAEVLADLPSLKVLIQIADD
SGNELLPGAVDYESIVAEGPAEVPPVQPSPDDLYVLYTGGTTGMPKGVLW
RQHDIFMASFGGRSLYTGELISSLDDVAQRCVESPGTTLMVLPPLMHGAA
QWAVFTAMNTGQSVVFSPVTEHLDVDDVVATIEREKVLAVTVVGDAMARP
LADAFERTTADLSALAVVANGGAQLTPSAKQRLIDVKKNLMVVDGVGSSE
TGAQMTHMSAPGAVSTGKFTAGPDTFVASEDLSTILEPGHDGMGWLAQRG
YVPLGYKGDATKTAATFPVIEGVRYSVPGDRARHLADGAVELLGRDSVTI
NSGGEKIFAEEVESAIASHPAVADVVVAGRPSERWGQEVVAVVALDSGAT
ATAEELIDHASAVIARYKLPKAVVFRPAIERSPAGKADYRWAREQAISGS
145224913YP_001135591.1 isochorismatase hydrolase [Mycobacterium gilvum PYR-GCK]MRIPLAELVAPGHTAVVTQECQEAVVGTNAGLAALADAARGEALPNISRL
LPVARRAGVDVVHCLVQRRADGRGANHNAKLFTVGASGVDITPDSPGTQL
VPEIDVQPSDLVLRRWHGLGPMGGTDLDAILRNLGVTTIVAVGVSVNVAI
LNLVMDAVNAGYRVVLPRDGVAGIPAEYATAVIDNTLSLLATLTITDDLI
SAWAATC
145224912YP_001135590.1 Rieske (2Fe-2S) domain-containing protein [Mycobacterium gilvum PYRMKVPFTWKVTGWFMIGWSAEFEVGDVKALRYFGEDLAAYRDESGRLHVLE
AHCKHLGAHIGHGGKVVDDCIECPFHGWRWGPDGSNTYIPYQPDRPNRGL
RLRSYPVEEQYGCIFMWYQPQGKEPQWELPDIFHKFPQFETDANAYYRPY
PEFSSRADAIPVHPQIVAENGPDSSHFRYVHGATVTPVCLHWEHVDEEWR
FLTGWPDARSDDPDKMALRIHSHFSGLGFAMSAFEGSSNHRLIFACTPVD
DEVSDMFYSIWWPKLPGETSDIPPAEVIEKVERQFLKTVWEDCDIWRYQK
YVENPPLAKIDAKPYMAMRKWAQRFYEVPPVGDPVASR
145224911YP_001135589.1 cyclohexanone monooxygenase [Mycobacterium gilvum PYR-GCK]MTIEHGPRRFDAIVVGAGFSGLYALHHLRELGLSVRVLERAHNVGGTWLF
NRYPGARCDIESIEYSYSFSEEVQQEWVWTETMPTQPEIEAYLNFVADRL
DLRRDIAFDTNVTAMVFDDDRAEWVVTTEAGESFVASYVIAATGILSVPL
EPTIPGMASFAGTSLFTSRWPEGADLRGRRVGVIGTGSTGVQLIPVVAEE
AAHLTVFQRSPAYTLPWTVRPFAPGELDELKAQYPQIRAAQREHPVGAAR
LSAFSVLLEMLVKPPLKSASREERTRAVEERGIMGALDWGDLFFDIDANR
MAAELYGEAVARIVDDPVTARALTPSHPFACKRPIIDQGYYETYNRDNVS
LVDLRADPIVSVRPTGIETEGGLHELDAIIYATGFDAMTGALSRIDVRGR
GGMSLGEFWATEGPLSYLGMAVAGFPNLFTIQGPGSPSAASNFVAAMEQN
VEWIGACIGHLREHRYQTIEALPDAQQNWIEQATALVAPTVLVHPSCNSW
YNGGNVPGKKRMYMGYTAGIPEYRRQCDEIAATGYAGFKLA
145224910YP_001135588.1 hypothetical protein Mflv_4331 [Mycobacterium gilvum PYR-GCK]MKTSERLWRIGSDFAGVLPRAHSAVAVGQAWNPLSVRGLRQLGEVALDEL
ALTGMTLTAPPPRLERSEASCAAAAAELAGLGVTGANADPDPVDIGSLRR
RRLGRHRYEQLTFDHDPHLPDTLSAEGFGGAATAVAHLCRTDSKRRPWLV
WVHGAGQGQPIDLLFSRARRIQDELGVNVALPVQPGCGVRASAWPEYPTM
DPLANVAGMLRVVSEVRALVRWLRPQATAIAVAGVSMGSPVAGLVSHLEP
VDAVAVYTPIFGLNAMIAAHLGRWGPSVDDTVALLRSEVVEQVSAAVDYQ
AVEPSASPDRRLIVGAWHDRMAMREPAQVLHARWGGELYWHQGSHVGHLF
APGVHTASEKFLRSLTG
145224909YP_001135587.1 hypothetical protein Mflv_4330 [Mycobacterium gilvum PYR-GCK]MTVPGSVDALTACWLTEALRSDPTLSDTLTVDGVRAERIAMDSGFSSLLY
RLHLTGTGVPATVIAKLPAESEARGAMELLGGYRRELAFYRNVAGRAPLD
TPHVYTAQIAEDSVDFVLLLEDLRDWDNADHLVGLTVEQTRLAVTNLAGL
HAWSVDPSNSAALQHFPSLSTPIVRDLLVPAFAPGWQVYRDRSGAAVPRR
IARFADRFAELAPQALAALVEHSMLLHGDIRADNMFFDGGRLKIVDFQFA
SVGSGAADIAYLVSQGLPTDARRGHDETLMREYLGMLGVPYRFDDAWRHY
RFAVAYLMVLPVIILVGWDSLPERSRALCLELTSRAIAAIDDVDATEVFA
145224908YP_001135586.1 hypothetical protein Mflv_4329 [Mycobacterium gilvum PYR-GCK]MTRTAREVVEQYNLIVWNERDFALAEELMGDTVIRHDVGESTTLTHEQAV
ARVVDHWAMFESIRFDLNLVIAGDDGEHVTIVYQSPMKLKDGTETTIGSM
EIFRVVDGRITEVWNCGYKQGVWA
145224907YP_001135585.1 luciferase family protein [Mycobacterium gilvum PYR-GCK]MTEAKMDELGYYLLAGAGGEGPATLMDEARRGEELGFGTGFISERWNVKE
ASSLTGAALAVTSRMQIATAATNHNTRHPLITGSWATTMHRLSGGRFTLG
IGRGIGAIYNAFGIPTVTTAQMEDFAQVMRKLWHGELIFNHDGPLGKYQV
LFLDPDFREDIRLAIVAFGPQTLALGGREFDDVILHTYFTPETLQRAVKT
VKDAAEQAGRDPASVRVWSCFATVGDHLPEELRLKKTVARLATYLQGYGD
LLVNTNGWDPAVLQRFRDDKVVQSIGGGIDHKATAEQIEHIATLIPDEWL
EPSATGSPQQCADRVRKEFDYGADAVIMHGATPDELEPIVAAYRAGQS
145224906YP_001135584.1 propionyl-CoA carboxylase [Mycobacterium gilvum PYR-GCK]MAKAEDWAETLDELSRRRDHSRAMGGDERLARHHGKGKLDARGRIQHLVD
KGSFREFGTLVGGDIAADGIITGAALIDGRPVMVGAEDFTTLAGSIGPGG
NAKRYRLAELALRDRVPMVMLLEGAGFRPSGEHYGRTPTDLLAQAQCSGK
VPTVGGLFGPSAGHGALVAPVCDWTIMTGQGAIFTAGPPVVKESTGEDIS
KEDLGGPSVALASGVIHNLGADDAAVLDDIRRYLSFFPSSAWSYPSSTPP
GEGTGHRATPELLDIVPRGNRQVYDMSDVLDVVFDDSGWFEVQPRFGRAM
ITALARLGGHPVAVVANQPKVLAGSIDADAADKAAHFIMVADAFHLPIVF
LADNPGMLPGSRSEKTGVLRSGARMFAAQTAASTIKLHVTLRKAYGFGSM
VMSLLGFDNQSATFAYPGATMGAMSAAALSRASNATEDLEAKLRQAEVDA
SFRSAGHLGFDDLIHPQETRDVLLDALERGLYSRQAAAQPVTRTVITP
145224905YP_001135583.1 putative oxidoreductase [Mycobacterium gilvum PYR-GCK]MDAAVVSQLSHVPAAARTLEQRGYDGCWTAEINHDPFLPLTLAAEHTERM
ELGTSIAVAFARNPMSVAQIGWDLQDYSEGRLLLGLGSQIKPHIEKRFSM
PWGRPVARMREFVQALHEIWACWRDGTRLNFEGEFYTHTLMTPMFVPQQH
AYADPKVFVAAVGDRMTEMCGEVADGLLAHAFSTQRYVREVTIPTLERGI
ARAGRTRADVVVSSPLFVVTGHDEQELAANAVATRKQIAFYASTPAYRGV
LELHGWGDLQTELHRLSRAGEWDTMGALIDDTMLAEFAVVAPVDELVHTI
RARCDGLIDRVLVGFPPSIDEATVVGLVSELQAEETS
145224904YP_001135582.1 cytochrome P450 [Mycobacterium gilvum PYR-GCK]MSVRVADEAGKVFADPTAYADEQRLHAAMTHLRANAPVSWVDVEGYNPFW
AITKHADIMAIERDNTVFTNSPRPVLTTAEGDAQHASMGVSTLIHMDDPQ
HRKVRAIGADWFRPKAMRALKVRVDELAKTFVDQMYDRGGECDFVQEVAV
NFPLYVIMSLLGIPESDFGRMLTYTQELFGSDDAELQRGTTMEERGLALF
DMFTYFNELTASRRAQPTEDLASAIANARINGEPLSDIDTVSYYLIVATA
GHDTTSATISGGLQALIENPDQLARLQQAPELLPLAVEEMIRWVTPVKEF
MRTAQQDTEVRGVPIAAGESVLLSYPSGNRDEDVFTDPFRFDIGRDPNKH
VAFGYGVHFCLGAALARMEINSFFSELLPRLTSVELAGRPEHIATIFVGG
LKHLPIRYSLTR
145224903YP_001135581.1 amidohydrolase 2 [Mycobacterium gilvum PYR-GCK]MNRDDMILISVDDHIVEPPDMFKNHLSKKYLVEAPRLVHNEDGSDTWQFR
DVVIPNVALNAVAGRPKEEYGLEPQGLDEIRPGCWQVDERVKDMNAGGIL
GSMCFPSFPGFAGRLFATEDPEFSLALVQAYNDWHVEEWCGAYPARFIPM
TLPVIWDPEACAKEIRRNAARGVHSLTFSENPSAMGYPSFHDFDHWKPMW
DALVDTDTVLNVHIGSSGRLAITAPDAPMDVMITLQPMNIVQAAADLLWS
RPIKEYPDLKIALSEGGTGWIPYFLERVDRTYEMHSTWTGQDFKGKLPSE
VFREHFLTCFIADPVGVATRHQIGVDNICWEADYPHSDSMWPGAPEQLDE
VLKANNVPDDEINKMTYENAMRWYHWDPFTHIAKEQATVGALRKAAEGHD
VSIQALSHHKEGERGGGAGHFDALNAAARGNSGA
145224902YP_001135580.1 hypothetical protein Mflv_4323 [Mycobacterium gilvum PYR-GCK]MGDNDYRRYLDHHARTHAGQVPMTEREYWRRRHAQADAEPGARCC
145224901YP_001135579.1 carbon starvation protein CstA [Mycobacterium gilvum PYR-GCK]MATPTAASSDRIEETDGDITYIRTDKNLPPVAIVDRSPITVKHKIIFSIV
AVLGAVAWAIIAFFRGETVNAVWFVVAAICTYVIGFRFYARLIEMKVVRP
RDDNATPAEVFENGTDYMPTDRRVLYGHHFAAIAGAGPLVGPVLATQMGY
LPGAIWIIIGAVVAGCVQDYLVMSISVRRRGRSLGQMARDELGVVGGVAA
IVGVLVIMVILLAVLALVVVGALAESPWGVFSIAMTIPIAIFMGLYLRFL
RPGRVSEVSVIGVALLLLAVVAGGWVAETDWGVEWFTLSKVALSWCIIIY
GLAASVLPVWFLLAPRDYLSTFMKVGTIALLAVGILIARPVMEAPAISQF
AASGTGPVFAGSLFPFLFITIACGALSGFHALISSGTTPKLLEKESQMRL
IGYGGMLTESFVAIMALITAAILNQHLYFAMNAPSASTGSTAQSAADYVN
GLGLSGAPITAGEISDAAESVGEESIVSRTGGAPTLAFGMSEVLHQVFGG
AGLKAFWYHFAIMFEALFILTTVDAGTRVARFMLSDGLGNLGGPFTKLRN
PSWRVGAWICSVIVVAAWGSILLMGVTDPLGGINTLFPLFGIANQLLAAI
ALTVVTVVIIKRGLLKWAWIPGVPLLWDLIVTMTASWQKIFSGDPKVGYW
TQHFQYRNARDAGQTAFGAAKDAGQLDAVIRNTFIQGTLSIIFAVLVIIV
FAAGVVVALRAIRGKGSPLTEDDPVPSRMFAPSGMTMTPAEKEVQKQWDA
LPKTPAGSSATSPGTGKH
145224900YP_001135578.1 ATP-dependent DNA ligase [Mycobacterium gilvum PYR-GCK]MLLVDVAGASADVAASSARLAKIARIAELLRRAGREDVAIVVSWLSGELT
QRQIGVGWASLRSVPAAAAEPTLTVAEVERRFGEIGATAGRGSQARRAQL
LADLFSAATDVEQTFLRRLLTGELRQGALVGVMADAVAKAADLPAATVRR
AAMLGGDLPAVAAAALTDGDAGLAQFTLQAGKAVGPMLAQTAADVTDALD
RLGGTAMFEAKLDGARVQIHRRGDSVSIFTRSLDDVTARLPEVVEATLAL
PVTDLIADAEAIALRPDGRPHRFQVTASRFGRRGGTSDTASNPLSVFFFD
LLHVDGVDLLDAPAHERIARLDAVTPDSQRVDRLVTSDPGAAQEFFDRTL
AAGHEGVMAKSTVAPYEAGRRGAGWLKVKPVHTLDLVVLAVEWGSGRRSG
KLSNIHLGARDPGTGGFVMLGKTFKGMTDEMLAWQTRRFLDLADGDATDH
YVVKVRPEQVVEIAFDGLQTSTRYPGGMALRFARVVRYRDDKAATDADTI
DTVREIYERGN
145224899YP_001135577.1 molybdopterin binding oxidoreductase [Mycobacterium gilvum PYR-GCK]MTTPGVRAAGGVAAAAVAVGVASLVGAAFGPEADVRTAVGSSVIDLTPGP
VKEWAIATFGTADKLALAVMVLLTIAAIAAVAGLAETRRRPVCSIAIVIA
GGIGCAAVLSRAGSTGADIIPTLIGTACGVAVLRILQSDRLDGPSSETGT
DPGRRRSLLTIGLLAAGAVSGVAGVVISRLASSVAGDRDAFALPRIDTPA
APIPESVQPKGVELPSWVTGNDDFYRIDTALSVPQLSRSEWRLRIHGMVD
REVTFTYEDLDRFEVVEKVITLTCVSNPVGGELISNAVWTGYRVKDLLAE
AGVRSGADMVLSMSVDGWTAGTPVEALTGDDALLAIGMNGEPLPIEHGYP
ARLVVPGLYGYVSATKWVTALELTRFDRAQAYWTRLGWSARGPIKTASRV
DVPRSGQDVALGPVTFGGVAWAQNRGVRSVEVQMDDGPWEQATLGDSYSG
DTWRMWSYAWEARDTGFHTITVRATDDSGYTQTPDRADPVPDGATGWHSI
TFAVK
145224898YP_001135576.1 short-chain dehydrogenase/reductase SDR [Mycobacterium gilvum PYR-GMEIEGKKAIIVGGASGFGRATAEALAKRGATVAVLDRPQSKGKEVADQIG
GTFYEVDITDFEGTESVLNKVVEDLGGLHIAVTTAGGGIAERTVKKDGPH
SLDSFRKSIDLNLIGTFNISRIAAWHMSKNEPVDDEAEERGVIINTASIA
AFEGQIGQLAYTASKAAIAGMCLTMARDLGSLGIRALAIAPSLFATGLTE
GIPDEFATVLTKDAAFPKRLGKPEEYAKLAVAIVENPMLNGQCLRLDAGQ
RFAPK
145224897YP_001135575.1 aminoglycoside phosphotransferase [Mycobacterium gilvum PYR-GCK]MPVDVTLTDDAVAALQEWVRRTGLGSVVSDVEPLTGGSQNIVVRVRLDGS
DVVLRRPPQHPRPTSNDTMRREIAVLQTLRGTDAPHPEFVAGCEDLDVLG
VVFYLMQAVDGFNPGTEIDEAYVRDAGMRHRVGLSYAASLARLGAVPWEG
SPLAALKRPGSFLARQVPQFLRLLESYRHENYAPESFPSVHVLAEWLEAH
RPPDSEPGIMHGDCHLNNVLLRRDVPELAAFIDWEMCTVGDPLLDLGWLL
VCWPDGPNPIDAGSALGALGGLASRAELIDAYRDAGGRPTTHLDWYIAMA
CFKLAIVIEGTWSRYLAGRASAEAGERLHASAENLIALGTRVSTGDNPFV
145224896YP_001135574.1 hypothetical protein Mflv_4317 [Mycobacterium gilvum PYR-GCK]MLFAAGILGGLTGSIAGLASVATYPALLVAGLPPVTANVTNTVALVFNGV
GSVLGSRPELRGQRTLLTRAIPFAVLGGVTGAVLLLSTPAEGFEKIVPAL
LGFASLAILLPVRPAGDPSTASRRRRTLTLAVQGLAVFAICIYGGYFGAA
AGVLLLAMFLRLGGETLAHANAAKNVVLGVANGVAAVIFAVVAPVQWVAV
LALGAGCLVGSRIGPVVVRRTPDRPMRLAIGLAGVALAVKLGIDAYR
145224895YP_001135573.1 hypothetical protein Mflv_4316 [Mycobacterium gilvum PYR-GCK]MNVSSNTHPTTASSASASLPFAAHVDGRTPRALRELAEIKSFDEFLAVYA
PTSGPLRLGQWTCVDDDRPGRRLGPQARQYQATLAVGDRIATSRAAACGP
VAALTEMLHEHGIAIEMTAFHQVPAGDHTATFIRGSRCGGEQWAMGWSDD
STDSALRAVIACANRLLSA
145224894YP_001135572.1 cytochrome P450 [Mycobacterium gilvum PYR-GCK]MTAISTPEYLLDQAKRRLKPTPVTIPGMGAIEKRLLEKQWDEIILAEPPA
GSGLKAVRGDNGLPIVAHMIEMFRGGPDFILHQYRKYGPVYYSGSQVLPA
VGALGPDATQAVFSNRNKDFSQRAWDPVIGPFFEGGLMLRDFEDHMYHRR
IMQEAFTRSRLTGYVEHIDQVASAVIANDWVADDRRFLFYPAVKELTLDI
ASVVFMGHKAGTDKQLVTTVNEAFTTTTRAGNAIVRKPVPPLSWWRGIRA
RKTLEDYFNAGIAEKRRSESTDMFSVLCHAQDEDGQSFTDQDVVSHMIFL
MMAAHDTSTSTLTTMAYHLAANPEWQDRCREESERIGDGPLDIEALEKLE
TYDLVINEALRMVTPLPFNFREAVRDTELLGYYIPAGTAIMTWPALNHRL
PELWTDPEKFDPARFAEPRNEHKKHRYAFAPFGGGAHKCIGMVFGQLEIK
TVMHRLLRKYRLEPVSPNYRPRYDHGGMAVPIDGMPIVLRPLH
145224893YP_001135571.1 TetR family transcriptional regulator [Mycobacterium gilvum PYR-GCKMPRSNSMTAEPAPTDLRRSRGDRQRDAIVTAVRELLHERPFAELSVSTIS
ERAGVARSGFYFYFDSKYAVLAVIIAEAMAELDQLTHSFGPRDEAESPSE
FAKRMVGYAAIVFASNDPIMRACNLARSTDAQIREIMDDFQNTVVEKIVG
LVGRDAGARPISDDLPALVRVMIAVTSSTLAHDSAFVGRDGDPARALAVV
ERLWESSLWGGQ
145224892YP_001135570.1 short chain dehydrogenase [Mycobacterium gilvum PYR-GCK]MAQRSGSDRFSGKRCFVTGAASGIGRATALKLAARGAELYLTDRDADGLA
LTVADARALGGVVAEHRALDISDHDAVVAFADDIHSRHPAMDVVMNIAGI
SAWGTVDKLTHDDWTSLININLMGPIHVIETFVPPMMEARRGGHLVNVSS
AAGIVALPWHAAYSASKYGLRGLSEVLRFDLARYRIGVSVVVPGAVRTPL
VDTVRIAGVDRDDPRVQKWTNRFSGHAVSPDVAADKILDGVARNRYLIYT
SLDIRALYLFKRTMWLPYSIAMKQVNPLFTRALRPKTKQR
145224891YP_001135569.1 hypothetical protein Mflv_4312 [Mycobacterium gilvum PYR-GCK]MLETVAIRGYRSLRDLVLPLRRLTVITGANGTGKSSLYRALRLLADCGRG
EVIGSFAREGGVASALWAGPEHLGGARRTGTAQGGPRSRSVSIELGYAGD
DFGYLIDLGLPQATETAFGRDPEIKRELVFAGPVARSTTTLVRRVRGMVE
VASDTGRGFDELARNLPAHRSVLTDWAGASPELAMVRERLRNWRFYDGFR
ADADAPARRPQVGTRTPVLADDGSDLAAAIQTILETGNGDLARAVDAAFD
GATVSVAITDGLFDLQLHQRGMLRPLRSAEISDGTLRFLLWAAALLSPQP
PSLMVLNEPETSLHPDLVPPLARLIGEAATRTQLVVVTHSAMLRECLGAE
PIGTDGDAWEIELYKDWGETRVGDQDLSTMPPWDWGRR
145224890YP_001135568.1 putative GAF sensor protein [Mycobacterium gilvum PYR-GCK]MASQVPGFDERLDDALVDEAARAGEPVDVFIARAVAARIAVEMARRSDPD
LDGILRRLRLMDLSPPRPGLPADTGSVIADPERLQALYETGLLDERRGPV
LDRIVEMTVAALAVPTAVVSLVDRDSVYLPSAIGMPGVLAAARQVSLERS
ISRPIVATGEPVIVEDARSHPALRDHPMVLDGFVVGFAAMPITNSGGHTI
GTLAVWDSTPRRWTDGHIQILEDFTAIICDRIFGRGAA
145224889YP_001135567.1 DNA polymerase IV [Mycobacterium gilvum PYR-GCK]MSDPPAAGERDWVLHVDMDQFLASVELQRRPDLVGLPVIVGGNGDPAEPR
KVVTCASYEARTFGVHAGMPLRAAARRCPDATFLPSDPEAYDAASDRVMG
ILRDLGHPVEVWGWDEAYVGARVSDPFALARHIQTVVASQTGLTCSVGIS
DNKQRAKVATGFGKPAGVHMLTDENWMPVMGDRPVDALWGVGPKTAKKLA
AIGITTVADLAGTDSAELTKTFGPTTGLWILLLAKGGGDTTVSAEPWVPR
SRSHVITFPQDLTERAAMDEAVTELARRTLDEVIAQQRIVTHVAVTLRTS
SFHTRSKIRKLPEPTIDADAVISTATTLLDAFDLQRPVRLLGVRLELAMP
SATAARG
145224888YP_001135566.1 TetR family transcriptional regulator [Mycobacterium gilvum PYR-GCKMSAPENRNGLPVLSVAESGPSERAAERGDAARNRVLLLDAARRLVDERGA
DSVTTDDIANAAGVGKGTLFRRFGSRAGLMIVLLDEDEKAQQHALLFGPP
PLGPGAPPLERLLAYGRHRLKFVDTHHALLSDVGRDPQMRFNAPMTLHHS
HVRLLLDEAETTGDLDAQAAALLALLDADYVHHQRTDLGRSLESIADAWE
TVARKLCGT
145224887YP_001135565.1 NADPH-dependent FMN reductase [Mycobacterium gilvum PYR-GCK]MSENGSSTVLVLVGSLREASVNRQLAELAVESAPADVDVEWFDRLGELPF
YNEDIDTADVPEPVAALRTAAARADAALVVTPEYNGTIPGVLKNAIDWLS
RPYGDSALKDKPLAVVGAALGQYGGVWAHDETRKSFGIAGPRVVDGLELS
IPTKTLDGKHPRESDDVVARLRDILGKLVAEID
145224886YP_001135564.1 glutaredoxin-like protein NrdH [Mycobacterium gilvum PYR-GCK]MPAHPAFLIGAVPQMTQPAPVTVYTKPACVQCNATYKALDKQGIAYEVVD
ISVDTEARDYVMALGYLQAPVVVAGSDHWSGFRPDRIKALAGAVTATA
145224885YP_001135563.1 ribonucleotide reductase stimulatory protein [Mycobacterium gilvum MANIVYFSSVSENTHRFVQKLELPAIRIPLKDRIRVEEPYVLILPTYGGG
HANGPDPDRGGYVPKQVIAFLNDEHNRSLIRGVIAAGNTNFGAEFGYAGV
VVSRKCDVPFLYRFELMGTTDDVFAVRAGLQDFWKDQSCPQPSQLQNR
145224884YP_001135562.1 ribonucleotide-diphosphate reductase subunit alpha [Mycobacterium gMDYHALNAMLNLYDADGKIQFEKDVQAAREYFLQHVNQNTVFFHSQDEKL
DYLIEKNYYEREVLDQYSRNFVKGLLDRAYAKKFRFPTFVGAFKYYTSYT
LKTFDGKRYLERFEDRVVMVSLTLASGDTTLAEKLVDEIMDGRFQPATPT
FLNSGKKQRGEPVSCFLLRIEDNMESIGRSINSALQLSKRGGGVALLLTN
IREHGAPIKNIENQSSGVIPIMKLLEDSFSYANQLGARQGAGAVYLHAHH
PDIFRFLDTKRENADEKIRIKTLSLGVVIPDITFELAKKNEDMYLFSPYD
VERVYGLPFADISVTEKYYEMVDDARIRKTKIKAREFFQTLAELQFESGY
PYIMYEDTVNRANPIDGKITHSNLCSEILQVSTPSLFNEDLSYAKVGKDI
SCNLGSLNIAKAMDSPDFAQTIEVSIRALTAVSDQTHIWSVPSIEQGNNS
SHAIGLGQMNLHGYLARERIFYGSDEGVDFTNIYFYCVLYHALRASNRIA
IERGTAFGGFEKSKYKSGEFFDKYTDQVWEPKTEKVRGLFADAGIRIPDQ
EDWKQLKASVQEHGIYNQNLQAVPPTGSISYINHSTSSIHPIASKVEIRK
EGKIGRVYYPAPYMTNENLEYYQDAYEIGYEKVIDTYAAATQHVDQGLSL
TLFFKDTATTRDVNKAQIYAWRKGIKTLYYIRLRQMALEGTEVEGCVSCM
L
145224883YP_001135561.1 excinuclease ABC subunit C [Mycobacterium gilvum PYR-GCK]MIRHSFNTGDEASLRGKEDLTEDRVREYTRFQGISRRQFPAQPERYWVVL
IADGRRRSRLWGTFENHGEVASERTESARYFNLRPHDFLAPLVNRLVVEW
DTPRAWHRRAASAAHMPVLEISDRDKEPFPGFDNVLLTFHELGEMVSDHR
YADWQVALSQVQGIYLITDASNGKQYIGKADGAERILGRWRAYASDGHGG
NRALRELAQASIGAGGAKTDHARHFVFSILRVFGPSTSSSEIDAAESHYK
KSLLTREFGLNRN
145224882YP_001135560.1 hypothetical protein Mflv_4303 [Mycobacterium gilvum PYR-GCK]MSRPNAQSMKPATAAKKLDVYLPATPADFQQNPITRDELAALQADPPQWL
IDLRKNGPHPKNLVAAKLGVSIAALARNGVGTALTTEEINELVEENPEWL
AVEREGYQQVLREERRLKSLRADQAGDS
145224881YP_001135559.1 LysR family transcriptional regulator [Mycobacterium gilvum PYR-GCKMTLGYVPGATPAKWARHWADRHPEAPLRLHGVTAADAAAAVRDGSVDVAL
LRLPTETSGLAVIPLYEEMTVAVVTAEHVLTAADNVDATELHDEAILIPA
DTVVDWPDAPGTPVEHRPETTEAAVELVAAGVGVLLVPQSLARLHHRKDL
TYRPIVDAPTCPVALAFPEGPQSELLEEFIGIVRGRRPGSSRGQTQPERK
RTAREKTLAKQAARAAAGKVARKPGRSRR
145224880YP_001135558.1 ABC transporter-like protein [Mycobacterium gilvum PYR-GCK]MRHGPTTSHDIGSRDGLGRRDVVDGDRAGGNRRSRGSRRPRYRRRVRDHL
RGADAGRTRRPDPASGRLARPGRRQGRATRRRCARRRGAEDDLPRRLLPA
AQRGERGHRPRDPRARPAHRGDQRESARGSDGAGRRRVAAYRRPVEAGEQ
VIVQRHQDDRPADPVQLRMIETSGLTKSFGPKKVLDDVSVCFPGGTVTAL
LGLNGAGKTTLLRLIAGLDRPDGGTVTVDGRAPGGDPNQVGVHLGPGALD
PRHTVGRHLKWLAALAGTEVRRIDDVLDETGLHAQRRERIGALSLGARQR
LSIAGALLCSPRALLFDEPLNGLDVPGIVWFRGLLRKLADDGCAVVVATH
LLAEVVLSADRVLMLDCGRPRVHGPLDNVIPAGDQPRDWLESALLDGARC
A
145224879YP_001135557.1 hypothetical protein Mflv_4300 [Mycobacterium gilvum PYR-GCK]MSVALAVRGARAEMVRTGGRSRLWTVLIPAAVMLPAGITVAIAIAAETFA
RIPGQISVLQVPTSNAAYWVITVTTVVVALAASDGQACENRYHAKEYVRL
SAPRQWPVLTGRWLFYGALGAAAAAVALLTVLVLLPVVSPLVYGSVSVTD
PVALRLLWTVPLLSFFAAGAGIGIGSLIRSPLGAAAVILLWVYAAESAAG
YLPSGAYLQRFMPVLNGVYATGQDAVLIPPWSQNVALLYVCSLFTAIFVI
AAVERTVRHG
145224878YP_001135556.1 type 11 methyltransferase [Mycobacterium gilvum PYR-GCK]MADSPLPLAERSDADLPGHWLLARLGKRVLRPGGLELTTRLLTAARIQGA
DVVELGPGLGRTATDIVAERPRSYVGVDDTAAATEQVRSIVAPVGGKVVV
ADAASTGLPDGSADVVVGEAMLTMQGEKAKRAIIGEAFRVLRPGGRYAIH
ELGLSPDDLSQGIKDDIRRDMSRAIKVNARPLTSAEWTALLTDAGFKIES
VDHAPMALLNPARVLADEGPLGALRIVGNLIRRPAARKRVIGMRKTFQRY
RRSLTAVAVVGVVPGQ
145224877YP_001135555.1 putative transcriptional regulator [Mycobacterium gilvum PYR-GCK]MAVLSSEAGQKPDRAAGRQRRRVLDLLREADGPVDAQGVADLLKIHITTA
RFHLSTLETQGFVRRAGVRKSGAGRPKLTYEPAPRLDYADIVALFATHLG
GTAQEREARAQLIGADLAHRVRLARPRAESSIGDLVVATLTELGFQVRSV
LSSFGEVTVQLCTCPLAEVAQSAPEVVRGIQQGLIQEVIDLNVDVIGGSY
GVSVTPDPRGGSCEVGLVLRPTRVAASEREGV
145224876YP_001135554.1 hypothetical protein Mflv_4297 [Mycobacterium gilvum PYR-GCK]MDVVSLKATAAEQLEAARNAHAGRAAHTVYGGHEHKLRQTAIALLADHRL
DDHESPGEASLLVLHGRVRLSTSSESAELGEGEYLIIPAERHNLAALEDS
VVLLTVVTGI
145224875YP_001135553.1 glyoxalase/bleomycin resistance protein/dioxygenase [Mycobacterium MDQRISLITLGVDDLARAREFYEQGLGWVPKSAPDGVVFYQLPGIAMALF
GRGDLAEDAHHPVDGRFSGITIAINQRTEADVDAVLAQAEASGATILKPA
ERVFWGGYSGYFADPDGHVWEVAMNPQWTINDDGTVSI
145224874YP_001135552.1 WD-40 repeat-containing protein [Mycobacterium gilvum PYR-GCK]MSRIFLSHSSRDTRQAIALKQWLIEQTPPLANEIFLDVDPGSGLRAGTRW
KDALRQANARCEAVICLLSKNWEASHECKVEYRTAENLNKQIFVARLEPS
TGDDLTSEWQRCDLFGEGPTTAIDTGQGDPVEFATAGLYRLRDGIRGAGI
GAASFVWPPPRDPDRAPYRGWEPLDEADAAVFFGRDAQIVRALDTVRGMR
LSGVTSMFVVLGPSGTGKSSFLRAGLLPRLRREDRRFVVMNIVRPERNVL
SGDAGFAAALCATRSEFGLSEPSLGEVKAACLAGDADRVISMLAELRQVA
ADRLLQRGGDGDELVAPTVILPLDQAEELFNAEHAESSERFLDLLRQILD
AANGSDLGLAVAATIRTDRFEIMQTHPRLAGLGTALFDDLKPMPATQFKE
VIVGPAQRSTEGGRPLQIAVDLVDRLLADAGSGADTLPMLALTLARLYTD
YGSTGELTLRQYEGMGGMNRVVQSEIDEVLSRDAVQRTRQLQALRSAFIP
WLATINPDNGQPMRRVARLSDLPQDSRGLIDALVAKRLMVSDVRGGTTVV
EVALESLLRQWSELAGWLRDERKDLRDADDLIRGAAAWRGSNRNPAWLLE
GTRLSEAAALVNRPGFRERLREVHDYLDASHRRQQQERDDEEKRRRGELI
AAQEREQAAQERARYAQEQQLTAERHATTLRKRGRVLRSVLALTAVVAVV
AVAGLAWAVSANSRAAERFRQATSLRLTSDSLAMMRGTRPGGDIQAIQQM
VAARALTSSPDDYALSTIVEQDNNTTKIIPAQGVMAGVSYSPDGSRLAAS
GADGYVRVWDAESGQPVVDPIPDHQGVSEIAFSPDGQALVTADLDGVLRI
FDAGDFSVDHEIDTGTENLSSIAFTSDGSRFATIGNDRVIQVVDTDTGDP
VREFPSGHQGYVSELAFSPDGALLLSGSEDGTLQMWDAEAGTAIGPRIET
GGMVADVAFRPDGRRFVSSGNSVILWDTQTRKPIGDPLQGHVNAVTTVSF
SPDSQVLATGSADATVRVWDADTGAFLWNVMYGHEGRIWGLVYSPDGRHI
ASASSDGTVRIWNPLGSQPLLGHTAAVRDLSYSPDGEFMASAGEDGTVRL
WDPDTHQLLGRPLDAGVPLYALDFSEDSSTLVAGGDGGTVVLWNMGSRQV
AGRYETGRAGAIRTLEFEDKGERLSVLDWDGVASVMDIDGQQVGEEVPDV
EAITLSPAWNLAATSRMSENNVYVLPIGGDSQGSEVTLEGHTNRVGRLVF
NPDGSLLVSASDDTTVRRWNPATGESVGGPLAGHTDEVLDLAFSPDGTRL
VTGSADTTARLWDVATGRQIADPYVGHTEHVTSVAFDPDGGSFATGSRDG
TVRVRSVTASPEMLCAKLTTNMSHKQWDEWVSPDIDYVQACPGLPIAPD
145224873YP_001135551.1 patatin [Mycobacterium gilvum PYR-GCK]MSAKTRDDHLFGAGPKRILALDGGGIRGALTLGYLGRMEDILRDRHGDDP
EFRLCDYFDLIGGTSTGSIIATGLALGFAVDELVDLYRSLGEKVFDKSRL
RLGLFGAKFPKEPLLRALDTHFGDMTLGGDELRTGLMIMTKRLDTGSPWL
LHNNPRGKYFDGDGGSYPNRDLLLRNIVRASTAAPHYFEPETLRIAPGVT
GAFVDGGVSPYNNPALQMLMLATCSGYGLNWRFGAENLMLVSAGTGHRPL
RMTAAQVTDMPAVVLAAQSMLSIMADANWLGQAVLQWLASSPTSWQIDSE
IGDLRDDRLGPGPDLITYQRYEVSLEPNWLRDTLDVHIDDEQCDALYAMD
NPKNLTRLASLGVTAGAVQVQPDHFPPGFDLL
145224872YP_001135550.1 hypothetical protein Mflv_4293 [Mycobacterium gilvum PYR-GCK]MRTASLSSTRTVVIRNVLAMIVAGLTGYLAAVAAWPQVHDLVPEQLRWFG
APNSAVTMGIVVIAYIALAVVLVRAGGGRRGGTPVAIVLILAIATTLLGV
ASYWRCQDETHPDFFTPLLWTAALLKGGDPARSLADGSCPSPMPVALNIA
QLSALAALFTSVAGVALALFRSQFDRLRLRLSRSVTVVVGGDDDASSLVA
AIAHTMGRTGTLVVVVGSAETDYARRARTAGACIVAVDLDDAEHLLAVPV
WDKLDRLYLLAPDPSTNLLRLRAVTARGGDERLRIPLVVRIDDPWQAAAW
RAQHFGGAHNRWAADTVGMYEVTARRLLDRTLTGPRVDRLFVCGSSQLTT
ALCADMLTRRLEAEYLGDDELPVLHVLAPDATQYQRDYAFTATQMGHADR
EADIVAVDEAPSVATLLRLVGEGDAQSTALIFADSTDYGSTATRIAARLP
DTTIHVHDHRADATRERVSVVGRLYTYRLSLDLPGGQAHDAWERAAILIH
RRYVAESGATGPAAEPWEELDEFYRESNRRQVRNALWMVEKIGGHTWNTW
GKPPDGVSTVALRELQPQEQLRQLGFDLTTATAMARAEHEDWCRYYRRHG
WRHGPRRDDRAKVHDKLIDWTQLESDPAMVAAALRSLAATLTKLRELGYR
SHSDASTHWERFRRAGTVIAEQRATAWTWTAHDGSTMHAAAGDWEVREES
GTDSWSVRDDIFRATHRHIGGNRWRRLGTVLARPANDGERIRTLEGTITA
PPGSWIVQGDHGDVWAVPGDEFTRRYALADHNRSNPGGK
145224871YP_001135549.1 hypothetical protein Mflv_4292 [Mycobacterium gilvum PYR-GCK]MHDAGAALGADAAQRLAALGAVTIERGMSDDELDRAETDLGIEFADDHRA
FLAAGLPTGGSWPNWRDEGRRSLTKRLHLPVEGILFAVEWNRFWHDSWGR
RPAQMKHALRTARYQLERVPMLLPICSHHYLPAGRGSFGHPVLSVVRTDV
VVRGADLVDYVTAEFGAGGPVAVDAVATVEFWSTLSGDYRC
145224870YP_001135548.1 geranylgeranyl reductase [Mycobacterium gilvum PYR-GCK]MTQRYDVVIAGGGPSGSAAAWQAAQTGAKVVVLDKAQFPRAKPCGDGLTA
RAVSYLQKMGLADEVATYHRVNRVTVFSPSRWELSFPKRPGMPDHGHTVS
REHLDTVLLKHAESAGAEIRQGAEVAGPEFDASGRVVGVILKSGEKVLGD
AVIAADGAYSPIKRALKIDSEYNGYSAIAIRSEMPANRPDTDSLDIYLKL
LFEGDQLPGYGWVFPMGDGIFNIGLGYVNSYKNWQSINATQFLGEFLRTL
PREWELPPIEELKKNKSVRAWRLPMGFTAWPPWRPGVLFTGDSLGAGKPA
SGAGISKALESGLAAGECAVAALTNGGPDDFTNYALRMEAAWGREYRRGR
IMHKLIGQPKLAEAGVKLIDNAAFRDRMLKALYKKAQGPQHSF
145224869YP_001135547.1 TetR family transcriptional regulator [Mycobacterium gilvum PYR-GCKMRRGSRARAAEETGVKVDARSERWREHRKKVRSEIVDAAFRAIDRLGPEV
SLREIAEEAGTAKPKIYRHFTDKADLFQAIGQRMRDMLWAAIFPSIDIST
DPARTVVFRAVEQYVRLVDEHPNVVRFLMQGRFAEQTESAMRALNEGRDI
TLAMADMFNNELKDMQLDYAAFELAGFATFGAAASATDWWLGAERDSPRR
LPSEKFVDYLTKIMVGSINGTCEVLGVKIDPDVPLHEGVTRREQVA
145224868YP_001135546.1 hypothetical protein Mflv_4289 [Mycobacterium gilvum PYR-GCK]MNTHSTPRAAAAAVTAHPVLPDGDDERFVGFGIMGLPFASGHYLALRQFP
ATTFAPAYTSVWHRDPSCTWTFYATTPGQQSCARYFSSATPNDPVQCDIR
VTWDSEWDVRIEIPDLLRWDVQLENTWATRTMTSLGGRLPQAAWTSKSAL
SLISRVAGPVLGAGDIRLTGTAANGQHYMVAPTTVWAVGASRAIVDGKDL
GPTGPLMRQARLGDFRCPQRGIGVIGSGHFENYDAERHLAAERTVAFG
145224867YP_001135545.1 metal dependent phosphohydrolase [Mycobacterium gilvum PYR-GCK]MAPPAQPPVRTPSRAELLAALSIAIDLGLGQPAEHMLRSAVIATRIADRL
GLDRAERDCTYYTALIMWIGCHADSHEYARWFGDDIAVRRDSYLVDWSGL
PYLRFLMANTGRGQPVLRRLSVLATLLADARGQIAELIHSHCSSAGILAD
RLGLSADVQTVLGYTFERFDGGGLPGGVGGDAIPIPMRVAQLADTAEVHH
RTFGVDGAVAMARSRSGGQFDPRVVDAFLADADAILEPPEDAWSAALREA
PDYGTGLADGELDELLVALGDFVDLKCPFTLGHSRAVAELAAGAAALMGM
DAGGVDLLRRAGHVHDVGRIGVSNQVWSKPSTLTTGEMERVRLHPYLTVR
ILSQVGGLDAVARVAGNHHECLDGSGYPRGLPAAALSVPDRVLAAAVAYR
SAVEPRPYRVALSPAAAATRLRDRVREGHLDELAVDAVLSAAGHAARRVS
ARPGGLTPREIEVLCLVARGASNKEIAATLGISGKTARNHVERTYAKIGA
TNRIGASMFALGHGLITPA
145224866YP_001135544.1 putative monooxygenase [Mycobacterium gilvum PYR-GCK]MTVAESADTTAPPQTPVRTRTLIIGSGFSGLGMAIELQRRGVDFLILEKS
DEIGGTWRDNTYPGCACDIPSHMYSFSFEPKADWSHMWSFQPEIQEYLLG
VTAKYGLRRYIEFGAHVDRAHWDDAEMRWHVFTKDGREFIAQFLVSGAGG
LHIPLIPEFEGYDDFLASGRAAFHSAQWDHSVDIAGKKVAVIGTGASAIQ
IVPEIVEDVAELQLYQRTPAWVMPRPNNPIPEGMQRAFATVPGTRAAMRA
GIYWIHETVGFAMTKQPKLLKIGELLGKWNIRRSVKDPVLRRKLTPDYRA
GCKRILNSDTYYRGIADPRTEVITDRIARFTARGIVTADEHGRETEREAD
VVVFATGFHVTDSYTYVDIKGPGGEDLVDRWNREGISALRGITVAGMPNL
FFLLGPNTALGHNSVVFMIESQIRYAAKAIAAVEKKGVQCLTPTREAQDA
YNDELQDDLRGTVWSTGGCRSWYLDEHGVNRTLWSGMTWQYWLATRRFKE
SEYTFG
145224865YP_001135543.1 ribonucleotide-diphosphate reductase subunit beta [Mycobacterium giMKLIDRVSAINWNRLQDDKDAEVWDRLTGNFWLPEKVPVSNDIPSWNTLT
AHEKQLTMRVFTGLTLLDTIQGTVGAVSLIPDALTPHEEAVYTNIAFMES
VHARSYSNIFSTLCSTSEIDDAFRWSEENPNLQRKAEIVMQYYKGDEPLK
RKVASTLLESFLFYSGFYLPMYWSSRAKLTNTADMIRLIIRDEAVHGYYI
GYKFQKGLALADDATRQELKDYTYELLFELYDNEVEYTQDLYDEVGLTED
VKKFLRYNANKALMNLGYEALFPRDETDVNPAILSALSPNADENHDFFSG
SGSSYVIGKAVITEDEDWDF
145224864YP_001135542.1 hypothetical protein Mflv_4285 [Mycobacterium gilvum PYR-GCK]MGQPRECHPGNHSAKTIRAGTASKKTLIVALSAFAVGCAGMASVPAASAS
ESGYWPLCGAFSLFSEGQCDAIKYYLSTDDPACRPDGTQPSPVPPQRWTA
Q
145224863YP_001135541.1 hypothetical protein Mflv_4284 [Mycobacterium gilvum PYR-GCK]MRVIARWFRRAIHGSGIGMNRLRKYASGVALFGFIAMAATPTAIAQTPGE
AFCAENQRLLDASNGEMPFEIDAAVAWLTQQFNMSETEAVRLIDNVGETH
WSGLNGRWEVTCHGQ
145224862YP_001135540.1 transposase- mutator type [Mycobacterium gilvum PYR-GCK]MVGIGRSAKNSYSKGTTMKKSNQIQSVDVSASAVPERVSVAMSEIAENMS
EGLLALAVGAGLQVMAALMEADVTALAGPKGRHDQARTAVRHGRERGSVT
LGGRRVPVTRPRVRAADGTGELAVASYELFSSTEILGRLAMEKMLAGLST
RRYPVGLEPVGVQITEKATATSKSAVSRRFVAMTETALAELLSRDLSGLD
LVALMIDGVHFAESCCVVALGIDIEGTKHPLALVEGSTENATLVTELLVD
LRERGLDVTRAMLVGLDGSKALRKAVLDVLDHPVIQRCQLHKVRNVKDHL
PQRLRTTVGCRMTDAYHAGSALEAEAALLALAKELDRTHPSAAASLREGL
DETLTVLRLGVPPTLARTLRSTNCIESMISVCREHAGNVKRWRDGQMALR
WCAAGMVEAGKQFRRVNGHLHLPALRAALEREVAEHVVPVVHNDQVSAA
145224861YP_001135539.1 cytochrome P450 [Mycobacterium gilvum PYR-GCK]MSTAAPSVFEADLPTFTYGFAATPHDIFDDVREAQSRAPIALGPLGPEIL
SYELARDMLRDNRFRLPPGITLAAQGITSGPLYDKITGSLLGLNGPPHVR
LRKLVSKAFTPRATARLQDTIHEVVNGLVDRVLDAGRCDVVTDIARPYPT
PIICALLGAPREDWPLFADWTEEVFKAFNFQPELTFDEAQIMRAWGELDA
YVDDMVAARRSNLTDDLLSELIRAESDGDRLNLDELRGLVAGFLMAGTDT
TRNQLAASVQVLLEHPDQWTKLRDHPELAMQAVEESMRHSPAASIVPRAA
TEDAEFGGYMFPAGTFILVNTFVANRDPAIYHDADRFDITRTDLPPILTF
GGGAHYCLGANLARRELAEALVVLTRRLAPPRRIGPAPWKSLLGMTGPTT
LPIEVTSEQPVTANA
145224860YP_001135538.1 TetR family transcriptional regulator [Mycobacterium gilvum PYR-GCKMRSRGWAGSTPASDEEAIARILDAVDDVVAERGPAMRLADVARRLGVTRQ
TVYRYFPNADALLIASAMRTADGFIDQVAAHAAGIPDPVTALVECVSFGV
QNLTGDPQLEGLLTPRHEGDAVISLTSDAAMTFCLSIFRRLDVDWALHGF
DDTALTELAEMTLRTVHSILVDPGEPPRDESELRRFVTRWLGPAILYPRI
TVLAGARR
145224859YP_001135537.1 hypothetical protein Mflv_4280 [Mycobacterium gilvum PYR-GCK]MSVTVTSMLHSILDWLRAGYPSGVPGPDRVPLLALLRATPLTEDQIKEVI
AHLTEPGAAATEDGVIDADEIAAFIKDVTQHDAGPENIARVAAKLAAAGW
PLTGVDPGATTAD
145224858YP_001135536.1 alcohol dehydrogenase [Mycobacterium gilvum PYR-GCK]MSTVSAYAATSATEPLTKTTITRREVGPHDVAFDIHFAGICHSDVHTVRA
EWGQPAYPVVPGHEIAGIVTEVGPEVTRYKVGDRVGVGCFVDSCRECEEC
RAGEQQYCTGGGMVGTYNGVGRDGEPTQGGYSGAIVVDENYVLRIPDSIS
LDKAAPLLCAGITTYSPLHHWNAGPGKKIAVIGLGGLGHLAVKIAVAMGA
EVTVLSQSLKKMEDGLRLGATDYRATSDRDTFKDLKGTFDLIINTVSANL
DLSDYLKLLKLDGTLVELGMPEHPMEVPAGALIFGRRSIAGSLIGGIAET
QEMLDFCAEHDVTPEIEVVAPDYINEAYERMLASDVRYRFVIDTASLR
145224857YP_001135535.1 periplasmic binding protein [Mycobacterium gilvum PYR-GCK]MAGHAARRTLTCRDAGECYGLRVLFTGAQAGRRVARSTGLAAVGTAVVVF
AAAGCGASGGDGAPEGARSPVETTVTRIAGAGVLGNDRRPDESCAPEPAR
LDDGPPDREVRNADAHGVTPPIPEVTTVRADPQRIVVLSGDQLDALCALG
LQSRIVAAALPDGSDVQPSYLGQLIHDLPGAGTRSDPDLEAIRGAEPDLI
LGSVALTPEEHLELSEIAPTVFEGPAGAAWKDNLRTVGAATGRAAAADAL
IEDFDQAADRTGIDNDATHFQASVVQFTDTTMRVFGVDSFAGSVLADVGV
DRPATQRFTDKPYVEVGITDEDLGDSPDLSLADGDLIYVSFATAQARDRA
PKVLESDAWRRLSATRDDRVFAVNNEVWQGDQGPNGIVAARGILADLRWV
NSPIN
145224856YP_001135534.1 cytochrome-c oxidase [Mycobacterium gilvum PYR-GCK]MVAEAPPIGELEARRPFPERIGPKGNLIYKLITTTDHKLIGIMYCVACFA
FFLIGGLMALFMRTELALPGLQFLSNEQFNQLFTMHGTVMLLFYATPIVF
GFANLVLPLQIGAPDVAFPRLNAFSFWLFLFGALIATAGFITPGGAADFG
WTAYSPLTDAIHSPGAGADLWIMGLAVGGLGTILGGVNMITTVVCMRAPG
MTMFRMPIFTWNILVTSILVLLAFPILTAALFGLAADRHLGAHVYDPANG
GVLLWQHLFWFFGHPEVYIIALPFFGIVSEIFPVFSRKPIFGYTTLIYAT
LGIAALSVAVWAHHMYATGAVLLPFFSFMTFLIAVPTGIKFFNWIGTMWK
GQLTFETPMLFSVGFILTFLLGGLSGVLLASPPLDFHVTDSYFVIAHFHY
VLFGTIVFATYAGIYFWFPKMTGRLLDERLGKLHFWLTFIGFHTTFLVQH
WLGDEGMPRRYADYLPSDGFTTLNIVSTIGAFILGLSTLPFLWNVFKSWR
YGEVVTVDDPWGYGNSLEWATSCPPPRHNFTELPRIRSERPAFELHYPHM
IDRMRREAHVGRAHGPEDGDVTRNEENVRT
145224855YP_001135533.1 phosphoserine phosphatase SerB [Mycobacterium gilvum PYR-GCK]MVDLSGSSVLITVTGRDQPGVTSALFEVLSRYGVTLLNVEQVVIRNRLTL
GVLVAAAPDVAAGAQFREDVEAAIHGVGLEVTIEGSNGLPVMQVPSTHTI
VVLGRPITAEAFGVVAREVAELGVNIDFIRGVSDYPVTGLELRVSVPNGV
YGDLQRVLARLSAEEAVDIAVEDYSLARRAKRLIVFDVDSTLIQGEVIEM
LAAHAGAEAAVAEVTEAAMRGELDFAESLHRRVATLAGLPAEVVDEVAAK
LELTPGARTTIRTLRRLGYHCGVVSGGFRQVIQPLADDLMLDYVAANHLE
IVDGKLTGRVIGPVIDRAAKAKALRDFAAQVGVPMQQTVAVGDGANDIDM
LSAAGLGVAFNAKPALREVADASLNHPYLDTVLFILGITRGEIEAADALD
GVVRRVDIPD
145224854YP_001135532.1 GntR family transcriptional regulator [Mycobacterium gilvum PYR-GCKMTEALATRSLNVDLLARELGNWRTSSRSGPAYHGLADAIRLLIVDGRLPV
GARIPSERALSEALRVSRTTVTAAYTQLREDGYLNARRGARSTTALPLTP
TPALRPVTATANLAAATLAAPASVTARAFTEAADMVAPYLQEIGIELTGV
PPLRAAIAERYCARGLPTDVDEIMVTTGALHAISLILATYTQPDDRVLVE
QPTYHGALAAMASRGLRPVPVAMAPDGWELDAVEAAIRQLAPELAYLIPD
NQNPTGMTMPVGDRARLARIISETKTRTIIDETITDMWLDEQVPPPLATE
VTSRPDLVMTVGSMSKSFWGGLRIGWIRAERSTLATIATLRPAIDMGTPI
VEQLAAARLLAADEEVLPERRDILRSRRALLLRLLAEHLPDWQPVPGKGG
MSVWVRLPAPMSSALSAAASRMGLEIPPGPRFGVDGTLERFIRVPYTLPD
AQLVEAIELLARAWRSVTGLTAPEPATVVV
145224853YP_001135531.1 hypothetical protein Mflv_4274 [Mycobacterium gilvum PYR-GCK]MPDWLLKGKPLRPEDGQHDPLDISLGPAAGRSVLLTVPGRHARRARRRRP
PCAQRTRRYPDALSGPRVRLRRGAIRGAALLIGLCGYGLSMAMMVRAGLG
LDPWDVFHQGLALRTGMTIGTASALVGVAVLVAWIPLRNRPGIGTVANVI
VIAVAVDVALWLMPAPTSLPVRVAMMVAAVVLNAVSTVLYIGAGLGPGPR
DGLMTGLVVRTGRSVRLVRSAIEVSVLTVGWLLGGTVGVGTVLYAFGIGP
LVQLFVQWTPDRVLAVSGWAGVDSPRRDVEDDRNGQPAGIGVAGG
145224852YP_001135530.1 putative fructose transport system kinase [Mycobacterium gilvum PYRMDNPPGSESLAAEAVGLGDGTHRAVLGIAGSPGAGKSTLVELLAARIRQM
RGPGWVAHVPMDGFHLADAQLRRLGLLDRKGAPETFDAVGYAHALHRIRT
DVDSDVYVPGFDRDLEQPLAAALVVPASARLVLTEGNYLLLDQPAWRRVR
RSLDQTWFVSADDSLRVERLIARHVEFGKTAAAARAWADTVDEANAALVT
STAASADRIVVNGTRGWSFGACLR
145224851YP_001135529.1 ABC transporter-like protein [Mycobacterium gilvum PYR-GCK]MPVEEVEAADPDLLIDFAEVTLRRNGRVLVGPVTWAVELDERWVVIGPNG
AGKTSLLRMAAAMEHPSSGTAYVLGERLGRVDMSELRSRVGLSSAALSQR
IPDDETVRDLVVSAGYAVLGRWREKYDDIDYVQAIDMLESVGAEHLADRT
YGTLSEGERKRVLIARALMTDPELLLLDEPAAGLDLGGREELVARMSDLA
ADPDAPALVLVTHHVEEIPPGFTHCLILSEGAVVDSGLLTDVLTAENLST
AFGQSIALDVIDGRYFARRVRSRAAHRRRQ
145224850YP_001135528.1 NUDIX hydrolase [Mycobacterium gilvum PYR-GCK]MSELKTTTEPDPLVPRPAATVMLVRDTPEGIKIFLMRRHSAMDFVAGVMV
FPGGGVDDRDRNADVAWHGPDRHWWAGRLGVDAELAEALVCAAARETFEE
SGVLFAGAADDPDLLVDDASVYRDQRAALENKSLSFGEFLRSEKLMLRAD
LLRPWANWVTPKEERTRRYDTYFFVGALPQGQRADGDNTETDKADWVTPQ
AALDDFAEGRSFLLPPTWTQLDALNGRTVAEVLAVERKIVAVEPSLAATK
GGNWEIEFFDGDRYNAARNRRAPQGYTDGAPLA
145224849YP_001135527.1 enoyl-CoA hydratase [Mycobacterium gilvum PYR-GCK]MREFVTVAVSGEGAVPDDGERRIATLLLSRPPTNALTRQMNREIADAVAE
VGGRDDICAVIVFGGHEMFSVGADVPELKTLDADEAGTADAVAAQAVAAL
AALPKPTVAAITGYALGAGLTLALAADWRVSGDNVKFGATEILAGLAPAG
DGAGRLAEAVGPSRAKDLVFSGRFVDAREAHTLGLVDELVAPDGVYDAAL
AWAGRFREHPPEVLAAAKAAFSAPRSVAGP
145224848YP_001135526.1 type 11 methyltransferase [Mycobacterium gilvum PYR-GCK]MTETKEPGAYPDVAVPAPTPHATKEQVEAALHDTKLAQVLYHDWEAETYD
DKWSISYDQRCVDYARGRFDAAVPEEVQRELPYDRALELGCGTGFFLLNL
IQAGVARRGSVTDLSPGMVKVATRNGQSLGLDIDGRVADAEGIPYEDNTF
DLVVGHAVLHHIPDVELSLREVVRVLKPGGRFVFAGEPTTVGNRYARELS
TLTWHAATNIMKLPMLSDWRRPQAELDESSRAAALEAVVDLHTFDPADLE
RMAANAGAVEVRTASEEFTAAMLGWPVRTFEAAVPPGRLGWGWAKFAFGS
WTTLSWVDANVWRRIVPKGWFYNVMVTGVKPS
145224847YP_001135525.1 hypothetical protein Mflv_4268 [Mycobacterium gilvum PYR-GCK]MSEVARYDLTESSLISDIASARKRFGDRTAVLVETVKLRRKAAVKFVDAG
EWLFTDDALQQATAAPVAAHRARRLAGAIVHDATCSVGTELAALRNSAAL
VLGSDIDPVRVAMASHNLGLRGPGVALCRADALRPVSEGAVVLVDPARRS
GSRRRFDPRAYLPPLDTLLDVLRERDYVVKCAPGIDFAVVGELGFRGEIE
LVSLGGSVREACLWSSGFAADGVRRRATMLDTGEQVTDTDPGQCPVAPAG
RWIVDPDGAVVRAGLVRHYAARHGLWQLDPDIAYLSGDRLPDGVRGFEVL
DQVAFSERHLRQALSALDAGALEILVRGLDVDPDALRARLRPRGAAQISV
VVTRIGSGAASRATAFLCRPSR
145224846YP_001135524.1 immunogenic protein MPB64/MPT64 [Mycobacterium gilvum PYR-GCK]MRFLAAALTAAAVSASLAAGPAALAQPAPPATPSACVALSGTVDTDDMCL
VQVENPTYRLDYSFPADYPDQQALTAYLTQTRDGFVNVAGMPGSWNLPYV
LDGRGTGYRTGPDDGGTRSVVFEMYENVGGAHPQTWFKSFNWDVAKKAPI
TFDTLFKPGSEPLAVIFPIVRSDISRQLGIEAPITTADGLDPAKYTEFAI
TDDAVIFYFGQGEIMAGAGGALQATIPRSEIASMLALEPVPVTP
145224845YP_001135523.1 amino acid carrier protein [Mycobacterium gilvum PYR-GCK]MSEFLSTLNDLVWHETLVYLCLAAGVYFSARSRFVQVRQIPEMIRLMMRG
EKSPSGVSSFQALTMSLAGRVGTGNIAGVATAIAFGGPGALFWMWMVAFL
GASTSFVECTLGQIYKDRDKLTGEYRGGPAYYLSTALSHTAAAGAMKVYG
YVFAAVTLLAMGLLLPSVQSNSMASAMNSAWGFSKWWVAVGTVIVLAFVI
IGGVKRIATFASVVVPFMAVVYIVLALIIVLTNASEIPAIISLIFSSAFG
LDSAFGAIIGAAVMWGVKRGIYSNEAGQGTGPHAAAAAEVSHPAKQGLVQ
AFAVYIDTLFICSATGFLILSTGAYRVFEGESADGAVISEGGDFLASDAE
VGPAFAQAGFDTLWSGAGSSFIAISLAFFCFTTIVAYYYMAETNLRFMLG
RFATIDVRFLPGSVGTTMTMLLQALILVSVTLGAVSTASEAWTLGDIGVG
LMAWLNIIGILILQRPAYKALWDYERQKKAGLDPTFDPIALDIRNATFWE
NYDPVTGRDKRPTITRA
145224844YP_001135522.1 Pyrrolo-quinoline quinone [Mycobacterium gilvum PYR-GCK]MLRRIIVVAWTTLVAGVLAGCGTTDSWVASRAASGWSAQYADAANSSSTP
TRGADTLQLEWGRSVKGSLAAQAALGSGNYLAVNAQTEGGCSLMVWEVDN
RARQRWCTRLVQGGGIASPLFDGFDNLYIGQPGLLQSFPTTQWVRWRKPV
IGLPLTARLVAPGRVLAVTHLGQVLVFDAHRGTVTGNSLDLVAGLDPRDS
ERGLADCRQARPECPIAAAPAYSDSNGMVVLTLWEPGADKPVLVGLRYQQ
GQTPQLTREWTSDAVGGGPLASPVLSHDGATVYVNGRDERLWAINTADGS
EKWSVPLGYLAQTPPSVTPDGLVIAGGGPGSRLVAIRDTADDGEELWTRE
EVAPLTTSSLAGLGYAVVRDGDGESAGLALRVFTLGDGTTVNTYPLPNAS
GWPVGVSIGHDGRVVTATSDGQVYGFAPA
145224843YP_001135521.1 hypothetical protein Mflv_4264 [Mycobacterium gilvum PYR-GCK]MHGRGPPARGPGEPADPGGVGDGRVGFSAMTTMWGAPLHKRWRGSRLRDP
RQARFLTLASLKWVLKNRAFTPWYLVRYFRLLKFKLANPHIITRGMVFLG
KDVEIQATPELSQMEIGRWVHIGDKNTIRCHEGSLRIGDKVVLGRDNVIN
TYLDIELGDSVLMADWCYICDFDHRMDSIELPIKDQGIVKGPVRIGPDTW
VGVKVSVLRNTSIGRGCVLGSHAVVRGDIPDYSIAVGAPAKVVKNRKLSW
ETSAAERAELAAALADIERKKAAR
145224842YP_001135520.1 glucose-6-phosphate 1-dehydrogenase [Mycobacterium gilvum PYR-GCK]MSSRKLQTISYPASGAHPYRRDEPPLAPFVIVLFGATGDLAKRKLLPGMA
YLDQSELAPHIQVVGTSLEDLTDDEFRALAREAVDAHGTHKLTDEQWENF
AKILTYVPQSAGPDALAAAVSEAESRLLAGYGSSDAGEVQRLHYLSVPPD
AARAVITMLSEADLVRRSRVVMEKPFGTDLESAVGLNKFVHETFKERHIF
RIDHFLGKEAAQNILAFRFANGLFEPIWNRNFIDHIQIDIPETLGLDERA
GFYESTGAYKDMVVTHLFQVMAFVVMEPPTALEPRAISEEKNKVFRSMLP
IDCSTVVRGQFSGYRELDGVARDSDTETFIALKVGIDNWRWAGVPIYLRT
GKRMAEGQRIISIAFKEAPRTMFPAGSGVGSQGPDHLTFDLADASKVSLS
FYGKRPGPGMKLEKMSMQFSTQETEQSNDVLEAYERLILDAMRGDHTLFT
TAEGIESLWERSTDLLVDPPAVKMYQPGTWGPNSIHQLIGPNAWRLPFER
EWRELRD
145224841YP_001135519.1 group 1 glycosyl transferase [Mycobacterium gilvum PYR-GCK]MKMKILLVSWEYPPVVIGGLGRHVHHLATELVAAGHEVVVLSRRPTGTDP
QTHPTTDETHEGVRVIAAAEDPHEFGFGTDMMAWVLAMGHSMIRAGFGLD
GWRPDIVHAHDWLVAHPAVALAQFFDVPLVSTIHATEAGRHSGWVSGSVS
RQVHALESWLVRDSDSLITCSASMRDEISALFGPELAEISVIPNGIDTDG
WPFAARRAHSGPAELLYFGRLEYEKGVHDAIAALPKVRRTHPGTTLTIAG
DGTQLGFLTEQARRHKVLKATKFVGRVDHSQLLTLLHRADVAVLPSHYEP
FGIVALEAAATGTPLVTSTAGGLGEAVIDGVTGMSYPPSDVIALAAAIRA
VLDAPAAAQERATAARARLTSDFAWHTVAAETAQVYLAAKRAERRPQPRR
TIVERPLPDR
145224840YP_001135518.1 glycoside hydrolase family protein [Mycobacterium gilvum PYR-GCK]MSHADVVSGDENSSVPGLFTLVLHTHLPWLAHHGRWPVGEEWLYQSWSAA
YLPLIRVLRTLAAENRRHLITLGITPVVAAQLDDPYCLQGMNHWLANWQL
RALEASTTRSSEPGAPPASQPQALRQFGVREYDEAERELGEFDALWRHGA
SPVFRELLDSQTIELLGGPLAHPFQPLLNPRLREFALREGLADAHARFAH
RPSGIWAPECAYAPGMEIGYDDAGVTHFMVDGPSLRGDTSLGRPVGGSDV
VAFGRDLQVSYRVWSPKSGYPGHSAYRDFHTYDHATGLKPARVTGRNVPS
DAKAPYDPARADAAVDVHVADFVDTVRRRLASESERIGRPAHVVAAFDTE
LFGHWWYEGPVWLERVLRALPAAGVRVGTLSDAIAEGYVGAPVDLPPSSW
GSGKDWQVWSGDQVADLVQLNSEVVDAALSTVDKALAHGAALGSPTPRDF
VADQILRETLLTVSSDWPFMVSKDSAADYARYRAHLHAHATREISDALAS
GRREHAQQLADGWNRADGLFGALDARRLPAP
145224839YP_001135517.1 type 11 methyltransferase [Mycobacterium gilvum PYR-GCK]MSASVTNGDPGLPLTGERTIPGLAEENYWFRRHEVVYRRLVERCRDRDVL
EAGSGEGYGADLIAEVARSVIGLDYDESAVAHVRARYPRVDMRHGNLAEL
PLESGSVDVVVNFQVIEHLWDQGQFVAECARVLRPGGVLLMSTPNRITFS
PGLDAPVNPFHTRELDAAELTELIESAGFAMETMLGVFHGPPLVELDARH
GGSIIEAQIARAVADAPWPPDLLADVESVTIDHFDLTAGSDTTPGRHIDD
SLDLVAIAVRP
145224838YP_001135516.1 electron transfer flavoprotein subunit beta [Mycobacterium gilvum PMTNIVVLIKQVPDTWSERKLSEGDWTLDREAADAVLDEINERAVEEALLI
KEREGGDSTVTVLTAGPERATEAIRKALSMGADKAVHLLDDGLHGSDMVQ
TGWALARALGTIEGTELVIAGNEATDGTGGAVPAIIAEYLGLPQLTHVRK
LSVENGKVTGERETDDGLFTLEASLPAVVSVNEKINEPRFPSFKGIMAAK
KKEVTTLTLAEIGVEADEVGVANAGSKVLSSTPKPPKTAGEKVTDEGEGG
KKVAEYLVAQKII
145224837YP_001135515.1 electron transfer flavoprotein subunit alpha [Mycobacterium gilvum MAEVLVLVEHAEGALKKVTAELITAAKKLGEPSAVVVGKPGTSEGLVDGL
KSAGAAKIYVAESDDAENYLITPYVDVLAALAESATSAGVVLAASADGKE
IAGRLAARIGSGILSDVVEVKEGGAGVHSIFGGAYTVEAEAVGDTPVITV
RPGAIEAEPSDGAGEVVNVEVPAPAENATKITSREPAVAGDRPELTEASV
VVAGGRGVGSADNFTIVEELADSLGAAVGASRAAVDSGYYPGQFQVGQTG
KTVSPQLYIALGISGAIQHRAGMQTSKTIIAVNKDEEAPIFEIADLGIVG
DLFKVTPQLTEAVKARKG
145224836YP_001135514.1 hypothetical protein Mflv_4257 [Mycobacterium gilvum PYR-GCK]MNASSVLIPSDHSVTAGSVPRYSMLLCTDPASIEAAQRLRYDVFTSEPGY
TLNRGTLHRSAAPDGLDADRFDEFCDHLLVRDDDTGQLVGCYRMLPPPGA
IAAGGLYTATEFDISALDALRPSLVEMGRAVVRDGHRNGAVVLLMWTGIL
AYLDRSGYDYVTGCVSVPVADPDGLTPPGSRLRGVRDLVRRRNAAPPEYT
VRPYRPVVIDGHHLDDIAAPPRVKVPALLRGYLRLGAQVCGEPAHDPDFG
VGDFPALLDKRRADVRYLTRLRSAAAAAADVTR
145224835YP_001135513.1 phospholipid/glycerol acyltransferase [Mycobacterium gilvum PYR-GCKMTVTDGHAWLQAATCGAGCVDAGADGPGRRWVVALRTGVRVSAALTLVTG
VWLLALPLPGRSHLQRGYCRLMLRSLGVRMSVAGGPVRNLRGVLVVSGHV
SWLDVFAIGTVLPGSFVARADLVTWPALGPVVRLMKVIPIDRARLRRLPT
VVASIADRLRAGQTVVAFPEGTTWCGLGYGRFRPAMFQAAVDAGRPVQPL
RVSYRHRDGRPSTVPAFVGDDSLLDSITRVITARRTVCHISVESLQLPGR
DRRELAARCESAVRGHSAPVPRATAAACGGGHALVA
145224834YP_001135512.1 class V aminotransferase [Mycobacterium gilvum PYR-GCK]MRWSRERDRGARPRGRYPGTAMSASAAAPRPVYLDHAATTPMRPAAIEAM
TAALATVGNASSLHGSGRTARRRLEESRETLAQLLGARPSEVIFTAGGTE
SDNLAVKGIYWARRDAEPQRRRIVTTPVEHHAVLDAVQWLADHEGAEVTW
LPVDQYGAVNPADLRVALSETADVALVSVMWANNEVGTIQPIAELAAIAT
EFGVPMHSDAIQAIGQLPVDFGASGLSAMSVAAHKFGGPAGVGALLLRRD
TACVPQLHGGGQERDVRSGTQDVAGVIGMAVAARDAADTMEPVIARVRDL
RDRLVAGVLESIDDVDVNGAPGPGRLPGNAHFTFRGCEGDSLLMLLDAKG
IECSTGSACTAGVAQPSHVLTAMGVDPASARGSLRLSLGHTSTEADIEAV
LEVLPAAVDRARQAALASSGRH
145224833YP_001135511.1 tRNA-specific 2-thiouridylase MnmA [Mycobacterium gilvum PYR-GCK]MRVLVAMSGGVDSSVAAARMVAAGHDVVGVHLALSSAPGTLRTGSRGCCS
KEDAGDARRVADVLGIPFYVWDFADRFKEDVIDDFVESYARGETPNPCVR
CNERIKFSALASRALALGFDALATGHYARLADGRLRRAVDHDKDQSYVLA
VLTAEQLRHAVFPIGDTPKAQIREEAARLGLAVADKADSHDICFIPSGDT
KAFLGARIGVRRGNVVDAAGTVLAEHDGVHGFTIGQRKGLGIPGPGPDGS
PRYVTGIDAQTGTVHVGDVADLEVTSLQGDAPVFTSGVAPTGPLECVVQV
RAHGGVADAVAELRGDTLEVSLRTPLRGVAPGQTLVLYRRDPAGDEVLAS
ATIRATH
145224832YP_001135510.1 LpqA [Mycobacterium gilvum PYR-GCK]MTGRAWAPLLCATAIMAVGCTQIVGGDAVRTVRAIDEDSRSPVDVDTVLL
ESAQMQAVTGAGRDLTAIPGTESKVPVDVPVDMALPRMAKDLPPQCGWVF
AETQVFGSEVEEFRKTSYQNPPRGGLISQAAAGYRDAATAQRAFAAIVEQ
IEGCGTTDSGAAMVGMVTTTPDSVQTRPGNCGRDYRVKSVVLVEVTFCAF
PDSVPEIVMTNILANVPDR
145224831YP_001135509.1 methionine synthase- vitamin-B12 independent [Mycobacterium gilvum MSVFATATGVGSWPGTSAKEAAEVVVGELHRLPHLVELPARGLGADMIGR
AGGLLVDIWIDTVPRGYRIASGRSSVTRRAVSLLEEDLDALEEAWEKAGL
RGGGRAVKVQAPGPVTLAAQLELPGGHRAITDPGAVRDLTASLAEGVAAH
RAALARRLESPVVVQFDEPTLPAALAGRLTGVTSLSPVHPVDDAVATALL
DDCVQTVGGDVVVHCCASGVPWKLLQRSAVHAVSVDVDTLSADDLDGVGE
FVDSGRTVVLGAVPTAAPAARPSAEQIAATVAAVTDRLGFARAVLRDRVG
ITPACGLAGATTAWARSAIELAQRAADGLADDPEAF
145224830YP_001135508.1 PAS/PAC sensor-containing diguanylate cyclase [Mycobacterium gilvumMNVTGWCSLSGKIPGRGPSPGDAKDDEVARLLALESFDILDTPPEESFDG
LTALAAYVCDVPMALIGFLDAERQWLKSRQGVGHSEIARELSFCASTMGD
GDTLIEIPDTRLDSRLAGHPMVTGDPHLRFYAGMPIRTAEGHALGTICVM
DVEPRTLSDAQRSHLRTLADQVMNLLDLRRRARQYAVEMTRRLEIDEALR
QQQRLLSGVLDHTDVLVYTKDVEGRFVMANNAVQHVTQADRSMIGATDYD
FFDATVADSYRRNDRRIMETREWQVFSEDVVHPDGSVHTYRSTKFPLISD
SGEVLGVGGLSTDVTELAAARAAHEAAEERWRALVEQSPAPVIVVDAEGA
LAYVNPEGLALLGVARGADVSLLPAEDFIPPQLRRATQKLLDETMAGTRV
VRGERGVLRRRDGTEITVEINATVVSHSGERSVQLEIRDVSEVAAAHAAL
EHSASTDPLTGVLNRKAWDARVATLLPEVSDTSPMTIAVIDLDNFKTYND
TRGHTAGDALLQQFAGAAAACLGADDVFARWGGEEFIVALPGADPDRAEP
ILDRLRGHVPSEQTCSIGYTGHVPPEALTDTVIRADKALYQAKRRGKNRI
ARL
145224829YP_001135507.1 AMP-dependent synthetase and ligase [Mycobacterium gilvum PYR-GCK]MTFSSPFPEVDIPTASVYDYLFSGLSDPDDPVLDRVALIDAKSGRQTTYR
EMVARIDSFAGALAARGVGVGDVVGLLAPNSSAFAVAFHGILRAGATATT
INALFTAKDIAKQLTDSRARTLITVTPLLAQAREGAALAGLSDEDVIVLD
GPGRDGSGDGAGHPNAADILAPGTPAPQVNFAPSSHLAVLPYSSGTTGNP
KGVMLTHRNLVANVAQIRPLHGMEPDDVVLAVLPFFHIYGMTVLLNAALH
ARARLVIMPSFDLGDFLGNIAEHRCTIAFIAPPVAVALAKHPLVDDHDLS
SLQVVMSGAAPLDADLGHAVAKRLDCKVVQGYGMSELSPVSHITPFDGGR
LNMHDDAPLASVGWTVSNAASKLVDPETGAEIEIPDEGLSKTGELWFKGP
NVMAGYLNNEEATKETIDEDGWLHTGDLAQIDDRGLVYIVDRLKELIKYK
GYQVPPAELEAVLLSHPDIADAAVVGVRDEEGEEVPKAFVVTQANSELTE
TDVIEFVAGQVAPYKKVRKVEFIDAIPKSASGKILRKDLRTG
145224828YP_001135506.1 phosphoribosylglycinamide formyltransferase protein [Mycobacterium MAHPIMFRDDDMGLAEVREIALGFPAATEKISWGRPVFCAPKMFAIYGGS
VKGADKGAYVQYPHSVLVKVEESERRALEQDRRFFFPAYLGPFGWLGLDL
TAAAAVDWTEITELIDASYRMVAAKKLIRQLGER
145224827YP_001135505.1 NAD-dependent DNA ligase LigA [Mycobacterium gilvum PYR-GCK]MSPEAIPDPESMLAEQAHDALDPDLRRSWQELADEVREHQFRYYIRDAPI
ITDAEFDQLLRRLQALEDEYPELRTPDSPTQLVGGAGFATDFTAAEHLER
MLSLDNVFDLEELAAWAARIRTEIGADAQYLCELKIDGVALALVYRDGRL
ERAATRGDGRTGEDVTLNARTIEDIPERLSGTNEFPLPTVVEVRGEVFFR
VADFEDLNAGLVAEGKPPFANPRNSAAGSLRQKNPAVTARRRLRMICHGL
GHVESSGGSPFPTLHDAYRALKAWGLPVSDHTAQVTGLDAVTERIAYWGE
HRHDVEHEIDGVVVKVDAVALQRRLGATSRAPRWAVAYKYPPEEAQTRLL
DIRVNVGRTGRVTPFAYMEPVKVAGSTVGLATLHNASEVKRKGVLIGDTV
VIRKAGDVIPEVLGPVVDLRDGSEREFVFPTHCPECGSELAPAKEGDADI
RCPNTRSCPAQLRERVFHVAGRGAFDIEGLGYEAATALLQAGVIADEGDL
FGLTADDLLRTELFTTKAGELSANGKRLLANLGKAKAQPLWRVLVALSIR
HVGPTAARALATEFGSLEAIETASEEQLAGTEGVGPTIAAAVIDWFTVDW
HRAIVDKWREAGVRMADERDASIERTLEGLSIVVTGSLAGFSRDEAKEAI
IARGGKAAGSVSKKTAYVVAGDAPGSKYDKAIELGVPVLDEDGFRRLLAE
GPERDAEDGEPG
145224826YP_001135504.1 amino acid-binding ACT domain-containing protein [Mycobacterium gilMLPVPSYLLRVELEDRPGSLGSLAVALGSVGADILSLDVVERAAGYAIDD
LVVELPPGAMPDMLITAAENLNGVYVDSIRPHTGLLDAHRELELIDHVAA
ADGKLQRLQVLVDEAPKVLRVGWCTVVTLTDSGPQRLVGSSGAPETQAAE
TPWLPLARAEALDASAQWVPQVWRDMDTTLAAAPLSDPSTAVVLGRPGGP
AFRPSEVARLGYLAGIVTTIIG
145224825YP_001135503.1 aspartyl/glutamyl-tRNA amidotransferase subunit A [Mycobacterium giMSELIKLDAATLADKISSKEVSSAEVTQAFLDQIAATDGDYHAFLHVGAE
QALAAAQTVDRAVAAGEHLPSPLAGVPLALKDVFTTTDMPTTCGSKVLEG
WTSPYDATVTAKLRSAGIPILGKTNMDEFAMGSSTENSAYGPTRNPWDTE
RVPGGSGGGSAAALAAFQAPLAIGTDTGGSIRQPAALTATVGVKPTYGTV
SRYGLVACASSLDQGGPCARTVLDTALLHQVIAGHDPLDSTSVEAPVPDV
VAAARTGAGGDLTGVRIGVVKQLRSGEGYQAGVLASFNAAVDQLTALGAE
VTEVDCPHFDYSLPAYYLILPSEVSSNLAKFDGMRYGLRAGDDGTHSAEE
VMALTRAAGFGPEVKRRIMIGAYALSAGYYDAYYNQAQKVRTLIARDLDA
AYQKVDVLVSPATPTTAFRLGEKVDDPLSMYLFDLCTLPLNLAGHCGMSV
PSGLSADDNLPVGLQIMAPALADDRLYRVGAAYEAARGPLPTAL
145224824YP_001135502.1 6-phosphofructokinase [Mycobacterium gilvum PYR-GCK]MRIGVLTGGGDCPGLNAVIRAVVRTCDARYGSSVVGFLDGWRGLLEDRRV
QLKNDDRNDRLLAKGGTMLGTARTNPDKLRAGLDQIKQTLEDNGIDVLIP
IGGEGTLTAAHWLSEEGVPVVGVPKTIDNDIDCTDVTFGHDTALTIATEA
IDRLHSTAESHQRVMLVEVMGRHAGWIALNAGMASGAHMTLIPEQPFDVE
EVCRLVKQRFQRGDSHFICVVAEGAKPAEGSMQLRQGGMDEFGHEKFTGV
AAQLAIEVEKRIKKDVRVTVLGHVQRGGTPTAFDRVLATRFGVNAADAAH
AGEYGMMVSARGTEIGRVPLADAVRQLKLVPQTRYDDAAEFFG
145224823YP_001135501.1 aspartyl/glutamyl-tRNA amidotransferase subunit B [Mycobacterium giMSVTTDELLDYDEVIAAYEPVLGLEVHVELSTATKMFCGCANRFGGEPNT
QVCPVCLGLPGSLPVLNQSAVESAIRIGLALNCEIAPWGRFARKNYFYPD
QPKNYQISQYDEPIAINGHLDVPLDDGTTWRIEIERAHMEEDTGKLTHLG
SDTGRIAGATTSLADYNRSGVPLIEIVTRPVEGAGARAPEIARAYVTALR
DLLRALDVSDVRMDQGSMRCDSNVSLKPIGQVEFGTRTETKNVNSLKSVE
VAVRYEMRRQAAVLKAGGSIVQETRHFHEDGYTSPGRSKETAQDYRYFPE
PDLEPVAPSAELVEQLRATIPELPWLSRKRIQQEWGIGDEVMRDLVNIGA
LDLIAATVTHGASSEAARAWWGNFLVRKANENGVELDALPITPAQVAAVV
KLVDDGKLSNKLARQVVEGVLAGEGDPEQVMNDRGLVVVRDDSLIQAAID
DALAAHPDVADKIRGGKVAAAGAIVGAVMKATKGQADAARVRELVMAACT
145224822YP_001135500.1 integral membrane sensor signal transduction histidine kinase [MycoMTRIQDLVYRVLDHPLRWLSLRSIVILSQLGVTILVLTLGVWVWVGVTND
QYDQLDRRLDSLSSLGDVNTLLRSAQEGVGPEPTEGGLVRTARWAGSTVS
IPADIVLPDLDSGYADATIDGVEYRVRTIKTGNASIALGAPMAETQARID
SLHWRVFWICSGVILTTMLVGWVIGLIMVNPFRLLAQQARAINAQSNPDE
VQVRGVWEAVEISEAVEGMLARIGDEQQRTRAALESARDFAAVASHELRT
PLTAMRTNLEVLATLDLGAEQRQEVLGDVIRTQSRIEATLTALERLAQGE
LTTVDDFVPVDVAELLDRAAHDAMHNYPGVEVTLASSTTVLMLGMPAGLR
LVIDNAIANAVKHGGATQIRLSVVSSHTGVEIAVDDNGSGVPEEERAEVF
ARFHRGTTASRSGSGLGLALVAQQAEIHGGTASLEVSPQGGTRLMLRLPG
SGPS
145224821YP_001135499.1 LppZ [Mycobacterium gilvum PYR-GCK]MLLSAALLAGAGCARFDSAQSQPFTTEPQLAPGPTSTPPPPPPLPAKPFP
KECPAPGVMQGCLESTSGLIMLPDSQSALVAERTTGAVKQVSVRAEPIQK
MMIPVDGSGDGGLMDIVLSPTYTQDRLMYAYISTPTDNRVVRIAEGDPPK
PILTGIPKGTTGNTGSLIFTSPTTLVVQTGDAGNPAQATDPGSMAGKMLR
IEQPTTVNQAPTTTALSGLGPGGGMCIDPSDESLYVTDRTPTADRLQRIT
KDSQVSTVWTWPDRPGVAGCAALDGTVLLNLVDTKQTVAVRMAPETGAVT
GDPEVVRQDQHGHAWALEVSPDGNVWGGTVNKTSGDAMKLDDVVFPLFPQ
GGGFPRANDEKT
145224820YP_001135498.1 DoxX family protein [Mycobacterium gilvum PYR-GCK]MLNAPSEFPARDRSALTLAVVTSPLDPRPWQRPDDSAGRPASASLVDPED
DLPSANYGGDFETTAIPRYDSAKPADQQQPFALLNDPEPLPYVQPSIGLA
PGAYGSTAAPTEVGVDPDRHSGDRRGTQDLGLLLLRVAVGALLIGHGLQK
VFGLWGGPGLGGFRDQLTDVGFRNADILSYVAAGGQIAAGVLLVLGLFTP
IAAAGALGYLVTATLAEATLAHDDARLSSFLTDGHEYQIVLLVVVAAIIL
VGPGRYGLDAGRGWARRPFVGSIAALILGAGAGVAIWVLLNGANPLG
145224819YP_001135497.1 hypothetical protein Mflv_4240 [Mycobacterium gilvum PYR-GCK]MRLCYARIRASAASTREPITTSRVCIADDGSRRTGPRSNPGPGRPAHPPG
PRCDDGDMRSSSAPESAPVVIRISPMAHVAVGFLTVALLAVVLAGPIWFL
LLFLIPAGVSYAVARYRTVADRDTVTARTLFGKQTVRWEDIHGLRFGRQA
WAVARRRDGSELTLPGVTFATLPVLTAASGGRVPNPYE
145224818YP_001135496.1 acetolactate synthase 1 catalytic subunit [Mycobacterium gilvum PYRMSAPTKRPPEQSETPTNGTAAAAKYNSATTQAQPNVVAPHQLTGAQAVIR
SLEELGVDVIFGIPGGAVLPVYDPLFDSQKLRHVLVRHEQGGGHAASGYA
HATGRVGVCMATSGPGATNLVTPLADAYMDSIPMVAITGQVGRALIGTDA
FQEADISGITMPVTKHNFLVRDGDDIARVIAEAFHIAASGRPGPVLVDIP
KDVLQGQCTFAWPPQFELPGYKPNTKPHNRQIREAAKLIAESRKPVLYVG
GGVIRGEASEQLLDLAELTGIPVVTTLMARGAFPDSHPQNLGMPGMHGTV
AAVAALQRSDLLIALGTRFDDRVTGKLDSFAPEAKVIHADIDPAEIGKNR
HADVPIVGDVKNVIADLIEVLRRDGQGAVELDAWWESLRGIQATFPLSYG
PQSDGSLSPEFVIETLGKMAGPDAVYVAGVGQHQMWAAQFISYEKPKTWL
NSGGLGTMGFAVPAAMGAKMGRPEAEVWAIDGDGCFQMTNQELATCAIEG
VPIKVALINNGNLGMVRQWQTLFYEERYSQTDLATHTRRIPDFVKLAEAL
GCVGLRCEREEDVADVIAQARAINDRPVVVEFVVGADAQVWPMVAAGTSN
DEIQAARGIRPLFDNEEGHA
145224817YP_001135495.1 acetolactate synthase 3 regulatory subunit [Mycobacterium gilvum PYMATTHTLSVLVEDKPGVLARVASLFSRRGYNIQSLAVGATEHKDLSRMTI
VVDVEESPLEQITKQLNKLINVIKIVEQDEEHSVSRELALIKVRTDATTR
GQVIEAVNLFRAKVVDVSTESLTVEATGTPEKIEALLRVLEPYGVREIVQ
SGVVSLSRGPRGISTK
145224816YP_001135494.1 ketol-acid reductoisomerase [Mycobacterium gilvum PYR-GCK]MAVEMFYDADADLSIIQGRKVAVIGYGSQGHAHSLSLRDSGVEVKVGLKE
GSKSRDKVTEQGLDVDTPAEVAKWADVIMLLAPDTAQAEIFTKDIEPNLE
DGNALFFGHGLNIHFGLIKPPANVTIGMVAPKGPGHLVRRQFVDGKGVPC
LIAVDQDPKGEGQALALSYAAAIGGARAGVIKTTFKDETETDLFGEQAVL
CGGTEELVKTGFDVMVEAGYEPELAYFEVLHELKLIVDLMYEGGIARMNY
SVSDTAEFGGYLSGPRVIDADTKKRMQDILKDIQDGTFVKRLVANVEGGN
KELEGLRKQNAEHPIEVTGKKLRDLMSWVDRPITETA
145224815YP_001135493.1 hypothetical protein Mflv_4236 [Mycobacterium gilvum PYR-GCK]MVNAGVTNYTEITGSVRSVSMTGSSTPASALLARAGGVRGLVYTALPVTT
FAAGNAIAGLMPALIAAVVAGALVMTVQLVRRESTRPAMFGFAGVAAGAG
FALVTGRAKDFYLPGIWMYLALAVLFTASVLARRPLIGVVWAWMTGRDDT
WRRTRRVRIAFDLVTLMMAAVSATRFAVQFYLYDTDQEGLLAVARIAMGW
PVFLLTSTLIYLAIRTAMRTLPRGVPE
145224814YP_001135492.1 hypothetical protein Mflv_4235 [Mycobacterium gilvum PYR-GCK]MGSNGQVELTVVGSGPNGLAAAVICARAGVSVRVVEAQPTAGGGARTLPD
PEFSGVSHDICSAVHPLALASPFFAAFDLRARGVTLEVPEVSYGNPLPGR
RAAIGYLDIDRTCAELEDGEPWRRLLGPLAADCDGVVGLLLGDKRSIPPS
IPAALRVAPRLLAQGTPAWGTLLGEDARALFTGVAAHTISRMPSLVASGA
GLMLSTLAHAVGWPIPVGGSQAIPDALIADLRAHGGELVVGEEVSTPPSG
VVLYDTAPTALLDIYGDRLPSRYARTLRRYRYGPGVAKVDFVLSGEIPWR
DKRLASAPTLHMGGDRATMALAEKDIAEGRHAQWPMVLASLPHLADPGRI
DAAGRRPLWTYAHVPAGSTVDMAETITGVFERFAPGFRDLVVGVRSVPAA
RLADHNANLVGGDIGVGGNNMFSALTGPALRWNPWATPIPRTYLCSSATP
PGGGVHGMAGYYAARTVLRREFGIREMPPLAP
145224813YP_001135491.1 D-3-phosphoglycerate dehydrogenase [Mycobacterium gilvum PYR-GCK]MSLPVVLIADKLAQSTVEALGDQVEVRWVDGPDREKLLAAVADADALLVR
SATTVDAEVLAAAPKLKIVARAGVGLDNVDVDAATARGVLVVNAPTSNIH
SAAEHALALLLSTARQIPAADATLREHTWKRSAFSGTEIFGKTVGVVGLG
RIGQLVAQRLAAFGAHITAYDPYVSHARAAQLGIELLTLDELLSRADFIS
VHLPKTKETAGLIGTEALAKTKPGVIIVNAARGGLIDEQALADAITSGHV
RGAGLDVFSTEPCTDSPLFELPQVVVTPHLGASTVEAQDRAGTDVAASVK
LALAGEFVPDAVNVGGGAVGEEVAPWLDLVRKLGLLVGALSAELPTNLCV
QVRGELASEEVEVLRLSALRGLFSAVIEDQVTFVNAPALATERGVEASID
TESESPNHRSVVDVRAVAADGSTVNVSGTLTGPQLVEKIVQINGRNLDLR
AEGVNVIINYHDQPGALGKIGTLLGGANVNILAAQLSQDADGEGATIMLR
VDREVPADVLAGIGRDVNALTLEVVDLT
145224812YP_001135490.1 3-isopropylmalate dehydrogenase [Mycobacterium gilvum PYR-GCK]MKLAVIAGDGIGPEVIGEALRVLDAVVPGVEKTEYDLGARLYHRTGEVLP
DSVLDELKGHDAILLGAIGDPSMPSGVLERGLLLRIRFELDHHINLRPGR
LYPGVQSPLAGNPEIDFVVVREGTEGPYTGNGGAIRVGTPHEIATEVSVN
TAYGVRRVVQDAFKRAQQRRKHLTLVHKNNVLTNAGSLWWRTVQAVAAEY
PEVEVAYQHVDAATIHMVTDPGRFDVIVTDNLFGDIITDLAAAVCGGIGL
AASGNIDATLTNPSMFEPVHGSAPDIAGQGIADPTAAIMSVSLLLAHMAE
IDAAARVDKAVAEHLATRGDEKLSTTQVGDRILGKL
145224811YP_001135489.1 hypothetical protein Mflv_4232 [Mycobacterium gilvum PYR-GCK]MADSLCFVGSWFFTTAAWMQLALSDRRVRFEWSSAFVQFGGTVLFNLSTG
AAVWAHAVTEERRYVWVPDVTGSIFFLVSGVLAMVSVAPVTGVLAFRSGA
WRAAAVNLAGCVAFGVSAVSAFVRGDGVTVDEWLANFGTFLGALCFLVAA
LMVLPRAVPSGLP
145224810YP_001135488.1 major facilitator transporter [Mycobacterium gilvum PYR-GCK]MAPSSIGPTRRWLMLAIGLLTTLCANVFINGVAFLIPTLHDERGLDLAGA
ALMSSLPSLGMVVTLIAWGYVVDRIGERAVLTAGSALTAAASFAAASMDT
LLTTGIFLFLGGMAAASSNTASARLVVGWFDAERRGLVMGIRQTAQPLGV
GVGALVIPRLAESHGLSAALLFPAVVCAVSAVLCLAAVIDPPRPARADAA
RTDLANPYRNSAMLWRIHLTSVLLVIPQVVVWTFTLVWMISEHGWSPESA
GVLVMVAQIMGAAGRIGAGRWSDHYVRRSGDLLASRLRPIRIIAAAAAAS
MALLALTDLVNSPLSIALMMVASVITVSDNGLAFTLIAEYAGPFWSGRAL
GTQNTSQLFAQGVAPPLFGGLIAVAGYPVAFAVCALLPVLAIPAVPLKVT
VDR
145224809YP_001135487.1 5-carboxymethyl-2-hydroxymuconate delta-isomerase [Mycobacterium giMRLGRIASPDGVAFVAVEGPPDDPAAAVAREIAEHPFGTPTFTGRQWPLA
DVRLLAPILASKVVCMGKNYAAHIEEMGGGTFEDPIIFLKPNTAIIGPYT
PIQLPADADPVHFEGELAAVIGRPCKDVPASRAAENILGYTIANDVSARD
QQKKDGQWMRAKGHDTFCPVGPWIVTDIDPSDLEIRTEVNGELKQHSRTS
LMIHDIGAIIEWISSVMTLLPGDLILTGTPEGVGPLEHGDTVSITVEGIG
TLSNPVVRKGKS
145224808YP_001135486.1 glutamyl-tRNA synthetase [Mycobacterium gilvum PYR-GCK]MKVRVRFCPSPTGTPHVGLIRTALFNWAYARHTGGDFVFRIEDTDAQRDS
EESYLALLDALRWLGMDWDEGPEVGGPYAPYRQSQRRDLYLDVIRRLLAA
GEAYEAFSTAEEVEARHLAAGRNPKLGYDNFDRDLTEEQRAAFRAEGRQP
VVRLRMPDADMTWVDLVRGETTFPVGSVPDFALTRGSGDPLYTLVNPVDD
ALMKITHVLRGEDLLPSTPRQLALYAALIRIGVTDMTPQFAHLPSVLGEG
NKKLSKRDPQSNLFLHRERGFIPEGLLNYLALLGWSIADDRDIFSVQEMV
AAFDVADVNSNPARFDQKKADALNAEHIRRLDEAEFVRRLADYFSTHGYD
TGLDDARFAEAAALVQTRIVVLGDAWDLLKFLDESSFALDEKSAGKELKD
TAVPVLTAALAALKGVGEWTTAQIEDALKVALIDGLELKPRKAFGPVRVA
VTGSSISPPLFESLELLGRDRSLERLRAGRDHAAAAVTMDA
145224807YP_001135485.1 regulatory protein IclR [Mycobacterium gilvum PYR-GCK]MRQNSGIGVLDKAITVLHAVAESPCGLADLCERTDLPRATAHRLAVGLEV
HRLLARDGDGLWRLGPALTELAGHVNDSLLAAGAVVLPRLRELTGESVQL
YRREGTSRICVAALEPPAGLRDTVPVGTRLSMTAGSGAKVLLAYADTHTQ
QAVLPNAKFTDRTLAEVRKRGWAQSAAEREPGVASVSAPVRDGRGAVIAA
VSVSGPIDRMGRRPGARWAADLVAAADALTRRL
145224806YP_001135484.1 isopropylmalate isomerase large subunit [Mycobacterium gilvum PYR-GMAVANQPRTLAEKVWSDHVVVSGSGEGAAREPDLIYIDLHLVHEVTSPQA
FDGLRLAGRPVRRPDLTIATEDHNVPTVDIDKPIADPVSRTQVETLRRNC
EEFGIRLHPMGDVEQGIVHIIGPQLGLTQPGTTVVCGDSHTSTHGAFGAL
AMGIGTSEVEHVLATQTLPLRPFKTMAVNVDGELPPGVSAKDVILAVIAK
IGTGGGQGHVIEYRGSAIESLSMEGRMTICNMSIEAGARAGMIAPDETTF
EFLKGRPHAPQGADWDAAVEAWKLLRTDEGAQFDTEVYIDAASLSPFVTW
GTNPGQGVPLSDSVPDPEMIFDEGERSAVEKALAYMDLRPGTPMREIPVD
AVFVGSCTNGRIEDLRVVADVLRGRTVADDVRMLVVPGSMRVRAQAEAEG
LGEIFTAAGAEWRQAGCSMCLGMNPDQLAPGERCASTSNRNFEGRQGKGG
RTHLVSPAVAAATAVRGTLSSPADLTAEPTR
145224805YP_001135483.1 isopropylmalate isomerase small subunit [Mycobacterium gilvum PYR-GMEAFRTHTGIGVPLRRSNVDTDQIIPAVYLKRVTRTGFEDGLFAAWRNDP
SFVLNQPPFDQGSVLVTGPDFGTGSSREHAVWALMDFGFRVVISSRFADI
FRGNAGKAGLLAAEVTQDDVELLWKVIEQHPGTEITVNLQDRSVTAGTVM
VPFTIDDYTAWRLLEGLDDIGLTLRKLDEIEDFETHRPSWKPRTLPA
145224804YP_001135482.1 histone family protein DNA-binding protein [Mycobacterium gilvum PYMNKAELIDVLTEKLGSDRRQATAAVENVVDTIVRAVHKGESVTITGFGVF
EQRRRAARVARNPRTGETVKVKPTSVPAFRPGAQFKAVVSGAQKLPAEGP
AVKRGVAAASTARKAAKKAPAKKAAPAKKTAAKKAAPAKKAATKAPAKKA
APAKKAAPAKKTAAKKAAPAKKAPAAKKAAPAKKAPAKKAATKAAPAKKA
PAKKAPAKKAPAKRGRK
145224803YP_001135481.1 NUDIX hydrolase [Mycobacterium gilvum PYR-GCK]MTKTSIMAAGAVLWRPQDGTDAPEIAIIHRPRYDDWSLPKGKVDPGETDT
VATVREIGEETGFRSHLGRRLPTVTYPVDGAVKKVRYWAARAVGGEFVPN
DEVDEMKWLPADRAIAELGYPHDRKVVRRFLKLPADTKTVLIVRHGTAGD
KKRYRGDDRKRPLDKHGRAQAESLVGQLLAFGAAELFAADRVRCRQTLEP
LAEELGVSIAGEPTLTEEAYAEDRKAARARILDIAETAGTPVICSQGKVI
PDLIAWWCERDGVRADKSRNRKGSTWVLSLAEGRLVAADHLSSALPPKK
145224802YP_001135480.1 polyphosphate kinase [Mycobacterium gilvum PYR-GCK]MTEAQTRTEPSESSESSEAVAPAITSAADSAPEAPPATTAPAIENPLPED
RYLNRELSWLDFNARVLALAADPSLPLLERAKFLAIFASNLDEFYMVRVA
GLKRRDEMGLSVRSADGLSPREQLRRISERTQQIASRHAHVFLDSVRPAL
ADEGIVIVTWAQLDDAERAKLSTYFHEQVFPVLTPLAVDPAHPFPFVSGL
SLNLAITVKHPDDGGQHFARIKVPDNVDRFVELPARGDSPGVVRFLPMEE
LIAAFLTVLFPGLEIVEHHAFRITRNADFEVEEDRDEDLLQALERELARR
RFGSPVRLEVSDDMTESMLELLLRELDVAPGDVVEVPGLLDLSSLWQIYS
VDRPGLKDPPFVPATPSAFGERETPKSIFSALRDGDVLVHHPYDSFSTTV
QRFIEQAAADPNVLAIKQTLYRTSGDSPIVNALIDAAEAGKQVVALVEIK
ARFDEQANIKWARALEQAGVHVVYGLIGLKTHCKTCLVVRREGSTIRRYC
HIGTGNYNPKTARLYEDIGLLTAAPDIGADLTDLFNSLTGYSRKESYRNL
LVAPYGVRRGIIERIDREIAATRDGAEGRIRLKANALVDEQVIDALYRAS
QAGVQVEVVVRGICALRPGEPGFSDNITVRSILGRFLEHSRIIHFRAIDE
YWIGSADMMHRNLDRRVEVMAQVKDPRLTTQLNDIFDSAADPRTRCWELG
SDGHWTALPQEGHSVRDHQISLMERRRHP
145224801YP_001135479.1 hypothetical protein Mflv_4222 [Mycobacterium gilvum PYR-GCK]MRNSAPDADIGLVIAVKRLTAAKTRLAPVLSATNRESVVLAMLVDTIGAA
ITVPAVRSVLVVTPDDGAASAARRLGARVLADPTPAGHRDPLNNALSAAE
TAIREECSNIVVLQGDLPALKSIELAEALHAARAHPRSFVTDRHGTGTAA
LFAFGVALQPRFGAGSAQRHRESGAVELTGDWPGLRSDIDTPEDLVAACE
LGVGPATSQAISAA
145224800YP_001135478.1 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase [MycobacteriumMGAGAWGTALAKVLADAGNSVTLWARRPELADAINRTHRNDNYLDATLPE
SIRATSDAADALTGACTVLFAVPSQTLRTNLEAWKSHVGADATLVNLAKG
IELDTLLRMSQVIAQVTGADPGRIAVVTGPNLASEIGAGQPAATVVACTD
SGRAVALQRALATGYFRPYTNADVIGAEIGGACKNVIALACGMAAGAGLG
ENTAAAIITRGLAEIMRLGIALGAKPATLAGLAGIGDLVATCTSPHSRNR
SFGERLGKGGTMQAALDATGGHVAEGVTSCRSVLALAASYDVEMPLTEAV
HGVCHKGLSVDEAIALLLGRTTKPE
145224799YP_001135477.1 cystathionine gamma-lyase [Mycobacterium gilvum PYR-GCK]MAGTHGDSTRSVKAVASQDVPGTAVAAPPVFASAYHLAADEDDTLDSYGR
RSNPTWRQLESALAQLEGAAAALSFASGMAALTAVLRVLAQPGHTLVVPA
DGYYQVRAYAREYLASRGVTVVEARCADLGDAAARADVVLAETPSNPELD
VVDLHRLALTCRSRGTVLVVDNTTATPFGQQPLSLGADLVVASATKALAG
HSDVLAGYVAGSHPELMERVERERLHAGAILGAFEAWLVTRSLGSAGLRF
DRQCQNAAAVALTLRSHPAVRSVRFPGLADDPSHEVAARQMRRFGGIVSF
ELADADAVHALVDRSALLVAATSFGGIHTSVDRRARWGDSVAAGFARMSM
GIEDTDDLVSDLQQALGPA
145224798YP_001135476.1 D-alanyl-alanine synthetase A [Mycobacterium gilvum PYR-GCK]MNARIRVAVVYGGRSSEHAISCVSAGSILRNLDPDRFEVTAVGITPEGSW
VLTEGRPETLAITDGKLPGVTGDSGTALTLTADPARRGQLVSLGEAAGEV
LASADVVFPVLHGPYGEDGTIQGLLELAGVPYVGAGVLASAAGMDKEFTK
KLLASAGLPVGDHVVLRARDSTLSLQDRERLGLPVFVKPSRGGSSIGVSR
VTAWDELPAAIELARRHDPKVIIEAAVPGRELECGVLEFPDGHLEASTLG
EIRVEGVRGREDGFYDFETKYLDDGAELDVPAKVDDDVAEAIRALSLRAF
TAIDCQGLARVDFFLTDDGPVINEINTMPGFTTISMYPRMWAASGVDYPT
LLATMVETALARGTGLR
145224797YP_001135475.1 hypothetical protein Mflv_4218 [Mycobacterium gilvum PYR-GCK]MDSETADGPPRAVLIAAAAVAVGAVVALLIVVAVMQREPAQKPVAVSGIP
APQADSPQCRSLVEALPEQLGDYRRAQLVEPAPQGAAAWQPEAPDGEALI
LRCGLDRPAEFVTGAPLQVVDAVSWFRVGEAGAGNDRVGEAGAGESGVAD
GDRSTWFAVDRPVYVALTLPRDSGPTAIQTLSTIIAETLPAQTPQPAPLG
145224796YP_001135474.1 AsnC family transcriptional regulator [Mycobacterium gilvum PYR-GCKMVEAFVLVQTEVGRAEVIAKQLAGLTGVLSAEYVTGPYDVVVRVGAPSLD
DLKSGVVPAVQQVAGITRTLTCPIADGAAP
145224795YP_001135473.1 thiamine monophosphate kinase [Mycobacterium gilvum PYR-GCK]MAAEDADAKLSELGEFAVIDRLVADRRQPPAVSLGPGDDAAVVFAADGRT
VVCTDMLVEGRHFRLDWSTPHDIGRKAIAQNAADIEAMGARATAFVVAFG
APGDTPTAAAVQVADGMWHEAALLGAGIVGGDTVAAPQWVISVAALGDLG
GREPVRRDGARPGDTVAVTGVLGRSAAGYELLRNGIDGFDELRRQHRVPS
PPYGQGAIAAQAGATAMTDVSDGLLADLAHIASASGVSIDITLDTLTSDE
AAVADAAGATGVDARQWVLGGGEDHALVATFPGAVPPNWRVLGTVAATAA
DGAPAVTVDGSPWIGNAGWQSF
145224794YP_001135472.1 uracil-DNA glycosylase [Mycobacterium gilvum PYR-GCK]MNARPLSELVDDGWAAALAPVESQVAQMGEFLRAELAAGHRYLPAGPNIL
RAFTFPLEKVRVLIVGQDPYPTPGHAVGLSFSVAPDVRPLPRSLDNIFKE
YRADLGHPAPSNGDLTPWCEQGVMLLNRVLTVRPGTPASHRGKGWEAVTE
CAIRALVARRQPMVAVLWGRDASTLKPMLEDTAVIESPHPSPLSASRGFF
GSKPFSRANELLAQRGAEPVDWRLP
145224793YP_001135471.1 50S ribosomal protein L28 [Mycobacterium gilvum PYR-GCK]MAAVCEICGKGPGFGKSVSHSHRRTSRRWNPNIQSVRAVSSPGGNKQRVN
VCTSCLKAGKVARG
145224792YP_001135470.1 Dak phosphatase [Mycobacterium gilvum PYR-GCK]MSARRLDASTLRRWAHDAVAALISHTDEINRLNVFPVADADTGTNMLFTM
RAAWAQADSDAADDVTAITAALAAGALRGARGNSGVILSQILRALAEVTA
EAAEERGGVLSEVTGEMLAAALRHAVTLVVASMGEAVPGTIVSVLHDAAA
AAEDAVCGQADLAAVVVACTQAAAAALDRTPTQLDVLADAGVVDAGGRGL
LVLLDALSAILTGELTRRQVYLPDPKHAAGAAAPPSPTPGFEVMYLLSDC
DAENVEQLRARLDALGDSVAIAASGFGEAGAGHYSVHVHADDAGAAVEAG
LAVGTLSRIQITSLHGGADRSSAGSWGRERAVLAVVDGEGAEELFVGEGA
AVLRTEPGVEISAQQLLHALVKTGAAQVMVLPNGYVAAEEIVAGCAVAAD
WGIDLVPIPTGSMVQGLAALAVHDPGHRLVDDGYTMARAGAAARFGSVRI
AAEDALTWAGACRPGDGLGITGDEVVVVGDDIVSAATGLIDLLLAAGGEL
VTVLTGDGVESEVGAALAEHVHHNHLGAELVTFHTGHRADALLIGVE
145224791YP_001135469.1 ATP-dependent DNA helicase RecG [Mycobacterium gilvum PYR-GCK]MATLDDRLDFVIGAKAARPLEEHLGLHTVGDLVRYFPRKYSDAMTVRGEG
EDLDLEEGEHVTFVDVIARAELKRVRNQPSREFLVVTLRDRRPKVTATFF
NPKWLKKTLVEGTKVMLSGEVGYFRGTMQLTHPAFMVLDSASGKTVGTKS
LTSIASTSGATGDDLLAEFEKNYFPIYSATSKVQTWDIYACVRQALAVLD
PVPETLPDWFVREHDLMSEDEALRAVHLSENAEDRARAIERLTFDEAAGL
QWGLVVRRNSELGASGPPAPRRGGGLVDAMTAQLPFELTAGQQEVLAVIS
EELGAARPMNRMLQGEVGSGKTVVSLLAMLQMIDAGYQCALLAPTEVLAA
QHSSSIRSMLGALAGAGELGGAEQATRVSLLTGSMSAAQKRDARREVASG
VAGIVIGTHALLSDSVEFDNLGMVVVDEQHRFGVEQRDRLRAKAPAGLTP
HLLVMTATPIPRTVALTIYGDLETSTLRELPRGRRPITTNTIFIRDKPAW
LDRAWTRIAEEVAAGRQAYVVASRIDENDTADGKADGKAKKAKKTSESDQ
QGPPPVTVVDLLARLQRGPLSGVRLGLMHGRLSGDEKDAVMAAFRAGDID
VLVCTTVIEVGVDVPNATVMVVMDADRFGISQLHQLRGRIGRGEHPSLCL
LATNLPESSKAGQRLTAVAATQDGFELAELDLRERSEGDVLGLFQSGRPV
TLRFLSLADHVEIILSARELCETVYASDPLDPGMAALSAPFTDSDKVQYL
DMS
145224790YP_001135468.1 hypothetical protein Mflv_4211 [Mycobacterium gilvum PYR-GCK]MSRKQTLWLAVAVVLAVIVAYQTVENSAQRSAQFVADADVPTVAPGEDVL
AGVAVVPLRLRGHDYRRDAFGDAWTDDNDAPGGRNGCDTRNDILDRDLVD
KTYVAISRCPTAVATGILHDPYTSLIVPFTRGNQTGAAVQIEHIVPLAYA
WDQGARFWTDQMRVRFANDPANLVAVQGEVNQDKGDKEPALWMPPNAAFH
CQYAMQFIAVLRGYRLPVDAPSVPALTRAAETCPTR
145224789YP_001135467.1 hypothetical protein Mflv_4210 [Mycobacterium gilvum PYR-GCK]MMPGMPEPPDIVGEIDGVAIVGAALIGGAMMGGGAMGAIGGAAIGGGAIG
GGAIGGAAIGGAAIGGGAAAAGGWTIGGGGGRYGLPVHAASAGLDMHAGS
RGPVGVAGAIAYGPP
145224788YP_001135466.1 Dyp-type peroxidase family protein [Mycobacterium gilvum PYR-GCK]MGEPSRARGFNRRRLLLTGGAALAATTTLTRCGRAESATAATGFGSNSEP
FHGAHQGGVDTPAQAHALFVALDLVATPDRAPRDTLASVLRLWTADAARL
TQGRPALADTEPELAARPSRLTVTVGLGAGLFERAGLSHRRPDSVTEVPA
FSTDRLESRWCGGDLLLQICADDPLVVAHTARVLLKNVRTMTTQRWQQRG
FRSARGSDTSGATMRNLMGQVDGTVNLRTATDVDRLVWDDGAGQPWFAGG
TVLVLRRIRTELDSWDELDRTSRELTVGRRLDTGAPLTGTHEFDEPDLDA
AENGIPVIPPNSHVALARHRHDGERFLRRAYNYDDPPTDATTDAGLIFAA
FQRDPAQQFVPVQQRLAASDALNPWITTIGSAVFAILPGAADGGYLGQSL
LE
145224787YP_001135465.1 hypothetical protein Mflv_4208 [Mycobacterium gilvum PYR-GCK]MSGNRNRFALTVLAAAISLTACTSSGSGPDASMASAVTFDESWARAADSG
MTAVFGTFTNGGDRDAVIVSGESAAANRVELHEVTHNSGGAMMRPKDGGF
SVAAGGTKDLLPGGDHLMLMDLTQPLQPGDDVALTVTFADGSVLPITAQV
RDFAGGDEEYAPGAHHHG
145224786YP_001135464.1 peptidase [Mycobacterium gilvum PYR-GCK]MTLPEGTHDPTTLTNQAPEAIPKHRWRALLVRLHFYAGVLVGPFLVIAAL
TGALYAMAPTVERVVYRDLLFVEPGDRVLPLDDQVAAARRSYPALTVTGV
RPPAAENESVRVYFADPALAPDLGRAVFVDPYTGRVLGDEVTWLGCLPVS
TWLDGLHRHLNLGEPGRLYSELAASWLWVVASGGLYLWLVNAAGDRRRGR
KPRILTVDRTAGGRSRNLNWHGATGVWLLGGLLFLSATGITWSTYAGAHV
SDLRAAFEWQRPQLDTATHGDHGDHAPAAGHTAGPQSVDFDGVLAAATTA
GVDLPVEILLPAEHGAAVTVSEIDKPYRWTTDAAAVNPGDLTVTGTVDYW
RDYSLIAKLADWGIRGHMGFLFGLLNQLLLLGIAVGLLAVIVRGYRMWWQ
RRPTRGSRWAVGRPPARGGLRRLRPLTVTALVAGAVTVGWFLPLLGLTLA
AFALTDLILGSIKKNASLKKNASLKKNASLNENTENSHVR
145224785YP_001135463.1 hypothetical protein Mflv_4206 [Mycobacterium gilvum PYR-GCK]MNTPKMRARWARGALVGASSAAMTLGAHAAAGGGALPLGSSLVLALLVCA
TVGALAGAVRSDDRRVRWLATTSALGGAQFLGHIALALTGHHHDALVPTP
GPSMIVAHIAAAVLLGGAISAAEYLYAVCASVLHWLRLFILQSPRPMPRA
RRRATRIVVPRPVLATGLGMRAPPHATVTA
145224784YP_001135462.1 2-5-didehydrogluconate reductase [Mycobacterium gilvum PYR-GCK]MTSAAAIPTVTLNDDNTMPVIGLGVGELSDAETEQAVTAALEAGYRLIDT
AAAYGNEAAVGRAIAASGVPRDELFVTTKLATEDAGFQSSQDALRASLER
LGLDYVDLYLIHWPVSQQGKHVDSWGGLMKSKEVGLTRSIGVANFHGHHL
DDIISLSFFTPAVNQIELHPLLNQAELRAVNAEHGIATEAYGPLGVGNLL
SHSAVNAIAEAHGRTPAQVLIRWSLQLGNIVIPRSSSPERIRSNIDVFGF
ELSEEQMSTLNGLDDGTRFRPDPETYSGS
145224783YP_001135461.1 integrase catalytic subunit [Mycobacterium gilvum PYR-GCK]MPASGDHRVDVAPLDCPVRRHESQRGQTAQGTRSRERPAQEAGRQPGPRH
RHAQGDFGGKLLTPNRKRSAVIALRERFGVSERRACTVVGLHRSTMRLTP
APVTTEEAELRAWLRRFSTDRPRWGWRRAAKMARRAGWKANNKRIRRLWR
EEGLRVPQRRRKKRLTGIGVAVGAMSPIRPNVIWAMDFQFDTTADGRTLK
MLNVIDEFTREALAIEVDRAINADGVVDVLDRLALTYGAPHYVRFDNGPE
FVANAVADWCRFNSAGSLFIDPGSPWQNAWIESFNGRLRDELLNLWRFDS
LLEARVIIEDWRRDYNANRPHSAHGELTPAEFALQWTTTHQPQVA
145224782YP_001135460.1 alpha/beta hydrolase domain-containing protein [Mycobacterium gilvuMPASRATESHNNWTTPKGSPHAGGAVEKLTNTLAGVTLRALPRIPDPVKR
LLLGRRTITLDGNTLDTTLHLMLAGQRLMGIEGLVADDDVTVARAQLEVL
AAAFKQHIPVAAVTNLTVPGAQGPLDARHYRTDEPDAALLVFFHGGGHVI
GSLDSHDDLCREICRAGRIHVLSVDYRLAPEHKAPAGAQDAYSAYLWARE
HAAELGADPERVAVGGDSAGGNLSAVLTQRARDEGAPLPALQVLLYPATE
VGIQTRSQTLFSDGFFLTKRDMDWFMDHFLDGADVADTDPRVSPLRTDDM
SGLPPALVVTAGFDPLRDEGRLYAEALREAGTPVDYREYGTVVHGFANFF
PLGGDSATAMADVISAIRAHLTRAG
145224781YP_001135459.1 hypothetical protein Mflv_4202 [Mycobacterium gilvum PYR-GCK]MASKPKKNARYDLKAADRKRNLLIQIGLTAVVVIFAVALVLYIVGSADDK
PTAGESRGIRVESTSVIKKEGTDEPKAVVSMYEDFLCPHCGAFEQQFGPT
INKLVDAGAIAADYYMVGILDRPQNQNYPARAGGAAYCVADESIDAFKRF
HAALYAQQPGETGSTYPDNARLIEIARQSGATGGVPECINKGTYVDMVGG
LARATEIKSTPTVRINGEEYQYSTPDALVAKIKEIVGDVPGLEAAPPAPA
PQPAPAS
145224780YP_001135458.1 vitamin K epoxide reductase [Mycobacterium gilvum PYR-GCK]MTVTATDSVDHADPSADEATGVAVARGSALWVLIAGVVGLAAALTLTVEK
IELLIDPDYIPSCSINPVLSCGSVMITPQASLFGFPNPLIGIVSFTVVVV
TGVLALAKVSLPRWYWAGLAVATLLGTVFVHWLIFQSLYRIGALCPYCMV
VWAVTIPLLVVATSVAVQAQRSGNAAVRLIYTWRWSLVTLWFTGVLLLIL
ERFWNYWSTLI
145224779YP_001135457.1 transposase IS116/IS110/IS902 family protein [Mycobacterium gilvum MTTGQVWAGVDVGKEHHWVCAVDDSGKVVLSRRLVNDEQPIRELVAEIDE
LAERVSWTVDLTTVYAALVLTVLADAGKTVRYLAGRAVWQASATYRGGEA
KTDAKDARVIADQARMRGQDLPVLHPDDDLISELRMLTGHRADLVADRTR
TINRLRQQLVAVCPALERAAQPSQDRGWVILLARYQRPKAIRQSGVSRLT
KVLTDAGVRNAASIAAAAVAAVKTQTMRLPGEEVAAGLIADLAREVIALD
DRIKTTDADIEGRFRRHPLAEVITSMPGIGFRLGAEFLAAVGDPALIGSA
DQLAAWAGLAPVSRDSGKRTGRLHTPKRYSRRLRRVMYMSALTAIRCDPD
SKAYYQRKRDEGKRPIPATICLARRRTNVLYALIRDNRTWQPDSPPVTAA
A
145224778YP_001135456.1 transposase IS116/IS110/IS902 family protein [Mycobacterium gilvum MNRTGLAAVTAEATASIPLSGQVKVGVEAAGHYHRPVLDHRWPPGWEVLE
LNPAQVAEQRRVQGRRRIKTDVIDLEAITDLVLAGYGRSVSDRDVVIGEV
SAWAVHRSRRTATRTATKNQLLGQLDRAFPGLTLALPDVLGTKIGRLVAA
EFTDPARLAGLGVSRLIRFAATRDLQLRRPVAERLVAVARDALPTRDAVI
ARRILAADMALLADLDAQIDAAETELGSLLPRSPYATLTSVPGWGVVRVS
NYAAALGDPQRWPGPRQIYRASGLSPVQYESAHKRRDGGISREGSVALRR
ALIDLGIGLWLSEPAAKTYAHGLKDRGKHGGVVACALANRANRIAHALVR
DHAVYEPTRWA
145224777YP_001135455.1 pyruvate carboxylase [Mycobacterium gilvum PYR-GCK]MAGQITKVLVANRGEIAIRAFRAAYEMGIATVAVYPYEDRNSLHRLKADE
SYQIGDVGHPVRAYLSVDEIMRVALDAGCDAVYPGYGFLSENPELAAACA
SAGITFVGPSAHVLELTGNKARAIAAARSAGLPVLASSEPSASVEELVEA
ARTMEFPLFVKAVSGGGGRGMRRVAEPEGLAEAVEAASREAESAFGDPSV
YLEQAVLNPRHIEVQILADSRGNVMHLFERDCSVQRRHQKVIELAPAPNL
PEELRQQICADAVAYAREIGYTCAGTVEFLLDERGHHVFIECNPRIQVEH
TVTEEITDVDLVASQIRIASGQTLADLGLSQEDLVIRGAAMQCRITTEDP
ANGFRPDTGRITAYRSPGGAGIRLDGGAVLGGEIGAHFDSMLVKLTCRGR
DFATAAARAHRALAEFRVRGVSTNIPFLQAVIDDPDFRAGRVTTSFIDER
PGLLTSHTPADRGTKILNYLADVTVNQPHGPRPSTVYPQDKLPQIDLNTM
PPRGSKHLLSEVGPEGFARWMRESKAVGVTDTTFRDAHQSLLATRIRTSG
MLMVAPYVARMTPQLLSIECWGGATYDVALRFLKEDPWERLAALREAVPN
ICLQMLLRGRNTVGYTPYPESVTHAFVQEATATGIDIYRIFDALNNVDSM
RPAIDAVRETGTAVAEVAMSYTGDLSDPAENLYTLDYYLKLAEQIVDAGA
HVLGIKDMAGLLRPQAADTLVRALRSRFDLPVHVHTHDTPGGQLATYLAA
WQAGASAVDGASSPLAGTTSQPALSSIVAATAHTEFDTGLSLEAVCDLEP
YWEALRKVYAPFDVAAAGPTTPTGRVYHHEIPGGQLSNLRQQAIALGLGD
RFEQIEASYAAADRILGRLVKVTPSSKVVGDLALALVGAGVSADEFAADP
ERFDIPDSVIGFLRGELGDPPGGWPEPLRSKALAGRAPAKPATELSAEDT
AALADAGATRRATLNRLLFPGPTKEFEAHREQYGDTSSLSANQFFYGLRH
GDEHRVTLEKGVQLLIGLEAISDADERGMRTVMCILNGQLRPVVVRDRSV
ASEVPAAEKADRNNPDHVAAPFAGVVTVNVAEGDQVETGQTIATIEAMKM
EAAITAPKAGAVGRVAVSATAQVEGGDLLVVIGSAGAKVSSDGAGESS
145224776YP_001135454.1 putative methyltransferase [Mycobacterium gilvum PYR-GCK]MPQQKSGRGTRPTTDRVREAMFNLLSARIDFSGIRVLDLYAGSGALGLEA
LSRGARSVLFVESDARAASVIEQNIAALGARGATVRRGSVAAVLSAGAAT
PVDLVLADPPYEVDAAQVADMVDALDNAGWASPGTVAVVERPASASEIDW
PARWSAWKARRYGDTRLEMASVID
145224775YP_001135453.1 phosphopantetheine adenylyltransferase [Mycobacterium gilvum PYR-GCMSGAVCPGSFDPVTLGHIDVFERAAAQFDEIVVAVMVNPNKSGMFTLDER
IALIEESTTHLPNLRVESGQGLIVDFVRERGLTAIVKGLRTGTDFEYELQ
MAQMNKHVAGIDTFFVATAPSYSFVSSSLAKEVAMLGGDVTALLPAAVNT
RLTAKLAERG
145224774YP_001135452.1 hemerythrin HHE cation binding domain-containing protein [MycobacteMPETFVQSTDDVVAFLKDQHNLIRDMFDDVIHASDPKAREKAFTELRQLL
AVHETAEEMVVHPRIRREVDEGDDIAEALLAEEHASKEKLVALENLDIAS
DEFLRELTEFRDTVLAHAEHEEIEEFTKLSRELGADDLKRMAGAVQAAEA
IAPTRPHPGVESATLNFAVGPFASMLDRARDVIGAALK
145224773YP_001135451.1 hypothetical protein Mflv_4194 [Mycobacterium gilvum PYR-GCK]MYRVFEALDELGAIVEEARGVPMTAGCVVPRGDVLELIDDIKDAIPGELD
DAQDVLDARDAMLREAKDHAESTVSTANAEADSMVNHARTEADRLLADAK
AQADRMVAEARQHSERMVGEAREEAARIAATAKREYEASTGRAKSEADRL
LESGNLAYEKAVQEGIKEQQRLVSQTEVVATATAEATRMIDSAHAEADRL
RGECDIYVDSKLAEFEDFLNGTLRSVGRGRHQLRTSAGTHDYAAR
145224772YP_001135450.1 hypothetical protein Mflv_4193 [Mycobacterium gilvum PYR-GCK]MATHASAAARRSSRSPLVIDITRLGRRPGSMITVETTVPSPTRIGVELIA
IEEGAPLELDLRLESVSEGVLVTGTMSAPTSGECGRCLKPITGEVSIDLT
ELFAYPDSTTDETTESDELPRVGRERGTDTVDLEQSVIDAVGLALPFSPV
CGPDCQGLCPDCGVALEDAEPGHHHEKIDPRWAKLAEFGEKDGDDA
145224771YP_001135449.1 ribonuclease III [Mycobacterium gilvum PYR-GCK]MTVDRALLLKALGIDLPAELLTIALTHRSYSYENGGVPTNERLEFLGDSV
LGLTITEELYHRHPDRSEGDLAKLRASIVNTQALADVGRNLSEHGLGAYL
LLGKGEENSGGADKSSILADGVESLLGAIYLEHGAVAAREVILRLFSDLL
DTAPTLGAGLDWKSSLQELTASLALGAPSYHVTSTGPDHDKEFTAVVIIA
EREHGTGVGRTKKEAELKAASAAWNALQRAHPDA
145224770YP_001135448.1 formamidopyrimidine-DNA glycosylase [Mycobacterium gilvum PYR-GCK]MPELPEVEVVRRGLAAHVTGRTISAVRVHHPRAVRRHEAGPADLTARLLD
SVITGTGRRGKYLWLTLGDGSAVVVHLGMSGQMLLGPVRNENHLRIAVLL
DDGTALSFVDQRTFGGWMLADLVTVDGSDVPAPVAHIARDPLDPLFDRAA
VVNVLRRKHSEIKRQLLDQTVVSGIGNIYADESLWRAKINGARLASGVSK
AKLAELLDAATDVMTDALAQGGTSFDSLYVNVNGESGYFDRSLDAYGREG
EPCRRCGAIMRRDKFMNRSSFYCPRCQPRPRV
145224769YP_001135447.1 OsmC family protein [Mycobacterium gilvum PYR-GCK]MHSSRSPLDLRLLECNFGGGCRNRGVTELWVERTGVRRYTGRSTRGAEVL
VGSEDVEGVFTPGELMKIALAACSGLSSDQPLRRRLGDDYRAKIRVSGAA
DREQERYPLLEEKLEVDLSGLSDDEKARLVTVVERAIDQVCTVGRTLKAG
TEVTFEVGDAGGE
145224768YP_001135446.1 acylphosphatase [Mycobacterium gilvum PYR-GCK]MPGASDVRLTAWVHGQVQGVGFRWWTRSRALELVLTGFAANKPDGRVQVV
AQGPREACERLLGALQGGDTPGHVDKVIYDWSEPADAIAGFTER
145224767YP_001135445.1 chromosome segregation protein SMC [Mycobacterium gilvum PYR-GCK]MHLKSLTLKGFKSFASPTTLRFEPGITCVVGPNGSGKSNVVDALTWVMGE
QGAKTLRGGKMEDVIFAGTSSRAPLGRAEVTLTIDNSDNALPIEYSEVSI
TRRMFRDGAGEYEINGSRCRLADVQELLSDSGIGREMHVIVGQGKLSEIL
ESRPEDRRAFIEEAAGVLKHRKRKEKAVRKLDSMAANLARLTDLTTELRR
QLKPLGRQAEMARRAQTIQADLRDARLRLAADDLVARKAEFDDTDQAETT
LRREHDELTERLQERAAELDAHETAVEDLSERADAAQQRWFRLSALAERV
SATVRIASERAQHLDGDPDFSAGPDPDELEAQADAVAEQEQQLLDELAES
QERLEAAREELAEREQAAAEAERAHMAAARAEADRREGLARLSGQVDTMR
TRVESVDETVARLTANIDDAAARAQLTQAEFETVQARVGELDAGEVGLDE
HHDRSVAALRLADERVAELLAAERAAERQVASLQARIDALSVGLDRRDGA
AWLQENHSGAGLFGSIANLVKVRAGHEAAIAAMLGAAADALAAEDFGAAR
AAVAALKESDGGRAALVLGDWPAQEAVTGQLPAGAAWAVDLVEPADRVRG
AVTAMLSGVAVVENLTAALDLVAAQPRLRAVTADGDLVGAGWVSGGSDRK
PSTLEIQSEVDRARSELVDAERRTGELSAALSGALAEQAARQDAAEHALA
ALNESDAAISAIYEQLGRLGQDARAADDEWQRLIRQRDEMEAGRNRTVSE
LAELELRLQNAQREPMFDAEVVDRTEFTAAAEAARSAEVEARLSVRTAEE
RANAVRGRADSLRRAAVAEREARVRAQRAREARVHAAAVAAAVAESGRAV
AQRLADAVSVASRIRDEVAAERQVRAGALTKAREEVNELTARITALTDAL
HRDEVAKAQAALRIEQLEQQVLEQFGMAVADLVAEYGPDVALPPSELEMA
EYEQARERGEQVTAPAPMPYDRPTQERRAKRAERELKELGRVNPLALEEF
AALEERYNFLSTQLEDVKAARKDLLDVIAEVDTRILQVFTEAYMDVEREF
TQVFSTLFPGGEGRLLLTNPSDMLTTGIEVEARPPGKKIKRLSLLSGGEK
SLTAVAMLVAIFRARPSPFYVMDEVEAALDDVNLRRLISLFEQLRERSQL
IVITHQKPTMEVADALYGVTMQGDGITTVISQRMRGQELVTSSS
145224766YP_001135444.1 isopentenyl pyrophosphate isomerase [Mycobacterium gilvum PYR-GCK]MTPDPASALQHRKRRHIDVCLTDPVDYQTLTTGFERYQLPYNALTQTDLH
SVDLGTEFMGSRLRAPVLIGAMTGGAALSGIINRNLAEAAQQLGVGMMLG
SQRVMIDDAVAAESFDVRGVAPDVLVIGNIGLAQLQPSMVPALAAALDRV
GANGLAVHTNPLQEAMQHNGDTDFSGSMSRLREVVDSLGYPVMLKEVGHG
IGASAAAQLVDCPVAAVDVAGAGGTSWARIEQFVRYGEVRYPALAEWGIP
TAQALTEVRGILPDVPLVASGGIRTGMDAAKALAMGAEVVAIARPLLAPA
VESVGAVVDWLQRFIDELLVCLHGSGAANLSALRERGVTELP
145224765YP_001135443.1 signal recognition particle-docking protein FtsY [Mycobacterium gilMSEGLWIAIAVIAVLLVVALVVGLVRYRRRQIKLSAPDTATPVDRSGGYT
ASSSITFTQSAPVKEPPAPPKEPQRPRRLDTTGLPAVGDDATIPRDAPKR
PIADVRLPEPPVVEPAPAPAPPEPVAEPEPVAEPEPLPEIQVPEPVAEPE
QVTEAPAPDIDAIAPTEGRLDRMRGRLAKSQNTLGRSMLGLIGGGDLDED
SWEEVEDTLLIADLGPVVTESVVTALRAKMASSKVRTEADARAVLREVLI
AELQPDLDRAIRALPHADKPSVLLVVGVNGTGKTTTVGKLARVLVADGRR
VVLGAADTFRAAAADQLQSWASRVGAQVVRGPEGADPASVAFDAVDTGIA
SGADVVVVDTAGRLHTKTGLMDELGKVKRVVSKRAEVDEVLLVLDATIGQ
NSLPQARVFAEAVDITGVVLTKLDGTAKGGIVFRVQQELGVPVKLVGLGE
GPDDLAPFEPAAFVDALLG
145224764YP_001135442.1 ammonium transporter [Mycobacterium gilvum PYR-GCK]MLLALPDEAFLPFGPEGLSAGDTAWVLTSAALVLLMTPGLAFFYGGLSRQ
KSVLNMMMMSFGSMGVVSVIYVLWGYSMSFASAHTGESDFFGVFDNPFSL
FGVSQLTEVREIGGVDTFVSGGFGTVPAIVWVAFQLTFAVITVALISGAV
AERMKFGTWLVFGGIWVTLVYFPLAHMVWGGGLLSGAEDGIAAKLFGVDE
EGAANVSPIDFAGGTVVHINAGMAALVLAILLGKRAGFGRTPYRPHNIPF
VMLGAALLWFGWFGFNVGSEGAADMLAGAVWVNTTAATAAAMLGWLLVER
IRDGHATSVGAASGIVAGLVAITPACGSLSAIGSVILGAVAGVLSALAIA
LKYKFGYDDSLDVVGVHLVAGLWGTIGIGFLALETGLFYGGGFEQLVVQI
VIALVAVVFTAVMTAIIAFIVKPLGWRVSKEDEDTGIDETEHAETAYELA
145224763YP_001135441.1 nitrogen regulatory protein P-II [Mycobacterium gilvum PYR-GCK]MKLITAIVKPFTLEDVKTGLEQTGILGMTVSEVQGYGRQKGHTEVYRGAE
YSVDFVPKVRVEVVVDDAAVDKVVDVIVQAARTGKIGDGKVWVSPVETVV
RVRTGERGADAL
145224762YP_001135440.1 PII uridylyl-transferase [Mycobacterium gilvum PYR-GCK]MKDSTSKPAAGASRWERPAAVSSRPATDLVAAAEQLLAGGARPLDSAALR
DALLDLHDFWLTTKATEIGITATSGFAIVATGGLGRGELLPYSDLDLMLL
HDNMPAEIVGEVAELLWYPLWDANIRLDHSVRTVPEALRVAGEDISAGLA
MLEARHIAGDADLSSLLIGGARRQWRTGIAPRFEELVEHARARWQRSGEI
AHRAEPDLKCGRGGLRDVQLLNALAIAQLADVYPSRSLASPTETLGEANL
ALLNVRTELHRVAGRGRELLLAQHADEIGASLRIGDRFDLARTLSDAART
VSYYVDAGIRTAANSLPRRGLAALRRPVRRPLDEGVIEFAGEVILARDAR
PERDPGLILRVAAASATTGLPIAGSTLSRLVEAAPELRTPWPRQALKDLL
VMLAAGPSAVGTIEALDRTGLWGRLFPEWGAVRDLPPRDVVHIWTVDRHL
VETVSRASAFTTRVSRPDLLLLGALVHDIGKGRGGDHSVIGAELAHQIGS
RLGLWPSDIKILAQVVRYHLLLPHTATRRDLQDAATISAVVDALDGDPAV
LELLHVLAEADSLATGPGVWGDWKASLLGELVRRCRMVMAGEPLPHPDPV
DPRFISLAGQVGVHVELTPTDTPHIYQVTMIAPDSRGVLSKAAGVMALNS
LRVHSASVNGHEGSAINSFVVSPRFGTPPAAELLRQQLILAIDGELDVMG
ALEKKEAESVATGRAGEVRAAVPINAPTAPPKVLWHEPSGSGHVVAEIRA
TDRTGLLAVLTRVFERAGVDIAWAKVTTMGSSVIDVFGIVLPAGEDAVRE
SLEKQLLAVLPAPPQPKPVREEAS
145224761YP_001135439.1 signal recognition particle protein [Mycobacterium gilvum PYR-GCK]MFESLSDRLTGALSGLRGKGRLTDADIDATAREIRLALLEADVSLPVVRA
FISRIKDRAKGVEVSAALNPAQQVVKIVNEELVAILGGETRQLAFARNPP
TVIMLAGLQGSGKTTLAGKLAKWLKAQGHTPLLVACDLQRPGAVNQLQIV
GERAGVHVFAPHPGVSPAGETIEQMTAHARSETAGAGDPVSVAAAGLAEA
RSKLYDVVIVDTAGRLGIDQELMAQAAAIRDAVNPDEILFVLDAMIGQDA
VTTADAFREGVGFTGVVLTKLDGDARGGAALSVREVTGQPILFASAGEKL
EDFDVFHPDRMASRILGMGDVLTLIEQAEQVFDAEQAEATAAKIGSGELT
LEDFLEQMLAIRKMGPIGNLLGMLPGAGQMKDALAAVDDSQLDRVQAIIR
GMTPQERADPKIINASRRLRIANGSGVTVAEVNQLVDRFFEARKMMSQMA
GQMGMPFGRKNTRKAAKGKNKQAGKKKGGRGPTPPKNRNPLGAGMPGMAG
LPPGFPDLSNMPKGLDELPPGLADIDLSKLKFPKN
145224760YP_001135438.1 amidohydrolase [Mycobacterium gilvum PYR-GCK]MDGTPLHVRGRRLPDGEPVEWWIVGGRLSADPVAGAETVFGADGDGGWVL
PGLVDAHCHVGLGPGGPTGLDEAIGQAETEREVGALLLRDAGSPVDTRSL
DDRADLPRIIRAGRHLAKPKRYIPGLPIDIEDESQLPEYVVQQARFGDGW
VKLVGDWIDRGIGDLAPLWSDEVLEAAIAAAHANGARVTAHVFGEDALPG
LIKAGIDCIEHGTGLTEDSIGLMVEYGTALVPTLINIENFPGIAEAAGKY
PTYARHMRDLYASCRDRVAAARDAGIPIFAGTDAGGMIAHGRIADEVEAL
KGIGMTPTEALGAACWDAREWLRRPTLRHGASADLVCFTEDPLTGAEVLA
NPTRVILRGVVY
145224759YP_001135437.1 peptidase S11- D-alanyl-D-alanine carboxypeptidase 1 [MycobacteriumMRRRLAGLAFALGALLTASVSVAAPGIAQPAAQPAAAQPIPDGPAKAWLV
ADLDTGRVLASKDPYGTYAPASTIKVLLAMTVLDHLRPDSFARANESHTK
IECSCAGLTPGQAYTTAQLVSAILMVSGNDAATMLGDMLGGQRVAVAAMN
RKAALVGARSTKASSTSGLDGPGWESVTTPHDLAVIMRAALKYPLIAQIM
RSPTAPFPGKTLHNQNELLSRYPGDLGGKTGFTNLARKTYVGAAQRGNRR
LVVVQMYGTGDLYGQAMQLLDYGFSQP
145224758YP_001135436.1 Serine-type D-Ala-D-Ala carboxypeptidase [Mycobacterium gilvum PYR-MNTTGRAGRGWIDFPVMTRLLASLGAALCLILAGSGVVSPTASAVPVTGI
VQPAGSVPVPDGPAQAWVLADMDTGAVLAARQENGRFAPASTIKILLAMV
VLDELPLDATVVANEADTRVECNCAGVAPGTTYTTRQLLEGLLLVSGNDA
ANTLATMLGGRDAAVAKMNAKAAGLGAHGTRAGSPSGIDGPGIDIWSTPR
DLAVLFRAAMAYPVFAQITAQPTAVFPTKSGDVVLVNQDEMLHRYPGTFG
GKTGYTDLARKTFVAGASRNGRHLVVAMMYGLVTEGGPTYWDQASALLDW
GFALGPNAGVSRL
145224757YP_001135435.1 hypothetical protein Mflv_4178 [Mycobacterium gilvum PYR-GCK]MMTLEEISDRLEIQQLLIDYSTAIDAKRFDDLDSVFTADAYIDYRVSGGV
DGRFPDVKAWLAEVLPNFPAYYHMLGNVDVRLGSDGNTATSRAICFNPMV
MGGDAGQIYFVGIWYVDEFVRTEQGWRMSRRVEEKAFDKLV
145224756YP_001135434.1 hypothetical protein Mflv_4177 [Mycobacterium gilvum PYR-GCK]MTDAAVTVLEIEAIKTLKARYCRYLDTKDWESWRTLFSDDFRSDTSRAGG
KVIVGADDFVAFTRRSLRTNATVHQVHAPEITLTSPTTADGIWALEDVVR
LAPGLNLRGYGHYTESYEKLDGRWLITESTLTRLREDIFNVAVSVYVSPR
MKRAIGALARRVAH
145224755YP_001135433.1 magnesium transporter [Mycobacterium gilvum PYR-GCK]MADITAPPSETQLKSLLRALDDLDLPALTALLRPLSAIQVVDVLERLDVH
ERAVLYRILPKDRALEVFEILPPSLQGDLVGALQDDAVAALFADMDPDDR
VELLDELPATVAGRLMHGLPPDERELTAVVLGYPQRSIGRRMSPEFVSVR
PTMTTAEALTRVSAGLDDAETVYMLPVVDDERVLIGVVSLRRLLTAVPGT
TIVEVMRPPHWARATEDAETAARRCADLRVLALPIVDNETRLVGILTVDD
ALQILETAESEDQARIAGTEPLRRPYLTAPVVSLVRSRVVWLLVLAIGAT
LTVQVLEVFEATLSEVVTLALFVPLLIGTGGNTGNQAATTVTRALALGDV
GPRDLGRVLLRELRVGLSLGLLLGGLAFAVTSLVYDRSIGTVIGLTLVSL
CTMAATVGGAMPLIARAIRVDPAVFSNPFISTFVDATGLLIYFTIARAVL
GI
145224754YP_001135432.1 30S ribosomal protein S16 [Mycobacterium gilvum PYR-GCK]MAVKIKLARFGKIRNPQYRISVADARNRRDGRAIEVIGRYHPKEDPSIIE
IDSERAQYWLGVGAQPTEPVLQLLKITGDWQKFKGLPGAEGTLKHKEPKP
SKLDLFNAALAEAEGGPSTEATTPKKKKAPAKKDEQPTEKAAEPAAEKAA
EPAAEAPAEAAAESEAPAAE
145224753YP_001135431.1 hypothetical protein Mflv_4174 [Mycobacterium gilvum PYR-GCK]MSSVVVDAVEHLVRGIVDNPDDVRVDMVTNRRGRTVEVHVHPEDLGKVIG
RGGRTATALRTLVAGIGGRGIRVDVVDTDQ
145224752YP_001135430.1 16S rRNA-processing protein RimM [Mycobacterium gilvum PYR-GCK]MDLVVGRVAKAHGVTGELTVEVRTDDPQGRFVRGAVLRGRPPRGGAEREY
VIESVRTHGDRLLVRFDGVADRDAADALRGTVFLVDSADLPPIEDPDEFY
DHQLEGLTVITTSGGEVGKVAEVLHTAAGELLAVRTADDTEVLVPFVSAI
VLSVSLDDQLITIDPPDGLLELD
145224751YP_001135429.1 tRNA (guanine-N(1)-)-methyltransferase [Mycobacterium gilvum PYR-GCMRIDVVTIFPAFLDALRQALPGKAIEAGIIDLAVHDLRDWTHDVHRSVDD
SPYGGGPGMVMKAPVWGAALDEICSPETLLVVPSPAGRLFTQATAQRWST
ERHLVFACGRYEGIDQRVVEDAATRMRVEEVSLGDYVLPGGESAAVVMVE
AVVRLLPDVLGNPASHQDDSHSEFVGGLLEGPSYTRPASWRGLDVPDVLL
SGDHARIAAWRHQQGLERTRERRPDLLPPDAS
145224750YP_001135428.1 hypothetical protein Mflv_4171 [Mycobacterium gilvum PYR-GCK]MPRPRRLITATALASAVATVLAGCTPAGHGAPPVSAGPHLTVVAPLGRLA
PLPEAPPDEPPAAFTRLADLERQATSKAAAAGADITAAVLDRNTGELVTN
GNDMTMAIASVVKVFIADDLLLQVAQRRTGLSPQDRKSLEVMLRSSDDSA
AEVFWNRSGGAAIIDRVVKRYGLTSTRRPTDGRWFNTISTATDLVRYYDM
LLSGAGGLPRAQADVIVSNLAASTPTAPDGMVPGGVYPQRFGIPEGLFAE
PVAVKQGWMCCIGADWMHLSTGVIGRDRRYVMVIGSMQAGGDDAARRTIT
DAVKTMFPDGRI
145224749YP_001135427.1 50S ribosomal protein L19 [Mycobacterium gilvum PYR-GCK]MNTLDFVDQSSLRDDVPAFGPGDTVNVHVKVIEGSKERIQVFKGVVIRRQ
GGGIRETFTVRKESYGVGVERTFPVHSPNIDHIDIVTRGDVRRAKLYYLR
DLRGKKAKIKEKR
145224748YP_001135426.1 signal peptidase I [Mycobacterium gilvum PYR-GCK]MTPSPEPSGPSGPSGIPEDSPTGRTLEDPVPAEEPADEEKTGKKRGALRE
AAILISIALVLYYVTLTFIARPYLIPSESMEPTLHGCNGCVGDRIMVDKM
SYRFGSPEPGDVVVFKGPPNWSIGYKSIRSDNAAVRWIQDTLSVVGFVPP
DQNDLVKRIIATGGQTVQCRVDTGLTVDGKPLNEPYLNAETMMADPAVYP
CLGNEFGPVTVPEGRLWVMGDNRTHSADSRTHCTNEPADVQKGLLCTGDP
TAGTIPVENVIGKAQFIAWPPGRWGGVNSVNPQS
145224747YP_001135425.1 ribonuclease HII [Mycobacterium gilvum PYR-GCK]MPAVWPPRTVIRKSSGLRTLESALYRAGLGPVAGVDEVGRGACAGPLVVA
ACILGPNRLESLSALDDSKKLNESERERLFPLIRRYAVAFHVVFIPSVEV
DRRGVHVANIEGMRRAVAGLAVRPGYVLSDGFRVPGLPMPSLPVVGGDAA
AACIAAASVLAKVSRDRLMVAMDQEHPGYGFADHKGYSTRAHSAALNDLG
PSTQHRFSFINVRRLVVDGEPGQGGELECGKLAVDVPVDMPVDRVLREGQ
LSR
145224746YP_001135424.1 hypothetical protein Mflv_4167 [Mycobacterium gilvum PYR-GCK]MSAEDLEKYETEMELSLYREYKDIVGQFSYVVETERRFYLANSVEMIPRN
ADGEVYFELRLGDAWVWDMYRPARFVKQVRVITFKDVNIEEVEKPELRLP
E
145224745YP_001135423.1 hypothetical protein Mflv_4166 [Mycobacterium gilvum PYR-GCK]MARRAVTLAACALVLAGGVGDVAPAHAESDVALNGVFTARSDGLWAKTNE
IMVYQQDVVATWTITSSCTTSQDCTGTVVSDQGWTANLVYQSQRWKAVHT
IENWQRCPDGSTARGEQSFTFWAARLDAADRHDRLTGWDQTIGPSGACGV
NRSLNIRMPFELTRKP
145224744YP_001135422.1 virulence factor Mce family protein [Mycobacterium gilvum PYR-GCK]MLTRLVRIQLTLFAIASVVGIAVMVLQYIRVPTLLGIGRIEVTLQLPEAG
GLYRFANVTYRGVQIGKVTALDVDRDGAEATLSLSGTPRVPADLRAEVRS
VSAVGEQYVDLQPRSRSGPYLESGAVIPSSAVTVPQRVAPMMQNLSDLIT
DIPKDKLAQLLDESFAAFDGSGYELQTLAESMTRISADMDRVAGRTSSLI
EDTAPVLDGQAASADALDTWAADLAAISAQLVDRDPEIRRILTTGTPAAQ
QVTQLIEQVRPTLPVLLANLTSLGQVGLTYRAGLEQLLVLLPPASAFYQS
AVGSNNATGIPVGDFRISVDDPPACTVGFLPPSAWRSPADTTTIDTPDGL
YCKLPQDSAIAVRGVRNLPCMDVPGKRAPTVELCRSDKAFQPLAARPHAL
GPYPFDPSLVAQGVPPDDRVTRDERLFAPPGGTPPPGSPPPPLAVATYDP
QTGRIATDDGTAVQQTDLVAPARTWKDLIWPAAP
145224743YP_001135421.1 virulence factor Mce family protein [Mycobacterium gilvum PYR-GCK]MRPVRAARRAVAIAAAVLMTTTACSFDGVSSLPLPGTVGRGDGATAYTVA
LANVGTLEPNSPVMIDDVVIGSVSRIGIVDRHAEVGIRVKAGVEIPANAI
ATVGQTSLLGSMHLELAAPLGEPAVGVLAPGSSIGLDASSTHPSTEQTLA
ALSTVVNGGGLGQIGDVVHSFNDVFAGHQNDIRELLGRLDRFVGILDTQT
DDIIATITELDRFSATLAQQRDVVSRALREIPPALDTLVRQRPRFTEALD
ALRRFSDTAGTVIDAVHTDLVTNLANLEPALRAVADLGPDISTGLGYALT
FPLNQNIIDRGVRGDYMNLFVTVDLTLGRFKRGLLAGTSFGDENAPLVPA
PGDPGYETFYSKNPLGEAVAPPPGVMGPDRLPTGGR
145224742YP_001135420.1 virulence factor Mce family protein [Mycobacterium gilvum PYR-GCK]MTRPTLIRLTAVALGTLLVASAGVIAAARLFPPTTLTAIFANANAIYPGD
DVRIAGVRVGTITAIEADGTQTVFTLQVDHGVRIAADVKAVVVAQNLVSA
RFVALTPRGGSGPVAESGAVIPRERTAVPVEWDEVKERIDRLAADLGPTA
ELTTGSVGRFVDSAADAMAGNGQKLRTAITQLAGISRVIAEGSGDITEML
SHLQTFVAVLRDSNEQIVRFEERLATLSSVLDGSRGDLDAALIHLAEAVG
EVQRFVAGTRDRTGEQVARLAGVTQNLVDHRADLEQVLHVAPSAMANAYN
MMDPRTGGASGVFVLNNMADPTAFFCGMLGALANVTAPESSKLCAQYLGP
GLDTVNFNYLPFPVNPLLTPIPSDSKLIYSEPDLRPGGPGTRSGPTAIAP
GDSAYQAQQPTVPQMLLPAERPTP
145224741YP_001135419.1 virulence factor Mce family protein [Mycobacterium gilvum PYR-GCK]MLKYRRASTVRAGFIGVVLIVLVIAVGLAPERITGWATAIRYQAVFADLS
GLSVGNDVTVSGMTLGKVTAVQLQDPNALVTFTVDDTTPLGSQSTAHIRT
GTLLGQRVLTVQSEGDGSMSAMDIIPLTRTSSPYTLTEALGDLTTNSTGT
DTAALNEALNTLSDTIDQISPQLGPTFDGLARISEALNTRNTALRRLFGS
GRDVTAVLAERSEEVSALILNADDLVAMLAERRHTIVELLAHISAVARDV
TGLVHDNEQQLAPTLEKLNTVLAMLERQRDNIALALPRLAKYQVTLGETV
ASGPYYSAYIPNLDLPPILQPFLDYAFGFRRGVDAGQPPDDAGPRAELPF
PRNGIPERPPR
145224740YP_001135418.1 virulence factor Mce family protein [Mycobacterium gilvum PYR-GCK]MRRQRGAGLKFALFVTVMALLTGCLFAVFGQYRSGSTNVYSAVFKDVSNL
RAGESVRFAGVRIGTVKDLSMQPDKTVVVTFDAERGLVLTSGTRAVVRYL
NLVGDRFLELVDDEGSTRILPAGARIPVEQTAPALDLDLLLGGLKPVIKG
LDAQEVNNLSAALIQIVQGQGGTLESLLSRTSSFSNALADRTEVIDRLIV
NLQTTLGTLADQRDDFSEGLTRLHRLVTELSAERQPIGAAIDSLSAGTAS
LSDLLTDTRPPLADTVDQLHRLAPNLESKLDRLETAISKAPENYRKLVRI
GSYGSFVNYYICSLGVRVTDLAGRTAVFPVFRQDNGRCAEN
145224739YP_001135417.1 virulence factor Mce family protein [Mycobacterium gilvum PYR-GCK]MIRPVIGLISLAAVASLTAVSVTLFRDSFAESVPLTVISPRAGLVMNPDA
KVQLHGVQVGKVVSIDYRDDGTAALHLAIDPARQNIIPADVTVDIASTTV
FGAKSVRLVPPADPSPSPVHAGQILGADRVMIEANTLFEQLVAVLDTITP
EKLNQTLGAIATAMRGRGTMIGQGLADLNSALAQIDPSLPALEHDLSTAP
AVLRSYADAAPDLMSIVAAATEIGSSIVETENELDALLVSAVGLGEVGSE
VLADNGPPLTEVLRLLAPTTELLRDYHPALSCGLGSLTVMANNPPLDVPG
VEVLAGFFWGQDRYRYPADLPRVAATGGPQCTDLPKIPYGKAPPFVVTDT
GANPWKYGNRGPIVNSDLLKQIMFGPIDGPPRNSAQIGQPG
145224738YP_001135416.1 dihydrodipicolinate reductase [Mycobacterium gilvum PYR-GCK]MHSADKVGRDAGTLCGREPLGIAASGDADEMIALQPDCVVYAASGPDRDA
AAVPDYVRLLESGINVVSTSSTALVYPPVYYSPQWREQLASAASQGGASF
YVSGIFPGFASDQLALLLSTLSASISEVKVTEVALNDHYPVAEVMMDGMG
FARPLDFEPLLKTPGFIEMAWKAPIALMADALGVEVTEVRGTLDRRLTDR
DIEVAFGTIPAGTCGAVCTRAAGVVDGREAIIVEHIIRMARDVAPDWPAS
DFDATDRVDITGDPDIHCAMNLGDAQGHGAGRAAMTATAMRVVNAIPFVV
AAPPGLLSSLDLPNTLPRHAFA
145224737YP_001135415.1 TetR family transcriptional regulator [Mycobacterium gilvum PYR-GCKMAADAAGQKPGRGRRAGRKRSGSAELAAVRDAAPADTTRRAEILKTANTV
IAATGLRSSLQQIADAAGILAGSLYHHFDSKEAILVELIRLYHDDLDRIG
DLALRKLDEPDPEPVSAQITALGCAIARCAVEHRAALQMSFYEGPSADPE
LQALSARAPEKVQAAMLQALRAGRWSGEIRSDVDLPTLADRLCQSMLHVG
LDVIRHKARTDDLATLKCRIALNGLASEAPSDASLDRSKAFAAAQSVIST
WADDEDETDLKAAHLRAVARAEFGRRGYEMTTIRDIASAAGLGTGTVYRI
IGSKDELLMSIMLEFGRKVGGAWSDIVRTDSTTVEKLDALSWLNINALDQ
FPDEFRIQLAWLRQSPPDSANPAWSFTTRIRQMKSLLSEGIRAGEIHIDS
PTADMLARCIIGEQWIPENILQEVGPRNALILARDTILRGVAVRT
145224736YP_001135414.1 short-chain dehydrogenase/reductase SDR [Mycobacterium gilvum PYR-GMIDFTGQVVVVTGAGRGLGRLYALELARRGAAVVVNDIGATMHGEGHDTT
VADTVVDEIRAHGGQAVASHESVGSPEGGQAIIDTALTRFGRVDVVISNA
GIFTSIPFESLTAERWRQMLEVHLDGAFYLSRPAYAAMMRQGYGRFVFVS
SSAGNFGQPMEAHYGAAKTGLVGLSNVIAIEGAAHGILSNTVLPTGFSRM
VTETVGDEKFLAESGFLRAIRPELVVPLVTFLASRECTVTHHNYSACAGR
YARVFTALADGWLADTANEPTAEDIERRFGTVSATEPFIVPDSIVDEVLQ
VCDRRGISAMPDNAAVTFPKGPGR
145224735YP_001135413.1 von Willebrand factor- type A [Mycobacterium gilvum PYR-GCK]MTDDTGGERCSGLGMLASALAGRAVAVDSVAGGKPAWTDGETVYVDASAP
LRTQYETVAVQASMIAAGSLTPEVVRALVRHPRLAKRYLAIEGHRALLDN
SALLPSVLAASMVPDIGRRSDSAERSLALARGREGPAEAPASFGAIQAKK
VLAVRALADKQAGDDVGHVPRRQGGQELAEFDDDDPDNWDDTDDPDLFSS
PVGGGGVIGRWLQKLLSSSRKSGGDGAGPPGADAPTHRTTSTTRGAHAVS
SLAAVSSEEIVDVTTEGVKYPEWNVDRHTYRLDWCTVREVEPEILAAATQ
QIEDAISVRRPLARLGMGLHRRPRQPQGDDIDIDAALEARVEVRAGSVPD
EAVYLDSLRRQRDLSVLLLLDISGSAAEPGTVGRTVHQQQRTAVAHLMVA
LHDLGDRVSLYAYYSQGRDAVSMVPVKRFDEHLDARVIRRLNSLEPGAYS
RLGAAIRHGSAVLEERGGTSRRLLVVLSDGLAYDHGYERAYGAADARRAL
GEARRRGTGCVCLTVGASTDVDALRRVFGSTAHATVSDPDQLAGVIGPMF
RSAVRSAEVRRRVS
145224734YP_001135412.1 ATPase [Mycobacterium gilvum PYR-GCK]MAIESGFAHKNGAGGRLEGRRPYYTPVGNEDTVFKAAYRQGLSIVLKGPT
GCGKTRFVEAMAHDLDRPLITVACHDDLTTADLVGRYLLKGDETVWVDGP
LTRAVREGAICYLDEVVEARQDTTVVLHPLADHRRQLPIERLGVTLDAAP
GFGLVVSYNPGYQSVLKDLKDSTRQRMVAIEFGFPAPEVEVGIVAHEAGV
DERTAAELVRFGQAIRRLETGGLREVASTRVLIAAARLIAEGLPVAVAAQ
VAVAGPLTDDIAVARGLNELIEVYLGETAAND
145224733YP_001135411.1 hypothetical protein Mflv_4154 [Mycobacterium gilvum PYR-GCK]MSYESTAEPIKVGYLMDFTLPPGFPEELRASFTRTFDLVFAEAAEQGLMD
RGVQMIYREVEGLPKGSVKAVIDAYGELVDEGCLVVFGPNITDNCVPLRE
AIEDRFKVPAISVTGTDDWLGEWTFAFPQGSMTDEPIFLIDLVAKRGLKE
IGVLVEQNLIGESYLRNLRSAAARKGIRIVAEEAIAQTAQDIDGAVRALY
EAKSEAIVHLGFGFGIVFINPALEAVDWDPPRFTTTAFQNAWVNPIMWNA
FLGWVGVDQYDEGNRIGQAWLDRYADRYDGSRPEYCVSVVNHDVAATLVR
AFTDAHPLSPRGVKEALERVKMMPAASGAPGTRVSFGKWTRRAWMGAGYL
VARTLDADGVNSHLVDRFGEEA
145224732YP_001135410.1 hypothetical protein Mflv_4153 [Mycobacterium gilvum PYR-GCK]MTTQKAGAPLPQAKPDAGASPRKGPNWGRWISAFALLGFFGLFTAFSRTE
LDPRVANPNVEGRPRPVEFLFGWDGWLWVHQIGCVILLVVLVAIFVRGWR
RDPGSPVMLMFLCTTLIVWQDPIMNWAPFAVYNPELLHWPENWPLIMLSP
TVEPFIVFGYVAFYFAPFFPAIWCLRKLQAKHGPTAFVSRHPLISLGALT
LVIGFIFDAILEVSLVRTGLYIYSQAIPFGTLFPGTTFQFPLIWESLAVT
FVMVPAAVLCYRDDTGKAVAEKLAARAKLFPSKPVLGTFLVMFFIINIAY
FAYGSWFAAIKASGLATAVACPWPYPEAKVYDPQGYFEKEGAQGPFSVGK
WATWQSGLPNGRPEVTPPPPGEGDCAPENADG
145224731YP_001135409.1 short-chain dehydrogenase/reductase SDR [Mycobacterium gilvum PYR-GMAERAGAQRRVALITGASRGLGFASAVRLYREGWGVVAAMRTPERGMPRL
REATGASEDDDRLVGVQLDLMDAASIAAAAKSIDEAVGAPYAVVHNAGIS
AAGVVEETDIELWERMFTTHVMGPVALTKALLPSMRAAGQGRIVLVSSAS
GVRGQPATAPYSAAKGALERWGEAMAVEIAPFGLGVTILVTGTYDTDIIT
DAGTTDNRDLAGPYARIHQTMDSRGRFAMGMARPPERFTDGLVKALEDTA
AFRRHGVGPDASMLLLSNRILPAAGMHHMSRVVLGIPRQGAMRDGAWPLT
TAQRAMVAAAKVIPQPVMQRLVQWSTRRAAGSGGGTSEG
145224730YP_001135408.1 cytochrome P450 [Mycobacterium gilvum PYR-GCK]MSQLFEDLEDFGSFDDAVSGDVRDPYPELARLRREEPIQRIDMSAMPGEE
GKPVFIVYRYEDAQQMLRDNVTFSSSGVIAAFGPVLGERVMLGMDEPVHG
RLRSLVSKAFSQKGLARWQDELVGRVGNELIDRFQADGKADLVKQFTFDY
PSRIIAGLLGLPEQDYPQFQRWSISLLSWILNPERGLAAAAALCEYFAPI
LEARRTDPQDDLISLLAEAEIDGEKLTDEEIFSFLRLLLPAGVETTYRSL
GNLLFALLSDTAQLDAVRADRSLLPQAIEEGVRWNPPLLTITRTTTCDTE
LGGVPIPAGCSVLPMLGSTNRQEDRWEDPDEFNLFRAQKANLGWGYGVHV
CLGMHLARLEMRTAVNLLLDRLPGLRLDPDGDDPHIRGQVFRSPTSLPVL
FDAVGSDA
145224729YP_001135407.1 cytochrome P450 [Mycobacterium gilvum PYR-GCK]MTDHPDADGIDFETVDYFTDAALVPDPYPYFDHLRSKCPVTQATPFNVLA
VTGYTEALSVYKNPAFSSCNSVAGPFSGMPFGPGESDDVTDLIEQHRAAV
PMAEHITSQDPPLHTRTRGLLSRLITPKRLKENEDFMWRLADRQLDTFIG
RGSAEFLTDYAKPFSLLVIADLLGVPAEDHEQFKAVFAGETVGELGKEAP
TTHNPLQWLNDKFHAYIEDRRREPRDDVLTELAQAKHEDGSTPDIEDVMN
LSTFLFAAGTETTTKLVSSAVRFIADNPGYEAMLRRDRSKIPAFLEETLR
LESPVKSHFRMAATSTTIGDVDVPAGTTVMVLPGACNRDARKFADPNSFR
PDRQNVREQIAFIRGAHSCPGAPLARAEGRISLERILDRMQDITISEDHH
GPAGDRRYAYEPTFIMRGLSELHITFTEKEH
145224728YP_001135406.1 short-chain dehydrogenase/reductase SDR [Mycobacterium gilvum PYR-GMTGKLEGKVAFITGAARGQGRAHAIAMAREGADIIAVDICRDIPSNPYPL
ATPDDLAETERSVKETGRRVVARVADVRERHELREAVEAGVVDFGKIDIV
VANAGILPMAMGNPDPMGFVDASDVDLVGVMNTVAVAIPHLPDGASVIVT
GSTAGMIRGTTTSPDMGPGGAGYGWSKRIVIEYIEEMSLQLAPRMIRVNG
IHPTNCNTHLLQNEGMYGVFRPDLKMEGKTPTREDAEPLFSLFQAMPIPY
IEPEDMANLGVFLASDDSRYITGQQIRVDAGSLLKWPNGLGG
145224727YP_001135405.1 TetR family transcriptional regulator [Mycobacterium gilvum PYR-GCKMPVPQRNSPQKPQADVRNGRRPRGEARRLLLDAARELFARKDYRATTTRE
IAEAAGVSEYLLFRHFGSKAGLFREALVVPFTSFLDQFRSTWQSVIPEET
DEEELSRQFVGQLYDVLVDHRGLLLTLVAADGLSAEDIEAAGIADIRRSL
RVLGQISAEGMQLRGLHSEQPDLPAHSTVATIVGMVAMRSTFFGENPPSR
EIIVDELVQAVLHGFLHRPDREPLSPKSVRPLQQ
145224726YP_001135404.1 hypothetical protein Mflv_4146 [Mycobacterium gilvum PYR-GCK]MGGELSPALIAGLSFAYIGGVVFLAFGVYLSIRRGRLHPLLLVSISAISF
SWIEAPYDWAVYAQFPPELPRMPSWWPMNMTWGGGLPSAVPIGYIAYFVL
PAVIGAALGRRVIARFGWRRPQTLLIVGFLVGFGWALLFNGFFGPRLGVF
VYGYVIDGLAIFEGSRYQYPVYDAVAMGLQMMVFTYLLGRVDEQGRNVIE
VWSDRRSSSKIGSSLLSIAAVVVVGHLMYGAVFAPHLATKLGGYVTEGPT
EQLWPPIENQPR
145224725YP_001135403.1 cytochrome P450 [Mycobacterium gilvum PYR-GCK]MPAHDTVELYYDPYDFAIDDNPYPVWRRMRDEAPLYYNDKYNFFALSRYA
DVSRALPDWQNYRSGKGTTADILFNGIEVPPGILLFEDPPLHDIHRRLLS
RVFTPRRMLAVEDLVRGFCARALDPLRDGDGFDFVGDLGAFMPMRTIGYL
LGIPEEGQEQIRRRTDQNIAVGDAAGDVSATVFAESLALFAEYIEWRSTH
PSDDLMTELLNAEVDEPGGSRRRLERNEVLAYTAMIAGAGGETTARLIGF
MGELLGNHPDQRRELVADPSLIPSAVEETLRFEPPSPVQARYVAHDVEWY
GQTVPEGSFMLLLNGSANRDDARYTDPDTFDIHRTGGHLSFGQGLHFCLG
SALARLEARVAFEEVLTRWPDWEVDYDNAERARTSSVRGWARMPVLAR
145224724YP_001135402.1 L-carnitine dehydratase/bile acid-inducible protein F [MycobacteriuMTEPAPDPARPLAGVRVVEISSFVAVPLAGMTLAQLGAEVLRVDPVGGAA
DYRRWPLTESGDSIYWAGLNKGKKSLAVDMRSGQGQALVARLIADAGVFI
TNVAGRQWHSYDALRTDRPDLIHAEVSGRHDGGTGVDYTVNAAIGFPLVT
GPPELSTPVNHVLPAWDVTCGIYTALSVVTALRHRDATGHGQQISIPLEN
VALATAGNLSLLTEAMINGTSRQRIGNAVYGTYGQNFTSSDGVSFMVVAL
TGRHFRDLNALTGTTESVAALSRSLDVDFSDEGERYRHREALGGLYAEWF
SAHTGAEISAALSETSVLWERYQTFAETAADARVTDNPLFTELDQPRVGT
HLAAGLPVSIDGVYPRAVPAPALGDDTDSVLGDWLSLDAARIDELRETGT
VA
145224723YP_001135401.1 acyl-CoA thioesterase [Mycobacterium gilvum PYR-GCK]MSRLLELLEVTQAQPPTWRGPASGPQGKRAYGGQLAAQSLAAAARTVDRS
KAPTAMHLQFLRGGVAGDPTDYAVVNVHDGRTAASRRVDATQGERLLTTS
TVSFAVALPGPEHGRRELPAEDPESLPQTGPPGPAPSLPLDELDLRYVDD
GSGEGFVRRLWWRTVVDLPEDPLLHTLIAVYVTDVYLIDPALQVHGHSMR
ARTHRSGTTDSSIWFHHEVRAGEWNLLECRSPAAARGRGVVTANLIRRDG
VLAATLVQEGLIADREPAPPA
145224722YP_001135400.1 AMP-dependent synthetase and ligase [Mycobacterium gilvum PYR-GCK]MTRLADHLRKHGDRIAVMTASAQVSYSELADRVDRFAGGLGTRRQLVLIE
TRNDLSTLVGYLGVLAGGHVAIPVPAAGDHSHILATYRPDVVVDGSGVHV
RSEGAHALHDDLALLLSTSGSTGSPKLVRLSRANLIANATSIAGYLGIDE
TDRAATTLPMSYCYGLSVVHSHLLVGAALILTERSVADPEFWELFARHRG
TSFAGVPYTFELLDRIGFTSMDLPHLRYVTQAGGKMSPERVRRYATAARD
RGWQLFVMYGATEATARMAYLPPDLARERPTAIGVPIPGGEFSIEPVEDW
PDTSSGELVYRGANVMMGYAHGPGDLVLDAGPDVLRTGDIARRGADGLYE
VVGRRSRFVKIYGLRIDLQRLETSLRDAGIPALCTDSGDRLAVVATAEHE
PGEVRRTAAGAGGLPPAVVDVACVAELPKLPSGKPDYPAARTLAAAASAP
APHDGDLRGVFADVLHLDRAEVTEDSSFVDLGGNSLTYVMMSLRLERALG
RLPADWQRMSLRELQNLPAPKPRRWKSWGATLETSVALRAVAIVLIVGSH
VELFELWGGAHILLGVAGYNFGRFCLTPLPRPTRIRHLRTTITWIAVPSV
LWIAFASLITDDYHASNLLLANKILGPHDSMTAGRLWFVEVLVWTLIALA
ALFCIPAMDRLERRPPFTLAMCFLGVGLALRYDALGITMGDDAMFSLLAF
WFFAAGWAASKATSAWQRAAVTAVLVVGLVGYFDEPSRHLMVLTGLALLI
WVPAIRCPAGVAVVAGVIAEASLYIYLTHYQVYPLFGSHELVGVVAAIVV
GVSVSAAVTLARQRLGRLGSGGRGGLPVGDEPLLDQGRSEDAVTPDQVRG
DDAATARRRR
145224721YP_001135399.1 hypothetical protein Mflv_4141 [Mycobacterium gilvum PYR-GCK]MAVRTPGGSMPRSLHGAADRAADSNALEKLARVGFAASGVLHLLVAYIIA
KLAFVGGGAGGGGNADQSGALATVAGQTGGAVMLWVIAAGLVALGLWYVA
EAVLGSKPKERSNEDKPAWKRVKPLGLAIVNFALAFSAARYAMGSGQSNA
QQNAGWSAQLMQSTGGKALLIAIGIGVAAVGAYHIYKGASEKFLDELRGS
YGKSVTVIGVTGYAAKGLVLAGAGLLVILATVQADPTKATGLDAAVKTLG
QAPFGKFLLIAAAVGIAAFGLYSFVRSRYGRM
145224720YP_001135398.1 hypothetical protein Mflv_4140 [Mycobacterium gilvum PYR-GCK]MTRTDTRAGVGALGEQLAVDYLQGLGLRVLARNWRCRYGELDVVVADDAV
QAVVFVEVKTRTTDRFGGVAEAVTPVKVRRLRRLAGLWLSEQDARWESVR
LDVVTVRIGQGRSPELTHIEGVG
145224719YP_001135397.1 Mg chelatase subunit ChlI [Mycobacterium gilvum PYR-GCK]MALGRAFSVAVRGVDGEIVEIEADISNGLPGVHLVGLGDAALRESRDRVR
AAITNCKFDWPQARLTLALSPATLPKTGSLYDIALAAAVLSAQTKKTWPR
LDKSVLLGELALDGRVRPVHGVLPAVLAAVHQGWPAVVVPVENLAEASLV
DDIDVWGVRSLGQLQSWLEGRGDLAPRVDSPLRGPEVSADLADVVGQTQA
RYAVEVAAAGGHNLLMTGPPGVGKTMLAQRLPGLLPPLSHKDALEVTAIH
SVAGLLSGDTPLITRPPFVAPHHTSSVVALVGGGSGMARPGALSRAHRGV
LFLDEFPEINSGALEALRTPLEDGEIRLARRDGVARYQCRIQLVLAANLC
PCAPPDPRDCVCGAAERRRYRTKLSGPLVDRVDLRVEMHAAREGTFTDEE
GESTALVRERVWAAREAAAERWRPYGFTTNAEVSGALLRRRFRLGTEAMK
PLRTAVDRGRLSIRGRDRTVRVAWSLCDLAGRVSPSKEDVTAAMSFRGLG
EA
145224718YP_001135396.1 DNA protecting protein DprA [Mycobacterium gilvum PYR-GCK]MDVMDEATRRAWAYVSRVAEPPHRLLSELVATEGVVAAAERIRRRDIDPK
LLRATEARYDLDCARDDLEVLDRMGGRLLTDTDEEWPHLAFAAFRGVDHA
RRPQGRPPLVLWVLGPLLLCDVAERSAAIVGTRAATSYGEYVAADLAAGL
VERDFAVVSGGAYGIDGAAHRATLAADGDTVAVLAAGLDVPYPAGHSALL
HRVGKHGLLVSEYPPGTRPTRRQFLTRNRLVAALGRATVVIEAGVRSGAA
NTAGWADALGRQVCAVPGPITSASSVGCHELLKRDGVTLVTRAADIVELV
GRSGEFAPDLDRPTTGLDDLDDVELAVFDALPGRGMSTVDEIAVTAGLPA
TDVLGPLTMLNVRGLAVQENGGWKLAKRWPPAAQLPLV
145224717YP_001135395.1 siderophore-interacting protein [Mycobacterium gilvum PYR-GCK]MAGRPVHTFEVVRTEQLTPHVIRVVLGGNGFDTFTPGDHTDSYVKLVFVA
DDVDVSSLEQPLTLDSFNALPAQHRPTVRTYTVRKADPERREITIDFVVH
GDHGVAGPWAASATPGRRLFVMGPSGAYSPDPAADWHLFAGDESAVPAIS
AALESLPANAIGKVFLEVAGPEDEIELQAPAGVEVSWIYRGSRADLAPEE
SAGDHAPLIDAVKETPWLPGQVQVFIHGEAQAVMHNLRSYIRKERGVDAT
WASSISGYWRRGRTEETFREWKRELAAAEAK
145224716YP_001135394.1 FMN-dependent alpha-hydroxy acid dehydrogenase [Mycobacterium gilvuMTFGNYQLEIYLQGLSGIMPAYPMDFAGWEARAQASMPPSVWSYVAGGAG
DENTQRANRTAFDRWGLMPRMLVGTTERDLTVDVFGLTLPSPIFMAPVGV
AGICSQSGHGDLEAARAAARTGVPMAVSTLTEDPLEDVAAEFGDTPGFFQ
LYTPTDRDLAASFVQRAEAAGYKAIIVTLDTWIPGWRPRDLSTSNFPQLR
GRCLSNYTSDPVFRGLLPQPPEENMQATVLQWAGMFGNALSWDDLPWLRS
LTDLPLILKGLCHPDDVRRARDGGVDGIYCSTHGGRQANGGLPAIDCLPV
VVEAADGLPVLFDSGVRSGADIVKALALGATAVGIGRPYAYGLALGGTDG
LVHVLRSLLAETDLIMAVDGYPTLADLTPDTVRRVT
145224715YP_001135393.1 site-specific tyrosine recombinase XerC [Mycobacterium gilvum PYR-GMDTVLEEFDRYLELERGRSEHTRRAYLGDLRSLFAFLDERSPGTGLGGLT
LPMLRSWLAAHAAAGTARSTLARRTSSVKTFTAWAVRRGLIGDDPASRLQ
VPKARRTLPSVLRQDQARDALEAAESGAQQGDPLAVRDRLVVEMLYATGI
RVSELCGLDVDDVDTSRRLLRVLGKGNKQRTVPYGEPAHAALTAWLHEGR
PALATADSGPALLLGARGKRLDPRQARTVVHQTVSAVGGAPDIGPHGLRH
SAATHLLEGGADLRVVQELLGHSSLATTQLYTHVTVARLRAVHDQAHPRA
145224714YP_001135392.1 peptidase M23B [Mycobacterium gilvum PYR-GCK]MRVLVLVATLVAICTAPAEADDGRLEWPMRPRPAVVRAFDAPAPNWQRGH
RGVDLGGAEGQVIQAAASGTVVFAGELAGRPLISVAHPGGLRTTYEPVSP
VVRRGQVVSTGTALGHLVAGHPGCAAAACLHWGAMWGPSSRADYVDPTGL
VVTVTVRLKPLR
145224713YP_001135391.1 30S ribosomal protein S2 [Mycobacterium gilvum PYR-GCK]MAVVTMKQLLDSGAHFGHQTRRWNPKMKRFIFTDRNGIYIIDLQQTLTYI
DSAYEFVKETVAHGGSIMFVGTKKQAQESIAQEATRVGMPYVNQRWLGGM
LTNFQTVHKRLQRMKELEAMEQTGGFEGRTKKEILMLTREKNKLERSLGG
IRDMAKVPSAIWVVDTNKEHLAVAEARKLNIPIIAILDTNCDPDVVDYPI
PGNDDAIRSAALLTKVIASAVAEGLQARAGAGADKAEAGQDGAAAEPLAE
WEQELLAGATTAAPEAAAGEAAAAPEQSS
145224712YP_001135390.1 elongation factor Ts [Mycobacterium gilvum PYR-GCK]MANYTAADVKRLRELTGAGMMDSKNALVEAEGDFDKAVELLRIKGAKDVG
KRAERATAEGLVAAKDGALIELNSETDFVAKNAEFQAVAEQIVAAAAAAK
ATDVDALKAAKLGDTTVEQTIADLSAKIGEKLELRRATYFDGQVETYLHK
RAADLPPAVGVLVEYTGDDKSAAHAVALQIAALKAKYLTREDVPEDIVAN
ERRIAEETARAEGKPEQALTKIVEGRVTGFYKDVVLLDQPSVSDNKKSVK
ALLDEAGVTVTRFARFEVGQA
145224711YP_001135389.1 sugar transferase [Mycobacterium gilvum PYR-GCK]MCVGVLFVNALSRAELTYSAWRNAKTVLVNVTNTVDTARTAKAVTNGRTS
EVAPADGGQLHKRRGWEPFLAAAIDLSTGSLAVAVGMTWATASDLELPPT
WMLFFFAPTLVGLCAMRGLYRRSLRRTFLDELPTIESSTALAAMLLLSGL
ILNPFLPESEGSSVGRLWMCAAILVPLGRLLWITIKNYHYRHDRLTAPTL
IVGNGRVAAKVVDRLKVTPEYGMTPVGIVDDEMPMMGTDRDKPASIPYLG
KLADLDSAIAATGAECLIVAFSRTRDEAMSAAVNLAHERGMSVWIVPRIF
DTIGVRSHIDHIGGLPLIAVAHTNPRGWQFAAKHVSDRVLAGVGLLLISP
LFLTLMLLVRLSSPGPIFFGQPRIGRDGREFSCLKFRSMREPKESDAAFV
RSADSAPGGVEGEDRRTTIGKIMRSTSMDELPQLLNVIKGEMSLVGPRPE
RPEYVDLFNIQIARYGDRHRVKAGITGWAQVHGLRGKTSIADRAEWDNYY
IENWSLWLDFKILAMTVGAVLRPAE
145224710YP_001135388.1 amidase [Mycobacterium gilvum PYR-GCK]MERIAAFGDDALADSDAVGLVEALRAGTVSPTELLDAAIARLEKVDPHLN
GLAHAAYDGARARAAQHRRYGGFFDGVPSFLKDNVAVAGMPTMNGTDAWA
PSPAAAHGDFARAYLATGLVPVGKTQMSEFGFSAAAEHPRLGAVRNPWNT
DHTAGASSSGSGAFVAAGVVPIAHANDGGGSIRIPASCNGLVGLKPSRGR
LPLDRDMRQMPLRIVANGVVTRSVRDTAAFYREMEKISAGPKLPPIGDVT
GPGVRRLHIAVCTQSIIREASAEVRDATLATAALLEGLGHRITVIDNPVP
KNFIDDFVLYWSFLAFALVRGGRRTFGASFERTRLDNLTLGLERHAARNL
HRVPAATARLARTRRITAGLYGTYDALLTPTLAETTPPIGHLNPTAPYEQ
IIDRLIEWVAFTPLQNATGEPAISLPLAQSATGLPIGLMFAAPVGHETRL
LELAFELEAAQPWPRLAA
145224709YP_001135387.1 hypothetical protein Mflv_4129 [Mycobacterium gilvum PYR-GCK]MPTAIRAPQPAAGSGNTVTCLIRFALANIRRRPERFVLAVLGIALAIACV
TVVRTISASFAATGEESVADVLGSAALWVVPAAGVHYDAQAGALIADGDA
PEISIPGGWTATRVLSGLVDIDGEGVSLRGSDEIASGTATVGHALAERLA
VVDGGTVTVGGRRLQVSVEAAGQSLTVQTALARSLVGERGWWLVNAPPGG
EHRRDLGAAFGAAVGLPFTPDPAVRPDGDGAGLVYDTVGGSGPLTFEQKY
SALFSGKVTSSTLGLISTIGLGLGFVIAVSSFLAAVTERRREFGIMSSIG
LADEVLYFFLVESAVIFVTAYLVGVTAAGIAVAVVIPGIASVASWLQGAA
LTAMFLPAMAIVGALVPVHRLLQQRPVSLLGDR
145224708YP_001135386.1 hypothetical protein Mflv_4128 [Mycobacterium gilvum PYR-GCK]MSTQKGLAYGWLAARRRVREMVLPAITTATGAYLVVLVFGMSAGIREQSE
SLGYADEISRAVVLIAVTVLLVGVAEVAVVTTRTVAHRTRELGVLAANGV
PRAPVVAALLVEPLLAAVLGALAGVLLAVVTGIVLGIAGLVATGVSSAGL
AAGSGIAVVVSVAAAVATSVVPTWKAASRPPVQSLASGA
145224707YP_001135385.1 ABC transporter-like protein [Mycobacterium gilvum PYR-GCK]MTVVDETPDTPTGPVADPAPVIEISDVWKLHKLGDEVVKALMAAELTVMP
GEFVCLMGPSGSGKSTLLNIIGGLDRPTKGNVRIAGTDTATLTESQYAAL
RHDTIGFIFQSYNLIPFLSAVENVELPLMFEPYDRKALRKRAIELLELVG
LGHRINHQPTRMSGGEQQRTAIARSLISNPALVLADEPTANLDHRTGETV
VRMLRDLCSTMGVTVVASTHDPTVADEASRVVRMKDGQIVN
145224706YP_001135384.1 amino acid permease-associated protein [Mycobacterium gilvum PYR-GCMTQTEPSPSAGRDKLMTTELVPEQILPKVMTTFGLTAAYVFIICWITGSS
VMAGGGWTAIPMWVLGILTFLVPAGMAVVELGNLWPGQGGVYIWATRTMG
ETWGFIGGYLSWVPVILNAASSPAVVLQLLLLAFHAELGLTTSIILQLVI
LWTVIGLALAKLAANQKIMNVVFVVYGVLTLTIFISGLMFAVENGSATPF
SWAEATIPNFAVAGFLYGTVLLYLLGVETPYNMGAEFLSVRKSGPKMILW
GSAALVAIYLLTTLGTMMALPGDQIDPVTGVIGMLDVAGFPGLMEIGAVV
LAFIVIVALMTYQVAYSRLIFVSGLERHLPRIFTHLNPRTRNPVTAILIQ
GVISSLILVGLYSQSSMANVTVYLQGGLSTVWLLSGFFFLIPVVVARKKY
ADRYESEQFWRIPGGMAGVWTTVVVGSLATAGGIYYSFVTPWIDVPSSTW
MTWVGSISLGMFALGLTVYIFGRRSAHKVSQEDSLAHLAVFDLTNKEEEP
TK
145224705YP_001135383.1 tyramine oxidase [Mycobacterium gilvum PYR-GCK]MTMEDTRIGADPAAGLAPYPLDPLTVAEIESAAAVVRASDYATPTLKFVM
IQLAEPAKTPALTFADAPDTPRCAFLTMYDAAAKMIYEAVVDLRAGLIES
WTPIPGRFPSYLVEHMTGVEEKVREDPRWQEAMRRRGVTDFSLAMIDPWP
AGYYGAQDHYDNSPLVCRPLTFMRAAPSEHGYARPVEGLIVTFDLDAMAV
IDVEDHGVVPLPPTAGNYSEAFMFDPNNRPAFTAFRDDVKPIEITQPDGP
SFTVDGWNVKWQKWSLRIGFNPREGITLHEVTYTDRGETRPVLYRASLSE
MVVPYGDSAPTHWNKNVFDMGEVGMGFSANPLTLGCDCLGEIHYFDGTVN
DSAGNAVTIPNAICMHEEDFGISWKHTDFRTEEVEVRRSRRLVISMICTV
GNYEYGFFWYFYNDASIEVEVKLSGVLTTGAVEMAPGEQPRWGKMVAPGI
YGPNHQHFFNFRLDMSVDGPGNSVYEVDSIPEPDPARNPHRNAWITRDTL
VASESDGARDWNWSTGRYWKIANPSRRNELGIPVAYKLVPKDVVPVMVQE
GSYIYDRARFLQHNLWVTRYDPAEKFAAGDYMYQSADTQGLPEFVAGDEP
LEDSDVVLWYTLGAHHVVRPEDWPVMPCAYTGFHLKPIGFFDGNPALDLP
PSPPKACHATRAGLPVAERALES
145224704YP_001135382.1 uridylate kinase [Mycobacterium gilvum PYR-GCK]MADPVTDQTPESRRAYTRVLLKLGGEMFGGGQVGLDPDVVALVARQIAEV
VRSGAQVAVVIGGGNFFRGAQLQQRGMERTRSDYMGMLGTVMNSLALQDF
LQKEGIDTRVQTAITMGQVAEPYIPLRAVRHLEKGRVVIFGAGMGLPYFS
TDTTAAQRALEIGAEVVLMAKAVDGIYTDDPRLNPAAEMLTAISHREVID
RGLKVADATAFSLCMDNGMPILVFNLLTDGNIARAVAGERIGTLVTT
145224703YP_001135381.1 ribosome recycling factor [Mycobacterium gilvum PYR-GCK]MIDETLFDAEEKMEKAVSVARDDLASIRTGRANPGMFNRIHIDYYGASTP
ITQLSSINVPEARMVVIKPYEANQLRPIEDAIRNSDLGVNPTNDGNIIRV
SIPQLTEERRRDLVKQAKSKGEDAKVSIRNIRRKAMEELARIKKDGDAGE
DDVTRAEKDLDKSTHQYTSQVDDLVKHKEGELLEV
145224702YP_001135380.1 phosphatidate cytidylyltransferase [Mycobacterium gilvum PYR-GCK]MTDQHSTPVGPQPVDEPPKKSSRAGRNLPAAIAVGVLLGGGLIAILIFAP
YLWLALLSAAVAMATYEVSSRLGEAGYRIPFVPLLVGGQATLWLTWPFGP
SGALGGFAATVVVCMIWRLVGHGLNHAPQNYTRDIGATVFLATWVPLFAS
FGALLIYPDDGANRVFCLMLGVVFSDIGGYVAGVLFGRHTMAPAISPKKS
WEGLAGSLLFGVTASVLAVVFLLDKPWWAGVALGLMLVITGTLGDLVESQ
FKRDLGIKDMSNLLPGHGGMMDRIDAALPSAVATWIVLTLLA
145224701YP_001135379.1 ribosomal RNA large subunit methyltransferase N [Mycobacterium gilvMPDPLPLVFDAPRRALPPRHFADLADTERAAAVADLGLPAFRGKQLANQY
FGRLISDPSQMTDLPAGVRDQVGAALFPELLEAAREIECDRGETRKVLWR
AVDKTTFESVLMRYPDRNTVCISSQAGCGMACPFCATGQGGLKRNLSTAE
ILEQVRFASAELRDREGGRLSNIVFMGMGEPLANYNRVVAAVRRITASSP
HGFGISARSVTVSTVGLAPAIRKLADEKLNVTLAVSLHTPDDELRDTLVP
VNNRWKVDEVLDAARYYADLTGRRVSIEYALIRDVNDQPWRADLLGRKLH
ATLGPLVHVNLIPLNPTPGSEWDASPKPVEREFVRRVRAKGVSCTVRDTR
GREIAAACGQLAAQG
145224700YP_001135378.1 hypothetical protein Mflv_4120 [Mycobacterium gilvum PYR-GCK]MREPGLADELEIHALLYRYARAVDTKDWDLYRSVFTEDAHIDYSSAGIPP
GSRDEIADLFSAAFEAIPWTMHYITNIEVLERGSDTASVRAMFYNPMQLP
GMAEQSSCGGYYHHELVRTSDGWRSRHLREDNVWFVNRPGGPS
145224699YP_001135377.1 aldehyde dehydrogenase [Mycobacterium gilvum PYR-GCK]MLSPMTTAETETGVLAGDERMLIDGELQNTGSGATFDVIHPASEQVAGVA
TDGTVDDMSRAVGAARRAFDTTDWSRDLDFRYHCITQLHEALERNKERLR
RVLITEVGCPVSVTGSQIESPIEEVKHWAEHGRNFDYLVDNGVHDTPLGP
ARRKIHYEAVGVVGAITPWNVPFYLNIAETVPALMAGNTVVLKPAQLTPW
SGSEYGRIVAEETDIPAGVFNVVVSNANEVGAALSSDPRVDMITFTGSTA
TGRAILAAGASTVKKTLLELGGKSAHIVLDDADFNSALSMAAMMACVMSG
QSCILPSRILLPRSRYDEGIEILKNMMENFPVGDPWTPGIMQGPQISDTQ
RQKVLGLIKSGIDSGARLVTGGGIPENLPVGYYTQPTLLADVDPDSQVAQ
EEIFGPVLTVTPYDTDDDAVAIANNSIYGLSGEVSGGDLERAFAVATRMR
TGNVTINGKSHFGIGSPFGGTKQSGLGYRNGEEGYKEYLDAKTIGMPDQ
145224698YP_001135376.1 TetR family transcriptional regulator [Mycobacterium gilvum PYR-GCKMNQPADDAQTPDDVSTRQRILAATAEVLGRSGQTKLSLSEVALQAGVSRP
TLYRWFADKQALLEAFGVHEREMFETGILKATAGLRGTERVDAAMRFIVE
YQQSYSGVRLVDIEPEVVISRLAHIIPLMRAQLEKLLPGANGAVKAATAV
RVAVCHYIVRADDDDQFLAQLRHAVGLRATD
145224697YP_001135375.1 hypothetical protein Mflv_4117 [Mycobacterium gilvum PYR-GCK]MSVLSERIAPAVGLASHLGRGVRRIGTDTLIGRLLPLPRTIGDLGPDAMS
SLMGRSVTSVAVLDGDAGTSSRARLALTGDGVPATVFVKMAAETVATRLM
GELGNLADTETRFYSRLSAELTGVPRCHGSRFDPRTGRFVLILEDLADAS
AGPCDFPDTLHPIDADRAALVVELLARLHATFWGRLPERRGTGPLGWLYS
ASEDSASLLTAPLLRTSARRLAERTALPVGRGRFIDENYRAAAALIDRGP
HTVMHGDAHPGNLYFRAGQAGLLDWQAVRRGHPSRELAYTLTTSMTVEGR
RGSQRDLLEVYRRALAAGGGPELDRDDLWDRYRQAALYPYVATLITVGMG
GMQVEDIAMKGLERALEALDDLETVALLEKNL
145224696YP_001135374.1 L-carnitine dehydratase/bile acid-inducible protein F [MycobacteriuMAGPLEGIRVVELGVWVAGPAAGGILADWGADVVKIEPPTGDPARTFGRM
LGIPPQDRHHVSPPFQMDNRGKRSVVLDLASPDGRRSARELIDGADVFVT
NIRVGGLRRIGLDFEALAAANPRLVYGLITGYGTEGPDADRPAFDVAAFW
ARAGLAHLLTRPGDVPPFQRGGMGDHMAGMTLAGAICAALVARARTGTGQ
LVSTSLYRQGAYTVSFDLTTFLITGNPIAIGQREVMGNPCMNNYSAADGK
RFWLVGLQGDRHWPALCAAVQRPDWPTDERFATGRARAANAAELIAELDA
IFARRTLAEWTEVFAAHPDLFWSPINSMEDVIGDEQFHAAGGIVYVPDDE
AGSVPMVATPADFHGTPAQIRCSAPELGAHTEEVLTELAQRTNRST
145224695YP_001135373.1 hypothetical protein Mflv_4115 [Mycobacterium gilvum PYR-GCK]MAVHITDLARPTFTPQAQVIIDGMAAMAPYCPLTAEALHEQASAQTGLTD
FGDQGYRERMSVLLQAFEELPGLTSFGRTYAFSLMLTFLKGRLQVVDHLK
RYPEVFDIDIAAPMIIAGLPRTGTTHLHSMLAADPALRSLPYWEAQEPLP
PPGEEGTIEPRRQRTGDALNISNTLMPYFQLMHEMTVDHIHEDIGLMVQD
FSSGFFTTLTHLPRWSDYLRDHDQTPGYQFLRMMLQVLSHQDGSTRRWVL
KSPQHLEQFVPIMNVFPDATFIVTHRDPVDVSVSMATMMTYTMRMSVDEV
DVPTVAGYWIDRIDEMLSACLRDHDKLPAERTIDVRFDEFMADDLAMVQR
VWDTAGYTPSDESRAAVAEYLAGHTRGRLGTVDYRAEDLGVDRDELRRRF
APYVERFVR
145224694YP_001135372.1 hypothetical protein Mflv_4114 [Mycobacterium gilvum PYR-GCK]MSSTESAAAWRELLSAFAEFDNQFLDGPKAVRGQTAVAEGYQNLATMLAL
SLDMHFFADPVAPRFLDTLTPFRPDRRWGGDNTDCYYGYAVVDPRRTYRV
SGTPNDSVMYSITVYNEPEPGAWPNRTVGLLYDTDMPIGEDGRFSCVLGP
RRPDGYGGPFIELAPDARGIITRDYHEHPESGARVEWDIEVVDHAGLEVV
PAKSDADVARSLRATLRFAQDMYALIPLILAERKPVELADGQSLSLNTLA
PPYRAGAATHGFSMQDACYSLGGFSLEPGEALVITSTHPRCRFWNLTLWN
QYMAALDVEYGRAGINSGSAVPNSDGSVTIVVSTEQLAHPNALSTKGHPE
GLMSFRWFLSDDLPERPVAEVVPVAQAPVSVS
145224693YP_001135371.1 TetR family transcriptional regulator [Mycobacterium gilvum PYR-GCKMGRKGWGGVPPTDDAEARDRILRAALASIERRGPRLTTLTEVAADLGITR
PTIYRHFGSTDELLAAAAEIALDHWTARIGRMAVRLEDATDFLVEAVAYL
IEKLPHEPLLATMLETDRTRVMSRQMVMPAAVRRSREMLENTRIDWASAG
FGGSRMDDLVEFLLRMIQSMVIAPPDPPRDPVALREYLRLWIGPAMAAGA
GPVS
145224692YP_001135370.1 TetR family transcriptional regulator [Mycobacterium gilvum PYR-GCKMTMPSPAPGSADPDNPTRQRILAATAEVLGRNGTTRLSLSEVAAQAGVSR
PTLYRYFADKRELLDVFVVWERQYYERAIAKATAELPAHERLDAALRVIV
EYQLSYPGMRMVDVEPDQVIRRMSRVLPLMRERLERLCTGPDAALSAATA
VRVAISQYLVRSDDSADFLAQLRHAARVRHPGR
145224691YP_001135369.1 putative ferredoxin [Mycobacterium gilvum PYR-GCK]MKVEVDLAKCTGHGICETIAEDVFEVQDDGTVVILDAVRPESDRERLQQA
VTQCPAAALRLHES
145224690YP_001135368.1 hypothetical protein Mflv_4110 [Mycobacterium gilvum PYR-GCK]MSDSYYELVDADDARGERFAATDLVRSTWSASIQHAAPVSALLVRALEHC
ERRDDTRLSRVLVDLLGPVPAEGDLWVRVRIERPGRQIELVVTELLAPGP
DGEPRPVARASGWRLQTLDTVAVLHAPAAPLRPLSQARSRDMKKDWDRNY
VHSLDWRWLTAPMADGPGESWIRPEVDLVGGEAMTPLQRLFAVADDANGI
GTRLDIRRWTFLNTDLAVHIHRLPDGEWIGIRAETSYGPDGIGTTLGTLF
DQTGAVGAIQQSVLVRPR
145224689YP_001135367.1 SMP-30/gluconolaconase/LRE domain-containing protein [MycobacteriumMTLTPLADGFCFGEGPRWFEGLVWFSDMLGEAVHTVTLDGATSTLALPGH
APSGLGFRPDGTLLIVSTELRQVLGYDGETVVTVADLSALVPANLGDMTV
DRHGCAYVGSQARDGGVIVRVDPDTGRATVVAENLQFPNGMALTADGATL
IVAESTGRRLTAYSVADDGTLSDRRIFADGLDGPPDGICLDDEGGVWVGM
TLAHQFERVVETGGQARVTDRIDMGGRTAIACTLGGPEGRTLFLVTTTDA
YPERLRGTTLSRLDAVTVDVPAAGFVGEVHVH
145224688YP_001135366.1 hypothetical protein Mflv_4108 [Mycobacterium gilvum PYR-GCK]MTLQNTGQVSRSLGAAVNQEHVVNMKKYHSHTLLYLHETMDLGTARGDRF
IAEFSAVYHPMMSELGARLFAIWETTPYNGHWPQVTIIWEIDAFADYARI
GRAQARGGSHEAAAAAWSTYLHDTGVRGEGRIMYAGRSNRTLAQLQEADF
KAGLVIQEVMQTKPGRQDDYIRELERLYVPWSESTGKRWLGSFITTFRFN
EVIHYWALEGDWACFENHYPSWKDSPPAEIVTWMSVAPALRDGWEDSILA
ALPPSPLQ
145224687YP_001135365.1 cytochrome P450 [Mycobacterium gilvum PYR-GCK]MRYDPFDPAVMADPLPYYRVLRDEHPVHYLETWDTYALSRFDDIWNVLEI
NDGTFVASEGTLPAAAVLARHNDGPVADPPLHPMPFHANFDSPIYEDVRR
CTATPFRPKNVAKLRDRIRVLANERLDELLPLGRFDLTQDYGGIVAASVV
CELVGLPAEMAADVLATVNAGSLAQPGSGVEVANARPGYLEYLTPVVERT
RAGEPGDLPIVDNLLAYRLPDGSALSDMEAAVQMLGVFIGGTETVPKIVA
HGLWELSSRPDQLADVVSDLDANVPVAREEMIRYCAPAQWFARTLRRPFT
LHGTTMRPGQRIISLLASANRDEREYPQPDEFLWNRPIARLLAFGRGQHF
CLGAHLARLEITIMVTEWLKRVPEFRVDAAAASRPPSSFQWGWNNLPVDV
HGVGG
145224686YP_001135364.1 alcohol dehydrogenase [Mycobacterium gilvum PYR-GCK]MWSYRLVAPYTFERTEQPQRSPESLAENQVLLRFLAGGICGSDLPGFRGA
RGRLAFDTGRQAAEKDGFPIHEVVGEVLASRHLAHTPGDRVVGWASGFDG
LAEEVVADGEGLASYDPSLDPAHAVALQPLACVLYAVEQMPDLAGRHVAI
LGQGSIGLLFSYVAKAAGAAHVTGVDPVDRSAVGAAFGVDTVVRATSDRW
VSHLGADDRPDVVIEAVGHQVATLTHAVEAAAFGGFVFYFGVPDDDWYPI
SMRTMLRNNLTLKAGVTLERRRVLRCADEFAAAHPGLLDRYLTHTFGVDD
VQQAFELAARPVPGRVKIAIEAR
145224685YP_001135363.1 HpcH/HpaI aldolase [Mycobacterium gilvum PYR-GCK]MTSRLQQALSSGGPVWGGWVVGPTVIGPEEYAAAGYDYVGIDVQHSYLSD
ADVALMLRRLEHVPIATVVRLPDAAPAPIGRVLDAGADGVIIAMVESAAD
AAAAVAATRYAPGGVRSFGPLRASLGLDPSALQERASVFAMIETTRGLAA
VDEICRVDGLTGIYVGPADLAISMGHGPTDAWSRRDVFDVILTAQRAAAA
AGVVSGIHASAGSAGNMLAQNGFQMITLASESQALRRGAAAHLSDARGES
GDGR
145224684YP_001135362.1 short-chain dehydrogenase/reductase SDR [Mycobacterium gilvum PYR-GMAADRIALVTGAARGQGAAIVTRLLQDGFRVAACDLLGDDVTRTVAAHDT
DHAVAIELDVTSAEQWTRAVGEVVDRFGGLSTLVNNAGVLHRASLADETP
DGFEGSWRVNSLGPFLGIQAALPHLKAAEGAAIVNTCSTGAIRPFPNHAA
YGSSKWALRGLTQVAAVELAPSGIRVNAVFPGPVETPMLDANTQTRLAAN
ALMGRIGKPMEIADAVAFLVSEHATFITGSELIVDGGQSLQIG
145224683YP_001135361.1 cyclohexanone monooxygenase [Mycobacterium gilvum PYR-GCK]MAKSLSVGIIGAGPGGLALGIFLRRAGFDDFTIFDREDGVGGTWRINTYP
GLACDVKSHLYSYSFDLNAHWSRLWSGQKEILEYFERCAQRYRLQEKLRC
NTEIVSARWVPSERRWRLRTSTGAEHSFDVVVSAVGMFTQPVMPDLVEEE
PFTGTVMHTARWDHSVDLRGARVAVLGTGSTAAQLVPEVAKQAAAVYSVQ
RSPTWVLPKPDRPYTDREKWMFAHVPFAKKIYRTRLWLRSESNISVIEHG
SDKTQEFKSIALRTLEATVSDDELRARLTPDHPLGCKRLVFATDYLKTLT
EPHVDVVSSPARALRSRSLVTEDGTELDVDVVLCATGYAAADYLGQIDVR
GADDIPLSQTWRDGAFAYLGMSVPGYPNFFMLYGPNTNVGSNSVIFVLEA
QARYIVRALKYLRRRNRSYIEVRSDVMKRYLDKIDSWMQGTVWLTRCSNY
FRAPNGRVVTQWPRSARDFWALTRWFRAGDYVFEAPSARETISVGAQAEA
ER
145224682YP_001135360.1 alpha/beta hydrolase domain-containing protein [Mycobacterium gilvuMTRDIAERLDPQLRHLAAARTDLSPPVLGAVRDSLNQRRAETARTADLIG
VEVEQREVPVPAGHTVTVRIYRGGPPQSPAVIYCHSGAFVLGNLDTDHRQ
CIEMARRGRCTVLSVDYRLAPEHPYPAAQDDVSAILDWAVRCSAELGIDA
TAVAVAGSSAGAALAAGLARRSAAGDGPPVVFQMLHQPVLDDRPSPSKDE
FTTTPGFDAEAVAWMWRHYGGDASLPDEAVPARIEEMSSLPAALITCSEL
DPLRDEALDYALRLLWAGVAAELHVFSGTCHGFDSLVPEWEISRQLFDIQ
GTALRRAFLR
145224681YP_001135359.1 hypothetical protein Mflv_4101 [Mycobacterium gilvum PYR-GCK]MGIVTTTSETAFTQSPEQIYDFVTNPVNWTRTYPGSAHVGRIPEKLPLEV
GDTWTETGPDGSRIFTWHLAIAMRPKLWMFNSVGNLGHDSDGNGGMPGRI
TVQYKFTQPGEGITLFSRTMTVEAYRDAPLPDGFFRTVNPANIDAYHEAV
ARELALEDSA
145224680YP_001135358.1 acyl-CoA dehydrogenase domain-containing protein [Mycobacterium gilMGVAVDFSEVELCDADKAFRDEVREFLAAVVTDDVIRRDLESGDNFDEQV
HLALGSAGYLERDWRAEADGGFTAVQRRIFELEIGRAHTPWFHWPTTAMV
ANAVDHFGSDELKDEVLPQVLAGRYRLCLGYTEPEGGSDIATCKTRAVRE
ADGSTWIINGSKMFTSNAHHAQYVYLITNTDPQAPKHQSLTMFLVPLDSP
GVEIQPIRTVDGDRTNITFYSDVRVDDRYRIGPVNGGWGVLREALNAEHG
TVERDASGLQKIAVMTEHALLLAEEVDRVASVVGDRLGDGEVAYRLGRSV
ARLEAALSTPEMFGRVAIAQTLRDITPDLMDILGPASVLPSGRSAEYLFR
LALPMGIYGGTLDVFRNMIAQHALGLGKPNYSPPR
145224679YP_001135357.1 hypothetical protein Mflv_4099 [Mycobacterium gilvum PYR-GCK]MFDSLVPEPGALAGLSDAELVDAAGAAARAENAVCARKLAVMAELFTRRV
DLAPEDRLNWWVDPDAAVAAEIAAAVTITQGLATHQTYRAVVLRDRLPKV
GALFLAGLLSELLVRAIITRTDLITDPELIAAVDADLAADILRWGPQSAK
KTEAAIDHIVERHDPDAVRQSRQHDVGRTIEIGNPGDAPGYTTVWARMFA
GDAAAGHRTLTTMAYSVCDNDPRTLDERRNDALTALFHGITTLACRCGHT
DCDAATNPRPPRELTVYALTDQTAANAASEEPRGDATDADAGAVDAQPAT
PPVKPRRSKPTLLPGRSGYLFGSGFMPAPLFDALLDGAKIREILHPGQAG
PEPRYTPSTALADFIRCRDLTCRFPGCDTPATEADIDHTVAHPVGPTHAS
NLKCLCRFHHLLKTFWTGPGGWHDRQDPDGTITWTAPTGHTYITHPGSRL
LFPTLCKPTATLWAGDPPQVPIRERRGAMMPRRAKTRAQNRAAYITAERT
HNVEHRTDSPRGNDPPF
145224678YP_001135356.1 luciferase family protein [Mycobacterium gilvum PYR-GCK]MRRPEIGVYLPQMGFSFDEVLHRARRCEDLGIDSLWLYDHLYGPGMPDYP
SMEAWTLATALLSRTERLRIGHMVLCNQFRHPVTLAKMVTTLDQISGGRL
SLGIGSGSIEDEHRRAGLPWGTFAERSAQLGETLQILRQAFTDERVDFAG
RHFTVTDFPIKPGPVQKSGPPIVVGGVGEKYTLPLVARYADVWNVPTYAL
DQIEPKIAVLRSICEDIGRDPDSIVLSIEAVMAVAPDQESLESVRMLAEK
RFRGPGFGLHDTGLIGTPAEIAAKLGRLVEIGFGQIVLFTHDRCSDQTLE
LLASEIIPRL
145224677YP_001135355.1 luciferase family protein [Mycobacterium gilvum PYR-GCK]MQFAITHPMHSHPYNPELVTGAGIARVAVAAEKAGFGGFGFTDHPAPTQR
WLEAGGHDALDPFVAMGFAAAHTTTLRLIPNIVVLPYRNPFVVAKAGATL
DLISDGRFTLAVGVGYLKREFAALGVEFDERAAVFEEALDVITQIWTTDD
LSYDGRNFSAKGITAHPKPLTTPHPPIWVGGNTSAARARVAKYAQGWCPF
RAPAMLAQTARTAALETTEHLAKGIDDLRRRLEDAGRDPADVDITFTNDA
GGAPGTDDFNADEFLAGAEELERAGVTWLQVNVPGDSLAHAVEAIEGFGE
TVIAQR
145224676YP_001135354.1 TetR family transcriptional regulator [Mycobacterium gilvum PYR-GCKMGRKGWAGAPPRDDEEARTRIVEAALTCIERHGPSQTSLSDVADTLGITR
RTVYRYFATTEDLFTAAAEVALGGFVRRIETITADIDDVAGQLVEVVAFI
VERLPEEPLLTLLLENDRTNQFSRRMLSAPVIDRCRVILRHSRIDWEGLG
YVSDADIDELIEFLLRMIQSMVIAPPEPPRDSAALRSYLHRWVGPALTAG
R
145224675YP_001135353.1 hypothetical protein Mflv_4095 [Mycobacterium gilvum PYR-GCK]MTELHVRRPRFDFTADVPWQWNPASPAFSYFMNATSIIAVCFEQMIVAAV
TEARPLISDPSVAEEATAFLRQEAQHSASHRKHVNALIAHYPGLQHTVDA
TMAEFDALTASTPLAYRLAYIADLEATFTPSFKLMLDNEASLFRPGDERV
ASLFLWHFVEEVEHRSSALVIYDAVIGDPWYRLRKVPAVVRHLLGVIAVI
AEGVNTHIPESDRAVDARTMHPWHGTRTALRQRISRDRHTAPPAFAGVPR
TQKLIAGWRVLLSQLPFHDPADEPLPGFADEWFARWERGEDVTRWYSSRR
AG
145224674YP_001135352.1 alcohol dehydrogenase [Mycobacterium gilvum PYR-GCK]MSTLTNRQILLRRRPTGLVDPEDTELVSVPAPEPADGEALVRTTYVGIDA
AARTWLDDQPGYLPPVGLGEVIRAAGIGEVIESRCEAYAVGDIVTTLTGF
QEYTLVRDDLFTTPVPGPADQVDQLAVMSIYGPTGATAYFGMVGIGRPQQ
GETVVVSAAAGATGSVAGQIAKIAGARVVGIAGGPHKCRAVVEDFGFDAC
IDYRNDDLRAELKRHCPQGVNVYFDNVGGPILDAVLGRLAHKARVVLCGV
ISSYLTGEHPGPANYVNLLAKTATMQGFNALDEWGRFDEAFTALRRWEEQ
GLLTHREHIFDGIESCVDALNGLFTGANIGKTLVRLGIGDDASTRSS
145224673YP_001135351.1 acyl-CoA thioesterase [Mycobacterium gilvum PYR-GCK]MTGVKLSWISQFLQFERRGDTFVTTPPEVAPGLRLFGGLIAAQALGAAGA
TVDPGKHPQSLHLYFVRGGRYDADVELQVERTRDGRSFDTRRVTAVQQGA
VILEMIASFHTPEPGADEFPPHPPSVTLDETESMEPDVEFTDLFEIRTGP
GDPSIFVTPPFWIRSREQVEDDPLIRACALTFLSDFGPVPAAHPQHTPLR
PGTGQAASLDHSVWFHRPFDPHEWHRYEVHPLNVGDSRGLVHGSLYDGSG
SLVATTTQEALWRL
145224672YP_001135350.1 hypothetical protein Mflv_4092 [Mycobacterium gilvum PYR-GCK]MVATAHRREPRTDEPDENCCHRDTSMSLVAGRGPLSRDRAGQLIPPVADD
LVYVEPHPRRVQAVLGGRTVIDTEHALMVHRRGAPLSYAFSAGDIGDLPS
TPVPEAPGYAVVPWSAVDSWFEEGRELVHYPPNPYHRVDCRPTARRLRVD
AGEVTLVDTTDTTILFETALPPRLYVRPSAVRTDLLRRSSTTSYCNYKGY
ATYWSLDIDGTVVDDVAWSYADPPPESLPIAGMVSFDETRVAVTAELPAT
PERG
145224671YP_001135349.1 hypothetical protein Mflv_4091 [Mycobacterium gilvum PYR-GCK]MKRLNGVDAMMLYSETPEIHMHTLKIGVLDVSGIGGYDFEFFRRAALPRL
HALAPLRYQLVDIPWKLHHPMWIQNAEIDVDYHLRRAKVAAPGGRRELDQ
LIGEIAGTPLDRTRPLWEMYIADGLADNKIAVIHKVHHVLADGVASANQL
AMAIQPREPAVGGQLEAVPADSMGRANLLAGAGRDHWRQVRRLPKLVGET
ASGVSRVRRKARERGANPDLAKNFAPPPTFFNHVVTPGRRFATAPLSLAD
VKETARHLGVTLNDIVLATAAGALRQLQLTYDGHANSPLIAGVPVSFNSS
PDRLMGNEFTYMTPSLPVHIEDPLERVKLTATATAIAKENHNLLGPTLLP
SWLTYLPPGTTPQVFRSQARRVESAMVMNLTISNVPGPRERGCMEGAVID
EIYSVGPIVAGSGMNITVWSYVDQLSISVLTDDRTLKDPHEATDALLASF
VEIRRAAGLPEELTPVEKSMPPAPAL
145224670YP_001135348.1 hypothetical protein Mflv_4090 [Mycobacterium gilvum PYR-GCK]MTMFEVDGLGSAERAGSGVRVSAEVVHSYDLTVIAADVDGVVASAGGWLC
DRVRAGWQVTVLVAAGADTGALTVLGVRDETLDSAAAALRRPTAAVAVDT
RVLTHDDNARTEVLRLLDSGRTEVTVWGTPSPVTSELLSDARFDTVCHRA
SAAARAFKAGALRTCGHDATGPSVETFISAGLWYPPDGGDLVPVSGT
145224669YP_001135347.1 hypothetical protein Mflv_4089 [Mycobacterium gilvum PYR-GCK]MASSRRFIPAGKPADGEGLHRYRVVAVTSDIAALVECAGGFLCDRARAGW
NVRVLVDGPGERRPLTILGVSADAVSGQTDAGAAMSGFGPGTTVIVGADL
LTRDSRLRASAARLATAGAAVHVWGPPSYPGCRPAPIQHELSTAAQAFKN
SALRAARIDRAAEPVETLYRLADGSPRRLRSV
145224668YP_001135346.1 hypothetical protein Mflv_4088 [Mycobacterium gilvum PYR-GCK]MASTEVERHTGVDVEEVPSAQWGWSSGSVRGYQIGGTIVGIFFLLLTIGN
HQGHVEDLFMIGFALLTFGLVARSVYTTRNRDTR
145224667YP_001135345.1 short-chain dehydrogenase/reductase SDR [Mycobacterium gilvum PYR-GMTADAPHGLFDGKVVLVTGAARGQGRAHAVRFAEEGADVIAVDVCAQLDS
VAYPMSTPEDLDETARLVEKTGRRVVAEQCDVRDRDRLADVVAAGVEEFG
RLDFVLANAGILPIAGDQGRSITAFTDAVAVMLNGVYFTVDAALPALLRN
PDGGAIVITSSAAGFTSVSTGFDTMNHGAAGYTAAKHGVIGVMRHFARSL
AEKNIRVNSVHPGGVATPMVLNEALAQWAGEHPSFSQAQQALLAMPMMEP
EHISDTMVYLCGPAGRYVTGVALPVDAGQTLK
145224666YP_001135344.1 deoxyribodipyrimidine photo-lyase [Mycobacterium gilvum PYR-GCK]MPAVLWFRRDLRLADLPALVAAAEVDGDVLACYVLDPRLKATGGSRRLQY
LYDALRDLRESLDGRLLITRGDPVSRIPVLAAAVGASSVHVSEDFTPFGM
RRDEQVRDALGDVELVATGSPYLVSPGRVTKGDGSPYKVFTPFFDAWRQH
GWRPPAESGPPSAHWLDPADVAGKPGITDIPDAGVELDLPAGETAARRQW
KQFVDDGLAGYAEDRNRPDLAATSRMSAHLKFGTIHPRTLAADLGRGKGA
QAYLRELAFRDFYAAVVAEWPRSTWWNWNSTFDAIEVDDGPDAQRAFEAW
KAGRTGFPIVDAGMRQLAETGFVHNRVRMIVASFLVKDLHLPWQWGARWF
LDQLTDGDMANNQHGWQWAAGCGTDAAPYFRVFNPTTQGKKFDPAGVYVK
RWVEELRDVASSVDVHNLDRDRPADYPEPIVDHAQERAEALRRYNSLRG
145224665YP_001135343.1 beta-Ig-H3/fasciclin [Mycobacterium gilvum PYR-GCK]MTIMMKSFAGAGLAVTAALGLSFATATTASAAPAGPGCAAYVQQVPEGPG
SVQGMAMDPVATAASNNPLLTTLTKAVSGQLNPNVNLVDTLNGAEFTVFA
PTDEAFAKLDPATVETLKTDSNLLTNILTYHVVPGQAAPDQVVGEHVTVQ
GATVNVTGAPDHLMVNDASVACGGVQTANATVYLIDTVLMPPAM
145224664YP_001135342.1 beta-Ig-H3/fasciclin [Mycobacterium gilvum PYR-GCK]MMTTRRKTAAVAGIAAVAIFGAACSSEEAGNNASSATSSATSAMESATSE
MTTSSSAPMADPAANLIGSGCAAYAEQVPEGPGSVAGMAADPVTVAASNN
PMLTTLTQALSGQLNPNVNLVDTLDGAEFTVFAPTDDAFAKIDPATLETL
KTDNELLTSILTYHVVPGQAAPDAVAGEHTTVQGAPLTVTGAGNDLMVND
AGLVCGGVKTANATVYMIDTVLMPPAN
145224663YP_001135341.1 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Mycobacterium gilvMNERLRVLILGSTGSIGTQALEVIAANPDRFEVVGLAAGGGNRDLLARQR
AETGVTNIAVADEAAAAALGEVTYSGPDAVTRLVEATEADVVLNGLVGAL
GLKPTLAALATGARLALANKESLVAGGPLVQKAAAPGQIVPVDSEHSALA
QCLRGGSADEVATLVLTASGGPFRGWSVDRLEDVTPEQAGAHPTWSMGPM
NTLNSASLVNKGLELIETHLLFGIDYDRIDVVVHPQSIVHSMVTFTDGST
LAQASPPDMKLPIALALGWPARVAGAAAACDFSTASRWDFEPLDDEVFPA
VALAREAGKTGGCMTAIYNAANEEAAEAFLAGRIRFPAIVRTVAEVLRAA
DQWAAEPATVDDVLDAQNWARDRARSAVERESAGSRS
145224662YP_001135340.1 peptidase M50 [Mycobacterium gilvum PYR-GCK]MMYVLGVTLFALAILVSVALHECGHMWVARATGMKVRRYFVGFGPTLWST
RRPNKLGETEYGIKAVPLGGFCDIAGMTAVEELDPADRPYAMYRQKTWKR
VAVLFAGPAMNFIIGLVLIYGIAIVWGLPNITAPTTAVVGETSCIKSEVT
QGELGDCVANSPAAAAGIEAGDVIVRVGDTEVPTFDALVEAVRQESGPTV
LTVQRDENGQVREFTTTVDVTPSQRYVAGEDGGPAVPVDVGSIGVTAAQF
GPTQYNAFTAVPGTFVFTKDLAVELGKAVVKIPTKIGALVDSISGGERDP
ETPISVVGASRIGGETVEAGIWVAFWFFLAQLNFVLGGINLVPLLPLDGG
HISIALYEKVRNKIREARGKVAAAPVNYLKLMPLTYVVIIVMVGFTLLTV
TADVVNPITLFQ
145224661YP_001135339.1 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase [MycobacteriumMTSTAGVGLGMPAPPPPVLAPRRKTRQLMVGDVGVGSDHPIAVQSMCTTK
THDINATLQQIAELTASGCDIVRVACPRQEDADALPAIAKKANIPVIADI
HFQPKYIFAAIDAGCAAVRVNPGNIKEFDGRVKEVAKAAGDAGIPIRIGV
NAGSLDPRILKKYGKATPEALVESAMWEASLFEEHGFGDIKISVKHNDPV
IMVAAYEQLAAQCDYPLHLGVTEAGPAFQGTIKSAVAFGALLSKGIGDTI
RVSLSAPPAEEVKVGNQILESLNLRPRGLEIVSCPSCGRAQVDVYTLANE
VTAGLEGLEVPLRVAVMGCVVNGPGEAREADLGVASGNGKGQIFVKGEVI
KTVPEALIVETLIEEAMRLAADMDTTPGSEEASGSPVVTVS
145224660YP_001135338.1 N-acetyltransferase GCN5 [Mycobacterium gilvum PYR-GCK]MSAPPLFRLVDERRVSVVRDIQAVRQVLDDDPVASCMVASRVAEHGIDPA
AIGGELWTRRRANESLCFAGPNLIPLRGGAGDLNAFADKAMSSVRRCSSL
VGRAELVLPMWQRLEPVWGPARDVRAHQPLMALNTAPSCPTDPAVRPVRM
EELDAYLVAAIDMFIGEVGIDPRLGDGGRGYRRRVAGLIAAGRAWARFER
GEVVYKAEVGSQSPAVGQIQGVWVHPERRGCGLGTAGTASVAAAVVGAGR
IASLYVNSFNTVARATYARIGFTEIASFATVLLD
145224659YP_001135337.1 hypothetical protein Mflv_4079 [Mycobacterium gilvum PYR-GCK]MTEHDSTATRREIADAMMKALDRRHELLDAVVASEDYDAAIEAIADLLDA
SAEASEAVLRLSFDRLTKVSRRRIAAELENLNSKVLTFASSEQTPGSARR
LMLRPFSAADDRDVFAERTADVRSAGDGTAAPAGDLGDEIRAAVTRMAAE
EAVWLVAEVGSTKVGMVFGELADGEVDVRIWIHPAHRKHGFGTAALRASR
SEMAAYFPAVPLVVRAPAAG
145224658YP_001135336.1 integrase catalytic subunit [Mycobacterium gilvum PYR-GCK]MTAAIGSQRQALAMIDLSRSTWHYRTNPRPPVSDPLPQKHRAYPSRIDEA
DRAVIRDKILAGWEAGSSVDHAFAASWDEGVMLASRRSWWRIAAAIEDQS
ARPVAPTRSTSKTPRQAPVLKATGPQQIWSWDITDLRSPWRGVAFKAYSI
LDIYSRKIVGWRVEERECDDLAVDMFEAAFAGHGLPAVVHADSGPAMRST
VLKDLLAGLKIGQTHNRPRVSNDNPFSESEFRTMKYRPNYPGVFTDLDSA
RAWVSAYVSWYNQHHRHSGVELFTPDSVHDGTWAQLWDRRDTALQAYYDA
HPERFRNRPRTKSPSPVVGINLPTENDPDRLQAA
145224657YP_001135335.1 hypothetical protein Mflv_4077 [Mycobacterium gilvum PYR-GCK]MSVSISAGFSIAEIREFVVEYQRVPHGQKGSWLAASGVSGGQFRRWQAAV
FSGDLDRGLIPREGSEMTVPPALRKALAKVDAARQDRDEAELAQLRERVR
ELEATNEALGKAIGLLHTMSAHEPDAAPTIHDLDDSSTPRTDLSPS
145224656YP_001135334.1 penicillin-binding protein- transpeptidase [Mycobacterium gilvum PYMASLFTSVTRAAALASAAALVVTLGACTPRPNGPEPTAEEFFEALATGDT
GAAAQLADDPEGARAALNEAWAGLQATGLQAQILSSKYAEDTGSITYRYT
WHLPKDRTWTYDGQLNLVRDEGRWEVRWSATGLHPRLGENQTFALRAEAP
PRASVHERTGTNVLVPGYRYHVALDAKAAGADLMATARTVAGDLHRFDNT
LDPQRLAELASSTRGALSLITLNQADHDAVAPALRSLPGVVITPQPEMVP
TDPTFAPAVVNEVKKNVAEDLDGDPGWRVVTVNQNGVDVDVLNEVAGTPA
PSVSISLDRSVQTAAQNAVNITGKQAMIVVIKPSTGEILAVAQNAAADRE
GPLATMGLYPPGSTFKIVTAGAAIERQMATPNTLLGCPGRMDIGHRTVPN
YGGFDLGTVPMSRAFASSCNTTFAELASRMPPRGLTEAASQYGIGLDYDI
PGLSTVSGSVPPTVNLTERTEDGFGQGKVLASPFGMALAAATVAAGRTPV
PQLIAGRETAVTGAQQQIPQDVVEGLRPMMRLVVTNGSAKDLAGSGDVRG
KTGEAEFAGGSHSWFTGYRGDMAFSALIVGGGSSEYAVRMLKGMLDSLPP
DYQA
145224655YP_001135333.1 hypothetical protein Mflv_4075 [Mycobacterium gilvum PYR-GCK]MTDINHGRSLEPVEMRISDADRNGTLRRLHNAVALGLIDIGEFEERSAMV
SQARQRSELDALVGDLPGPGAIVTSAADRVELRGVLGSLKRQGEWVVPSR
LALHRRMGSVDLDLTRARFAGPIVVIELDMRFGGLDLRLPDGASASIDDV
EVNVGSAHDHRRDAPAEGNPHVILTGKVVCGSVDIRGPRKSWRPGLFRAT
145224654YP_001135332.1 hypothetical protein Mflv_4074 [Mycobacterium gilvum PYR-GCK]MNRFAPEQLIVRACEATGLDDFGDDDTWRDGLDLVCDGLTTDARLNEIGV
EIAAADLHRALTSRLHIVGWRTQHPEIAAAPVARPIFIVGQPRTGTTILF
DLLAQDPALRPPLTWEVDNPFPLPRLDTYTSDPRIAQTQASIEMSEQIVP
GLLGHHPMGALVGQECVRIVAGQFCSMIYPTQYRMPDYYRWLLYKADHGP
AYRYHRMFLQHLQSGVGGPSCQWLLKSPAHLWQLEALLAEYPDALIVQTH
RDPLNVIASISALLHHLRRLASDDSSIPECAAQSREQIVAGLEYAVRLRD
SGVPAANQIVDVHFRDFMRDPFETIRALYARLGRELEPVAEQRMRDFLAA
HPGDHAGNRYRWADTGLDAAEVRAQVRTYQERFGVPDEVLR
145224653YP_001135331.1 hypothetical protein Mflv_4073 [Mycobacterium gilvum PYR-GCK]MLADLTKTVIEDATSERELLEGLSVLAKVTALCTEMTVEADPQRPRFFEM
STDTRLLGGSNPDGRYLLAMIRGDRTYRVIGSRGDSAYLGFQVLAGSGMN
PRRMAAYLSDRELHCSRGTFNFLLSAHEPAPEVLGAAQWVQIPADATSIV
VREYIADFDSELAAMMTIECLDSRPAEPLSDPALAETFTAMAWTIVKLTT
LHRTIKPELLTRPNVLVTAEAAELGSADTTPDNLYMIGSFALDSDETLVL
EFTPPDTRYWNVALESVWHECVAPRRQGGSVTNAGVRPDSAGQVRIAIGA
RDFGHGHWLDTGGRRRGFVVVRWLDNPQAPTVRSTVVRGAP
145224652YP_001135330.1 TetR family transcriptional regulator [Mycobacterium gilvum PYR-GCKMRHSLIMDAVSGPKSGESLTVRRQRATKARIAAAAAEAVAAHGLAGATIE
HIAAAAEVGRATFFRYFSAKEDAVVEGMAAHWLDAIADAIAAQPPELAAD
AAVVAAFQDLGHGFEAVSDQVRELAVMTRSSPVFSAWTLQLYLRYEAAIA
DLVGIRMADPAPDDPRPRLLGALAMASVRIALDDWLVHGGSLPERVRTAL
ASLHVA
145224651YP_001135329.1 thioesterase superfamily protein [Mycobacterium gilvum PYR-GCK]MQVTPGHLFAQLDFRDVEDTDERMVIELDNRPDLVNRRGALQGGLVATLI
DIAAGRLADRHVGPGQDVTTADLTIHYLAPVLEGPARAVATVVRAGRRVS
VIAVDVIDVARDRLAARATVSFAVLDPR
145224650YP_001135328.1 methionine aminopeptidase [Mycobacterium gilvum PYR-GCK]MSVRTALRPGTVSPMLAVPKSIERPEYVGKPTAREGSEPWVQTPEVIEKM
RVAGRIAAGALAEAGKAVAPGVTTDRLDRIAHDYMVDHGAYPSTLGYKGF
PKSCCTSLNEVICHGIPDSTVIEDGDIVNIDVTAYIDGVHGDTNATFLAG
NVSEEHRLLVERTHEATMRAIKAVKPGRALSVVGRVIEAYANRFGYNVVR
DFTGHGIGTTFHNGLVVLHYDQPSVQTVLEPGMTFTIEPMINLGSLDYEI
WDDDWTVATRDKKWTAQFEHTLVVTESGAEILTQL
145224649YP_001135327.1 hypothetical protein Mflv_4069 [Mycobacterium gilvum PYR-GCK]MTRRAAIAAIAACLLSGCGHDTTGTATWPGARLEKAVLTEADFPSGVVFE
RITRDPADGDDAAGPPPMLSEPEGCTDGLTRDIAGDAERGPGSAVEYVVV
YDGARMVITVLSWRLDLDRLAATAQRCAEYRTFFDESDPGVAMTTTPVPV
SRADALAYEQTMYLPGQETSVYFAFENVGAMAVFGIAFPTPDPSIPVKGA
LPQTFLDITAKQAERARTV
145224648YP_001135326.1 hypothetical protein Mflv_4068 [Mycobacterium gilvum PYR-GCK]MPTPMVTVDGFGVPVEVTGPDKGSVVVLLGAAHQAPAAYEGICQRLHTAS
LKTVVIGADPRLTAKSVISILDEVEVRWALLVGDRHGGEIAWDLAATRLD
RFIGLVVIDRGHPRVADLTGAVRDEHCPPVELNTTALVSTSAARAVAKAS
QRFVYGEYRIVDLLGRRNAADSTAQLAAEIVMRTSTW
145224647YP_001135325.1 N-acetyltransferase GCN5 [Mycobacterium gilvum PYR-GCK]MTADPTADNPEAITLALHEAATADQLDSMADDVVLELGWGRLIFGQTFAD
PERLAEVLRQEGQGRRDICIYAREPHVLVSKAPAELFIDPSHTYRLRFAE
VEDSGSTPTGFRVRTLAERADADEMNRVYLRCGMVPAPTDVLWDNHREQP
SVDYLVAVSDEDGTVLGTVTGVDHVALFSDPENGSSLWTLAVDPTAALPG
VGAALTRALASLYRDRGRAYMDLSVAHDNVAAIALYEKLGFARVPVMAVK
RKNAINEPLFTHPPETVDDLNPYARILADEAMRRGIWVEVLDAEAGEMRL
SHGGRTVVTRESLSEYTSAVAMARCDDKRLTRRIVSEAGITVPKGRLATF
DQADHDFLAEVGDVVVKPTRGEQGKGITVGVDSAEELDAALARAREQHPE
VLIEQRAEGDDLRLVVIDGKVVAAALRMPAEITGTGRHTIRELIETQSRR
RAAATGGESQIPIDAVTENTVREAGYTFDDVLPEGERLRVRRTANLHQGG
TIHDVTATVHPELCRVAVAAAAAIGIPVTGIDLLVPDVTKPEYAFIEANE
RPGLANHEPQPTAQAFVDFLFPNQPGLPQAWTPDEVQS
145224646YP_001135324.1 asparagine synthase [Mycobacterium gilvum PYR-GCK]MCGATGEVRLDGTSPDVRAVAAMAEVMVPRGPDAAGAWSQGRVALGHRRL
KIIDLTEAGAQPMVDSDLGLTIAWNGCIYNYEELRDELAGHGYRFFSHSD
TEVLLKGYHHWGDRFVDHLKGMFAFAIVERDSGRVLLGRDRLGIKPLYLT
LTPDRIRFASSLPALLAGGGVDTRIDPVALHHYMTFHSVVPAPHTILRGV
TKLPPASLMAIEPDGRITTTTYWEPDFTRHADRADWSEKDWEEATLDSLR
TAVKRRLVADVPVGCLLSGGVDSSLIVGLLAEAGQHGLATFSIGFESVNG
VAGDEFKYSDIIAQRFGTDHHQIRIDTARMLPALDGAIGAMSEPMVSHDC
VAFYLLSQEVAKHVKVVQSGQGADEVFAGYHWYPPMGEPAAASLEGSVAS
YRGAFFDRDRAGYADIVAPGYLTGDDPSELFVTEHFARAGAETGVDRALR
LDTTVMLVDDPVKRVDNMTMAWGLEGRVPFLDHELVELAATCPPQYKTAH
EGKGVLKQAARQVIPSEVIDRPKGYFPVPALTHLEGPYLELVRDALYAPV
AKERGLFRPDAVERLLADPNGRLTPLRGNELWQIALLELWLQRHGITGAA
A
145224645YP_001135323.1 glutamate--ammonia ligase [Mycobacterium gilvum PYR-GCK]MTDRTKGRLELMTTRGMLTLEDLEKQVADGDIDTVIVAFCDMQGRLTGKR
ISSRLFVDDVAEHGAECCNYLLAVDVDMNTVDGYAISSWEKGYGDMVMTP
DMSTLRRVPWLPATALVMADLSWTDGRPVTQAPRGILRAQLDRLDALGLD
AVAATELEFMVFDTGFRDAWAAGYRNLKPATDYNIDYAMHASTRMEPLLR
DIRLGMDGAGMYCEGVKGECNLGQQEIGFRYEQALVTCDNHTIYKNGAKE
IADQHGKSLTFMAKFDESEGNSCHIHISFRGRDGSPEDIAVFADDSDELG
MSSMFRSFIAGQLATLREFTLFYAPNINSYKRFAEGSFAPTAVAWGLDNR
TCSLRVVGHGQGMRMENRAPGGDVNQYLAVAALIAGGLYGIENKLELEDA
VEGNAYTSGADRLPTTLSEAVELFENSKIARDAFGDDVVDHYVNNARVEL
KAFNAAVTDWERVRGFERL
145224644YP_001135322.1 peptidase C26 [Mycobacterium gilvum PYR-GCK]MSVSSRPVIGLTTYLQQAQTGVWDVRASFLPAIYFEGVGMAGGIASLLPP
QPVDDTIAERVLDGIDGLIITGGRDVDPSTYGAQRHPRTDEPDTDSRARD
AFEFALVRAALRRAMPVLGICRGAQVLNVALGGTLHQHVPDVVGHTRHQQ
GNAVFTTSSIATVPGSRVAALVGPDTEAQCYHHQAIDRLGDGLVVSASDT
DGVIEAVEVDLSAHPDHWVIAVQWHPEERLDDLRLFAGLVGAAGVYATQK
TQKVNR
145224643YP_001135321.1 betaine-aldehyde dehydrogenase [Mycobacterium gilvum PYR-GCK]MTASDVINPATEEVLRTVEHTDEAGVDDAVARAKAAQRSWARQAPAERAA
ALRAFAAVVDAHVEELAALEVANSGHPIGNARWEAGHVRDVLQYYSASPE
RLSGKQIPVAGGLDVTFNEPLGVVGVITPWNFPMTIASWGFAPALAAGNA
VLVKPAEWTPLTTIRLGELAVEAGLPADLFQVLPGRGSVVGERFVTHPDV
RKIVFTGSTEVGTRVMAQAATQVKRVTLELGGKSANIVFDDCDLERAAAT
APYGVFDNSGQDCCARSRILVQRSVFDRFMELLEPAVKGVVVGDPGAEGT
EMGPLVSKAHWNSVSSYVPDDAPVAFRGSAPQGPGFWFPPTVLTPARDDR
TVVEEIFGPVVTVLPFDDEADAIALANDTVYGLSGSIWTDNISRAMRVSR
AVEAGNLSVNSHSSVRYSTPFGGFKQSGLGRELGPDAPLSFTETKNVFFA
VEEN
145224642YP_001135320.1 short chain dehydrogenase [Mycobacterium gilvum PYR-GCK]MDLSQRLKDKVAVITGGASGIGLATAKRMRSEGAIVVIGDLDEKTGKSVA
NDLNVTFVQVDVSDQVAVDNLFDTAFEVHGGVDIAFNNAGISPPEDDLIE
NTGIDAWDRVQDINLKSVFFCCKAALRHMVPAQKGSIVNTASFVAVNGSA
TSQISYTASKGGVLAMSRELGIQYARQGIRVNALCPGPVNTPLLQELFAK
DPERAARRLVHVPMGRFAEPEELAAAVAFLASDDASFITGSSFLVDGGIT
GHYVTPL
145224641YP_001135319.1 regulatory protein GntR [Mycobacterium gilvum PYR-GCK]MAAPDPADSSDASEALLRPVRPLNAFEDTVERLLQTIRLGVLTPGESLPP
ERELAARLGVSRDTVREAIKSLADAGYLVSRRGRYGGTFLADALPAPRAD
GTEMHRDDIDDAVRLREILEVGAARMAAVRTLAAVEREALRSRLTDVRGA
DPADYRRLDSRLHLAIAEAAGVPSLVPLVAQNRMRLNELLDRIPLMTRNI
AHSDEQHEAIVSAILAGDADTAAQTMAAHVWGSAALLHGFLD
145224640YP_001135318.1 type 11 methyltransferase [Mycobacterium gilvum PYR-GCK]MATVDNEDDRALKAKHRALWASGDYPAVAAELIPSLGPELVRACGVRSGD
RVLDVAAGSGNASIPAAAAGAVVTASDLTPELFDAGRRIAAERGVAVEWV
EADAEALPFPDDSFDVVMSCVGAMFAPHHQATADEIVRVTRPGGTLGLIS
WTPEGFIGHLFATMKPYAPPPPPGASPPPMWGSENHVEALFGDRVRDLTM
RRQTVRFDHCASPLDFREYWKRNYGPTLAAYRFNEDRPERLAELDAAFLD
FLTTWNQADGTDGTAYDAEYLLVTATKR
145224639YP_001135317.1 regulatory protein ArsR [Mycobacterium gilvum PYR-GCK]MAGYYICPVEDQQLVDRASSALAEVDTPGWAQRFDLVSDPHRLEILLCLH
RAPGICVSDLAAALGRSENTVSQALRVLRQQGWVTSTRAGRSVTYRLEDE
VVHDLLHWIGARHG
145224638YP_001135316.1 cobalamin (vitamin B12) biosynthesis protein CbiM [Mycobacterium giMSAHYVAMHMSDGIINAPISMLFVAIAVAALGICAWRAREELDERTVPLA
GLVAAFVFAVQMVNFPILPGVSGHLLGGALAAILVGPYTGALCVSIVLIV
QALLFADGGVTALGTNITNMSVIGVAAGYGTAVLLYRVLRRRRADLAVPV
VGVIAFVSAVVGTVCAAMGFVAQYALGGAATTSLGTVAAYMFGTHVLIGI
GEGVITALTVMAVVRARPDLVYLLRSHPARQAVPV
145224637YP_001135315.1 hypothetical protein Mflv_4057 [Mycobacterium gilvum PYR-GCK]MTRPSGGRRWFFWAAFAVATLLIAGVVSSFASSSPDGLDSATLRGCEIVE
TAAGEQLRGECIAQHAQEHPLTSSPLADYAVEGRDGTGGAAGVVGVLVTV
LVAGGVFWSIARSRARPKSSVGE
145224636YP_001135314.1 cobalt ABC transporter inner membrane subunit CbiQ [Mycobacterium gMGGGHSHPLYRDGDSPVHRLPAEVKIVCLAAFVLAVVATPRELFWPFGVY
ALIILAVWRAARIPLRWILPRMLIEAPFLVLAVLLPFSEGGERVSLAGMH
LSIAGLYAAWGIVIKGTLGVAASLTVAATTTSRELPVALSRLRVPAMIVS
VLTLMIRYIDVLAAEARRMRMARVSRGDSPRMFHQIGATARGVGSLFLRS
YERGERVYLAMLSRGFDGHVPALAVGAGSVAAATPRQWVMALLPAAAAVA
VAASAWATL
145224635YP_001135313.1 cobalt ABC transporter ATPase [Mycobacterium gilvum PYR-GCK]MGDAVSGPAIRVRGLRYSYPDGHVALDGIDLDIADGERVALLGPNGAGKT
TLMLHLNGVLRASAGDVEIGGTVLSRSTLRDIRRRVGLVFQDPDDQLFMP
TLAQDVAFGPANFGVRGAELDARVAHALAVVSMTELAGRSPAHMSGGQRR
RAALATVLACEPEVLVLDEPSANLDPVARRELAETLSGLDATMLIVTHDL
PYAAQLCRRAIVMDGGVIVADGAIDEVLSDTALLAAHRLELPWGFTVGLR
145224634YP_001135312.1 mycothione reductase [Mycobacterium gilvum PYR-GCK]MADFDLAIIGTGSGNSILDERYVDKRVAICEQGVFGGTCLNVGCIPTKMF
VYAAGVAEQIRESARFGVDGRLDGVRWPDIVSRVFGRIDPLAGGGEQYRR
SSPNVEVFASHTRFAGPDSGDGYRLHTDDGDEFTAEQVVIAAGARATVPQ
AILECGVPYHTSDTIMRISDLPEHLVIVGGGFVAAEFAHVFSALGSRVTI
VLRGTTMLSHCDDTVCERFTDIAGKKWEIRSRRNIVSGESDGSGVSLRLD
DGATLRADVLLVATGRVPNGDRLDAHLAGVEVTDGLVTVDEFQRTTARNV
FALGDVSSPYQLKHVANHEARVVKHNLLQDWDDTEALMPANHDNVPSAVF
TEPQIACVGLTENEARAAGYRIRSKVQDYGDVAYGWAMEDSTGFAKLIVD
DETGLLLGAHIMGHQASSIIQPLIQAMAFGLPAQDMARGQYWIHPALPEV
VENALLSLCGEPPWPRPRRH
145224633YP_001135311.1 hypothetical protein Mflv_4053 [Mycobacterium gilvum PYR-GCK]MSGWEPDPLPGYRQRTFALGPDPDGEGDLEATLVRRGDPDTRARHAVLMV
HGFTDYFFNTELADHFASRGFAFYALDLHKCGRSHRDGQTPHFTTDLARY
DVELERALAVIAEESAARVLVYGHSAGGLVVSLWLDRLRARGATASAGVA
GLVLNAPWLDLQGHAILRTPPITAALRAMARTRKHSVVRRPNPGGGYGAT
LHRDYAGEFDYNLQWKPIGGFPVTVGWIHAIRRGQAALHRGLDVGVPNLI
LRSDHSVREAPDPELIQRGDAVLDVAQIARWAGCIGNRSTIVPVVDAKHD
VFLSLPGPRAAAYAELDRWLDSYPAGSAAPSTPSEPPPSDGSTPHG
145224632YP_001135310.1 malate:quinone oxidoreductase [Mycobacterium gilvum PYR-GCK]MSEAEKTDVLLVGAGIMSATLCALLRLLEPNWSMTLVERLDGAAAESSDP
WNNAGTGHSALCELNYTPARPDGSIDIAKAVNVNEQFQVSRQFWTYAVEN
GVLPDVRSFLNPIPHVSFVTGADNVQYLRKRYEALVGNPLFGTMEFIDDA
GEFARRLPLMAEGRDLREPVGLNWTQDGTDVDFGALSRQLLGFGAQQGMD
TLFGHDVTNLSQNSDSTWTVKVVNRRTGRKRTFNAKFVFVGAGGGALPLL
QKAGIKEAKGFGGFPVGGQWLRTGNPELTAKHQAKVYGLPPLGAPPMSVP
HLDTRVINDKSWLLFGPFAGWSPKFLKQGKVTDLPFSVKPDNLVSMLGVG
LTEMGLLKYLIGQLLLSEAARVENLREFAPSAKDSDWELDIAGQRVQVIR
KAKGKGGVLEFGTTVLSAADGSIAGLLGASPGASTAVPAMFDVMKRCFAD
RYPSWEPKLKEMVPSLGVTLSDEPKLFEEVWARGTKVLKLDKPAGAIPAT
TDGQSTAGTEHTPTAATV
145224631YP_001135309.1 N-acetyltransferase GCN5 [Mycobacterium gilvum PYR-GCK]MTVALRRSWAKDLSAATLYELLKLRVEVFVVEQATPYPELDGRDLLAETR
HFWLENPEGEVISTLRLMEEHPAGQKAFRIGRVCTKRTARGHGHTARLLT
AALAEVGDFPCHINAQTYLVQMYGRHGFVRDGAEFLDDGIPHVPMVKP
145224630YP_001135308.1 magnesium chelatase [Mycobacterium gilvum PYR-GCK]MTGTASPPIYPLSAVIGHDRLRLALVLCAVRPDIGGVLIRGEKGTAKSTA
VRGLAQVLSAAFAAAGDDGGQLVELPIGATEDRVVGSLDLQKVLRDGEHA
FSPGLLARAHRGVLYVDEVNLLHDHLVDVLLDAAAMGRVHIERDGVSHSH
DARFVLIGTMNPEEGELRPQLLDRFGLTVDVAASRDVDVRAEVIRTRLAY
EADPVAFARRYADADADLAARIADARALVPDVVLPDRELRRIAALCAAFD
VDGMRADLVVARTAMAHAAWRGEVTVDEEDIRVAAELALPHRRRRDPFDD
PGLDPGTLDEAMEQAGESAGPTPDPEPDPDPPGGGADADGSADGQPPQQN
SSSHPSSSTRQSAPPSPTFKTRTLVVPGVGEGAPGRRSRARNRTGSVVSA
TSDPHVGHGMHVFATLLAAAGRQTRSGAVRPGPDDVHRAVREGREGNLVI
FVVDASGSMAARDRMSAVSGATLSLLRDAYQRRDKVAVITFRQQDAQVLL
PPTTSVHIASRRLARFDTGGKTPLAQGLLAARDMVVRERARDRARRSLVV
VLTDGRATGGPDPLGRTRTAASRLVAEGAAAVVVDCETSYIRLDLAQELA
RQLGAPAVRLEELRAEILTALVRTAA
145224629YP_001135307.1 cob(I)yrinic acid a-c-diamide adenosyltransferase [Mycobacterium giMPQGQPLTVPDDGLTTRARRNAPLLAVHTGPGKGKSTAAFGMALRAWNQG
FDIAVFQFVKSAKWKVGEESALTELGRAHDERGVGGPVEWHKMGSGWSWT
RKSGTEVDHAAAAADGWAEISRRLAEQRHDFYVLDEFTYPLKWGWVDVDD
VVETLARRPGNQHVVITGRDAPQALLDAADLVTEMTKVKHPMDAGRKGQK
GIEW
145224628YP_001135306.1 cobyrinic acid a-c-diamide synthase [Mycobacterium gilvum PYR-GCK]MSTPAVVIAAPSSGSGKTTVATGLMGALRRAGHRVAPFKVGPDFIDPGYH
ALATGRPGRNLDPVLVGEPLIGPLYRHGSDDADIAIVEGVMGLFDGRISD
GGAGPARGSTAHVAGLLGAPVVLVVDARGQSHSVAALLHGFATFDQTVRL
AGVILNRVGSSRHDEVLRQACDHAGVAVLGSIPRADELAVPSRHLGLVTA
EEHGRHATAAVAAMTELVARHVDLAAVTAVAGGDVADAPWTPAQFAAGPT
ATVALAAGKAFTFGYAEHREILCAAGADVVTFDPLCDPLPAHTSALVLPG
GFPEEFVTELSANEPVRSQIRALAAAGAPIHAECAGLTYLVDELDGHPMC
GVLAGSASFTPSLTLGYRDAVAVAESSLHAVGERVTGHEFHRTAVQFASD
RQAAWQYRGRGGAAVEDGAVLGGVHAGYLHTHAAAHPQAIARFVAAAATT
KLAG
145224627YP_001135305.1 uroporphyrin-III C-methyltransferase [Mycobacterium gilvum PYR-GCK]MSTYDNAYLVGLRLSGKKVVVVGGGTVAQRRLPLLVSNGADVHVVTKAAT
PAVEAIDGITLTLREFRDEDLDGAWYVIAATDDPAVNAAIVAGAERRRIF
CVRADIAVEGTAVTPATFEYEGLEVGVLAGGEHRRSAAIRTAIREALQQG
VVTDESGDAPGVVKGGVALVGGGPGDPELITVRGRRLLAHADVVVADRLA
PQELLAELSPEVEVIDASKIPYGRAMAQDAINAVLVDRAKAGKFVVRLKG
GDPFVFARGYEEVIACAEAGIPVTVVPGVTSAIAVPALAGVPVTHRGLTH
EFVVVSGHLAPDHPESLVNWDALAAMSGTIVLLMAVERIELFVKVLLKGG
RPADTPVLVVQHGTTSSQRTLRAGLSEVPERIRSDGIRPPAIVVIGAVAG
FGT
145224626YP_001135304.1 EmrB/QacA family drug resistance transporter [Mycobacterium gilvum MTALNDAERAAIQRDAEGRGKRGSDRASGRALPARVTGSGESAGGRGGDA
GRRGRTPAWMPSRRFFAAVIAIGGMQLLATMDSTIAIVALPKIQDELGLS
DAGRSWVITAYVLTFGGLMLLGGRLGDTIGRKRTFIVGVALFTIASVLCG
IAWDEATLVIARLLQGVGAAIASPTALALIATTFPKGPARNAATAVFAAM
TGVGSVMGLVVGGALTEVSWRLAFLVNVPIGLIMIYLARKTLRETNRERL
KLDAAGALLATMGCTAAVFGFSMGPEAGWMSPVTIGSGIAAVGCLIAFLW
VERTAENPVVPFELFLDRNRVATFAAVFLAGGVMFTLTVTIGLYVQDIMG
YSALRAGVGFIPFVIALGIGLGVSSALVSKYPPRVLVIGGGVLVLAAMIY
GSTLDANIPYFPNLVLPITIGGLGIGMIVVPLMISAIAGVGFDQIGPVSA
IALMLQNLGGPVVLAIIQAVITSRTLYLGGTTGPVKDMNAAQMHALDQGY
SYGLLWVAAVAVIVGAVALFIGYTAQQVAHAQEVKDAIDAGEL
145224625YP_001135303.1 prolyl-tRNA synthetase [Mycobacterium gilvum PYR-GCK]MITRMSELFLRTLRDDPADAEVPSHKLLIRAGYVRPVGPGLYSWLPLGLK
VLRKIEHIVRSEMDAIGGQEILFPALLPRAPYETTNRWTEYGDTLFRLQD
RRDNDYLLGPTHEEMFTLTVKGEYSSYKDFPLRLYQIQNKYRDEARPRAG
ILRGREFLMKDSYSFDVDDDGLKNAYHAHREAYQRIFDRLKVRYVIVSAV
SGAMGGSASEEFLAESEVGEDTFVRCAQSGYAANVEAVVTTAPDPIPLDG
LPEAVVYDTPDTPTIATLVDWANTADLPSFAGRAVTAADTLKNVLLKVRE
PGGDWELLAIGVPGDREVDDKRLGAALDPAEYAMADDADFAAHPFLKKGY
IGPKALLANGVRYLVDPRVVDGTAWITGADETGRHVVDLVAGRDFTPDGT
IEAAEVREGDPSPDGAGPLVAARGIEIGHVFQLGRKYADAFNADVLGENG
KPVRLTMGSYGIGVSRLVAVIAEQHHDELGLRWPGSVAPFAVHVVIANKD
AEARAGATELATALDRAGADVLLDDRTASPGVKFKDAELLGVPWIVVVGR
GWADGVVELRDRFSGEKREIPVGPDTTAAEQILAAITG
145224624YP_001135302.1 hypothetical protein Mflv_4044 [Mycobacterium gilvum PYR-GCK]MTSPTPAPTDAALPTRPEDAAAGALFDALAAEHATIYGYGVVSAHSTPEL
NYLVSAAIAEHRARREAAIALCEQQGVDPAVPEAGYQMPFEVDTPADATN
LAVQMEEDAAEAWRAVVEQATDPGVRAFGVTALTECAVTAAQWRAVRGDT
TVTVAFPGGSE
145224623YP_001135301.1 hypothetical protein Mflv_4043 [Mycobacterium gilvum PYR-GCK]MLLVPSRPPTLSRRRVLVGAAALAALSVTAAGCGTPPPPPDLDDLTTALD
RARSDGDLAAEVATGARGTLADALTTIAAQRAAHAEALSEEIVRLTGHAA
PTPSTAAASTTTTSAASVPDPTVDDVIGALRASADSATAAAGSLTGYRAG
LLASIAASCTASFTVALAGAGSTP
145224622YP_001135300.1 hypothetical protein Mflv_4042 [Mycobacterium gilvum PYR-GCK]MAERSTDFRPGLPSQRQVVELLDGEFARAGYDIEDVVIDAATRPPRIVVI
ADGDRGLDLDAVAELSRLASEQLDTLDTPPYVLEVTSPGVDRPLTEEKHY
RRAQGRLAEVTLADGSTLTGRIGAVQNATVALVVREARSNLTVRDIALDA
VVKAVVQVEFSPPSPRELELAGVSGKET
145224621YP_001135299.1 transcription elongation factor NusA [Mycobacterium gilvum PYR-GCK]MNIDMAALHAIEADKGITVDVVVETIKSALLTAYRHTEGHEADAHIDIDR
KTGVVKVMARQTDEDGNVLHEWDDTPEGFGRIAATTARQVILQRLRDAEN
EKNYGEFSAREGDIVAGVIQRDARANARGLVVVRMGSETKGSEGVIPAAE
QVPGERYEHGDRLRCYVVGVARGAREPVITLSRTHPNLVRKLFSLEVPEI
ADGSVEIVAVAREAGHRSKIAVTSRAPGLNAKGACIGPMGQRVRNVMSEL
SGEKIDIIDYDEDPARFVANALSPAKVVSVTVIDEAARAARVIVPDFQLS
LAIGKEGQNARLAARLTGWRIDIRSDDADKNGGDGPGGHDRSASRPDAGR
GVG
145224620YP_001135298.1 hypothetical protein Mflv_4040 [Mycobacterium gilvum PYR-GCK]MIQRETSARMRESTINPFAGPVRTCIGCRRRELAVELLRLVAVDSANGSG
NRSSAVTVDAARKLPGRGAWLHPDPGCLQAAIRRRAFGRALRITGSPDIT
AVSEHLLPQEQPEAPGQENR
145224619YP_001135297.1 translation initiation factor IF-2 [Mycobacterium gilvum PYR-GCK]MAGKARVHELAKELGVTSKEVLARLGEQGEFVKSASSTVEAPVARRLRES
FGGNKPDAVKPAAGASNGAPAKPSAPGARPGPRPGPPAPAQPKEPPAPAA
PAAAAPAPAAPAPPAAPPAPAASAAPPSAPEAPSARPTPGPRPGPGGPKP
GAPKPAPRTPRVGNNPFSSQQPVERPAPRPQGPAGPGGPRPGPGAGGPRP
GGGPRPGATPGNMPPRPVGGPRPGGGPRPGGGPRPGAGPRPTPGGAGRPG
GGGGGNYRGGGAGGGGGAGGAAAGGFRGRPGGGGGRPGQRGGAAGAFGRP
GGAPKRGRKSKRAKRAEYENMQAPVVGGVRLPHGNGETIRLARGASLSDF
ADKINANPASLVQALFNLGEMVTATQSVNDETLELLGGEMNYVVQVVSPE
DEDRELLQSFDLSYGEDEGGEDDLEFRPPVVTVMGHVDHGKTRLLDTIRD
ATVREGEAGGITQHIGAYQVTVDLDGNERPITFIDTPGHEAFTAMRARGA
KATDIAILVVAADDGVMPQTVEAVNHAQAADVPIVVAVNKIDKEGADPAK
IRGQLTEYGLVPEEYGGDTMFVDISAKAGTNIEALLEAVVLTADASLDLR
ANPDMEAQGVAIEAHLDRGRGPVATVLIQRGTLRVGDSVVAGDAYGRVRR
MVDEHGEDVEEALPSRPVQVIGFTSVPGAGDNFLVVDEDRIARQIADRRS
ARKRNALAARTRKRISLEDLDSALKETSQLNLILKGDNSGTVEALEEALL
GIQVDDEVQLRVIDRGVGGVTETNVNLASASDAIIIGFNVRAEGKATELA
NREGVEIRYYSIIYQAIDEIESALKGMLKPIYEEKELGRAEIRAIFRSSK
VGNIAGCLVQSGIMRRNAKARLLRDNVVVAQNLTVSSLKREKDDATEVRE
GYECGLTLTYNDIKEGDVIETYELVEKART
145224618YP_001135296.1 ribosome-binding factor A [Mycobacterium gilvum PYR-GCK]MPDPARAKRLAKRISTIVASAIEYEIKDPRLAGVTITDAKVTNDLHDATL
YYTVLGRSLDEEPDYEGAAAGLEKAKGVLRTKVGASLGVRFTPTLAFARD
TVPDAAHRMEALLAQARAADEDLARVREGAKHAGDSDPYRVLGEGDLEGP
ATGGPDVEDEGGANSHDR
145224617YP_001135295.1 phosphoesterase domain-containing protein [Mycobacterium gilvum PYRMSIVCHVFPDADTIGAGLALALVLDEAGKSVEVSFAEPDTLPDSLRSLPG
GHLLVPPATMRRDADLVVTVDIPSVNRLGALRDLADGDRDVLVIDHHASN
QLFGTANLVDAGADSTTMLVAELLDAWDKPLGLDVAHCLYAGLTTDTGSF
RWASARAHRLAARLVEAGVDNAAVSRTLMDTHPFAWLPMLSRVLGSAELV
ADAVGGRGFVYAIVGHDEWANARSEEVESIIDIVRTTAQAEVAAVLKEIE
PQRWSASLRSKSVDVSAVAATFGGGGHRLAAGFTATGSADDVVAALRTAL
G
145224616YP_001135294.1 MATE efflux family protein [Mycobacterium gilvum PYR-GCK]MADPVAPATGRRIAGLAFPALGVLAAEPVYLLFDLAIVGRLGALSLAGLA
IGALIMGVLSSQLTFLSYGTTARAARFYGAGDRNAAVEEGVQATWLAVGI
GTVIVAAVQVTAVPLVSALAAGGEIAETALPWVRIASLAVPAILIAAAGN
GWMRGVQDTMRPLRYVVVGFGLSAVLCPLLVFGWLGCPELGLPGSAVANV
AGQYLAAALFCRALFVEKVPLRVRPAVLRAQVVMGRDLILRTMAFQACFI
SAGAVAARFGAASVAAHQVVLQLWSFLALVLDSLAIAAQSLVGAALGAGQ
LTHAKAVAWRVTIFSAVAGVVLAVVFALGSQLIPSAFTDDQSVLDRIGVP
WWFLVAQLPVAGIVFAIDGVLLGAGDATFMRNATLASALAGFLPLVWLSL
AFGWGLLGIWAGLSTFMVLRLVFVGWRALSGRWLVPGTR
145224615YP_001135293.1 type 11 methyltransferase [Mycobacterium gilvum PYR-GCK]MDGSERPVNHHGDHPGFSGLTGQLCAVAFLLTGRETGRLAADLTAVSATD
HVLDIGCGPGNACRIAAARGARVTGVDPSAAMLRVARIVTHGASVTWVRG
GAEALPVPDAGATVAWALATVHHWPDVDAGLAEIHRALGPGARFLAVERQ
TEPDATGISSHGWTGAQAETFAAMCESAGLTTVRVGSGRAGKRRVWTVHA
TRP
145224614YP_001135292.1 enoyl-CoA hydratase [Mycobacterium gilvum PYR-GCK]MDTTIGASAGGRYGERVSTSTDVLLVDTRDRIQTLTLNRPGSRNALSAAL
RSRLFEALRQAQADDEVDVVILTGADPVFCAGLDLKELGDTTELPDISPK
WPPMTKPVIGAINGAAVTGGLEIALYCDILIASDQARFADTHARVGLLPT
WGLSVRLPQKVGVGMARRMSMTGDYLSADEALRCGLVTQVVPHAELQDTA
RQVATSIVGNNQKAVRALLASYHDIDDAQNGAALWQEAAAAREWMKSTSG
DDIAESRSNVIERGRTQVRP
145224613YP_001135291.1 hypothetical protein Mflv_4033 [Mycobacterium gilvum PYR-GCK]MTATPVESRGTATPTRPALKEWSAAIHALLDGRQTVLLRKGGIGEKRFDI
PAEASGSRFLLFPTVAHSHAERVRPEHRDLLEPAAADSTEDEVVVRAGAS
VVASIPVERPENLESIAMHHIWTGESVQSDRLDFRPRHRLTALVVATVPL
VEPVRLARTPDYRGCSSWVRLPVDPRWGEPVHSEAELDRVARLVRDSVG
145224612YP_001135290.1 peptidase S15 [Mycobacterium gilvum PYR-GCK]MSSELARRARRALSRVFDLPPPVCDFVVHRELRVPMRDRVELVADHYAPH
TASPAGTLLVRGPYGRGLPFATMFASFYAARGYHVVFQSVRGTFGSGGEF
DPFVNEVDDGADTAAWLRDQPWFTGTFATIGLSYLGFTQWALLTDPPPEL
AAAVITVGPDDVSGPRWGAGSFGLNDFLGWSDLVGRQEDPNRVRTLLRQA
RAQRRVTSASLRLPLAAASRELLGDGALWFESWLDHPDTDDPFWTRLRLR
DGLERAEVPVLLLTGWQDLFVDQTVEHYRMLAGRGVPTGLTIGPWTHGDM
MTKAAPTMLRESLDWLATHLKGEPPQRRSPVRIHLSRRGWLNLPDWPPAM
PSLVLHPQPGGGLAPGAPGAADATFVYNPGDPTPTVGGRLLSPVGGYRDD
TALARRADVLTFTGTALASDLPVVGVPVLDVAHTCATPHNDLFVRISQVD
AHGRSRNVSDGYVASAPDSGTVTVELDPVAWTFPAGSRIRVLIAGGSHPR
FLRNLGTGEHAGTATDFATARHTVHLGEGTRLTLPAGPPPPSAD
145224611YP_001135289.1 hypothetical protein Mflv_4031 [Mycobacterium gilvum PYR-GCK]MVAKLRLFSALCALVAAVVVVCQVNPAGLTTPAGVDLRSTFAPLPDATPP
PYASTTIKSPVIDLTDPDPFNPCRDIPLDAVQRIGLAYTPPTQEDSLRCK
YDAGNYQMAVETFVWRTYEESLPPDAVELDINGHRAAQFWIMKPTDWNNR
WWITCMVAFQTSYGVIQQSLFYSPIYSEPDPDCMQTNLQRAHELSPYYIY
145224610YP_001135288.1 metallophosphoesterase [Mycobacterium gilvum PYR-GCK]MSTDERRPTLWAVSDLHTGHTGNKPVTESLHPASPDDWLIVAGDVAERTD
EIRWALDLLRKRFAKVIWIPGNHELWTTQRDPMQIYGKSRYDYLVTMCDE
MGIVTPEHPYPVWTEEGGPATIVPMFLLYDYSFLPQGAGTKAEGLAIARE
KNIVGTDEYLLSSEPYATRDAWCRDRVNYTRGRLEDLDWMMPTIQVNHFP
MVREPCDAMFYPEFSLWCGTTATADWHTRYNAICSVYGHLHIPRTTWYDG
VRFEEVSVGYPREWRRRRPYRWLRQILPDPKYPAGYLNEFGGHFQITQEM
RDNAAKMQQRIKDRG
145224609YP_001135287.1 4'-phosphopantetheinyl transferase [Mycobacterium gilvum PYR-GCK]MIAAPLLSGVLPGEVDALAAAEMYTDPRELAPLPEEEPLIAKSVAKRRNE
FITVRYCARQALVDLGMEPVPILKGDKGEPCWPDGVVGSLTHCEGFRGAA
IGRRSDVRSLGIDAEPHDVLPAGVLDAISLPVERHELGGMPGGVHWDRVL
FCAKEATYKAWYPLTHRWLGFEDAHITFDVDSTGQAGTFRSRILIDPAAE
SGPPLTALAGRWSVRNGIALTAIVL
145224608YP_001135286.1 tRNA pseudouridine synthase B [Mycobacterium gilvum PYR-GCK]MSAEPGLVVVDKPGGMTSHDVVGRCRRLFGTRKVGHAGTLDPMATGVLVI
GIERATKILGLLTATDKSYTATLRLGQTTSTEDTEGELLHQVSAAQVTDE
QIERAIAPLRGAIEQVPSAVSAIKIAGKRAYQMVRDGEQVEIPARPVRID
RFEVLAVRRNGDVVDVDVVVDCSSGTYIRALARDVGAALGVGGHLTALRR
TRVGGFGLDQARTLEQLADAAELSYSLDEACLHAFPRRELTDAEVVDAGH
GRSLAPAGIDGVYAATAPDGRVMALLEDAGPRTRSVVVIRPATL
145224607YP_001135285.1 hypothetical protein Mflv_4027 [Mycobacterium gilvum PYR-GCK]MAKLELSRSLPMPAETAWAHASDLSSLGDWMPMHQGWRSDVPEEITVGTT
IVGVAGAKGMRNRVTWTVKQFDPPSALAVHGEGVGGTRYKMTMTVASTGD
GCTFTVRMDLGGAPLFGPVGAAAARAVKGDIDRAIKEFERRYA
145224606YP_001135284.1 iron dependent repressor [Mycobacterium gilvum PYR-GCK]MSPDGNPANPTDLSTVAQDYLKVIWTAQEWSHEKVSTKLLADRIGVSAST
ASESIRKLADQGLVDHEKYGAVTLTDAGRRAALAMVRRHRLMETFLVNEL
GYGWDEVHDEAEILEHAVSDRMLDRIDAKLGYPTRDPHGDPIPAADGKVP
TPPARQLSACQDGEAGTVARISDADPEMLRYFDTVGISLDSRLRVVARRD
FAGMISVAVENPGSSGGSKAASDGETTVDLGSPAAQAIWVVA
145224605YP_001135283.1 bifunctional riboflavin kinase/FMN adenylyltransferase [MycobacteriMVTIGVFDGVHRGHQELIGRAVKAGRSRGVPTVLMTFDPHPMEVVFPGSH
PAQLTTLTRRAELVEEMGIDVFLVMPFTSDFMKLTPERYVHELLVERLHV
VEVVVGDNFTFGKKAAGNVELLRKAGDRFGFAVDSLSLVAEHHRDETVTF
SSTYIRSCVDAGDMVAAEEALGRPHRVEGVVVRGDGRGRDLGFPTANVAP
PMYAAIPADGVYAAWFTVLGHGPVVGTVTPGERYQAAVSVGTNPTFSGRT
RTVEAFVLDTEADLYGQHVAVDFVARLRGQEKFGSVADLITAMEGDTERA
RTILSAQ
145224604YP_001135282.1 30S ribosomal protein S15 [Mycobacterium gilvum PYR-GCK]MALTTEQKKEILGQYGLHDTDTGSPEAQVALLTKRISDLTEHLKQHKHDH
HSRRGLLLLVGRRRRLLKYVAQVDVARYRSLIERLGLRR
145224603YP_001135281.1 polynucleotide phosphorylase/polyadenylase [Mycobacterium gilvum PYMSVVEIEEGVFESTATIDNGSFGTRTIRFETGRLARQAAGAVVAYLDDET
MLLSATTASKQPKEHFDFFPLTIDVEERMYAAGRIPGSFFRREGRPSTDA
ILTCRLIDRPLRPTFISGLRNEIQVVVTVLSLDPKDLYDVLAINAASAST
QISGIPFNGPVGGVRVALIDGQWVAFPTVEQLEKAVFDMVVAGRKVGDAG
NEDVAIMMVEAEATDKVIELVAGGAGAPTEAVVAEGLEAAKPFIAALCDA
QAALAGAAGKETAEYPVFPDYAEDVYYSVASVATDALSEALTIAGKEARD
DRTNEIKAEVVERLAEQYAGREKEIGAAYRSLTKKLVRQRILTDHFRIDG
RGVTDIRALSAEVAVIPRAHGSALFERGETQIMGVTTLDMVKMAQQIDSL
GPETSKRYMHHYNFPPYSTGETGRVGSPKRREIGHGALAERALMPVLPSV
EEFPYAIRQVSEALSSNGSTSMGSVCASTLSLLNAGVPLKAPVAGIAMGL
VSDDVEVEGGGVERRFVTLTDILGAEDAFGDMDFKCAGTKDFVTALQLDT
KLDGIPSQVLAGALAQAKDARITILEVMAEAIDEPDEMSPYAPRITTIKV
PVDKIGEVIGPKGKMINSITEETGASISIEDDGTVFVGASNGEAAQAAID
KINAIANPQLPKVGERFLGTVVKTTDFGAFVSLLPGRDGLVHISKLGRGK
RINKVEDVAKVGDKLRVEIADIDNRGKISLVLVAEEEAGAATPEAPAPAD
AATSSS
145224602YP_001135280.1 peptidase M16 domain-containing protein [Mycobacterium gilvum PYR-GMRRTRLPGGLRVVTEHIPSVHSASVGVWVNVGSRDEGRSVAGAAHFLEHL
LFKATPTRTAVQIAQAVDAVGGELNAFTSREHTCYYAHVLDSDLELAVDL
VADVVLNGRCEPDDVEVERDVVLEEIAMRDDDPEDTLGDVFLSAMFGDHP
VGRPVVGSVASIAGMTRSQLHSFHVRRYTPDRMVVAVAGNIEHDEVVRLV
RRHFGRHLVRGRSPVAPRKGAGRVAGRPTLELVKRDAEQTHLSLGVRTPG
RHWEHRWALSVLNTALGGGLSSRLFQQIRETRGLAYSVYSTVDTFADTGA
LSIYAGCQPERFDEVVRVTTDILADVARDGITADECRIAKGSLRGGLVLG
LEDSGSRMNRIGRSELNFGEHRTIADTLSKIDEVTIDEVNAVARQLLTRP
FGAAVLGPVRSKRSLPKPLQQIAG
145224601YP_001135279.1 beta-lactamase [Mycobacterium gilvum PYR-GCK]MTELSRRHVLLGGLSLFALTACSTQTVLADPARPLPPPEERIAALAARHD
ARIGLYAADLDSGATLAFGDTDTFAVCSTFKTYAAGAVLQRVQQGRLGLG
DTVLIEAADIRPHSPVTEPRVGTAMTLAELCQAALQQSDNAAANGLLRVL
GGPSAITEFARSIGDDRTRLDRWEVELNSAVPGDPRDTSTPRALATGYQA
LLTGDVLDPAGRRQLVDWMLANQTSSMRAGLPAGYTSADKTGSGDYGSTN
DVGIAFGPAGQRLLLAVMTRSASDDPDAPSLRPLIGELATLVLSEL
145224600YP_001135278.1 hypothetical protein Mflv_4020 [Mycobacterium gilvum PYR-GCK]MSSRLADMAALSEVLPDDVPTTTADALALFDSLAAVDPQFMIGTWHGAEL
PTGHPLDGILAASGWWGKRFRDNETVDPLLFPTADGAGLFALNPAPAFAG
LGLFTRFPMLKKQNFTAAVATLRPALQARGPKARLRTTRYRGVDTATMIY
DQLPINDVFRLVDDTPGSEVVLGAMDLRGYDAPYFFVLLRDGSRS
145224599YP_001135277.1 SecC motif-containing protein [Mycobacterium gilvum PYR-GCK]MRSDDMCPCGSGDLYGRCCLPLHTGQRGAETAEQLMRSRYSAFVAGDAEY
VWRTWHPRTRPADVTDLTVTWTRLEIVDRVDGGPGDDTGEVEFRAHHRAG
VLHERSRFAVRAGRWFYVDGEIFD
145224598YP_001135276.1 glyoxalase/bleomycin resistance protein/dioxygenase [Mycobacterium MSDYAAPVGAPIWLDLMSTDPARAAEFYHAVFGWDVEAPPQAEFGGYQNF
TVNGRRVAGLLPHMGGVPNVWSVYLHTADAAETVRAVEAAGGSVMVPPMP
VGDMGSMMVATDPAGAVIGFWQPGTHVGFTQWGVHGTPYWFECQSKDYEK
SLAFYPQVIGARTEEIGTGGDPNAVGPDRYAQLFIGESAYSGIMDSATLF
PAEVPSFWQIYITVDDVAGTVARAESLGAQILMPGEETPYGTLAALRDPL
GALICLGHPPAGM
145224597YP_001135275.1 alanine dehydrogenase [Mycobacterium gilvum PYR-GCK]MRVGIPTEIKNNEFRVAITPSGVAELVQRGHEVLIQSGAGDGSSISDADF
KRAGAQLITGADEVWSEADLLLKVKEPIEAEYSKMREGQTLFTYLHLAAS
KPCTDALMASGTTSIAYETVQLTDGSLPLLAPMSEVAGRLSAQVGSYHLM
RSHGGRGVLMGGVPGVAPAEVVVIGGGVAGYNAARIAKGMGAHVNVFDVN
INTLRKIDNENNGAIETRYSSSLDLEDAVKHADLVIGAVLVPGARAPKLV
SNSTVAAMKPGAVLVDIAIDQGGCFEDSRPTTHDDPTFAVHDTVFYCVAN
MPGAVPRTSTYALTNATLPYVLKLAGRGWRDACRADPALAKGLSTHEGAL
LSEQVAADLDVPYTDPAELLA
145224596YP_001135274.1 AsnC family transcriptional regulator [Mycobacterium gilvum PYR-GCKMSKESTTSRSSAGLAPKDVREVTLDDVDRRILTALHSDARMANSALAELV
GIAPSTCHGRVRRLQELGVIRGFYADIDPAAIGLTLQAMISVSLQANSRS
QIRHFIQTIRRKPQVMDVYFLAGADDFILHVAARDTEDLRAFVVENLNAD
ADVAGTQTSLIFEHLRGASPL
145224595YP_001135273.1 hypothetical protein Mflv_4015 [Mycobacterium gilvum PYR-GCK]MRWTHARSSLVAVAAGCMAVAVTLSVTPAQAAPYGSNGVFGVTTQPRDGW
ATTYIPPGRYRVDQSPSMQPYQSPPGRWFRCSEFPCAPTAPGNIMGSGAA
LRDAPTFVDILPTDVAVALHNVTLTPA
145224594YP_001135272.1 hypothetical protein Mflv_4014 [Mycobacterium gilvum PYR-GCK]MAGLSVGRTSVRCMDGVAEAVGVIGEQLAVLAKAAEDLSHRELIGLLSEL
TTVLRSAPAVEHAVLARLLDETEPHHLGEASWKKVLTTSLRMSSAEAGRR
LQRAKNLGPRRAMTGEPLAPVWESTAAAQAQGHLGEEHVEIIAKFHKKLP
SWVDVDTRAAADAQLAHTGSGLGPEELAQVADRLLMMIDQDGPEPSEKEK
ATRFWVKLGTQQRDGGRTISGYVDAETSAYWEAVLAKEAAPGANMAEQEK
AGDTRTQGQRNHDGLKAVLRRTLESGQLGSHNGLPVTVIVSTTLQELEKG
AGVAVTGGGSLLPIPELIRLAADAHHYLYVYDGHTGQSLYLGRAKRLANA
AQRIVMHARDRGCTRPGCTVPGYWCQAHHASADWKDDGHTDIDDLTFACG
PENRMIENTGWTTAKNSRNQTEWIPPPDLETGQHRVNGYHHPERHLLPHE
EGEDSSTSRDCDDP
145224593YP_001135271.1 dihydrodipicolinate reductase [Mycobacterium gilvum PYR-GCK]MRVGVLGAKGKVGATMVAGVQAAEDLTFTTGIDAGDPLSALVDTDTEVVI
DFTHPDVVMDNLKFLIENGIHAVVGTTGFTDERLDQVRKWLEAKPDVSVL
IAPNFAIGAVLSMHFAQQAAKHFESVEVIELHHPHKADAPSGTAARTARL
IAEARKGMPPNPDATSTGLEGARGADVDGVPVHSIRLAGLVAHQEVLFGT
LGETLTIRHDSIDRTSFVPGVLLAVRKIRENPGLTIGIESLLDLA
145224592YP_001135270.1 TPR repeat-containing protein [Mycobacterium gilvum PYR-GCK]MSDGSRALRIQLLIGFMCVALVVYFVLLGRTALILIGSGEAAPVGLGLAI
LIMPAIGAWVLVATLKAGLAHQRLARKARESGMDLDVDDLPRRASGRIER
DAADALFATVRTEVENDPDNWVRWYRLARAYDYAGDRTRARETMKKAVQM
EESAQ
145224591YP_001135269.1 hypothetical protein Mflv_4011 [Mycobacterium gilvum PYR-GCK]MSKTLLIVHHTPSPHCQEMFEAVLAGATDPEIEGVEVLRRPALTVSPAEM
LAADGYLLGTPANLGYISGAMKHAFDCSYYQLLDATKGRPFGVFLHGNEG
TEGAQRALTGITGGLGWEQAADTVVVSGKPAKNDLEACWNLGATVAATLM
D
145224590YP_001135268.1 hypothetical protein Mflv_4010 [Mycobacterium gilvum PYR-GCK]MPGMAEFALAGAPIAGGALLGLAAGNLRPPDVRDAIAKDLDLLERLPAEQ
VERRAELQRIIDMRIDGLVAAADKSRELRELAMSYEGNWRDIVLFVCAIM
FTLVWWHVDHSRSNWLVMFVVMIVLTVIVGIYAARGVLRGLASFLANRRR
GRQ
145224589YP_001135267.1 HpcH/HpaI aldolase [Mycobacterium gilvum PYR-GCK]MYDQSFGEAAFGEQGQRIDPVLARSWLLVNGAHYERFQAAAHSRADIVVL
DIEDAVAPKDKAAARANVVRWLGEGHADWVRVNGFGTEWWAGDLEMLAGT
SVGGVMLAMVESVDHVTETAKRLPGVPIVALVETARGLERITEIAAAKGT
FRLAFGIGDFRRDTGFGGDALTLAYTRSRFTIAAKAAHLPSAIDGPTVGS
SALKLSEATAVSAEFGMTGKICLTPEQCLTVNEGLSPSAEEIAWAKEFFV
EFERDGGEIRNGSDLPRIARANKILELARAYGIEPSEFDDVDEPTHIPAP
SDTYHY
145224588YP_001135266.1 dienelactone hydrolase [Mycobacterium gilvum PYR-GCK]MPTITDTVTTTDGSCPVTLHTPDGDGPWRGIVMYPDAGGVRPTFRTMADQ
LAGHGYAVLLPDVYYREGDWAPFTMSTVFGDAAERRRLFGMISKVTPERM
ESDAVAFFDYLADRPEVSGETFGTTGYCMGGRTSLVVAGRVPQRVAAAMS
FHGGGLVTDDAESPHLLADRIRAAVYVGAAHNDNSFTRADGETLDKALSA
AGVEHTVDWYSAQHGFAVPDNGPYDESAARRHWDAMQSFFAAHLV
145224587YP_001135265.1 thymidylate synthase [Mycobacterium gilvum PYR-GCK]MPTATPYEDLLRLVLDTGTPKSDRTGTGTRSLFGHQMRYDLNAGFPLITT
KKVHTKSIVYELLWFLRGDSNVRWLQERGVTIWDEWASPTGDLGPVYGVQ
WRSWPTPSGEHIDQISAALDLLKRDPDSRRNIVSAWNVGEIPQMALPPCH
AFFQFYVADGRLSCQLYQRSADLFLGVPFNIASYALLTHMMAAQAGLGVG
EFIWTGGDCHIYDNHVEQVTEQLSRDPRPYPELVLAPRDSIFDYTYEDVV
IKNYEPHPAIKAPVAI
145224586YP_001135264.1 dihydrofolate reductase [Mycobacterium gilvum PYR-GCK]MTELNLIWAQSSSGVIGRDGGIPWHVPEDMARFKELTMGHTVIMGRQTWE
SLPEKFRPLPGRRNVVLTRQADYVAEGAEVVTALEDAPLDDAWVIGGSQV
YGLALPLATRCEITEVDLDLHRQDEDALAPLLDEAWVGTEGEWRDSASGL
RYRFYSYVRK
145224585YP_001135263.1 hypothetical protein Mflv_4005 [Mycobacterium gilvum PYR-GCK]MRLTAAQARRVAVAAQGFHEPRPSGPVTRAHLKRLIARLQVLQLDSVSVA
VRAHYAPVFSRLGPYDRDVLDRAAWSHSARSPRLLVEYWAHEAALMAVDD
WPLLRWRMREYEHGRWGREIVKKNGKLAADIVEAVTALGPCTAGQIEAYL
ESEPRRTGGSVKKAMWDRSDTKWVAEALWSSGVLTTATRVGFARHYDLTE
RVLPADVVARRVDEADALRELTLRAATALGVATEADLRDYFRLGARQVRP
AITDLLDAGEIERVEVDGWDAPAYLRAGQTVPRRDRGTALLCPFDPLIFF
RPRVERLFGGFHYRIEIYVPQPKRRYGYYVWPFLLDGDLVGRVDLKADRT
AGALQVLGAYCEGGRDGPRVAAELATALRQMADWLGLDDVVVAERGDLSA
HLRAALVS
145224584YP_001135262.1 haloalkane dehalogenase [Mycobacterium gilvum PYR-GCK]MDVLRTPYERFTDLPGFPFDPHYVEVGGLRMHYLDEGPAGGDVVLLLHGE
PSWSYLYRTMIPVLVDAGLRAVAIDLVGFGRSDKPADRADYTYQAHVDWT
WGAVAALGLADITLVCQD
145224583YP_001135261.1 diguanylate cyclase [Mycobacterium gilvum PYR-GCK]MPASDRQWWRQTDQFEWFSNYLRERGMQQRWRWATFTFTVVLGALPLVML
ASPLGPDTDLTRGVAIVSGAAGAGASLLWLSGWPSRTQSLVYNALCSGGI
AMGCLALSNPYSGLMGCTLFAVIGGFLAYFHSVGQVAANFAVAAICATIT
AARLVTETGDVALTAAAAINVIALNTGVPFGIHSLVHSLHTDLRAADRDP
LTGLLNRRAFYSAVNQLLADTHAVDAAFNVTVIDLDKFKSLNDTRGHAVG
DAALVYVAEILHRHAGASAVSGRLGGEEFVVADVDLPVLQRRTADLIREG
IAAGPFGITASLGICSARIAWEDSAAGGMSPDFLDKLIESADAAMYVSKR
AGGDRVEHRRLDGADLADA
145224582YP_001135260.1 FAD-dependent thymidylate synthase [Mycobacterium gilvum PYR-GCK]MAEIAPLRVQLIAKTEFSAPPDVEWSTDADGGAALVEFAGRACYQSWSKP
NPRTATNATYVRHIIDVGHFSVLEHASVSFYITGLSRSCTHELIRHRHFS
YSQLSQRYVPENDAEVVAPPGIEDDPELLALFTAATDASRAAYTELLNRL
EAKLADQGTSTLRRKQARQAARAVLPNATETRIVVTGNYRAWRHFIAMRA
SEHADVEIRRLAIECLRRLVAVAPQVFSDFEITALADGTEVATSPLATEV
145224581YP_001135259.1 dihydrodipicolinate synthase [Mycobacterium gilvum PYR-GCK]MPVSTSGFDAPARLGTLLTAMATPFKPDGSLDIETAARLATRLVDAGCDG
LVVSGTTGESPTTTDDEKILLLRTVLEAVGDRARIVAGAGTYDTAHSIHL
AKASAAEGAHGLLVVTPYYSRPPQAGLVAHFTAVADATDLPNILYDIPPR
SVVPIEWDTIRRLAQHPNIVAIKDAKADLHGGGQIIAETGLAYYSGDDAL
NLPWLAMGAVGFISVWGHLAASQLRDMLSAFASGDVATARKINVALGPLS
AAQSRLGGVTLSKAGLRLQGFEVGDPRLPQIPANDVQLQALAADMRAASV
LR
145224580YP_001135258.1 beta-lactamase domain-containing protein [Mycobacterium gilvum PYR-MDLTHTPPGPLAPGGLRVTALGGIGEIGRNMTVFEHLGRLLIVDCGVLFP
THDEPGVDLILPDLRHVQDRLDDVEAIVVTHAHEDHIGAIPFVLKQRADI
PIVGSKFTLALIAEKCREHRLSPKLVEVTEGTKSTHGVFECQYFAVNHSV
PGCLAIGIHTGAGTVLHTGDIKLDQLPPDGRPTDLPGMSRLGDAGVDLFL
CDSTNSEIPGVGPSESEVGPALHRLMRGADGRVIVACFASNVDRVQSIID
AAVALGRRVSFVGRSMVRNMGIARELGYLKVADEDVLDIAAAEMMPADRV
VLITTGTQGEPMAALSRMSRGEHRSITLTAGDLIILSSSLIPGNEEAVYG
VIDSLAKIGARVVTNAQARVHVSGHAYAGELLFLYNGVRPRNVMPVHGTW
RMLRANAALAARTGVPDENIVIAENGVSVDLVAGRVSVAGSVPVGKMFVD
GLVTGDVGDATLGERLILSSGFVAVTVVVRRGTGKAVAPAHLHARGFSED
PKALEPAARKVEAELEHLASQNVTEPTRIAQGVRRAVGKWVGETYRRQPM
IVPTVIEI
145224579YP_001135257.1 two component transcriptional regulator [Mycobacterium gilvum PYR-GMAAVLIAEDEPRISALVRKGLSANGFSVTVVPDGPSAYAYAHSGAFDLMV
LDTGLPGMDGLSVLRRLRAEGSALPVIVLTTRTTGADTAALLGGADDVIA
KPFRLEDLVSRVRTRLSPGRAARTHTLSYGNLRLDLRTRRAHVGDYSVDL
SAREFALAEMFLRHPGQVLTRDQLLRQVWGNDYEPGSNVVDVYVRYLRRK
LGARRFVTLRGMGYRLEAVH
145224578YP_001135256.1 putative methyltransferase [Mycobacterium gilvum PYR-GCK]MTSRDAAAETAFGPMVLAAIEHNEPPDRRLVDDDLAESFLPNRFRLLVRC
ARVAAVRRAVIAAADRSGPGLWASIACRKRYIDERLSDPLNDTDAVVVLG
AGLDTRSCRIARHSTMPVFEVDQQINVDRKQAVLRRTLGEVPSSVRLVGV
DLERGQVMPALRAQGYDTRARTFFSRAPLTPFPDAVRATLTQLDGAAEGS
KLIFSYIRQDFIDGTDLYGARSVYRRFRQRRAVWKSGLVPEHVGELLADH
GWRLVEQAGPSYYRDTYIRPTGRPLAASPLEWTVFAER
145224577YP_001135255.1 3-ketoacyl-ACP reductase [Mycobacterium gilvum PYR-GCK]MAELTGKVAFITGAARGQGRAHAVKLASEGADIIALDLCAQIDSVPYPLA
TPDDMAATVKLVEEAGGRIATYEADVRDRDAVKAVVRDGTEKFGDRLDIV
IANAGIAPMAAADAWQDVIDVNLTGVYNTIDVAMKPMVKFGNGGAIVLTS
SVAGLVGIGAPLGGSVGYAAAKHGIVGIMRVYANFLAQYSIRVNSVHPAG
VNTPMIDNDFTRSWLDGMAQQSQGGPDMGNALPVQTLEPEDIANAVYWLV
SDAARYVTGITLPVDAGFVNKR
145224576YP_001135254.1 antibiotic biosynthesis monooxygenase [Mycobacterium gilvum PYR-GCKMPIVVVATLTAKPESVETVRNACKQAIEAVHEEPGCQLYSLHEADNTFVF
VEQWEDADALQKHSAAPAVATMFGAVGEHLDGAPDIKVLQPVVAGDPAKG
QLRA
145224575YP_001135253.1 cell division protein FtsK [Mycobacterium gilvum PYR-GCK]MASKTAARSSARQTRSKPAPRGGGRSARPAAPRRKPAPRKPARRNSSAIS
TAGTAVGKGVRAGWLMVAKGAGSTARSVGRARELEPGHRRDGIALALLGL
AVIVAASSWFDAARPVGAWIDTTVRVLIGAAVVLVPVLLAVVGVTLMRSE
PDPEARPRLILGSAMVALPAFGLWHLWAGAPADPVERRHAGGFLGFALGG
PLSDGLTAWIAAPLLFIGVLFGVLLLTGTTIREVPATVRDMFTTRWRDDD
DEYYDDSYDGDESYDGDDYYDEDHDGDDDRDHDDRADDFSDGYYDEQIGD
PDDEAQWPAAAQPTVPLTRPDGPTGTPMENYPLVDEDDDVAAPVAAPAVT
SRKKTPKEPKLSLDRVVEGPYVLPPLDLLVAGEPPKRLTAANQQMTDAIS
SVLQQFKVDAAVTGCTRGPTVTRYEVELGPGVKVEKITALQRNIAYAVAT
ESVRMLAPIPGKSAVGIEVPNIDREMVRLADVLTAPSTRRDHHPLVIGLG
KDIEGDFISANLAKMPHLLVAGSTGSGKSSFVNSMLVSLLARATPDEVRM
ILIDPKMVELTPYEGIPHLITPIITEPKKAAAALAWLVEEMEQRYQDMQA
SRVRHIDVFNDKVRSGEITAPLGSNRIYKPYPYILAIVDELADLMMTAPR
DVEEAIVRITQKARAAGIHLVLATQRPSVDVVTGLIKTNVPSRLAFATSS
LTDSRVILDQPGAEKLIGMGDGLFLPMGANKPIRLQGAFITDEEIHAVVT
ATKDQAEPEFVEGVTAVKAGERKDVDPDIGDDMDVLLQAVELVVSSQFGS
TSMLQRKLRVGFAKAGRLMDLMETRGIVGPSEGSKAREVLVKPDELAGTL
ALIRGGSDANGADGEDDETDF
145224574YP_001135252.1 type 12 methyltransferase [Mycobacterium gilvum PYR-GCK]MVVKSGTEGPRNMRLSLRGANAAERLALRAGVVPTAAAEAWGGMALSAVM
IAAVRTGLTARLARRPGTAAELAADLGLDPVPTRLILDCLRSGGHVRCRS
GRYRLTRSSRRWLDPASKLSVAQYVAGTADYWSWWANLDEVTRTGRPAAH
HDAPPGDPYWQRYIDGQLELARLSAGEVARKLRLPGEPWSLLDLGGGHGW
YSAQLCRRYPTLAATVLDLPGSAAVGRRVIADAGMADRVTHRDGDVTTAA
LGGGYDAVLCFNLLHHLSAEETVALFGRIHQALAPGGTLAVMDAFAEPGH
ATSAQANVLGLFVYLSSGSQVHPPAQLHEWLRQAGFGVPRRIPILRIPGQ
AMYVVAKT
145224573YP_001135251.1 UbiA prenyltransferase [Mycobacterium gilvum PYR-GCK]MLVRARALISAGHPGPSVAITALVALLAALSGSRGGDFALAVTAMLAGQL
SIGWSNDAADARRDAAAGRRDKPVVTGAVSVRAVWVAAVAALVTALSLGL
ALGVPTALLLAVVVGAGWVYNLGAKATTASGLMYILGFGPLPAYAASALP
GQPLPQWYATAAAALVGLGGHFANVLPDLAADRATGVAGLPQRVGARWGP
GAVRASALILLLSASVLLLFASGGHPVAWVGLGVAALLAVIAALGTGRVP
FAAAFGIAAVDVVLLVVVGYAQA
145224572YP_001135250.1 chalcone/stilbene synthase domain-containing protein [MycobacteriumMPRPDGNPILSVRSVFPAHRYPQAELSDAVAELSGLSADQRAQLGRLHAH
AGVEHRHTALPLSGYAALRTVEASNDRYVDEAVDLGERALRRALSAADVD
PADLDALFVTSVTGVTVPSLDARLIPRLGLRPDIRRVPILGLGCVAGAAG
LARLHDYLLAWPQHHAALLAVEICSLSWPTTRITTADLVVTGLFGDGAAA
VVAGGGGTRDAPRVLATRSEVYPDSTDALGWRLGDDGFRIVLTAELADVV
ERYLAGTVTAFLAEHDLTVEEISAWVCHPGGPKVLDAVQNSLKLPDSALA
LSRRSLAEVGNVSSVSVLHILEETLGQVAGERPPPGSTGLMIGLGPGISA
ELVLLRW
145224571YP_001135249.1 N-acetylglutamate synthase [Mycobacterium gilvum PYR-GCK]MVRRARTSDVPHIKALVDIYAGRILLEKNLVTLYESVQEFWVAEVDGEVV
GCGALHVLWSDLGEVRTVAVDPKVRGRGVGHAIVERLLTVAADLRLQRIF
VLTFEVDFFARHGFQEIEGTPVTAEVYEEMCRSYDTGVAEFLDLSYVKPN
ILGNTRMLLLL
145224570YP_001135248.1 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase MCNQYSVAVPGQPHTDPVVPRARVANIANVLTGIRMALVPVFLVALFVGD
GHETFWRLTAFTIFLVAVITDRLDGALARSYGMVTEFGTLADPIADKMLI
GSALVGLSILGDLPWWVTVVILVREVAVTVLRLVVLRRGVIPASRGGKIK
TLVQAVAIGLFVMPLSGAWLTGAWVIMAAAGVLTVLTGVDYFVSAVRDWR
RQSPGR
145224569YP_001135247.1 XRE family transcriptional regulator [Mycobacterium gilvum PYR-GCK]MTALVREVIGDVLRRARIEQGRTLREVSDSARVSLGYLSEVERGRKEASS
ELLSAICTALDVPLSRVLSEAGQELAVEESRAPAPKIDVTTKVVIPQVVS
MAVA
145224568YP_001135246.1 phage shock protein A- PspA [Mycobacterium gilvum PYR-GCK]MANPFTKAWKYLMALFSSKVDEYADPKVQIQQAIEEAQRQHQALTQQAAQ
VIGNQRQLEMRLNRQLADIEKLQVNVRQALTLADQAVAAGDTNKATEYNN
AAEAFAAQLVTAEQSVEDLKGLHDQALQAAGQAKKAVEQNAMMLQQKVAE
RTKLLSQLEQAKMQEQVSSSLRSMSELAAPGNTPSLDEVRDKIERRYANA
IGSAELAQNSVQGRMLEVQQASVQMAGHSRLEQIRASMRGEQLPAGGNAA
AAPNPTPAAPAANPAPENPLSQ
145224567YP_001135245.1 hypothetical protein Mflv_3986 [Mycobacterium gilvum PYR-GCK]MVSTRTGRPDAWRSMAQRGIDTAAEWSGLVADRLSAAADPRAKLLRKRRR
ALRLGVFLTVSAVFWVAMTALVAVWDTPVWALFIPSPIAVGAAFLATLAF
LRYRWLRGEPLPPQRITRHLPPWGSAARQPMAALTTSERGLFSLLGIMER
GQLLPAGELLELRVAAEQTAATMVATSAEVVSMEKAVKSSPQSRAYLTPT
IAAFTAQLDQGARQYNEMVGAAAQLVSAANSGTLSSSPMSARRYRDELGM
ATDRLKGWAQAFDELGRLRGA
145224566YP_001135244.1 limonene-1-2-epoxide hydrolase [Mycobacterium gilvum PYR-GCK]MTDQADPTALTAMTDKADIVQRFLFALEVNDFDTFEELAAPGLVWQNVGL
PSLRGRSTILKTLRRAEGKFGFAVKFHRIAADEGDTVLTERTDAIILGPL
RLQFWVCGRFDINDAGQITLWRDYFDLFDFLVKAPLRALPGILVPSLRPK
F
145224565YP_001135243.1 UDP-glucuronosyl/UDP-glucosyltransferase [Mycobacterium gilvum PYR-MRVAVVAGPDPGHAFPALELCRRFRAAGDAPTLLTGTRWLDVARGEGVDA
VELDGLDPTAFDDDTDAGEKIHRRAARMAVLNRARIGELSPDLVVSDSIT
VCGGLAADLLGVPWVELNTHPLYRPSRGLPPVGSGLAPGVGLRGRARDAV
LRALTARSWRAGLRQRAAARVEIGLPGDDPGPVRRLIATLPALEVPRPDW
PAEAVVVGPLHFEPTTELLAVPAGGGPLVVVAPSTATTGAGGMAELALNT
LVPGDTLPPGARVAVSQLDGPDSAVPPWAVVGLGRQDELLARADLLICGG
GHGTVAKSLLAGVPMVVVPGGGDQWEIANRLVRQGSAQLVRPLSAESLAA
AVREVLGSPSYREAAVRAGAGVADVADPVRVCHDALGAPRKLGPCG
145224564YP_001135242.1 hypothetical protein Mflv_3983 [Mycobacterium gilvum PYR-GCK]MRLTEFQELVERQFGAARASSMLVDHVLTSIGGRTPAQAIEDGVDPRDVW
RALCADFDVPRDQW
145224563YP_001135241.1 hydrogenase expression/formation protein HypE [Mycobacterium gilvumMPDTEPEASIETEPEASIETEPEASIDMESWVCPLPLRDAPAIVTGHGGG
GAMSGELVEHLFLPAFGSAAEAGLADSAVVEIGGARLAFSTDSFVVKPMV
FPGGTIGDLAVNGTVNDLAMAGAVPAVLSTAFILEEGTALDHLARVAQAV
GTAALAAGVKLVTGDTKVVDSGHGDGVYINTTGIGLVDPRVDIRPQRAAP
GDVVIVSGDLGVHGIAVLSCREGLEFATSVASDAAPLHGLVAAMVETGAD
IHTLRDPTRGGLAATLNEIARAAGVGVSIADTALPIPQEVRDACSMLGLD
PLYVANEGKLVAFVPAADADEVLAAMHAHPLGAQSAVIGTCVPDHPGMVV
AKTALGGNRVVDLPIGEQLPRIC
145224562YP_001135240.1 hydrogenase expression/formation protein HypD [Mycobacterium gilvumMKYLDEFSNPELAHRLIEQIEAVATRRWSIMEVCGGQTHSIIRHGIDQLL
PDTVEMIHGPGCPVCVTPLEIIDKALDIASRPEVIFCSFGDMLRVPGSEK
DLFRVKSEGADVRVVYSPLDALTIARDNPDRQVVFFGIGFETTAPANAMT
VYQAKKLGIENFSLLVSHVLVPPAIAAIMESPTCRVQAFLAAGHVCTVMG
TDEYPPLCDKYGTPIVVTGFEPLDILEGIRRTVIQLEAGRHELENAYPRA
VQDTGNPAAKAMLLDVFDVTDRTWRGIGMIASSGWRLSPAYRHFDAEHRF
AATDLHNEESAICRSGEVLQGLIKPHECTAFGTSCTPRNPLGATMVSSEG
ACAAYYLYRRLEVTHA
145224561YP_001135239.1 hydrogenase assembly chaperone HypC/HupF [Mycobacterium gilvum PYR-MCLAVPGRILSIHERDGTTMSVVDFGGIRKNVCLQYLPDAQVGQYVVVHV
GFAIQRLDEESARRTLAEFAHLGVLDEEFADGFASAARQARLANPDTGAR
SESIP
145224560YP_001135238.1 (NiFe) hydrogenase maturation protein HypF [Mycobacterium gilvum PYMTARRRVHAGVRGVVQGVGFRPFVYTQATLLGLSGWVRNDSSGAIIEVEG
GNDALERFLDVLRHHPPPLAVIDSIDVRYIAVTGGTGFTIVDTSRTDGGR
TLASPDVAMCAECAAEQRDPRNRRYRHAFVNCTNCGPRFTLIASLPYDRA
STTMAEFEMCADCAREYHDPADRRFHAQPICCPGCGPTLRYRDRAGRELA
GESGLRAARRMLRAGKIVAVKGIGGYHLACDATGPRAVTTLRARKRRGDK
PFAVMVPDLDAARRVAEVDPASAALLTGPARPIVLMPRRAGAAVADAVAP
HNPDLGVVLAYAPLHTLLFGFGGDEPAPQTLVMTSGNVAGEPICFTDDDA
WQRLRPLADGWLYHDRAILVPCDDSVMRADTAIRRSRGYAPLPVALPVAL
APTLAVGADIKNTMAVADGRYAWVSQHIGDMDDAATLSAFDSTRRHLEQL
TRVDPELLVADAHPAYRSTAWAHRNAAGRPVRTVAHHHAHIAAVMAEHGL
DGDEPVLGFAFDGTGYGPDGAVWGGEVLLADYKGYQRLARLRYVPLAGGD
VSVKRPYRMALAHLWAAGLPWDRDLAPVRSCPAEELSVLRHQLETGLGCV
PTSSMGRLFDAVSALAGVRQVVGYEAQAAIELEGLSRHENCGDTRYRFGI
GTGSSPVDLDPAPVLAAVVADAGRGIAPGVIGARFHRAVAALIADLASMS
PGYRVALSGGVFQNRLLLQLAQDMLRANGFDVLTHRHVPPNDGGIALGQL
MIGNAV
145224559YP_001135237.1 hydrogenase nickel incorporation protein HypB [Mycobacterium gilvumMCATCGCGEDGTTITVPVQGHDHHHNHPHDQPDDHHQHHHPHPTETVTLE
QKVLAKNDGIAARNRRWLTERDIVAFNMTSSPGSGKTTLLERTIRDLHPT
RSVAVIEGDQETLLDAERIQATGARVVQVNTGAGCHLDAEMIRRALDTLA
PRRARVLFIENVGNLVCPALFDLGETSKVVVISVTEGADKPLKYPHMFAA
ADLVLINKSDLLPYVDFDIDACASAARSVNPGVGILTLSAKTGDGVEEWY
DWISQRSIYDARVPIAGGRPAPEVRPHQEIRRR
145224558YP_001135236.1 hydrogenase expression/synthesis- HypA [Mycobacterium gilvum PYR-GCMHEMAITQSVVDAACAHADGRRVHRVLLEIGELCALVPDSMRFCFELATQ
GTVADGAQLDMDLRPGAAHCRTCHRLFELHDPILLCPCGSADVEVLAGRD
LRILSMEVS
145224557YP_001135235.1 dienelactone hydrolase [Mycobacterium gilvum PYR-GCK]MPTRDDVRIPAHGDEIAAYVYRPPAGVGATACVVMAHGFTGTRDDGLPDY
AEAFRDAGYVVVLFDYRHFGASSGQPRQLLDMARQREDFHTVIEWARRLD
GVDPNRIVAWGSSFSGGHVLAVAAEDPRLAAVIAQAPFTDALATLRNAPL
RNIPPMVVAALRDQLGAWRNRPPRMLAAVGPPGDLAALTSPDAEPGFGAI
LGPESLWRNEFAARLMLRFAFERPGRKAATLQMPVLFCVCDDDVVTPPGP
TIEAARRAPCGELRRYPYGHFDIYHDPQVKADQLEFLHRALARGGR
145224556YP_001135234.1 recombinase A [Mycobacterium gilvum PYR-GCK]MAQQAPDREKALELALAQIDKNFGKGSVMRLGEDVRPPIAVIPTGSIALD
VALGIGGLPRGRVIEIYGPESSGKTTVALHAVANAQAAGGIAAFIDAEHA
LDPDYAKKLGVDTDALLVSQPDTGEQALEIADMLIRSGALDILVIDSVAA
LVPRAEIEGEMGDSHVGLQARLMSQALRKMTGALNNSGTTAIFINQLREK
IGVMFGSPETTTGGKALKFYSSVRLDVRRIETLKDGTDAVGNRTRVKVVK
NKVSPPFKQAEFDILYGKGISREGSLIDMGVEQGFIRKSGSWFTYDGEQL
GQGKENARNFLLQNPDVGNEIEKKIKEKLGIGAQLTDDVADDALPAPVDF
145224555YP_001135233.1 recombination regulator RecX [Mycobacterium gilvum PYR-GCK]MTSPMTLFPLPSTSDSDGTPGTDEFATRAEQARALCLRLLTVRARTRAEL
EAQLTKRGYPDDVSAEVLDRLAQVGLVDDEDFAEQWVRSRRINAGKGKRA
LASELRNKGVDSEVIDAALADIDAGAERTRAEQLVRDKLRREKLGDPGDR
DAENKVMRRLVGMLARRGYHQSMALDVVTTELANERERRTV
145224554YP_001135232.1 hypothetical protein Mflv_3973 [Mycobacterium gilvum PYR-GCK]MNLVVGASWCAAIAGIVLGTAALIVFRSPLPAARVTLELFTAAGLLRLSV
DATWTAIAATAVVILLRRTVTRSLVADFSASPWRAQRST
145224553YP_001135231.1 hypothetical protein Mflv_3972 [Mycobacterium gilvum PYR-GCK]MTGLRDTSTLLAFDILPEQTLRDMVDVMVRLIEACGAVVIMIGAVVAIAK
FVVALGRRDIDQFSSVRLSLARFLVLGLEFQLAADVLRTAISPSFEEIGK
LAAIAAIRTLLNYFLNREIAQEQREVDLLRHPRVDDPPPAS
145224552YP_001135230.1 polar amino acid ABC transporter inner membrane subunit [MycobacterMAGSVLFDAPGPRARVRNRVITAVTVVAVLAVAWVVYSRLDERGQLTAEK
WEPFLTGDLWRTYVLPGIEGTLTAAAVSIVLALILGFVLGVGRLSTHTPI
RWVSSVLVEFFRAVPVLIMMIFAYFLYAFYDVFPSKYLALAGVITGLTLY
NGAVIAEIVRAGVHALPRGQAEASSALGLTWGQTMRSILLPQAVTSMLPV
LISQLVVVLKDTALGYQITFVEMVRQGTVIGSAYGNYIPALIVIAVLMIA
LNFSLSWFATWLEKRMRRSRKGPAPMEAEPLELQGDRSRGV
145224551YP_001135229.1 polar amino acid ABC transporter inner membrane subunit [MycobacterMEVFTEYREEIFAAFWTTVQLTVLSAIGALVLGTVLAAMRLAPVPMLNWI
GTAYVNLVRNTPLTLIILFCSFGLAQTLGLTLADRQSPTFIADSGFRLAV
LGLTVYTASFVCETVRAGVNTIPLGQAEAARSLGLTFGQNLRIVLLPQAF
RAVVIPLGSVLIALTKNTTIASAIGVAEAALLMKEMIENTAAVLVVGGIF
ALGFVILTLPLGLVFGWLGKRLAVAR
145224550YP_001135228.1 extracellular solute-binding protein [Mycobacterium gilvum PYR-GCK]MFPKSTSTRIAGALALAAALPFAMTACGGGGDSGGGGGAGGDTIVIGTKF
DQPGLGQKNPDGTMSGFDVDVATYVAGELGYAPDKIEWKESPSAQRETLI
QNGQVTFIAATYSITDSRKEKVAFAGPYLITGQSLLVRNDNNDITGAASL
ENNKILCSVSGSTPAQKIKDEYQGVQLQQYDTYSACIDALKNGAVDAVTT
DEVILAGYAAQSPGTFKIVGEPFSEERYGIGLKKDDAELRTKINDALKKM
EDSGAWKEAFDKNLGPAGITAPAPPPLDN
145224549YP_001135227.1 ABC transporter-like protein [Mycobacterium gilvum PYR-GCK]MPMISMKSVNKHFGPLHVLKDIDLEVGRGQVVVVLGPSGSGKSTLCRTIN
RLETIDSGTIAIDGVELPAEGRKLAQLRSDVGMVFQSFNLFAHKTILENV
TLAPMKVRKFSKDESREKAMALLERVGVANQADKYPAQLSGGQQQRVAIA
RSLAMNPKVMLFDEPTSALDPEMINEVLAVMTGLAGDGMTMLVVTHEMGF
ARRAANRVVFMSDGAVVEDAEPIQFFDNPQTDRAKDFLGKILHH
145224548YP_001135226.1 (dimethylallyl)adenosine tRNA methylthiotransferase [Mycobacterium MLQQADGVSPDRSSCDTPAPRTFEVRTYGCQMNVHDSERLSGLLEQAGYQ
RAGAGVDADIVVFNTCAVRENADNKLYGNLSHLAPRKQADPQMQIAVGGC
LAQKDRDAVLRKAPWVDVVFGTHNIGSLPTLLDRARHNRVAQVEIAESLR
EFPSALPASRESAYAAWVSISVGCNNTCTFCIVPSLRGKEVDRRPGDVLA
EVQALVDQGVLEITLLGQNVNAYGVSFADPTEARDRGAFAKLLRACGRID
GLERVRFTSPHPAEFTDDVIEAMAQTSNVCPTLHMPLQSGSDRILRAMRR
SYRADRYLGIIDRVRTAIPHAAITTDLIVGFPGETEEDFQATLDVVEAAR
FSSAFTFQYSKRPGTPAAELEGQIPKAVVSERYQRLIELQERISWEENRA
QIGREVELLVATGEGRKDAATARMSGRARDGRLVHFAPGALGADIRPGDI
VVTTVTGAAPHHLIADAGPAEHRRTRAGDAHAEGRTPKTGVGLGMPGIGA
PEPAPVTQGCAL
145224547YP_001135225.1 hypothetical protein Mflv_3966 [Mycobacterium gilvum PYR-GCK]MSPDPGFDDFKRDIDAAEKRVAREIDPGPRALVIAILVFVLLVTLLLPHT
GTARGLDVLTGSQAAVDNGVILPHRVFAILLVVFGAGFSMVALLTRRWAL
AWIALAGSTVASFLGVLALWTRQTAPEPYPGPGFGLIIAWLTAIVLSYHW
ARVVATRSALQLAAEEDRRRADAEGQNKGLLETFITDDDGDGPPK
145224546YP_001135224.1 hypothetical protein Mflv_3965 [Mycobacterium gilvum PYR-GCK]MTITESGGSQDAGQQTAEADNTAPAPEAPPSPRPKPSAARPKPGPAPRPV
PRPSTPAAAPVVNTVPSSDPHRFGRVDPDGTVWLITASGERTIGSWQAGD
AEAAYAHFGRRFDDLQTEVVLLETRLASGAGDARKIKSAASTLADTLPEA
HVLGDVDALAARLAAIVEQAEGATQQEKARREELRAANTARKEALAAEAE
DLAANATQWKAAGDRMRAILDEWKTITGLDRKVDDALWKRYSAARETFNR
RRGSHFAELDRERAGAKQAKEALCERAEALCDSTDWGPTSGLFRDLLTEW
KNAGRASKDVDDALWQRFKAAQDRFFAARNAATAERDAEFRANAEAKEAL
LAEAERIDASDVDAARAALRAIGDKWDAIGKVPRERAADLERRMRAVEKK
IRDAPTGGVDPEAQARADQFRERAEQFERQAEKAAAAGKTKDAEKARANA
EQWRQWADAAADSLSRKR
145224545YP_001135223.1 hypothetical protein Mflv_3964 [Mycobacterium gilvum PYR-GCK]MGEADIAVVLALAAALFMAVGDVIHQRSAHEITDEPVGHLELFLKLLRDG
RWWLGSGVAAMGFACQAAALGLGSVLLVQALLVTSLLFALPLSARLSHRR
VTRWEWIWAVLLAGAVAVIVTVGNPTEGATRASLQTWIEVAAVLGPVLVL
CLVGARMSSGAMSAVLTGVVSGALWGVFAVLTKTVVHRLDVTSLAGVVEL
LSTPELYAWAVVGILGTSTQQAAFRAGSLTASLPTMTVTEPLVGCALGVV
VLGETMRPGETGWVLLIAAAVTVVVATAALARGEATDLQPATV
145224544YP_001135222.1 hypothetical protein Mflv_3963 [Mycobacterium gilvum PYR-GCK]MVPVLSALAIVPSAPVMVPELASGAAAETADLRAAALEAVRGLPARWIAI
GVAEQDGVYGPDRAGTFGGYGVDIRVALSPEATTSAPTALPLCALICGWL
RGQARPDARVEARAYRAEHAGPVALGFGARLREQIDADAADIGVVIVADG
ANTLTPAAPGGYDEDSPTVQSALDDALAAGDCAALTRLPSGVLGRVAYQV
LAGLAGTGPRTAAELYRGAPYGVGYFAGVWTP
145224543YP_001135221.1 tRNA delta(2)-isopentenylpyrophosphate transferase [Mycobacterium gMRPLAVVGPTGTGKSDLALGIAEALSGEIAVEVVNADAMQLYRGMDIGTA
KLTVDERRGVPHHQLDVLEVTETATVARYQQAAAADVDAIAARGALPVIV
GGSMLYVQSLLDEWSFPATDPQVRARWETRLAEVGVAALHRELAAVDAAA
AASILPTDGRRIVRALEVVELTGRPFAASAPTIGAPRWNTAIVGLDWETT
VLDERLRRRTDTMFERGLVEEVRGLIGRGLRDGVTAARALGYAQVLADLD
AGGDGEAAREPTFVGTRRYVRRQRSWFRRDHRITWLDGAAPGNVDAVLRL
WRQRRAGAPRPAD
145224542YP_001135220.1 diaminopimelate epimerase [Mycobacterium gilvum PYR-GCK]MKFAKGHGTQNDFVLLPDLNAQYSLTARAVAALCDRRRGLGADGLLRVTT
AGAALAAGVFDRLPEGVAEDDWFMDYRNADGSIAEMCGNGVRVFAHYLHA
GGLEHRSEFVVGSLAGPRPVVLHEADDTTADVTVEMGKAVRCGTGTATVG
GRRFSGLAVDVGNPHLACVDEELTDAGLASLDVASPVAFDSTQFPHGVNV
EILTAPRDGAVAMRVHERGVGETRSCGTGTVAAAVAALDHQGARTGTLRV
RIPGGEVCVTVTETDSYLRGPSVLLAHGELAEQWWAAQH
145224541YP_001135219.1 HSR1-like GTP-binding protein [Mycobacterium gilvum PYR-GCK]MRSDIRANLDSPMTYPEFPHETPSVGELALEDRTALRRVAGLSTELADIS
EVEYRKLRLERVVLVGVWTDGSAADADASLAELAALAETAGSEVLEGLIQ
RRDKPDPSTYIGSGKALELRDIVVATGADTVICDGELSPAQLNALEKVVK
VKVIDRTALILDIFAQHATSREGKAQVSLAQMEYMLPRLRGWGESMSRQA
GGRAGGAGGGVGTRGPGETKIETDRRRIRERMSKLRREIRDMKQVRDTQR
SRRLANDVPSVTIVGYTNAGKSSLLNALTGAGVLVENALFATLEPTTRRG
ELSDGREFVLTDTVGFVRHLPTQLVEAFRSTLEEVVDAELLLHVVDGSDA
NPLAQINAVRTVVNEVVAETDATAPPELLVVNKIDAADGLVLAQLRQALP
GAVFVSARTGESLDRLQARLAEMIAPRDTVVDVTIPYSRGDLVNRVHAEG
RVDAVEHIEAGTRLKARVPIALAAALSEFASF
145224540YP_001135218.1 DEAD/DEAH box helicase [Mycobacterium gilvum PYR-GCK]MTAPTFADLGVPAPLVKALAERGIAEPFPIQAATLPDSLAGRDVLGRGKT
GSGKTLAFSIPLVAALTGIRRQASRPSGLVLAPTRELATQITAALEPMAT
AAGLRVTTIYGGVSQGRQVSALRGGIDIVVACPGRLEDLMQQKVISLDNV
TVTVLDEADHMADLGFLPGVTRILAATPRGGQRLLFSATLDNGVDKLVQR
FLDNPVLHSVNEAAEAPAQMTHHVFHVGGVQEKKDLVHQLASGTGRRILF
MRTKHQARKLAKQLTESGVPSVDLHGNLSQPARERNLAAFSSGEARVLVA
TDIAARGVHVDDVELVVHVDPPMEHKAYLHRSGRTARAGSDGDVVTVVLP
EQRRDTQQLLRKAGITVRPRDVHAKSSEVQALVGEIAPLRAPAPVAQPAA
KKPDHGRGSRNGGSGGHGRSGGEHQRRGGGGGRGRDGQGGGSSSTSRGPR
RRGQRPAGQSQRGVNTGG
145224539YP_001135217.1 molybdopterin guanine dinucleotide-containing S/N-oxide reductase [MLQSTSITKSPRRIDSKERRLFHPSFRRNGVRRLSCVARTRTSLTHWGAF
SATVESGDIASVRPWSGDADPSPALGNLPGSVRHRSRVTAPAVRRGWLEN
GPGPDTLLGADEFVAVTWDDLVELLGGELRRVIDTHGNEAIYGGSYGWSS
AGRFHHAQSQVHRFLNCLGGYTYSRHSYSLGATGVIMPRVVGTHDDLFTR
STQWQVIVENTDTMVCFGGLALKNTAVNDGGTTAHPARDALNRLRARGGR
IVSFSPLRDDVDGPCDWHAPVPGTDVAIMLALAHVLATESLADREFLASH
CTGYDRFERYLLGADDGIPKSPQWASSLCGLSADDLTALARRMAAGRTLV
TVSWSLQRTRHGEQAPWMGLTLAAMLGQIGLPGGGFGHGYGSMNEAGLAP
IRCGLPRLPQGVNPVTTFIPVAAVSDMLLHPGEPFDYNGLRLTYPDIRLV
YWAGGNPFHHHQNLPRLRRALSRPDTVVVHDPYWTAMAKHADIVVPSTTF
AERDDLSGSRNDPMLMAMPRLTETYAQARDDYDTYAALAGHLGVRQAFTE
GRSSRQWLRHIYETWSRTLDFDVPAFDGFWAAGALRLPTDDGLTLLADFR
ADPSAHPLATPSGRIEIFSADIDSFGYDDCRGHPAWFEPTEWLGGPRAAD
YPLHLVANQPAGRLHGQLDAGAASQATKVAGREPIRMHPADAHARDLSGG
DVVRVFNDRGACLAGVVLDDRVRPQVVQLSTGAWFDPADPADPHSMCVHG
NPNVLTDDVGTSKLAHGCTGAHVLVQIEKYAGTPPPVRAHQPPVFTPR
145224538YP_001135216.1 LGFP repeat-containing protein [Mycobacterium gilvum PYR-GCK]MIRQPMLRLRGVGRLTIGLLGVATVLLLAPPAMAQPEVDANNAITAAWDA
SGGDTGPLGPRTGEVYPVGEGFAQNFAAGTMFFTPDTGAHFMQGAILEKY
QASGGPADGDLGFPTIDEGPGRAPESRNSTFSAPDNPVIFWTPATGARIV
RGPINAAWDKLGGSSGVLGVPAEDETYNGSVVSQKFTGGELTYDARTKTF
TTVPPELAGQLADLSIPDDPVAAINAARRAAGGPLGPLGAVEGEVYDIGA
DGKGQDFANGAIYYSPDTGANVVTGQVLEKYKSVGGPEGDLGFPISGEED
GGLTPASRKSAFAAEDKPVIFWTPDHGAFIVRGPIVAAWDKLGGATGELG
APVADQTESGNTLSQRFSGGVISWDTSARTFSTEPAGLASQLTDVVVPGA
DAPQATPPTPQAAENNEDTGRKWNKWWLLAVVPLLLLAGLVAFAVMRHRA
RPGEDDMFTAPGAVGHDPQDPETDGHDGPHGDDGREDALFGDRYAREGLG
SVASANPEAPQDEEFAPQPLSFWGVPVQPEGGADAGDEEPQIDPDAVDTT
PTRIPTPSEVAGDSPFVDVETAASEDEFDESEDEFDEADDEFDESEDEFD
DLAVVDEDADLAADREPLVPPVPIPVRDGLTDTGRHARIDIDEPMPLGTA
LHMPLEDSDQIPDGYPVKADTKSGLYWTPDSADYHEAPVELWFASEEIAR
TNGFVRGE
145224537YP_001135215.1 LexA repressor [Mycobacterium gilvum PYR-GCK]MSDDSSDSTDAPGTSRSRDSGLTERQRTILDVIRASVTTRGYPPSIREIG
DAVGLTSTSSVAHQLRTLERKGYLRRDANRPRAVDVRAADDHPTPIVATE
VAGSDALPEPTFVPVLGRIAAGGPILAEEAVEDVFPLPRELVGEGSLFLL
KVVGESMVDAAICDGDWVVVRQQSVADNGDIVAAMIDGEATVKTFKRTKG
QVWLMPHNPAFDPIPGNDAAILGKVVTVIRKI
145224536YP_001135214.1 peptidoglycan-binding LysM [Mycobacterium gilvum PYR-GCK]MCSRRVVLSVASDSVRNSSITCSIHRTPDRVLFEHKSESEPRTKGRQMTI
LDDRQTWNEFERAPRLRVGDGRVRAVAPSRQPRPQRPAGAAVRYRGTGVL
VSRASHRRRPITPMATVGLALVAGAITLWLGLVAQVGGVSGAETQMPGRL
AVVQVQSGESLQHVARRVAPDAPVTEVVARIQELNELDSAAVDAGQTLIA
PVA
145224535YP_001135213.1 transcriptional regulator NrdR [Mycobacterium gilvum PYR-GCK]MHCPFCRHPDSRVVDSRETDEGQAIRRRRSCPECGRRFTTVETAVLAVVK
RSGVTEPFSREKVIRGVRRACQGRQVDDDALNKLAQQVEDAVRATGSPEV
PANEVGLAILGPLRDLDEVAYLRFASVYRSFSSAEDFEREIEALRAHREV
SARS
145224534YP_001135212.1 PhzF family phenazine biosynthesis protein [Mycobacterium gilvum PYMAIDVTVLRVFTDQDGRFGNPLGVVDASTVDPGDRQRIATELGYSETVFI
TLPPEGTHSAHAHIHTPTLELPFAGHPTVGAAWWLRDRGTPIKTLQVPAG
IVQISYPGELAAVSARAEWAPTFSIYDVATLDELAAADPDDYADEAEHYL
WTWIDQAAGTIRARMFAPHMGIREDEATGAAAVRITEYLSRDLTIVQGKG
SVLQTTWSAYGWVEVAGRVVDDGQRQID
145224533YP_001135211.1 alpha/beta hydrolase fold protein [Mycobacterium gilvum PYR-GCK]MTARTPNLRPVRELTPTLRYCTIHGYRRAYRIAGSGPAILLIHGIGDNST
TWAGVQTQLAQRFTVIAPDLLGHGKSDKPRADYSVAAYANGMRDLLSVLN
IDSATVVGHSLGGGVAMQFAYQFPQLVDRLILVGAGGVTKDVNIALRAAS
LPMGTEALALLRLPLLLPTLRLLGRVGGPLLGNTRIGRDIPNMLRILADL
PEPTASSAFARTLRSVVDWRGQVVTMLDRCYLTQSVPVQLIWGSQDSVIP
VSHAEMAHTAMPGSRLEIFEGAGHFPFHDEPDRFVELVEKFIDSTEPAVY
DQEYLRTLLRTGTSENTLSGDVDTQVAVLDAIGADERSAT
145224532YP_001135210.1 hypothetical protein Mflv_3951 [Mycobacterium gilvum PYR-GCK]MADDAHDSGSRYQPEQTGMYELEFPGPQLSTPDGRGPVLIHALEGFSDAG
HAIKLAAAHLKNSLDTELVASFAIDELLDYRSRRPLMTFKTDHFTHYDEP
ELNLYALHDSVGTPFLLLSGMEPDLRWERFVTAIRLLAERLGVRRVIGLG
SIPMAVPHTRPMTLTAHSNDKELIAEHQPWVGEVQVPGSASNLLEFRMAQ
HGYEVVGFTVHVPHYLAQTDYPSAAETLLAEVARTASLDIPTAELTTAAA
VVFDKINEQVTASAEVAQVVDALERQYDAFVAAQENRSLLARDEDLPSGE
ELGAEFERFLAQQAGEKKRKDGDDQPREGL
145224531YP_001135209.1 hypothetical protein Mflv_3950 [Mycobacterium gilvum PYR-GCK]MASRHHPENHLDISLNRPGALIAALPAVLGFTPESSLVLVTVAHGELGAV
LRGDLSDQSPQRLCELAELAAASGADAAIAVIVDDEGAGCAMCADEHREA
TSTLGDELARVGVELMAAHVVPEVAAGARWYCVDGCGSSGVVDDPMASPT
ALAAVLDGRRLYARRDELLDVVATVDGRRTGALAAVIEQAAPPEAPRPDS
QARHDIEHALECARRNEAGDTLSDDDLSRLAWALTDTRVRDTLYALAVGE
AAGTAEALWAELSRTLPEPWRVEALVLLAFSAYVRGDGPLAGISLDAALR
HAPHRMAGMLDRALQCGMRPEQIRELATTGYRLAAQLGVRLPPRRLFGRR
VG
145224530YP_001135208.1 iron dependent repressor [Mycobacterium gilvum PYR-GCK]MNDLVDTTEMYLRTIYDLEEECVIPLRARIAERLDQSGPTVSQTVSRMER
DGLLHVAGDRHLELTDKGRALAVAVMRKHRLAERLLVDVIGLPWEEVHAE
ACRWEHVMSVDVERRLVQVLNNPTTSPFGNPIPGLSELGVGDESGEAMSL
VRLTELPAGMPVAVVVRQLTEHVQGDVELIARLKDAGVVPNARVTVENND
HGGVMIVIPGHEQVELPHEMAHAVRVEKV
145224529YP_001135207.1 RNA polymerase sigma factor SigB [Mycobacterium gilvum PYR-GCK]MNVPPDQEAAMANATTSRFDQDLDAQSPAADLVRVYLNGIGKTALLTAAD
EVELAKRIEAGLYAQHLLATRKRLGENRKRDLAAVVRDGEAARRHLLEAN
LRLVVSLAKRYTGRGMPLLDLIQEGNLGLIRAMEKFDYAKGFKFSTYATW
WIRQAITRGMADQSRTIRLPVHLVEQVNKLARIKREMHQNLGREATDEEL
AEESGIPVEKINDLLEHSRDPVSLDMPVGSDEEAPLGDFIEDAEAMSAEN
AVISELLHTDIRYVLATLDEREQQVIRLRFGLDDGQPRTLDQIGKLFGLS
RERVRQIEREVMAKLRNGDRADRLRSYAS
145224528YP_001135206.1 hypothetical protein Mflv_3947 [Mycobacterium gilvum PYR-GCK]MRDSELSFDDEGRPVLITRAAPAYEEQHRQRVRKYLTLMSFRVPALILAA
VAYGIWENGLISLAIIVVSIPLPWMAVLIANDRPPRNAEEPRRYDMPRRI
PLFPTAERPAIESATRRAPQHGAGDTSGDVPG
145224527YP_001135205.1 hypothetical protein Mflv_3946 [Mycobacterium gilvum PYR-GCK]MDTQTIERTDADERVDDGTDDDTPKFFHYVKKDKIAESAVMGTHVVALCG
EVFPVTRSAKPGSPVCPDCKRVYEQLKK
145224526YP_001135204.1 ribonuclease BN [Mycobacterium gilvum PYR-GCK]MDDQSERPPERTFSKATPSRHHIRHIVARTLGKSWDDSIFAESAQAAFWC
ALSLPPLLLGMLGSLAYVAPLFGPDTLLTIENQLISLAGKFFSPNVVGEI
IEPTVRDIVNGARGEVVSLGFVISLWAGSSAISAFVDSITEAHGQTALRH
PVRQRFYALGLYVVMLIGAIVTAPFLALGPRKVAEFIPDSWDDALRFAYF
PVLFVALAVAVNVLYRVSLPKPLPTHRLLTGSLLAAGVFLVATWGLRVYL
TWITSTGYTYGALATPIAFLLFAFFLGFAIMIGAELNAAIEEEWPAPDTH
AKRLHWWLKAKAESRNGGGRSTS
145224525YP_001135203.1 hypothetical protein Mflv_3944 [Mycobacterium gilvum PYR-GCK]MTATLTSPGLTKADRCDRCGAAARVRATLPSGAELLFCQHHANEHEAKLV
ELAAVIEVSPLEP
145224524YP_001135202.1 hypothetical protein Mflv_3943 [Mycobacterium gilvum PYR-GCK]MESPLETTSKPDVLVHLCGADEWERAQRSGTHEPDSLKSVGFVHLSSPAQ
VHLPADRLYADRTDLLLLRIDAARLTSPLRWEPGLPSDPDGMRFPHLYGP
LPVAAVTSVTTYCPGPDGRYPVLTE
145224523YP_001135201.1 endoribonuclease L-PSP [Mycobacterium gilvum PYR-GCK]MPHLRMSLLRPGRTLRPVAERINVSSGSEFEAAVGYSRAVRVGAHVFVAG
TTGRGDSASAQARDALVRIAAALGDVGASLTDVVRTRMFVTDITAWREIG
SVHDEVFGAVRPAATMVEVAALISPELVVEIEVDAIVP
145224522YP_001135200.1 hypothetical protein Mflv_3941 [Mycobacterium gilvum PYR-GCK]MGIIFGLAPWLVYWVLVGNVPFHTAVLVALAVAVASFVVARVSGSPGRVL
EIGAVATFAVLTVLTFTVSGSFLEQWLQPLSNAGILVAALVGVLAGRPFV
REFAVVGQPKEVVESEPFARITSVLTWIWIAAFAGMTVSSAIPPMVQGDA
TILDTQTPLSFIFYWVVPFALLGVAALLTRILPDRMVPPAEEIVRKTTFV
AFAEAEIDQLIYLATEHANREAGAGKEAYDVRIGSKGVPLVGDETRESWP
STYKVRDRKR
145224521YP_001135199.1 O-methyltransferase family protein [Mycobacterium gilvum PYR-GCK]MTHTSTPRGSAARSAPNRVPPVRLIRAVDRLRAGLQRLHRSTAPGNVALM
ELATGAWTTQVLYVAATLGIPDELADGPAHAADVATRVGADAGAVYRLMR
AMVSRGALREERDGRFALTPVGDALRTDSEGSLRDMVLFIGHPARWADWG
SLEYSVRTGEPAADMLRGMPFFDYLDTDPEFATVFNNAMTAASGLSDDVA
LQACDFTGARLVVDVGGGHGAVLATILRSAAGARGILFDLPAVVAGAAPL
LADAGVADRCTVSGGSFLESVPAGGDVYVMKNIVHDWDDTDAATILRNVR
TAIAEGGKLVLLEMVLPERASSFIGHMLDLEMLLMLRGKERTRAQYSELL
EAAGFQLTRVIPTVSPISVIEARAV
145224520YP_001135198.1 RNA polymerase sigma factor [Mycobacterium gilvum PYR-GCK]MCAPTTRTTERVYVAATKASAATDEPVKRTAAKAPAKKAPAKKATKATKP
RAAKSADAPATRGRAKKATAAEPGVVDDELTGTEVDATDDIEPGEDLVDD
GDLELDDIEVEDEATEDDDSDDEAAEADPVVATTKAAAKPAKEADDDSLP
EPSEKDKASGDFVWDEEESEALRQARKDAELTASADSVRAYLKQIGKVAL
LNAEEEVELAKRIEAGLYCTQLMAEFAEKGEKLTTAQRRDYMWICRDGDR
AKNHLLEANLRLVVSLAKRYTGRGMAFLDLIQEGNLGLIRAVEKFDYTKG
YKFSTYATWWIRQAITRAMADQARTIRIPVHMVEVINKLGRIQRELLQDL
GREPTPEELAKEMDITPEKVLEIQQYAREPISLDQTIGDEGDSQLGDFIE
DSEAVVAVDAVSFTLLQDQLQSVLETLSEREAGVVRLRFGLTDGQPRTLD
EIGQVYGVTRERIRQIESKTMSKLRHPSRSQVLRDYLD
145224519YP_001135197.1 polyphosphate--glucose phosphotransferase [Mycobacterium gilvum PYRMTADAEPSSSVPQRRGFGIDVGGSGVKGGIVDLDTGALIGERFKLLTPQP
ATPEAVAKTIADVVAHFEWTGPLGVTYPGVVADGIVRTAANVDKAWIGLN
AKEVISAALGGQSVTVLNDADAAGLAEEKFGAGRNNTGVIVLLTFGTGIG
SAVIHNGVLLPNTEFGHLEVGGKEAEHRAASSVKERKEWTHERWTVEVTK
VLVAIENAIWPDLFIAGGGISRKAAKWIPLLKNRVPVVAAELQNTAGIVG
AAMAAESDVTATGREHH
145224518YP_001135196.1 inositol-phosphate phosphatase [Mycobacterium gilvum PYR-GCK]MGPDGRRCAAMDGVNTMHAADAPVRLQEVAERLAAEAAQFVRRRRVEVFG
DGSAGAAPDTAQPSVRAKSTPTDPVTIVDTETERLLRDRLGQLRPDDAIL
GEEEGGSVDIAEGRLTWVLDPIDGTVNFLYGIPAYGVSVGVRRDGVSVAG
AVADVAAGAVYSAALGHGARLSRDGVATELHVTSATDLSMALVGTGFSYD
RAHREQQGRIIARLLPEVRDLRRMGSCALDLCAVAAGRLDAYFEDDVHLW
DWAAGALIASEAGALVRPPRTEDGSGLMVAAAPGISVALDEALARSGAL
145224517YP_001135195.1 hypothetical protein Mflv_3936 [Mycobacterium gilvum PYR-GCK]MLSVVAQITEGTAFDKHGRPFRRRNFLPGAVMFACLAVAALLVWMIALSR
PPEVVQAAICNPPPPPAEPNTPAVDLGEQVTRSSMLDVTPAKLADTRIRV
LNASGQGGQAGEVAGALRDLGFTDPEAANDPVYASARLQCQGQIRFGPSG
RAAAAALWLVAPCTELFQDGRTDDTVDLAIGTDFTELAHSDDIDAVLTSL
MPDATQPADPDLLTKAHTGTC
145224516YP_001135194.1 hypothetical protein Mflv_3935 [Mycobacterium gilvum PYR-GCK]MATDYDAPRRTETDDVSEDSLEELKARRNEAQSAVVDVDESESAESFELP
GADLSGEELSVRVIPKQADEFTCSSCFLVHHRSRLASEKNGMMICTDCAA
145224515YP_001135193.1 hypothetical protein Mflv_3934 [Mycobacterium gilvum PYR-GCK]MSDTRATARTVRYRERLWVPLWWWLPGLGLAALIALEVDQGVRAVPDWLP
YAVLLPVAAVVLIGLGRTEVQVVGDEGNTELWVGNAHLPASVVTRSAVVP
RSAKSAALGRQLDPAAYVVHKTWVGPLVLLVLDDPDDPTPYWLISARHPD
KVLAALNS
145224514YP_001135192.1 deoxyuridine 5'-triphosphate nucleotidohydrolase [Mycobacterium gilMSTSLAVVRLDPDLPLPSRAHDGDAGVDLYSAQDVELGPGERALVPTGVA
VAIPHGMVGLIHPRSGLAARVGLSIVNTPGTVDAGYRGEIKVCLINLDTS
TPITIGRGDRIAQLLVQRVELPELVEVTSFDEAGLADTTRGDGGYGSSGG
HASL
145224513YP_001135191.1 hypothetical protein Mflv_3932 [Mycobacterium gilvum PYR-GCK]MGRHRSERAEAPEEVTSVDTDDEELEGPFDIDDFDDPAVAAVARLDLGSV
LIPMPDAGQVQVELNEAGAPSAVWVVTPNGRFTIAAYAAPKSAGLWREVA
SELADSLRKDAPKVSIEDGPWGREVVGSGGEGAAMVRFIGVDGYRWMIRC
VVNGPFERIAELTEQARDALADTVVRRGDTPLPVRTPLPVTLPEPMAAQL
AAAQQQAAAQQQQAATEQQPPAQQQPPAQQEPPQPNARRSAPGSAMQQLR
TITGG
145224512YP_001135190.1 hypothetical protein Mflv_3931 [Mycobacterium gilvum PYR-GCK]MTIDLRGVTAVLLPGTGSDDDFAYRAFATALHEAGAVVVTPRPEPQRLID
GYREQFDSAWHACAPQQIVVGGVSIGAAVAVEWAVAHPGCALAVLAALPA
WSGDPDTAPAALAARYSAEQLRRDGLGTTTAQMRAGSPAWLADELTRSWA
GQWPALPDAMDEAGRYVAPTSAALETLTAPLGVVSATDDAVHPLEVGVEW
VSAAPRAALRTVTLDDIGADPGILGRLSLAAVQDAQSRS
145224511YP_001135189.1 tRNA/helicase-type nucleic acid binding protein [Mycobacterium gilvMQPQRLSRRSGEAMATAEGYLRRLTRRLTEDPEQLDVDELSNEAANTGAQ
KAIDCQRGQEVTMIGTLRSVECNGKSCAGGVKAELFDGTDSVMLVWLGQR
RIPGIESGRTLKVHGRVGKLDNGSKAIYNPHYEIQK
145224510YP_001135188.1 hypothetical protein Mflv_3929 [Mycobacterium gilvum PYR-GCK]MGGISGLIYSSLPVVVFVPVSSAFGLLPAIAAALGVATLILIWRLVRRET
AQPAISGFFAVGISALIAYLVGASKGYFLLGIWMSLFWAVVFALSVVIRR
PVVGYIWGWVNTHDRRWREVRRAVLAFDLATLVWVAVFTSRFVVQHHLYD
ADQTGWLGVARIAMGWPLTAVAALVTYLAIRRAQRYVREAGLGDTDTDAR
SVSAAED
145224509YP_001135187.1 TrkA domain-containing protein [Mycobacterium gilvum PYR-GCK]MKVAIAGAGAVGRSIARELVDAHEVTLLERNAEHIDVNAIPAAHWRLGDA
CELSLLESVKLQEFDVVIAATGDDKANVVLSLLSKTEFAVPRVVARVNDP
RNEWLFDESWGVDVAVSTPRMLASLVEEAVSVGDLVRLMEFRKGQANLVE
ITLPDDTPWGGKPVKRLELPRDATLVTILRGPRVIVPERDEPLEGGDELL
FVTAAEAEDELRTLLLNPQQR
145224508YP_001135186.1 TrkA domain-containing protein [Mycobacterium gilvum PYR-GCK]MQRPWPGKDPQVRVVVMGCGRVGASLSDSLSRIGHDVAVIDRDGTAFHRL
SPDFSGERVLGMGFDRDVLVRAGIENASAFAAVSSGDNSNIISARVARET
FGVQRVVARIYDAKRAAVYERLGIPTVATVPWTTDRLLNVLTRETETTKW
RDPSGNVGVMELALHEAWVGRRISELESATSGRVSFMIRFGAGLLPEAKT
VIQAGDQVYLAAVSGHIAEALAIAALPPGEDAEG
145224507YP_001135185.1 amino acid permease-associated protein [Mycobacterium gilvum PYR-GCMSKLSTAARRLVLGRPFRSDKLSHTLLPKRIALPVFASDALSSTAYAPEE
IFLVLSVAGLASYSMAPWIGLAVAAVMLIVIASYRQNVHAYPSGGGDYEI
ATTNLGPTAGLTVASALLVDYVLTVAVSMSSAMANIGSAVPFINQHKVWF
AVAAILVLAALNLRGIRESGTAFAIPTYAFIVGMSVMLIWGFVQIYVLGT
PLRAESADFEMHSEHGDVLGFALIFLVARAFSSGSAALTGVEAISNGVPA
FRKPKSRNAATTLLLLGLIATTLLMGIIMLARAIGVQIAERPAEQLVGAP
EDYHQKTLIAQLAETVFHGFPFGLFFIALVTALILVLAANTAFNGFPVLG
SILAQDRFLPRQLHTRGDRLAFSNGILFLAFGAVAFVVAFQAEVTKLIQL
YIVGVFVSFTLSQIGMVRHWTRLLRTETDAAARGRMVRARVINTVGFLCT
GTVLIIVVVTKFVVGAWIAILAMGALFGIMKLIHRHYASVSRELEARAAD
AEDIVLPSRNHAVVLVSNLHMPTLRALAYARATRPDVLEAITVSVDDAET
RELVHKWENSDVSVPLKVIASPYREITRPVLDYVKRVTKDSPRTVVTVFI
PEYVVGHWWEQVLHNQSALRLKGRLLFEPNVMVTSVPWQLTSSERLKKMA
PQSAPGDARRGFLE
145224506YP_001135184.1 (uracil-5)-methyltransferase [Mycobacterium gilvum PYR-GCK]MSADDSAEELTLTTVAPANGGSCIARHDARVVFVRYALPGETVRARLVGD
RGSYLNAEAVEVLESSADRIDPLCPIAGADGAGCCDLAFAEPAAVRRIKG
EVVANQLARLGGLQWRDEAEATAEPVGDGAATGWRTRVRLDTSDDGRVGF
HRYHSGELVHRLDCAQLPAGMVDGLADMRWAPGSAVHVVLDGDGNRHVVV
AAGRDRGVRTTVVEGDYETVQRVAGRSWRVPATAFWQAHRAAPELYSALV
TRWAQLELGMSAWDLYGGAGVFAAALAAGVGPDGSVLTVDTSRGASRSAR
AALGDLGNVTVVTDSVRRALGAQRERADVAVLDPPRTGAGREVIDLLAGA
GVPRIIHIGCEAASFARDVGLYRTHGYAVEELQVYDSFPLTHHVECVAVL
SR
145224505YP_001135183.1 pH-dependent sodium/proton antiporter [Mycobacterium gilvum PYR-GCKMAATPLPPPRRPVFSRGSWAETRRVTEILRKETVGGVILLVAAAAALIWA
NSPWAEGYFALRDLELGGEWFGLHLNLTLGAWAADGLLAIFFLVVGLELK
REFVAGDLRDPSRAALPIAAAVGGMVVPALIFVLVNLNTGDGALRGWAIP
TATDIAFAVAVLAVIGTHLPSALRTFLLTLAVVDDLLAITVIAVFYTEDI
NGLALALAAVPLALFALCVQRGVQKWWVLVPLSVATWVLMHESGVHATVA
GVLLGFAVPVRRQATPRGRGPAPSQRVGMAEYFEHRVRPVSAGIAIPVFA
FFAAGVSIGGLDGFTRALSDPITLGIVLGLVLGKPIGIVLTTRVLSAVTR
ANLDASLRWVDVVGMSMLAGIGFTVSLLIGDLAYGLGSERDEFVKIGVLF
GSLLAAGVAAVVLLTRNRAYRRIYREETVDEDRDGVPDVYQTRQDRT
145224504YP_001135182.1 1-deoxy-D-xylulose-5-phosphate synthase [Mycobacterium gilvum PYR-GMLEQIRGPADLQHLSRAQMEDLAREIRDFLIHKVAATGGHLGPNLGVVEL
TLALHRVFDSPHDPILFDTGHQAYVHKMLTGRSRDFDTLRKKDGLSGYPS
RSESEHDWVESSHASSALSYADGLAKAFELNGHRNRHVVAVVGDGALTGG
MCWEALNNIAASRRPVVIVVNDNGRSYAPTIGGFAEHLAGLRLQPGYERV
LEEGRKAVRGVPMIGEFCYQCMHSIKAGIKDALSPQVMFTDLGLKYVGPI
DGHDESAVEGALRHARAFNAPVVVHVVTRKGMGYAPAENDVDEQMHACGV
IDPETGLATSVPGPGWTAAFSETLIELAAKRRDIVAITAAMPGPTGLSAF
RKRFPDRFFDVGIAEQHAMTSAAGLAMGGMHPVVALYSTFLNRAFDQMLM
DVALHKLPVTMVLDRSGITGPDGASHNGMWDLSILGIVPGMRVAAPRDGA
RLREELAEAVEVKDGPTAVRFPKGDVGEDIPAIERRDGVDVLAVPADGLS
DDVLIIAVGAFAAMSVAVAERLRDQGIGVTVVDPRWVLPVPAAINTLAAA
HKLVVTVEDNGGHGGVGSAVSAALRRAEIDVPCRDAALPQAFFDHASRGE
VLAEVGLTERTIARQITGWVAALGATAGDRQVSESVD
145224503YP_001135181.1 secretory lipase [Mycobacterium gilvum PYR-GCK]MPAWSGLDVRGYDAPIPAPGALLDAVPLDPALSVPGAGSAYRILYSTVDQ
HDRPAVSTAAVFLPRTPAPPGGWPVLAWAHGTVGLGDACTPSARERSDRD
GDYLSHWLDEGYAVVGSDYTGLGTPGLMSYLNSVTTARGVVDSVLAAHHL
DVDLSPKWAVVGQSQGGGAAVATARWATEFSAGSGLDYRGVVATGTPANV
ESIVKQAGPDMTVPPELGPMGSAYTAYIVAALREARPDLDLDRVLTPAGR
EAADRAETLCAADLAGSLTDLSVPGFFTAPVTSIPGAADAIDAYMGIPSS
GYDRPVFLGVGMRDRDVPPGLTLRFADALSANGQDVTLKVYPDADHSGTV
LTSVPDSTAFLARAFS
145224502YP_001135180.1 3'-5' exonuclease [Mycobacterium gilvum PYR-GCK]MPEPETAGSAPETPEPTDIEAEPLLTPRDGVPDVSSSRMEIARAADLLAS
GTGPFAVDAERASGFRYSNRAYLVQIRRVGAGTVLIDPVSHGGDPMEVLA
PVAAVLSTDEWVLHAADQDLPCLAEIGMRPTALYDTELAGRLANFDRVNL
AAMVQRLLGLQLTKGHGAADWSKRPLPDEWLNYAALDVEVLTDLREAIAA
VLDEQGKAEWARQEFEYLRTFEGSPTRRDRWRRTSGIHKVRDPRALAAVR
ELWTTRDQIARRRDIAPGRILPDSAIISAATANPDTIEKLTALPVFGGSK
QRRSAQVWLDALARARTNDPPDAQEPSNGPPPASRWSRRKPEAAVRLEAA
RAELTALAQQVSVPVENLLSPETVRRLCWDWQPPADGDATAAVEAFLRDS
TARQWQRELTVPALGRALSEPPVS
145224501YP_001135179.1 hypothetical protein Mflv_3920 [Mycobacterium gilvum PYR-GCK]MTTAEPAQFREAVAAMNATTVRPEIELGPIRPPQRLAPFSYALGAEVKHA
ETAIIPERSEGDAFGRLILLHDPEGAEAWDGTMRLVAYIQADLDSTEAVD
PLLPEVAWSWLVDALEQRAEHVTALGGTVTATTSVRYGDISGPPRAHQLE
LRASWTATTLELGPHVQAFCEVLEHAAGLPPTGVTDLNSRTRA
145224500YP_001135178.1 uroporphyrinogen decarboxylase [Mycobacterium gilvum PYR-GCK]MNTRRELPESPYLAAAAGRKPHRVPVWMMRQAGRSLPEYRELRAKNTMMQ
ACFDADLITEITLQPVRRHGVDAAILFSDIVVPLRAAGIDLDIVPDVGPV
IAHPIRTAADVATVSPLRRETVAPVATAIGQLTAALGDVALIGFAGAPFT
LASYLIEGGPSRNHERTKAMMLGETETWNALMAALTDVTIEFLRVQLDAG
VDAIQVFDSWAGTLSLADYRAYVLPHSARVFEALAGYGVPMTHFGVGTAE
LLGAMSEAVSGHGVPAVVGVDWRTSLTDAAARVRPGCALQGNLDPVVLLA
GWPVVERAVRAVVEDGRRAVDAGATGHVFNLGHGVLPATDPAIITDAVAL
VHQL
145224499YP_001135177.1 protoporphyrinogen oxidase [Mycobacterium gilvum PYR-GCK]MSVAARYCVVGGGISGLVAAYRLRVAAGPDAVITVLDPADRLGGILRTER
IGGQAIDVGAEAFVARRPEVPALLGELGLSGRQITTTGARPLIYSEGRLH
QLPTDTVNGIPSRPSALSGLVDDATVRWMLDEPRRPLVWRSGADPTVAEL
VGERFGEQVVVRSVDPLLAGVYAGSAATIGMRAAAPTVAAALDNGARSLT
EAVVAALPPPRAGSVFGAIDGGYQVLLDELVRRSGLQWAQVAARGVHPVR
AGWEVVDDEGGHWPADAVVLAVPAPRLPALLAELAPHSADIARRIPVASA
AVVALALPGGTPLPEQSGVLVAGRGPLHTKAVTLSSRKWGRRGSAEMLRL
SYGRFGDDLARSTGDDELLAWADEDLATLFGIAVEPVDARVVRWIDAMPQ
YGPGHADRVADLRAGLPRGLAVAGAYLDGIGVPACVASAARAVASLVAGS
SVGQ
145224498YP_001135176.1 chlorite dismutase [Mycobacterium gilvum PYR-GCK]MAKLDFDELNSTIRYLMFSVFSVKPGVLGDDDARAALVDETATFLKHQED
NGVVVRGLYDVAGMRADADFMMWTHAENVEALQATYADFRRTTTLGRAST
PVWSNVALHRPAEFNKSHIPAFLAGEEPGAYICVYPFVRSLEWYLLPDEE
RRRMLSEHGMAARGYKDVRANTVPAFALGDYEWLLAFEAPELHRIVDLMR
DLRATDARRHVREETPFFTGPRVSVEKLISALP
145224497YP_001135175.1 methionine-R-sulfoxide reductase [Mycobacterium gilvum PYR-GCK]MTAPKLVLSDDQWRERLTPQEFAVLRQAGTERPFTGEYTDTKTQGVYQCR
ACGAELFRSTEKFESHCGWPSFFDPADSDAVILRTDDSLGMRRVEVLCAN
CHSHLGHVFEGEGYPTPTDQRYCINSISLRLVPSGS
145224496YP_001135174.1 hypothetical protein Mflv_3915 [Mycobacterium gilvum PYR-GCK]MLTAFRPRTAPPTTATVLRSILWPLAIMAVIHRSYVLVFNRYITDDFAPV
YRAVINFKFGWDIYNEHFDHVDPHYLYPPGGTLIIAPFGYLPEVASRNWF
IFFNTVAIILAGYFLLRLFNYTLSSVAAPALLLAMFCTESVTNTLVFGNI
NGVLLLLEVLFFRWLLDGNRNHEWLAGISIGLTLVVKPLLAPLLLLPLLN
RQWRALVAAFVVPLVFNAAAWPLISDPMNFVTRTVPYILSTRDYFNSSIL
GNGLYYGLPMWLIMTLRVTIIVLGAISLWLLYRHYRTRDPFFWMLTSSGV
LLTTSWLALSLGQGYYSIALFPFLMTVVLPNSVIRSWVAWLAAYGFLTMD
RWLLWQLPSTGRAFEYLKITYGWSLMMVVVFAVLLFRYLDARQDNRLDEG
IDPAWMKQLTPAAKPSE
145224495YP_001135173.1 TAP domain-containing protein [Mycobacterium gilvum PYR-GCK]MRRVVRAVVLSLAVVLPLSACSPGLAANPRYATDSGAGPQGAPETSDQPA
GPPAVEAPKNELSWRDCTSRVFASASVPPLPGVKLDCASYDADLDSINGA
SGTVSIGVVRATSQQTPADAGPLVMTTGSDVPSSVQLPAWLSRAGADVLK
TNPIVSVDRRGIGMSGALDCRDLFDRQEMFEQAQFQSGDDPVANLGAVTM
TATTSCTDTIAPGDSAYDNAHAAEDIERLRTTWDVPALALFGVGNGAQVA
LAYAGAHPTKVARLVLDSPLPLGVSAEAATEQRVKGEQAALDAWATQCVA
TNCPLGPDPKAAVDALMTDARAGRGPGGASVAALADAISTALGYPRGGRV
DAGNELAQAIADARGGNTNRLNNLINQAETLRQTDGQFVNTCSDALNRPT
PDRVRELVVAWGKMYPQFGTTGALDMVKCLNWPSGSAPAEPSELEIPTLL
LGVANDPIVGNEGVAAVAATAINAGSSNRRVIWQGIGHGAAIYSPCALPP
VLDYLTSGELPSTDTYCPA
145224494YP_001135172.1 hypothetical protein Mflv_3913 [Mycobacterium gilvum PYR-GCK]MSGSGDGTHFTLLGRTDAVGVPDLAAHYPYPDGLDSCWVRANMITSVDGG
ATSAGKSGGLGGDGDRALFSALRELADVIVVGAQTVRSEDYSGVRLSASA
RLARQQRGQSEVPPIAVLTRSGRLDRDAKLFTRTDVPPLILTSTRALDDT
RRLLGSVAEVLDASGAQPDSVDPAQALTLLAERGLRRVLTEGGPGILGMF
TDDDLVDELCVTVAPLLLGGGPGRIVTGDGEVRSGMVLGHALTDGDGYLY
LRYLRDR
145224493YP_001135171.1 AFG1 family ATPase [Mycobacterium gilvum PYR-GCK]MHGSSDVEHLVDRHPSVTPERLVAQLIPPPTFADVSFDTYRPDPSEPSQA
AAVQTCRKFAEQAVERRAGKKKLFGKREVLPGVGVYLDGGFGVGKTHLLA
SSYYEVAGRSDYRQAFATFGELTQLAGVFGFMECIELLSDYALVCIDEFE
LDDPGNTTLISRLLSALVERGVSVAATSNTLPEQLGEGRFAAQDFLREIN
TLASMFTTVRIEGPDYRHRDLPPAPEPPTDDEVARWAAEADGATLDDFDA
LCAHLATMHPSRYLTLIEGVSQVFVTGVHPIDDQNVALRLVSLTDRLYDA
GIPVVASGTKLDTIFSEEMLAGGFRKKYLRATSRLLALTAAGQAGRTIT
145224492YP_001135170.1 N-acetyltransferase GCN5 [Mycobacterium gilvum PYR-GCK]MERRLTVQPASEDQLAELADVAARTFPLACPPSVSPDDVAAFIAENLTRE
RFADYLADPRRGVLVAVADGRIMGYAMTIDGVSDDPDVSSAVTVRPAVEL
SKLYVVPESHGAGVSSALMDAVVERARTREAASVWLGVNQRNERAQRFYA
KHGFAVAGTKTFRLGGHWEQDYVMVRPA
145224491YP_001135169.1 hypothetical protein Mflv_3910 [Mycobacterium gilvum PYR-GCK]MPSMRRWLVLLTATLATLAGVMASPASAAGIPIGRLGDVLRVEFKGLVAD
VSVNNIVPTPPPPGFGYPPRAPRNQVFRADVTITPVQLPTPYAMGITFAF
RGVTPTGDAYEPRNSDAPDALQNMMASARVGQTMTGGVWWDCYRDLVSNV
VLLDKLTGLRLAQWNVG
145224490YP_001135168.1 methylated-DNA--protein-cysteine methyltransferase [Mycobacterium gMIDIAFDVPGFDIPTSDEDDTLRRLHDRLAEAAEPAGVLDVAYRTIDSPV
GTLLLAATPAGLVRVAFDVEGHEVVLARLAESVSPRILRAPDRLDDVARQ
LDEYFAKRRTTFDVAVDLTLARGFRRNVVEHLRHIGYGRRASYADVAAAV
GSPRAVRAVGSACAHNPLPVVIPCHRVVRSDGTSGQYIGGPEAKTALLQL
ESSSG
145224489YP_001135167.1 ECF subfamily RNA polymerase sigma-24 factor [Mycobacterium gilvum MISHPGVPRRLHDVKVRPFEEIVACHGATVLRVCRAVVGPVDAEDAWSET
FLSALRAYPELPEDANVEAWLVTIAHRRALDLGRARSRRAVPTDSVPERC
DARADPAARDPDLWAALARLPDKQRHAVAYHHIAGLPFTEIAVILGNSPE
AARRAAADGIKALRSYYREDESA
145224488YP_001135166.1 Clp N terminal domain-containing protein [Mycobacterium gilvum PYR-MSDAAKISRPVRLDDLIEVITRVHDEPLDQLTDAVLAAEALDDVADHLIG
HFVDQARRSGASWTEIGKCMGVTKQAAQKRFVPKTPTDTAALDPDAGFSR
FTERARAAVVHAQNEAHAAGNGEIAPAHLVLGLFSDPSGLAAQLVAAQGI
ALDGIRDRIVLPARSEDVPALVPFDGRAKKALELTFRHALRLGHNYIGTE
HLLLALYEEEDADGVLHGVGIDAERFERDLRQALDGLPGT
145224487YP_001135165.1 hypothetical protein Mflv_3906 [Mycobacterium gilvum PYR-GCK]MTDRIEVSRIIAAPPADIFGVLCDPQGHVAIDATGMLQDADGSPARAIGD
SFVVHMDRAALNDFPELGRYDVTVAITQYEQDALIAWTILGQLKPQIGHV
YGYRLEPADTGTLVTSFYDWSDIHQHWRDMGIFPVISELALRGTLGILDR
TVRRGYPRS
145224486YP_001135164.1 helix-turn-helix domain-containing protein [Mycobacterium gilvum PYMMRANDKTTIQPRMLRRALDFMHENAQYDITIRDIASAADVTPRAIQYAF
REHLDTTPLEYLRRIRLERAHRELMSADPSFDTVTSIAGRCGFSHPGRFS
SAYKQVFGTEPSRTLRSS
145224485YP_001135163.1 hypothetical protein Mflv_3904 [Mycobacterium gilvum PYR-GCK]MIRKMLVASALGAALCCAPVASAQPGPIYWDDPVRYSTDVPGMNYDAHLT
GPCTNMDRFTFGRGPGGEALQCRWIPNQWPPIYTGFWQTSYELFGVQDIG
APCPKPQSAAQAPDGRPLVCLGAQGWQAGKYNGVGFTPM
145224484YP_001135162.1 hypothetical protein Mflv_3903 [Mycobacterium gilvum PYR-GCK]MRLTYVKPRTSHQISSHQARFRPSLSRFRADLHRRPFRTYDRAMAMQQIG
HGGQPLRPVFRRVHPPHRVLIDLVALFPREAHCDGRYHPKGLQMDSIVEG
RLTCWGLSEQGRWWGLVTYPITHGGQKDSVTHWVPASVLRLK
145224483YP_001135161.1 regulatory protein ArsR [Mycobacterium gilvum PYR-GCK]MRTVFHGDALARFGHALSDPVRARLLLALREGPGYPAELADVLGATRQNV
SNHLACLRGCGLVVAAPEGRRMRYELADVRLAHALGALLELVLVTDPSAC
PASPADDCC
145224482YP_001135160.1 Co/Zn/Cd cation transporters-like protein [Mycobacterium gilvum PYRMTDPAAEELKPLIASSAGCTDAGCTATAATVSPARRAVLTRRVRLFVLAT
ITYNLIEAVVAISAGTIASSAALIGFGLDSLIEVASATAVAWQFAGRDPE
ERERTALRIIAVSFFALATYVTVESARALFGAAEAAPSPAGIVLAAVSLA
VMPFLSYAQRRAGRELGSASAVADSKQTLLCTYLSGVLLVGLLLNALFGW
SWADPIVALVIAGVAVKEGRQAWRGEHCC
145224481YP_001135159.1 hypothetical protein Mflv_3900 [Mycobacterium gilvum PYR-GCK]MTRISAQARAVYDTEMQAARATASADQRWHHLERAHIVSQPFAWLHTRNH
IAMLRLALTQHDRREAFGQVIRILVAAPGSLTGRYPEGNTGRVAAGLTTP
MPVPRDLAAVMRSA
145224480YP_001135158.1 phage integrase family protein [Mycobacterium gilvum PYR-GCK]MARGTGRKDRAPGTFGSVDKLATGYRARYFGPDGRRHKAPVLFLTKTDAR
AWLAQRHSEIVAQQWTPPNAVEVPKTTFTEYADQWLLTRQVAGRPLKDRT
REHYQALLDDHITATFGALPLASITADDVRQWYARTLTDKPTMRSHAYGL
LRTILATAVSDGKISVNPCSIRGAGTAKRVHKVRPATVGEIGTIADAMPA
QWSLMVLLAAWLAMRFGELTELRRKDIDLADEVVRVRRAVVRTDDGFKVT
TPKSDAGIRDIAIPPHLIPPIEAHLSQHVGAKADALLFPAVGGGHLAPAT
LYRRFYTARERANRKDLRWHDLRHSGAVLAAATGATLAELMARLGHSTPQ
AALRYQHAAQGRDRQIAALLSKIAENGGA
145224479YP_001135157.1 DNA binding domain-containing protein [Mycobacterium gilvum PYR-GCKMAETLATRRRYAKLTEAADYLGVTDRTIRQMIADGRLTGYRSGKRLVRVD
LNEIDDAMQPFGGAA
145224478YP_001135156.1 HNH endonuclease [Mycobacterium gilvum PYR-GCK]MSRRQGITPAVYNTVMDRGNGLCRYCEFPASEIDHIVPVARGGGNDLANL
VPACRECNSEKRDLLPEEWADKRRADGKPWPIPTFIQRVKFLCHWYLPAS
QRHKGRFTLREPEKFRGLVVAARDCAELDGGAA
145224477YP_001135155.1 hypothetical protein Mflv_3896 [Mycobacterium gilvum PYR-GCK]MTLCITGITDDMTMVQKAQHLHQRGFHVFPTDHPDQRSCIGLHGPNNPCD
GHRGKHPAVAWGTWAVNPTPQMIDVAWKDRHGLANIGIACGPSGLVVLDE
DGDGEVTRWCVTYGVTLPDTYEVTTGRGRHLYFAWDHTAQRIGNVPKAVK
DFALDVRGDGGYAVGEGSQHVSGAIYTGNGLPAAPLPVQVAEILLAAQTK
RSEPVSGPTESPWDTFAGGTDPNTTKIGFRERHNALIAYAGRLRNTGLDY
TEALPVFRQRWLLCEQPTGQIPEAAFHSPDCPYPVTWDEADAKLRDVYER
YAAGQADDGGDWREQAIEAELDRQRIRREARLRLEAETRPETVLPTVKPL
NVLLAEPDPPARYRIDRLAPEGARAMLSAQFKAGKSTVVANAIRSLVDEE
PFLGRFDVHIPARRLVLIDDELGENTLRRWLREQNITNTAAVADVVSLRG
RLAAFDLLDDHCRQQWVQRLQQIECDYLILDCLRPVLDALGLDENRDAGR
FLSAFDAMLTSAGIPDALLIHHMGHSGERSRGDSRLQDWPDALWRIVRET
EEPDSERFFSAYGRDVNVPEGRLTFDADSRRLTYVAGSRSDAQADAARAA
VINLLVAAARQGAKPNASGIEADLVPPHTQKAIRQAVNTLVRGRLVAFDD
GPRNSKLYYIANPCDECRLPVAADGRSRHESCPRSAEEVVLL
145224476YP_001135154.1 hypothetical protein Mflv_3895 [Mycobacterium gilvum PYR-GCK]MTPKPAPFDCALCDTRIGRDRPHLIVGTNTVHIRCAEQRSAHNTIYPDCH
IRWHDVWDHPLQTATRGGADQLLRPDHTEEIA
145224475YP_001135153.1 hypothetical protein Mflv_3894 [Mycobacterium gilvum PYR-GCK]MTTNPTNPSLEDIDLLSTTATEILRRRIEQIDRDRGHQPEFLAMAREDAD
TARREALAAEPWADCWKAIPMTDAGTGEMTGMMALPTINGKELWGARAAF
DFLDAGEDREKIEEVLSRYFSALDGNTEHLFFIFSAALCTIAEHVVPAML
DKLEHDASDYRSRVMLADAAANAWRTRVGDDLCGPGDQESGEK
145224474YP_001135152.1 hypothetical protein Mflv_3893 [Mycobacterium gilvum PYR-GCK]MTATSLFDAVGLAPSLPGAKCRGRHHLFDAPEPGVDTDETRKAEQIALRL
CSECPSLGPCRTWLESLPKNKRPLGVVGGAVNTPRRVGRPRKRGNVSSRR
PEESCTVLSTVVDPRGGGHNRWRKTPSQTPAALNLSPPKKFPPKRSNDE
145224473YP_001135151.1 putative phage head protein [Mycobacterium gilvum PYR-GCK]MSGAKIAVRLPSDPKLFIPFVLQRQPDSLRSEQMSRKEALKQRYEQLRPQ
VAQAQQVAEKAYSQNRSMTVEEKAFFDPVMSQLKDIERALAEVAAEEKTL
DFAKKVGREVGASDSYGDAGSRQQFAFKRMAPEVVRKINRGAEGEKALAT
SGSVVVGQEFEASPVELGRPANSLLAVLPSKIRSVGEYAYLRQSVRTNNA
AVVADGGTKPTSVYTTVRVEDKLDVVAHLSEGVPRYWFKDNDTLEQFIAD
ELLYGLEKAVEAMALADIDGTSGIQTQAYATSPLVTLRKTLTKLETVGHA
ASAFVMHANDWEAIELALSSANTIEYRGLPYDASARRLYGVPVVVSLAQA
EGVAHTLGEGAARLETDDEGVGVQWSESSNADDFAKNLIRARCEGRFATS
VMRPLAVVKADLTA
145224472YP_001135150.1 hypothetical protein Mflv_3891 [Mycobacterium gilvum PYR-GCK]MTIDPEQVFEVARAAIIREVRDALGVLRADELTTRELIALANILTPAYER
RQAREATPAPLLQMVHRKRRGKR
145224471YP_001135149.1 hypothetical protein Mflv_3890 [Mycobacterium gilvum PYR-GCK]MLTSPTATADLVGFTSPSGNIGCILTDEMVRCDIASRSWDPPPRPADCPD
VTGYGQGITLSPTGPAAFVCAGDTTLGSGPALPFGQYEAGGGMSCNSEPS
GMRCSNSDGHGFVLAREAYQVF
145224470YP_001135148.1 hypothetical protein Mflv_3889 [Mycobacterium gilvum PYR-GCK]MQHRGFRFGFAAIAASALVVSACSNGSTDSSSDSATTSAAASATSSVASG
ATAHNGSDVMFAQGMIPHHQQAIEMSDMLLGKQDIDPEVVSLAEQIKSAQ
GPEIEQMQGWLQEWGVGSTPPGDGTMPGHHMPDHQMPHGGGMGPMPGMPA
GGHGMMSQADMTALQNAQGPEAGRLFLTQMITHHEGAIMMAQREIESGQF
PAAVDMARSIISSQQSEIDQMRAMLAG
145224469YP_001135147.1 integral membrane sensor signal transduction histidine kinase [MycoMSVTRRSPAASTRRWRRPGIGLRLLAAQAIVLAVGAATTAVVAAVVGPPL
FQEHLHRAGVPMNSPEEMHAEEAYGYATVMSIGGALAVSALAALAVSVYV
SRRLQRSVTEVACAAALVAEGRYDIRVSPPRLGDDFDALATAFNQMASRL
QSVESTRRRLFGDLAHEIRTPVAVLDAYVEALEDGVRTLNPDTVAVLRDQ
TGRLVRFSGDVAALAKAEESSVTMTYTEVDLDGLVRRAVAAARERYETKG
VALQVMSARELPLLRADEQRLSQVLDNLLDNALRHTARGGRVEIHCHTEG
ARVRIAVTDDGEGIAAEHLSSVFERFYRADAARDREHGGAGLGLAIAKAL
VEAHGGSVTAASDGAGTGATFTVELPTTRP
145224468YP_001135146.1 two component transcriptional regulator [Mycobacterium gilvum PYR-GMSTMDHPQGSPSEHSRGYRALVVDDEVPLAEVVASYLQREQFDAVVADNG
VDAIALARDFDPDVVILDLGLPGIDGLEVCRSLRTFSDAYVVMLTARDTE
LDTVLGLTVGADDYVTKPFSPRELVARIRAMLRRPRLLQSPPTGADREVT
PPRRFGALSIDVAAREVRIADDPILLTRTEFDILQALSGRPGIVLSRRQL
LEIIRDEPWVGNDQLVDVHIGHLRRKLGDDAARPRYIATVRGVGYRMGTG
A
145224467YP_001135145.1 copper-translocating P-type ATPase [Mycobacterium gilvum PYR-GCK]MTGNHDHHGHAGHGDHAAQFRKLFWLNLILAVPVVAFSGMFAMLVGYDVP
DVPGARWVAPLLGTVMYVVGGRPFLSGALDEIRSRKPAMMLLIGLAITVA
FVASWGASLGLLHHELEFWWELALLIVIMLLGHWVEMRSLAQTTSALDSL
AALLPDEAEKVDGDRTITVAPADLRVGDVVVVRPGGSIPADGRIIDGRAE
VDESMITGESRPVGRGVGDAVTAGTVATDSGLRVQVTAIGEDTALAGIRR
LVTEAQNSSSRAQRLADRAAGWLFWFALVTALVTAAAWSAIGDVDAAVIR
AITVLVIACPHALGLAIPLVISIATERAARGGVLIKDRLALEGMRTVDAV
LFDKTGTLTRGEPTVTAVDAVAGLGSDTVLALAAAAEADSEHPLARAIVR
AAQKRRITVPTAAGFTSSPAVGVAATVEGHDIRVGGPRLLQEVDADEVAE
ADRWRAEGAIILHVVRDGAVVGGLRLADEIRPESRDAVDALHTLGVEVVM
ITGDAEAVAMSVGRELGIDRVFAGVRPEDKATKVAALQHEGKKVAMVGDG
VNDAPALAQADVGIAIGAGTDVAIASAGVILASSDPRSVLSVIELSRATY
RKMKQNLWWGAGYNLVSVPLAAGVLAPVGFILPMSVGAVLMSLSTIVVAL
NAQLLRRLDLSPEAGTRAVLSGDGRGRRTAPAAPRQPRGTEGAEASAPRG
RSRSS
145224466YP_001135144.1 hypothetical protein Mflv_3885 [Mycobacterium gilvum PYR-GCK]MARRALSNTDSGLAARLAAFASLGAGVIHAAVVPAHWSEWMPAGVFFAAM
ALAQAGWALLILLRTTAPVLFFGIALNISAIVLWALSRSAGAPFGPHAGT
VEHIQGADLCALLLEIYAVMGAGWVWRRGRRGESIPAFANALVSLGAAGV
VILASTVGVTSGLRHGHHDAGAGHAEAGSHHAPSAPMPVIKMNDSGPGAP
TPPPLQSPGVAGAPPAPSDGHDHHH
145224465YP_001135143.1 ABC transporter-like protein [Mycobacterium gilvum PYR-GCK]MTAARLSTAGLCVDLGGRRIVEDVSMDVPAGRVVGIVGPNGCGKSTLLRT
LGGILRPASGVVSIDGTDIATLGARQLARTVAAVLQDSAGDFDLRVRDVV
LMGRSPYKRMFEGDNASDIRIVGDSLALVDAAHLEDRPFPLLSGGERRRV
LVARALAQQPHLLLMDEPTNHLDVRHTFDVLALPATLGVTAVIALHDLNL
AAQYCDVIHVLRNGRQVAAGSPADVLTADLLGDVWEVRATVQPHPDTGRP
HIYFDPRRRVTEESRSG
145224464YP_001135142.1 transport system permease [Mycobacterium gilvum PYR-GCK]MTRPVRASLPYPVLMLGLAATVLAAVVAGLAIGSIAIPPGDVARILAHQI
VPNLVDPTWPAHFQTVITQVRGPRVVLGAVVGAGLAVVGMTLQALVRNPL
ADPYLLGVSSGASVGAVAVIVTGVSLVGALSTSAAAFAGALLACSLVYGL
SRAGGRITTTRLVLAGVAVAYVLSAVTSLMLITADGGDRARQVLTWLLGG
LGGARWDNLWLPLAVVGAGLVVLMAHGRTLNVLLAGDEAAATLGVDTQRF
RVRAFVLTSLVTGVLVAVSGPIGFVGLILPHAVRLLVGSDHRRALPAAAL
AGAGFLVLADIAARTWASPQEIPVGVLTALCGGPFFLWLLRRDARRADTG
AAW
145224463YP_001135141.1 periplasmic binding protein [Mycobacterium gilvum PYR-GCK]MMPSRRCLSSVAAVMAALVSLTGCAASAPPESGATSAVVSVDNCGEQIRL
EAPPQRAVGYFQQSVELMLALGLGESVVATVYPDNPPLPRYAEAYRSIPQ
LSNKDASFEQVLSAAPDFVYGGYASAFDDTAGRSRRAFHDAGVATYLNPE
YCATEPITMDDVHTEIRTIAAIFGVPERADALIEEMRDRVAAAAAAVDGV
RTAKIFVYDSGEDTAFTAGRQGIGNQIIELAGGTNIFGDVEDTFADVSWE
QVVQRNPDVIVIYDYFGTPSVEDKWAFLRSRPELAGVPAIRDDRYAVLTL
QDAVLGVRAPYAVETLARQVHPERFR
145224462YP_001135140.1 CsbD family protein [Mycobacterium gilvum PYR-GCK]MGDSGPENAVEGVIEDVKGKAKEVAGIVTDNDGLREEGRAQQDKAEAERD
VAKKEAEAEAARAAASAAEARQESAESAK
145224461YP_001135139.1 hypothetical protein Mflv_3880 [Mycobacterium gilvum PYR-GCK]MTHAKVFLMSALAATAVLSGCSQVTNDGGDTTCADFASADEKKQNEAITK
MLTDEGKNEPANAELTGTRLSITAFCQTVGKQDSTIKEAPHL
145224460YP_001135138.1 anti-sigma-factor antagonist [Mycobacterium gilvum PYR-GCK]MVAIRTERIFAPSISSDEDQTRCGAAIFATRTCSPNRIAVAVVGEVDAVN
GRELARYVERHLRVSRQLVLDLRAVDFFGSQGFTALYYISVHCTRSDVDW
AIVASPPVRRLLSICDPESELPLADDLTAALARLDRRAQRHTPFVWSARS
VWRTG
145224459YP_001135137.1 response regulator receiver protein [Mycobacterium gilvum PYR-GCK]MTAPTRSIDVLLVEDDAGDELITREAFEQNKIANTLHVARDGQEGLDFLY
RRGAHELAPRPDLVLLDLNLPKYDGRQLLEQIKSDPELCDIPIVVLTTSA
AEEDILRSYKLHANAYVTKPVDLDQFMSAVRQIDEFFVQVVRLPPR
145224458YP_001135136.1 TetR family transcriptional regulator [Mycobacterium gilvum PYR-GCKMPSLHSSADRPHSGQIRMPRPVQGVGCHTVPVTQSGETRGLRERKKAATR
LAIRREAFRLFEDQGYANTTVEQIADAAEISPSTFYRYFAVKEAVLLSDD
HTTPIVDAFVAAPSDMSPIAAYRHAVAEVFAGLSPEERDNAILGQRLLYT
VPDARGLVYNEYVRLLGLIADGLAHRLPEPTDAMERRVIAGAVVGVLIAA
SHNNPLPGDVVDRALTFLDSRLL
145224457YP_001135135.1 putative sugar transferase [Mycobacterium gilvum PYR-GCK]MKTAVVTVAHGRHGHLRRQLRGLRLSAEQPDTHIVVALADPAIAGVVREE
NAAATVLECAAGPRLPLAMARNLGADAALDAAPELIVFLDVDCIPSPRLI
ARYRAAADHGDHRDALLCGPVTYLPPPGTRGYPLPVPDDAIDPHPARPSP
PGDTVVCTTDYALFWSLSFAVTADTWRTVGGFCEEYQGYGGEDTDFARCA
AARNVPMRWVGGAHAFHQHHAVSNPPVQHLADIVRNARLFHRRWGEWPME
GWLSTFEDRGLITRDPDGTPHVAGTRPGRAGLV
145224456YP_001135134.1 hypothetical protein Mflv_3875 [Mycobacterium gilvum PYR-GCK]MARAVSISAHLQRPVTALTSRPLPEAHPFTATVTLPRDDTAEHVAEPTAH
GALHWAPHHDAGYGARMQALAEWVADTGPDACVVDVSVEVAVFLRLLGVP
VIVVAQPGDRTDPAHTLVYQVADHILAPWPRELNTPRWLLPHAAKTSYVG
GISRFEGRTVDGYDADRDARIRAGELNVLLLGGAGGGFDKRIPSAGPDGV
RWKALGGAGGDWVDDPWAAICDADVVVSHAGQNSVADLAAARRRAIVIPQ
PRPFDEQEATANVLARHGLAATATGWPDDDAWPLLLQTARESDPGRWRRW
RVDGAAARAAEAIEDTAHRCRRPVA
145224455YP_001135133.1 hypothetical protein Mflv_3873 [Mycobacterium gilvum PYR-GCK]MLRVASVPGSHVYVRHLSHPDIPGVVRLQDPVPADRRKVPGGWWPPLMLE
PGWVGAHHDLFDVFHVHFGFDAVGADVLTGVVQELKACDKPLVYTVHDLR
NPHHVDPVEHTVQQDVLVAAADALITLTPGAAQEIRRRWDKDAVVLPHPH
VLDRRRIEAARVPTDRFVVGVHVKSIRANMDPLPVLAALTEITSRLPAAQ
LAINIHDEVFIPDNHWYAPDIGEAVRAFGDYEHVRVTEHPYFSDAQLWDY
LASLQVSVLPYRFGTHSGWLEACYDLGTAVIAPSCGFYSEQRPCHEYTFT
EEEFDVDSLSSAVELAYGDWLGGTPAPRATWTERRTERSMLASAHHAIYR
QVLR
145224454YP_001135132.1 FliA/WhiG family RNA polymerase sigma factor [Mycobacterium gilvum MSEPRREYSDVPNMIRALRQLDPASPEYRRLHERIIAMTLPLAQHTARRF
RGRGQSHDDLFQVASVGLVNAVKRFDPDSGSDFLAYAVPTIMGEVRRYFR
DCSWAVKVPRRLKDLNSQLAKARAELTQQLGRAPTPSEVAAHLGIDREEV
VQATIASSNYATLSTDSTSGPDGDFVALRETLGEPDARLDAVVDNETIRP
LIEKLPPREQAVLKLRFFDEMTQTQIAERMGYSQMHVSRLLAKALATLRD
QALSDGTAADFVPSRSGRVA
145224453YP_001135131.1 FliA/WhiG family RNA polymerase sigma factor [Mycobacterium gilvum MSRLRRDLIGLMPTQVSGYSAFRVCYAFPARKAGTTAHRSTAAGCPSSTD
GPRTDPRDVLDTEAVIPVHTQTLSPPARTASPRKRDGYDDVLDMFRELAV
LDRDSAAFRRQREAIIARCLPLADHIARRFRGRGEGHEDLVQVARVGLLN
AVNRFDVDSANDFLAFAVPTMMGEVRRYFRDHGWSLKVPRRLKELNVRLN
AARADLTQELNRAPTPSELAKYLGIDREEVVEGLVAANAYSTRSTEQPTT
FSGDGEGLSLQDTFGAPDDNIQKVIDVNTVQPLLAALPERDRLVLKLRFF
EDRTQSQIAEQIGVSQMHVSRLLARALATLRDQVGDEPATHS
145224452YP_001135130.1 hypothetical protein Mflv_3870 [Mycobacterium gilvum PYR-GCK]MRATGLISEFGVDASLFVSHGLCTPHGILRNAQFGRVFRRPGVRTVLSRG
CARSQSASLGFPAASKVPRGPLRLDDAGWRPRNRLVAWGFRVGICRSATR
EPTPHAYGPVFKRHLPGYPSAGRGPSEEQNMIGTIIGAIVVGLIVGALAR
LVMPGKQNMGVLMTIVLGALGSFLGTWITYTLGYSNSNGGFEVIPFLVGI
IVAIALIAAYLGITGRRGTRPRV
145224451YP_001135129.1 putative ribonuclease BN [Mycobacterium gilvum PYR-GCK]MGALRPAAVAGAFAAGLATGVLTRSQRNTHAGQDELPESAASAAPEPAEA
EKVDAPPADDPAKPESPTDLTRPSWLFVLRKTAREFTHDQCTDLAAALTY
YAVLSLFPALVVVMSLLGVIGQSERTADAVLGIVDDVSPGAAVDVLREPI
QQLVNAPSAGLTLVLGIVGALWSASGFVGAFGRAMNRIYEVEEGRPGWKL
RLQQLFLTLVGLIVAATAALLLAVSGPVAEAVGGYLGVGATGLTVWNIAR
WPLLLVLVVFGVAMLYYVSPNVRQPKFRWISVGAAIAIVTWVCASLGFGF
YVANFGNYNKTFGTLAGVIVFLLWLWLTNLALLFGAEVDAELERGRQLQA
GIRAEDTLKLPLRDTSLIEKNKAKEHETRLRGRVLRRSRGRHDGFGDDPQ
G
145224450YP_001135128.1 NAD-dependent epimerase/dehydratase [Mycobacterium gilvum PYR-GCK]MRIVITGASGNVGTALLRRLIGTGDGHDLVGIVRRPPPAEGVYREVTWHA
IDLADADAQDRLRPIFEGADAVVHLAWGFQPTRNTEYLTRVGVGGTRAVL
GAAHAAAVGHLVHMSSVGAYAPGRYGDYVNEDWPTLGIRTSPYSRDKSRA
ESLLDEYLDEQGSAAIPVARLRPGFIVQRDAASGLMRYALPGYVPMPVVP
LLPIVPLDRRLCIPLVHADDVAAALVAIVHRCAVGPFNVAAEPPVRRADV
AEVLNARQIHVPSQILGTLVDLTWRARLQPIDRGWLDMAFSVPLLDCARA
EKELGWQPTWSSVAALADVIDGVARQASTESPPLRPRSMLEQLRRDLTEG
LMTTRHLP
145224449YP_001135127.1 FAD dependent oxidoreductase [Mycobacterium gilvum PYR-GCK]MVVLGAGPAGLGIARELKHRHGVDPLIVDRSDAPAASWRARYDGFRLNTC
GFWSHLPGQRIPLSFGRWPTRDQMVEYFDDYVRRQGLRLRLGVRAERIDR
DGAGWSITTDDEDVRASAVVVALGNHNTPGLPPWPGMDGFTGQLLHAADY
RSAEPFGGQEVLVVGSGNSAVDIALQLSSAVAAKVWMSVRTPPQLVPRST
AGLPIDTLGPLLATLPVWLLDGAAAAMRRVWFGELAGVGLPPPRQGIYTA
LRAQAKVPTIADELVPRVKDGRIEIVSAVESFETNRVVLADGTALAPQVV
IGATGYRRGLDALVGHLGVLTDDGHPVVNGPPAAAPGLWFAGYEEPLIGP
LRAFRRHAPDVAEVVSHLAASSAASQTLSR
145224448YP_001135126.1 hypothetical protein Mflv_3866 [Mycobacterium gilvum PYR-GCK]MTSRSSRHTRIAAAGVPVHLGIHADSRAGREAQETPLGKTRLVLTKWAIP
LGASVTHLPIGFAMIILGIILLLIGYFTSLSILYTIGGILVVVGVVLWIL
GAVGRPVGGRKVWF
145224447YP_001135125.1 ribonuclease BN [Mycobacterium gilvum PYR-GCK]MVEWLDRLQRRSKAAGFVIAVIYKYLDDQGNYLAALLAYYAFVSLFPLLL
LLTTTLGVLLWNRPQWRAEIIDSAISQFPLIGEQLSRPESLSGGTTAVVI
GIVGALYGGLGVGQALQNAMDTVWAVPRYVRRDPIKSRVYSILLLIVLGS
FLVGTTLLTGLGRNWANLGFLGTSAVVVGSVLLNAAVCAVALRVTTVRPL
TWTQVLPGAVLAAVLWQALQWFGATYVSHVVASASVTNSVFAIVLGLLAF
LYLVSTAFMICAEINVVRVDRLHPRALLTAFTDNVDLTHADRRAYAGQAE
AQRAKSFQQVAVSFEEELEEEFEKEAEPGASDGGTPTAPTP
145224446YP_001135124.1 hypothetical protein Mflv_3864 [Mycobacterium gilvum PYR-GCK]MRITKRGARSAGMACGTVAASAALAVSTATSGWGVSTAIVIGGIGTPSMH
EVVTNQLLGGALQDYDQRISVNWPAEARPYTGEDDMTLGQSIEIGRANLN
AQIDTALAQLERDADGNLLDSEQVTVVGLSAGSLVVTETLRGWQSDDKED
PDAEEINFVVVADSSRQEIIDDTEQYNPTYDYTYRKAPETVYDTVEVTGE
YDGMADFPDRFNLTAISNAMAGSVLRHVQTMFSDLSDVPKQNTTVTENAL
GGTTVRYLVPAETLPLVQSNPSLAPREAELRAQVDRGYSRNDPANVAARL
AGPDVPERIRDIVTPEAAAQDTEDVDLGIAAAVQQDEESGAGAIPEIDGQ
RSLGEQLEAAQNAEDGADTSPAPTSRTIGAAVEAISERSTAADDDTGATP
LTPDAGDTESSTSDGASESAGSDVGDSTTRTSTKPSSDGAARSSSSAE
145224445YP_001135123.1 acetoacetyl-CoA synthase [Mycobacterium gilvum PYR-GCK]MDPSGVAGAEPSILWRPDSSTVRDTAIVRFARWAATCRDTRITDELDYSA
LHAWSVRDPEGFWSAAAEFLGVMFRDPPQRTLGSAQMPGTQWFPGSTLNY
AEHALTAAPGRDDADTAVEFVREDGVERTVSYAELRDLVGRARTGLIAAG
VGRGDRVVALAPNCVETLVMFLASASLGAVWSSCSPDFGTRAVIDRFAQI
EPTVLLAVDGYCYGGRRFDIRDRLETLRGNLPTVTTTVLVPYLDPAAELS
GSIGWAEFIAADGTLDFDPVPFDHPLWVLYSSGTTGLPKGIVQGHGGIVL
EHLKALRLQSDLGPGDRFFWFTTTGWMMWNYLVGGLLVGATIVLFDGSPG
HPDLNVLWELAARHRVRLFGVSAPFVHSCMDAGISPREHHDLSSMRALGS
TGSPLSVKGFRWIGEHVGEHVQICSVSGGTDVCTAFLGAAPTVPVWLGEL
SCAALGADVHSFDEDGADLRGEVGELVLTQPMPSMPVMFWNDPDGTRLRA
AYFEDYPGCWRHGDWVVATERGSFVIQGRSDSTLNRGGVRMGTADFYAVV
EGFAEVLDSLVIDTTELGDDAEGELLCFVVLAPSASLADVEAALRTALRR
ELSPRHVPDRFIAIDAVPKTLSGKKCEVPVKKILAGADPEKAVSREALQD
PDAIAPFLAMVTKGTVDGR
145224444YP_001135122.1 acyltransferase 3 [Mycobacterium gilvum PYR-GCK]MSVSASPGRRRGDLDGLRGVAIALVAVFHIWFGRVSGGVDVFLVLSGYFF
GAMVLGRALTPGASLSPLPMLRRLARRLLPALIVVLGGAAVLTFTLQPQT
RWESFADQSLASLGYYQNWYLSAAASDYARAGEAISPLQHLWSMSVQGQF
YLAMLAVTLGLAAVLRRFVGSRLKAVFVGVFVVLAAASFWYAIVAHGEHQ
AGAYYDSFARAWELLAGVLAALLLTRVSMPMWARTAAATVGVVAILSCGA
LIDGAQLFPGPWALVPVGATVLVIAAGAGQPRREPAPLRLLAGRPAVALG
AMAYSLYLWHWPVLIFWLVHTGAPRVGILDGLGVLAVSLVLAYLTTRLIE
NPLRHPDSAGDADRAARVWVWVRRPRFALGSAVVLLAVSLAVTSFAWREH
VVMQRAKGHELAQLPERDYPGALALTNRIRVPQLPMRPTVLEARDDIPAT
TLDGCISDFVTVELINCIYGDPDAVRTIALAGGSHAEHWITALDTLGTRH
GFRVVTYLKMGCPLTTEMVPTIAISSEEYPQCHEWNQRAMDKLLTDRPDF
VFTTTTRPNADEPGDLVPEAYLGIWDTLSANGISILGMRDTPWLIRDGRL
ADPADCLSRGGDSVSCGVKRSWALSETNPTLDLASYYPLLHPLDMSDAVC
DETDCRVTEGNILVYHDSHHVSATYMRTMTAELGRQIAAATGWW
145224443YP_001135121.1 ABC transporter-like protein [Mycobacterium gilvum PYR-GCK]MSGVRVRARLGERDIDLDVSVADGQVLAVLGPNGAGKSTLLQLVAGLLRP
DDGQVEVGDTVVTDTASGTFVPVHARGVAMLSQQAMLFPHMSVAANVAYA
PRCRGQSRSRARASARRWLEAVGAVELADRRPAQLSGGQAQRVALARALA
AEPRVLLLDEPMAALDVTAAPPLRRLLREILREQRRTAIIVTHDVLDAMA
VADRAVVIEDGRVAEAGPTRTVLTAPRSRFAARIAGVNLVPGTVSAPGVL
RAAWGAEICGTGDAVPGTAAVALFRPAAVAVHLAPPRGSPRNVMAVTLAE
VDVHGAAVRVRGTDQPDGGTGLAADITAAAAADLDLTPGQTVYFAVKAQE
VDLHPVPE
145224442YP_001135120.1 NifC-like ABC-type porter [Mycobacterium gilvum PYR-GCK]MPVRRRAGPIEVGLPEWIYLPAAVGALFVLTPLAAILLRIDWPDFVPLIT
SESSRAALALSLKTAAASTAVCVLLGVPMALVLARGDIPGQKVLRALVLL
PLVLPPVVGGIALLYTFGRQGLLGQHLEVLGVRIAFSTTAVVLAQSFVSL
PFLVVSLEGALRSAGAGYERIAATLGAAPTTVLRTVTLPLVVPGLISGAV
LAFARSLGEFGATLTFAGSLQGVTRTLPLEIYLQRETDADAAVALSLVLI
VVAALIVIGSASRRLAGPL
145224441YP_001135119.1 molybdenum ABC transporter- periplasmic molybdate-binding protein [MIRHPAVAVALTVATLMSGCSTAGEDRPAATPPTSDAVTGDLTVFAAASL
KSTFTELGSRFETDHPGTQVVFNFAGSTDLAAQISQGAPADVFASADTST
MDRAVDGGTVAGDPVVFATNTLTIVTALGNPRAIASFADLAGPGVQLVVC
APQVPCGSATEKVEAATGVTLTPVSEESAVTDVLGKVTSGQADAGLVYVT
DAAAAGDAVTAVAFPEAADAVNSYPIAALADSTNPAAASEFIEFVTGPQG
RDVLAAAGFGRP
145224440YP_001135118.1 DNA binding domain-containing protein [Mycobacterium gilvum PYR-GCKMIRIRDAAALLGVSDDTVRRWIDSGTLESTKDEAGRKVIDGRVLANFARE
HASPPPDVLGVGSSARNRLVGLVTAVTADTVMSEVQMQCGPFTVVSLMSS
ESVRRLGLEPGVVAVAVVKATTVIIETPGRPS
145224439YP_001135117.1 putative PAS/PAC sensor protein [Mycobacterium gilvum PYR-GCK]MTDDPRPTGGLDDFFDSAPCGLLLTSPDGRIIRANETFSRWVGYRSEHLT
GRQFPDLLAAGSRIHYETHFVSMLHMNGSLDGVAADLLTADGTRLAGFVT
ANVERDAAGAVVALRIAIQDASERRSYERELLETRRRADRERERAQVLAA
TLQRSLIPPTLSPPRGLTAAAHYHNASRDDVGGDFYDLFPMAEDRWGMFL
GDVSGKGAGAAAVTSLTRYTLRAAAVNDRDPVAVLHTLDAVLSHEFHGDD
PRFCTVIFGVITAAPDGFDVQLATGGHPPALLLPVDGPARYVATPGGQAV
GLIRNPRFVSTSVHLGPGDTLVMYTDGLTEAKTGRTRRFDDDDALLEFAG
RHTPTDAGAFVEAVRVLLASFGDGLEDDAAVIALSVPR
145224438YP_001135116.1 alpha/beta hydrolase fold protein [Mycobacterium gilvum PYR-GCK]MDVRIRNSVRVVGRPDGRPLMLAHGFGCDQNLWRLVVPLLSDRFRIVLFD
HVGSGSSDAGAWTAKRYADLQQYADDILEIVDDMRLREVVYVGHSVAAMM
GVLAAAKNPGAFAGLVLLTPSPRYLDDADYRGGFTRSEIDELLDSIESNY
LGWSRAMAPVIMGTPERPDLEGELADTFCRTDPQRALAFARATFLSDNRT
DLARVTVPTVVIECARDTLAPREVGAYCHEQIAGSTLVTLDASGHCPHLS
APEDTAAAIADFALRL
145224437YP_001135115.1 hypothetical protein Mflv_3855 [Mycobacterium gilvum PYR-GCK]MAAPELRLRAPRPGLIALPWDRPLADWAAPDVALRDIAVGPSRHLVRFVE
SDGELWALKELPPRIAGREYGVLSRLEEMGLNSVRAAGVVFQPDFDTAIL
LTRFLVGSWQYRRLFMRLPPDAPKHRARLFDAMATLLVELHRHGVFWGDC
SLANTLFSRDGQVLQAFLVDAETSEVHPGLSDGQRAHDIDITVENVGAGL
LDMAAKLERPDLQPGFIAEAVGIRDRYEQLWNLLDAKPTFGFADRYRVES
TIRKLNELGFAVDEVSLQPVSSGAEDLRLHVAVGDRNFHATQLRRLTGLD
VGEGQARILLGDLHAYQGQLCREAGHDVDERTAAQLWVMEVATPTMHRAH
RAVGGAGTPIQAYCDLLEVRWLLSERAGQDVGTERALQALARNVVPSESA
AQLAVVEVPTEPFSVLDDE
145224436YP_001135114.1 ABC transporter-like protein [Mycobacterium gilvum PYR-GCK]MAAITMRNIVKKYGDGYPAVNDVSLDIADGEFVILVGPSGCGKSTLLRMI
VGLEDITSGDMMIGDKRVNDMAPRDRNLAMVFQNYALYPHLTVFENIAFP
LRLAGKLSDDEIRQRVNDAATTLELGEHLDRKPANLSGGQRQRVAMGRAI
VREADAFLFDEPLSNLDAKLRGQMRTEILRLQRKLGVTTVYVTHDQTEAM
TLGDRVAVLKKGVLQQVASPRELYDQPVNLFVAGFIGSPPMNFVPARVTG
NEIELPFATVPLRDEWRGSVEEGKVYIAGIRPGAFEDAEFVDTDKASRGV
TFDVEIDVTEWLGNEQYAFVPFEATTEISGQLAELANELDSEQLRTQICV
ELDPLSRVRSGDKATLWLDSERLHLFDPHSGDNLTRVSHERPREQNPPES
RGRHAATAG
145224435YP_001135113.1 binding-protein-dependent transport systems inner membrane componenMTKNTKWWTIAGIVIVIYSFVPMLWMISLAFKPPSDIVSGEPSFLPSTVT
FDNFAQIFSNPLFTRALINSIGIALVATVISVIIAMFAAYAIARLEFPGK
KVLLSLALGIAMFPQAALVGPLFDMWRGLGIYDTWLGLIIPYLTFALPLS
IWTMSAFFRQIPWEMEHAAQVDGATQWQAFRKVIVPLAAPGVFTTAILTF
FFCWNDFLFAISLTSTDSARTVPAALAFFQGASYFESPVPYIMAASVIVT
IPVVILVLVFQRRIVAGLTSGAVKG
145224434YP_001135112.1 binding-protein-dependent transport system inner membrane protein [MTAPADAPIQKDPGKPSVSERAKGERRLGLYLTLPSYVVMLLVTAYPLGY
ALVLSLYNFRLTDPEGRSFVGLGNYLVILTDPIWWNDFVTTLAITVVTVA
IELVLGFWFAFVMLRIVRGRGPLRTAILIPYGIVTVVSAFIWRYAFAIDS
GFVNQWLNLTDFDWFGDRWSAIFVICLSEIWKTTPFISLLLLAGLVQVPE
DMQEAAKVDGATAWQRLWKITLPNMKAAIMVALLFRTLDAWRIFDNPYVM
TAGANNTETISFLAYRQNVTLVNLGMGSAVSVLLFLSVVAIAWIFIKVFK
TDLSQVRGDQ
145224433YP_001135111.1 extracellular solute-binding protein [Mycobacterium gilvum PYR-GCK]MKRNQFARGRRRRAVALASAPLVAASLLSGCGAQSGPPTLTWYILPDNGG
SVARAEQCAEASNGAYQVRIESLPSTATAQREQMVRRLAAGDSSIDLVSM
DVVFTAEFANAGFLRPYTAEETSRLTAGMLPAPIETGMWEDTLYGAPYKS
NAQLLWYRKSAAAAAGVDPASPTFTWDEMLKAAVGQQKKIAVQAQRYEGY
TVLINALVLSGGGALLEDVEAGRDAKPSLNTPPGLKAAEIVGTLGRSPAA
PTDMSNASEEQARANFQSDQGMFMVNWPYVLAAARSAAEEGTLPQEVVDD
IGWARYPRVSPDMPSAPPLGGANLGIGAYTEYPEEAVALVECINAEPKAT
QYMLDESEPSPYAASYDNPEIRETYENADLIRESIGDGGPRPPTPFYTDI
SGAIQQTWHPPASVTSETPERTDQFMADVLAGRRLL
145224432YP_001135110.1 hypothetical protein Mflv_3850 [Mycobacterium gilvum PYR-GCK]MRVQRRCVGLMCQTSGIVAPVSPLDHRHRRGRHRFGGALHLRRNVDAVAM
IASPSRGAAAEVNSGDHPAHRTGGERRHRPAARGPLPHQPCEV
145224431YP_001135109.1 alpha amylase [Mycobacterium gilvum PYR-GCK]MAPKHPWWQTAVVYQVYIRSFADGNGDGIGDIRGLRARVGYLGALGVDAI
WINPWYPSPMADAGYDVADYRDIEPAYGTLTEAQDLIDAAHAVGIRVILD
IVPNHTSDRHAWFEAALAGDPAARDRYHVRPGRGANGELPPNDWQSVFGG
PAWTRITDGPLQGQWYLHLFAPGQPDLNWENPEVRAEFEDILAFWFDRGV
DGFRIDVAHGLVKAEGLPDGAQADAPQAMLQVEAQHPAWDQDGVHDIYRG
WRSVAQRYTPERIFIAEAWVSSNERLARYLRPDELHTAFQFDFLRSPWRA
ANLRGVIDDAITSAASVGAPPTWVLSNHDVTRTVTRFSRSQPDHLVETDW
ERGRWSGEEPDHELGRRRARAAALVQLALPGTAYVYQGEELGLEEIEDLP
DDVRQDPTWAQSGFTDVGRDGCRIPLPWNESEPTYGFADGPDAVTWLPQP
GHWAEHSVEAQERDPDSMLHLYRAALKLRPSLWRDAGEVTWLDVAAEVAA
FDRGGAQCWVNTGTADVTLPAGASVVLASSPGVDGVLPGDTAVWLQTRGK
DFLL
145224430YP_001135108.1 hypothetical protein Mflv_3848 [Mycobacterium gilvum PYR-GCK]MNAHFPDAETLRSALSLANRAPSVHNSQPWQWRVGHESVHLYANPDLLLP
HTDPDARDLMLSCGAALHHCVVALAALGWQAKIHRFPNPAEPDHLAALEL
RRYPAADLDVTLAAAIPRRRTDRRYYSSWPVPQGDVALMGARAARAGVAL
RRVDDLAGLKRLVSAAAFQHRTDAGYLTELAAWSGRYAATAGVPARSVPA
ETAGAVSARAFAGGVLPQTPDTAADQDNAVVLALGTAGDDRLSWLRAGEA
TSVVLLTATALGLASCPITEPLEIAETREAVRRDVFGADGYPQMLLRVGW
APVNADPLPSTPRRNLSEVVVRLDDSSAE
145224429YP_001135107.1 two component LuxR family transcriptional regulator [Mycobacterium MVKVFLVDDHEVVRRGLIDLLGSDPELDVVGEAGSVSEALTRVPTAQPDV
AVLDVRLPDGNGIELCRELLSLMPDLRCLMLTSFTSDEAMLDAILAGASG
YVVKDIKGMELARAIKEVGSGRSLLDNRAAAALMAKLRGEGERTDPLSGL
TDQERVLLDLLGEGLTNKQIAARMFLAEKTVKNYVSRLLAKLGMERRTQA
AVFISKLDRGHGAGNA
145224428YP_001135106.1 UspA domain-containing protein [Mycobacterium gilvum PYR-GCK]MLDATFVPCIVVGIDGSPAAVDAALWAVDQAVDLDIPLRLVYVIDADNED
AVDPHDQARQLATAEMAVRYALTALESTDQPVKIEVEILRGRPVQTLLEA
ARSAVLLCLGARGLKHSTQGRIGSTAGAVSTSAHCPVAVVRAHRPHRRPD
RAVVIEITDNAGGGAVLERGLDEARRRGAPVRVLTSARSQLDVTGRWERR
LAEWRRRYPDLDISAVRARDGLFDYLAAHGDGLQLLVAGRNRPGGVAPLV
GTPGNAALRDTDCSILVCEPPNAL
145224427YP_001135105.1 hypothetical protein Mflv_3845 [Mycobacterium gilvum PYR-GCK]MSATQVRIETIIDAVDVACRAPSLHNSQPWRWVATDHGVDLYADPDRMIR
AADSTGREALISCGAVLDHFRVAMAAAGWSITVERLPEPSDPRHIASIRF
AAATEVTAEQKRRADAILVRRTDRLPLSAPRDWDVPGETGAAGAEPDNPV
RVHTVPGHKRDMLVEASQLAEVLRLYDSDYHSELFWWTADFVATEGIPRS
ALVSAAEGDRVGIGRTFPVTTQPERRGELESDDAAIVVLSTEDDSRESVL
RCGEALSAFLLDATMTGLATCTVTHITEVPAGRDVVASVLATTSIPQVLV
RVGAAPALDAIPAPTPRRPVHDVLEIRRGATC
145224426YP_001135104.1 GAF sensor signal transduction histidine kinase [Mycobacterium gilvMHDGAVADADDHRARDGARPVRTTLSQLRLRELLTEVQDRVEQIIRGRDR
LDGLVEAMLAVTSGLELDETLRTIVHTAIELVDAQYGALGVRGHDQELVE
FIYEGIDEPMRERIGHLPEGRGVLGVLINDPKPIRLEDISRHADSVGFPP
NHPPMRTFLGVPVRIRDEVFGNLYLTEKSDGQPFSEDDEVLVQALAAAAG
IAIDNARLYAQSQARQSWIEATRDIGTELLSGIDPAGVFRRVADRAQKLS
GAAATLVAVPDDPDLPVGEVAELTVAASAGETIAAAHDPIPVAGTAIGDA
FVHRTPGMTDRADIGIGATVGPALLLPLRAPDAVPGVLIVLRSVGAQPFR
SDELDMLAAFADQAAQAWQLASTQHRLRELGILTDRDRIARDLHDHVIQR
LFAVGLSLQGSIARARSEEVQQRLSANVDDLQSVIQEIRTAIFDLHGGSS
AVTRLRQRLDAAVAAFPESGVRTSMQCAGPLSVVDAGLADHAEAVVREAV
SNAVRHAEASTVAVTVTVEDDLAITVTDDGRGIAADVTGSGLANLARRAQ
DVGGSFSVRRGAQVGTTLTWRAPLP
145224425YP_001135103.1 hypothetical protein Mflv_3843 [Mycobacterium gilvum PYR-GCK]MSRTKKSIVVVMMGSAGLFLSAPLLGPAANATPTRGGVPCVGILQQIVTR
PGEIPQALTDTARSFTEPPKPAPPVVRPPASSSSSAGTPPVPGRPPASVV
TPSSGATPPVPPSPGTPASTSTRGGTPPVPPAPPAPAGTPASGATPPAPP
VPGVPAVTSTGGGTPPVPPVPGAPVGAPVANPGLPTPPVPGAPVFGDGGA
VLPPLPPAPAGPAGGPAGLVAPPAPPVPGGPAAVPAGVALPPAPPGAPGA
PVFGEAGAAPSGAAAPVAPAAGSGGAGGAGGGSGIGGPGGGGAPVEGTGG
AVPAGAPLAAAGGEVPPPAPPIPGAPVIGEAGVVPPPAPPAPAPPAGGLG
GAVPPPVPGAPGVPVVDEAGVVTPPAPGGPGVPTGGEGGVVTPPAPGAPG
VPVVDEAGVVTPPAPGGPGVPTGGEGGVVTPPAPGAPGAPVVDEAGVVTP
PAPGGPGVPAVGDTAVVTPPAPGAPGTPAVNSVETFSPPAPPAATPPSSG
SVETFSPPAPPAPGTGTNSTVEISTPPPPGTPGLPSEGSTTYTTPPTPEI
TLNPANSGIDIATPPAPGLPGAPLEATANITTPGTPGVPGAPVNSSIDVA
TPGEVGVPAAPIERSMTVTTPDTPGAPGAPANAAVDVATPPAPGVPGAPV
VGEAGVTTPGAPGAPGAPANAAVDVATPPAPGVPGAPVVGEAAVTTPGAP
GVPGVPAGGDAGVVTPPAPGVPGAPVVGEAGVTTPGAPGVPGVPAGGDAG
VVTPPAPGVPGAPAATEAGLATPPGPGAPGAPVVGDAGVATPPGPGVPGA
PIVDEAGLATPPAPVAPVEGAGGAVPPAGPPPAPVFGDAGAPVEAAAGGA
PVEAAAGVTGGGSVAGAGAGGGAGGAAGGAGVEGASGAVGAAGGPGAGAA
PAAAGGAAPGGAPGGPVAGGGPVGGPGALPAPGAPIVGEAGVVSPPAPGV
PGGAAAVPAGAVTPPAPGVPGAPVFGEAGVVTPPAPGVPGGAAAVPAGVV
TPPAPGVPGGAAAVPAGAVTPPAPGVPGAPVFGDAGVATPPVPGVPGGGT
TVPAASVTPPAPGVPGGASTVPGNAGTPSTPGLPPGSTDTYINYPAPPVP
PTPPNSTGVSAGTPGSPAPGTPGSTLTLTDLLTPPGIARTLQNTASSVMG
ATPPGTPPVPGGSGSVSLAVPGTPSPIAPLAATGLSNLVSPPSLTIPSIP
GLPVPLPNTVPVPSDLLCVGTDWSASQGDSAATPPAAEVPRVVTGAAPTG
DRRDRWGNR
145224424YP_001135102.1 response regulator receiver/ANTAR domain-containing protein [MycobaMRAPRARGSGNLDVLLTRNTRTVTVNDSADVEAAHLRVAELVQGLHNRPD
ADSDTVVAELAEHAAAEIPGAQYAGITLTRNAKHVETPAATHHWPLLLDK
IQQRYLEGPCLTAAWEEQTVHVRDLQTEERFPNYRRDALAETPIRSIMAF
QLFIADESLGALNVYSEEPDVFGSEARTLGLIFAAHSSVAWNSARREAQF
RRALESRDVIGQAKGMIMERYRVDAVRAFELLRKLSQDSNVPLSKVAADL
VAQAQTSNGQTG
145224423YP_001135101.1 hypothetical protein Mflv_3841 [Mycobacterium gilvum PYR-GCK]MKLTDLAGKSLTYTEVGATAGALPAGYHHVNKSAVIGRGRERFERAGNDG
MQWGMLRGAGLRVEATTAVAEVGAEVLVHLGPVVAPCRVVYVVDEQDRRG
FAYGTLPGHAEAGEELFLVRYDPSTDLVHAEVRAFSRHATWWSRLGAPLT
SAIQRAVTDRYLRAL
145224422YP_001135100.1 thioesterase superfamily protein [Mycobacterium gilvum PYR-GCK]MSTNDAAEAHTGTGFDAHVGGGFNPPRPTDRGGPDYGRFVEAVRTLQDHT
RAADAPDDVITAAADLIEKASALLAPYDADEWSSPSGRRMDLPNRGNILS
PPIDLRVTDGRVVGTACFRRYHLGRNGAAHGGAVAHLFDSLLGFTAFKLS
GSKAQRTAFLHVDYRRIALIGAQLQVEAAIDDIVDRKIYVSGRLLDGEHV
LADAHSLFVKLKPGQP
145224421YP_001135099.1 hypothetical protein Mflv_3839 [Mycobacterium gilvum PYR-GCK]MTDTDKPGFTRRWARRRDRLRERPVVDLTYRISVGVVGLVVLGLGILAIP
YPGPGWAIVFLGLAILATEFDWAKRLLGYARRRYDAVMDWFKQQGLWVQA
LGALFTCAVVVGTLWLFGALAFVGRWFGLEYGWLDSPIGIGS
145224420YP_001135098.1 threonyl-tRNA synthetase [Mycobacterium gilvum PYR-GCK]MSAPARPAPAAPIRVTAGTTAGQAVRDAGLPSRGAPDAVVVVRDADGRLR
DLSWVPDTDVEVTPVAADTEDGRSVIRHSAAHVLAQAVQEMFPDAKLGIG
PPITDGFYYDFDVAEPFTPEHLQALEKKMRKIVKDGQIFERRVFGSKDEA
RAELASEPYKLELIDDKSGADDPEVMEVGGDELTAYDNLNPRTRERVWGD
LCRGPHIPTTRYIPAFTLTRSSAAYWRGDQNNASLQRIYGTAWESQEALD
RHLELIEEAQRRDHRKLGVELDLFSFPDELGSGLPVFHPKGGVVRRELEE
YSRRKHIEAGYEFVNTPHITKEQLYITSGHLEWYADGMFPPMQIDAEYNE
DGTVRKPGQDYYLKPMNCPMHHLIYRSRGRSYRELPLRLFEFGSVYRYEK
SGVIHGLTRVRGMTQDDAHIYCTREEMRDELARLLQFVLDLLADYGLDDF
YLELSTKDPDKFVGSDDLWEEATETLREVAESSGLALVPDPGGAAFYGPK
ISVQVRDALGRNWQMSTIQLDFNMPDRFELEYTSSDGTRRRPVLIHRALF
GSIERFFGVLTEHYAGAFPVWLAPVQVVGIPVADAHAGYLDGVAAELRRR
GIRVEVDASDDRMAKKIVNHTNQKVPFMLLAGDKDVEAGAVSFRFGDRTQ
INGVPRDQAVEAIVDWVNRRENATPTAELVVLPSGDAQSPVAGEG
145224419YP_001135097.1 histidine triad (HIT) protein [Mycobacterium gilvum PYR-GCK]MDPEDTIVDRGVGDPDRLQRLWTPHRMTYIADAVKGGSAASSEPFSDIPN
MSDEDGLVVARGDLVYAVLNLYPYNPGHLMVVPYRRVAELENLTEDESAE
LMAFTQKAIRVMKTVSRPHGFNVGLNLGTSAGGSLSEHLHMHVVPRWGGD
ANFITVIGDSKVIPQLLRDTRLLLATEWENQK
145224418YP_001135096.1 CDP-alcohol phosphatidyltransferase [Mycobacterium gilvum PYR-GCK]MSNFYLMTRAAYAKLSRPVAKGALKVGLTPDTVTILGTAGSVLAALTLFP
IGQLWWGAVAVSFFVLADMLDGAMARERGGGTRFGAVLDAACDRISDGAV
FCGLLWWAAFGLQSAELVVATMICLVSSQVISYIKARAEASGLSGDGGLI
ERPERLVIVLVGAGLAGFPLFPLPWLLHVAMWLLAVTSLITVGQRLHSVR
TSAAAMEPLSVPDKPETTEQ
145224417YP_001135095.1 lipid A biosynthesis lauroyl acyltransferase [Mycobacterium gilvum MTRDQGAVRDGGGLLAFPSALAGQLSDWGYAAGWRLVRAAPDILARNTFE
AGAVWASRNGGPDQLRRNLARVIGSAPAEVPDSLMRASLASYARYWREAF
RLPSMDHAELGRKLWVRDIETVFAALEHGRGAVLALPHSGNWDMAGVWLA
QNHGTFATVAERLKPESLYNRFLAYRQSLGFNVVPSSGGERPAYDVVRDW
LLDNGIVCLMADRDLSRRGVEVDFFGELSRLPAGPAKLAIETGAPLFPAH
CWFDGDGWGCAVYEPIDTSSSDVSAVTQALADRFAANIAAHPEDWHMMQP
QWVADLSDERRAHLEGT
145224416YP_001135094.1 phosphatidylinositol alpha-mannosyltransferase [Mycobacterium gilvuMRIGMVCPYSFDVPGGVQSHVLQLAEVMRVDGHEVSVLAPASPDAQDSLP
DYVVSGGRAVPIPYNGSVARLRFGPATHRLVKKWIQQGRFDVLHLHEPNA
PSLSMLALNIASGPIVATFHTSTTKSLTLSVFEPILRPMHEKIVGRIAVS
DLARRWQMESLGSDAVEIPNGVDVGSFATAPLLPGYPRTGPTVLFLGRFD
EPRKGMAVLLGALPAVVEPFPDVEILVVGRGDEDELRSQAGPLAGHLRFL
GQVGDAEKASAMRSADVYCAPNTGGESFGIVLVEAMAAGTAVVASDLDAF
RRVLDDGEAGRLVTVDDSAALAQGLVEVLSDAAVRRRYIECATRAVARYD
WSVVGKQIMRVYETVAGSGVKVRVES
145224415YP_001135093.1 NUDIX hydrolase [Mycobacterium gilvum PYR-GCK]MIPWITAVVIAVVVGAVLLILTWAYQTATRLDRLHVRYDLSWQALDGALA
RRAVVARAVAVEAYGGGPEGRRLAALADAAERAPRASREAAENELSAALA
RVNPSSLAVAMVAELADAEARVLLARRFHNDAVRDTLALRERPLVRMLRL
GGTASLPTYFEIAEAGEMSARELAPARRRTSSRIVLLDEDGAVLLLCGSD
PAGADAPTPPPRWWFTIGGATQLGESLAQAAVRELEEETGLAVAPEAMVG
PVWRRDAVIDFNGAVIRSEEMYFVHRTRRFEPSDAGRSGLERTYIHDHRW
CDATMIGKLVADGENVYPRQLGELLDEANRLADAPDEVPAGPVRSIR
145224414YP_001135092.1 pyridoxal biosynthesis lyase PdxS [Mycobacterium gilvum PYR-GCK]MGSQARRSGSNGFAAASKLDQQRIKEIAVESELTGAASGAPARGTARVKR
GMAEMLKGGVIMDVVTPEQARIAEGAGAVAVMALERVPADIRAQGGVSRM
SDPDMIEGIIDAVTIPVMAKARIGHFVEAQILQSLGVDYVDESEVLTPAD
YTNHIDKWKFTVPFVCGATNLGEALRRITEGAAMIRSKGEAGTGDVSNAT
THMRKIGGEIRRLTSLSEDELYVAAKELQAPYDLVVEVAQAGKLPVTLFT
AGGIATPADAAMMMQLGAEGVFVGSGIFKSGNPAERAAAIVKATTFYDDP
DVLAKVSRGLGEAMVGINVEDIAQPHRLAERGW
145224413YP_001135091.1 acyl-CoA thioesterase II [Mycobacterium gilvum PYR-GCK]MAIEEILDLEQIEVNIYRGGVFSPESGFLQRTFGGHVAGQSLVSAVRTVD
PKYQVHSLHGYFLRAGDARSPSVYTVERIRDGGSFCTRRVTAIQHGETIF
SMSASFQTDQSGIEHQDAMPHAVPPDDIPDFKSVSKVFDDASFKQFDEWD
VRIVPRERLGVREGKASQQQVWFRHRDPLPDDHVLHICALAYMSDLTLLG
SAQVNHVEERKHLMVASLDHAMWFMRPFRADEWLLYDQSSPSACGGRSLT
QGKIYNRYGEMVAAVMQEGLTRFTRDFTPQRG
145224411YP_001135089.1 acyl-CoA dehydrogenase domain-containing protein [Mycobacterium gilMTFSLELSSDLLDVQKWVHEFAADVVRPAAAEWDEREETPWPIIREAAKV
GLYSMEFFAEQAAEPSGLGMIVAFEEMFWGDAGIALAILGTGLAAASVAA
NGTPEQVGEWVPQMFGSVDDPKVAAFCSSEPNAGSDVGSILTRARYDEAT
DEWVLNGTKTWATNGGIANVHVVVASVYPELGTRGQVSFIIPPGTKGLSQ
GQKFLKHGIRASHTAEVVLDDVRIPGRMIVGGKERFDARIAKVREGKKAA
GQAAMATFERTRPTVGAMAVGVARAAFEYARDYACEREQFGRKIGEFQGV
AFKLADMKARIDAARLLVYRAGWMARNGKAFESAEGSMAKLVASETAVYV
TDEAIQILGGNGYTREYPVERMHRDAKIFTIFEGTSEIQRLVMARAITGL
PIR
145224410YP_001135088.1 hypothetical protein Mflv_3828 [Mycobacterium gilvum PYR-GCK]MSGHSKWATTKHKKAVIDARRGKNFAKLIKNIEVAARTGGGDPGGNPTLY
DAIQKAKKNSVPNDNIERARKRGAGEEAGGADWQNITYEGYGPNGVAILV
ECLTDNKNRAAGEVRVAMTRNGGNMADPGSVAYLFTRKGVVTLDKNGLSE
DDVLAAVLDAGAEDVNDLGDSFEIISEPTDLVAVRTALQDAGIEYDSAEA
SFQPSVSVPVDLDGARKVLKLVDALEDSDDVQDVYTNVDIPDDVAAQLDA
D
145224409YP_001135087.1 hypothetical protein Mflv_3827 [Mycobacterium gilvum PYR-GCK]MEKVEDSDGVQWRIRRWWWKTVPWETGFATLDAMIFLIVLPFMLMWPFWL
AAKWCGVSWTVLVECDGSEVARERVRGWRASGQRIAELAESARAGTLAPT
LESSES
145224408YP_001135086.1 Holliday junction resolvase [Mycobacterium gilvum PYR-GCK]MRGARVPARSRRSQKLSSRTNVHRKGAGVRVMGVDPGLTRCGLSVIESGR
GRQVIALDVDVVRTPSDHPLAHRLLAISNAVEHWLDTHRPDVIAIERVFS
NQNANTAMGTAQAGGVVALAAARRDIDVHFHTPSEVKAAVTGNGRADKAQ
VTEMVTRILALQQKPTPADAADALALAICHCWRAPMISRMAAAEEMAAEQ
RRKYQATLKAKTRQVSRSAR
145224407YP_001135085.1 Holliday junction DNA helicase RuvA [Mycobacterium gilvum PYR-GCK]MIASVRGEVLDIALDHVVIEAAGVGYKVMATPATLATLRRGSEARLITAM
IVREDSQTLYGFADSDARDLFLTLLGVSGIGPSIALGALAMYDGPTLRQA
IGDGDLTALTRIPKVGKKTAELLALTLRDKVGSSTSSGVAAAGGHGIRGP
VVEALVGLGFAVKQAEEATDKVLANDPEATTSSALRAALSMLGKK
145224406YP_001135084.1 Holliday junction DNA helicase RuvB [Mycobacterium gilvum PYR-GCK]MGRFSNADGPGDDADEREVTPALTVGEGDIDASLRPRSLGEFIGQPRVRE
QLQLVLEGAKNRGGTPDHILLSGPPGLGKTSLAMIIAAELGSSLRVTSGP
ALERAGDLAAMLSNLIEGDVLFIDEIHRIARPAEEMLYLAMEDFRVDVVV
GKGPGATSIPLEVAPFTLVGATTRSGALTGPLRDRFGFTAHMDFYEPAEL
ERVLARSAGILGIELGAEAGAEIARRSRGTPRIANRLLRRVRDYAEVRAD
GVITRDIAKYALEVYDVDELGLDRLDRAVLSALTRSFGGGPVGVSTLAVA
VGEEATTVEEVCEPFLVRAGMIARTPRGRVATAQAWKHLGMTPPAGAGGL
GQVGLFE
145224405YP_001135083.1 hypothetical protein Mflv_3823 [Mycobacterium gilvum PYR-GCK]MQLAGLIVAVLAAVLHGYIFVMESLTWTSPRTRAVFGLTAEEAEATRMLA
FNQGFYNLFLGIVTVVGVVFALTGDTAVGRALVFAGVGSMLAAAVVLLAS
SPEKARAAVTQGALPLVAIVLLVVGAVL
145224404YP_001135082.1 diguanylate cyclase [Mycobacterium gilvum PYR-GCK]MSRIRQRWAQPDHYHWLSGYLGDRNLQGFTRRMMGLINLVLAIVPALMVL
SPSGPDTGFGVAAGLVVSVLCALMAGVWFLHWPTRAESIAFSILSNISIA
VVALSWPDPLTGLLGCITFAALAGYVAFFHSSHYLVMVLATAAGVAIICT
ADITAGGDAYLAAVAFMMIAVAVLAVPFSAQVLVHLLGDDALHSHTDPLT
GLRNRRGFYRSVRRLLRAAPDRDLNFLTVAMIDLDRFKQINDTRGHATGD
RLLVSISGCLCHCARGEAVVGRVGGEEFLIAEATRDDDAEALAERLRLAI
ASTSWGITASVGVACRRLNGDADTRELLGDLIEAADSAMYEAKRSGGNQY
RRARESAA
145224403YP_001135081.1 hypothetical protein Mflv_3821 [Mycobacterium gilvum PYR-GCK]MADTTTRAGRGTMQIPRSRGAVSGLLIVALGVWGALIPFVGPLFDFAFSP
DRPWAWTAGRGWLQVLPGLVAVLGGLLLFASRNRATAMLGSWMAVAAGAW
FVVGRAVAGPLGLGNAGEPVAATEAHRVWLELTYFSGLGALIIFLAALAA
GRLSVRSVRDIAYRDSRAQTEDDPTVTDTSGWSQHGPAAGTGPDAVTEPV
GRRRRSLFGRRRRDSRDTLTV
145224402YP_001135080.1 hypothetical protein Mflv_3820 [Mycobacterium gilvum PYR-GCK]MNLPSHPLAELFSARLSCAPVDDAPAVVLGPRMVNVCTALGAPLRDWWQV
CEWASRLDDDRVRDTFGAYVDVLVADRCVRLGDDLVSELIVHEVDGDGLT
ADEIRTLLVDFVQAAAQPV
145224401YP_001135079.1 gamma-aminobutyraldehyde dehydrogenase [Mycobacterium gilvum PYR-GCMTTVKNFIGGELVDSTGGATMPLIDPSTGEQYGTAPVSNEQDIDNAYAAA
SGAFKEWKKTTPSQRQKALLDFADEVERNADALVAAEGRNTGKPNHVTTV
EEIPPMVDQIRFFAGAARVLEGKSAGEYMADHTSWIRREPVGVIGQVAPW
NYPMMMAIWKICPAVAAGNTVVIKPSDTTPVTTVMLAELAAKHLPPGVLN
VVTGDRVTGANLVSHPTPEMVAITGSVAAGKAVAVSAGGNLKRTHLELGG
KAPVIVFDDADLAATAEGIATAGYFNAGQDCTAATRVLASASIAADLTAA
LAEQAKGATTTFGRPADDEDAWVPPVNNVNQMERVLSFFSDIPSHATVAV
GGNRQGDKGFYVEPTVVGGLRQDDRLIQQEIFGPVITVQSFTDEDEAIGY
ANGVEYGLASSVWTKDVSRALRVSNALDFGCVWINTHIPLVAEMPHGGFK
SSGHGKDLSMYGLEDYTRIKHVMAYTG
145224400YP_001135078.1 4-aminobutyrate aminotransferase [Mycobacterium gilvum PYR-GCK]MSALEQSRHLATAIPGPRSVELASRKNTAVSRGVGTTMPVYAARAFGGIV
EDVDGNRLIDLGSGIAVTTVGNASPRVVAAVAEQAAEFTHTCFMVTPYEG
YVAVAEALNRLTPGDGDKRSALFNSGSEAVENAVKIARTFTRKQAVVSFD
HAYHGRTNLTMALTAKSMPYKHGFGPFAPEIYRAPMSYPFRDAEFGGKEL
ATDGELAARRAITVIDKQVGAGNLAAVIIEPIQGEGGFIVPAEGFLPTLL
DWCRANDVVFIADEVQTGFARTGAMFACEHEGPDGLVPDLIVTAKGIAGG
MPLSAVTGRADIMDAPHVSGLGGTYGGNPVACAAALATIETIESDNLVAR
AAQIEALMKDRLGRMQAEDDRIGDVRGRGAMIAVELVKSGTLEPDPELTR
KLLTAAHAAGVIVLSCGTFGNVLRFLPPLAISDDLLLEGLDILELILRDL
145224399YP_001135077.1 preprotein translocase subunit YajC [Mycobacterium gilvum PYR-GCK]MDLVVFLPLLIIMGAFMYFASRRQKKAMQATIDLHNSLEIGDRIHTTSGL
QGTITGIGDDYVDVEIAPGVVTTWMKLAVRDRIVDDVEDDAELDDESAVE
ITERPNLNKD
145224398YP_001135076.1 preprotein translocase subunit SecD [Mycobacterium gilvum PYR-GCK]MASSSTVHPARYLALFLVLLIGAFLLVFFTGDKKPDPKLGIDLQGGTRVT
LTARTPDGSEPSRDALLQAQQIISARVDGLGVSGSEVIIDGNNLVITVPG
DDTSEARSLGQTARLYIRPVVHAIPAGEGAAPGGAPEGMPPGAIPGMPGG
VPGMPPGAIPGMPPGAIPGMPGDAMPGMPEGAMPLPPGALQGGPGGPGEP
VAPAPQPRPFPQQPAPSPAPEPPADPAAPIPPGTPAGPGGMPADDENLSL
ADQIKQEKLRRQSSDQMIQILAMQLQASQCGQEDVLAGNDDPNLPLITCS
QDGTTVYLLDKSIIAGEEIANATSGLNQQAGEYVVDLEFKDQGSKTWAEF
TAANVGVQTAFVLDSKVVSAPVINEPIPGGKTQITGQFTQDTARELANVL
KYGSLPLSFESSEAETVSATLGLSSLRAGLIAGAVGLAAVLLYSLLYYRA
LGVLIALSLVASGAMVFAILVLLGRYINYTLDLAGIAGLIIGIGMTADSF
VVFFERIKDEIREGRSFRSAVPRGWARARKTILSGNAVTFLAAAVLYFLA
VGQVKGFAFTLGLTTILDVVVVFLVTWPLVYLASKSPLWAKPSLNGLGAV
QQIARERRAAATAAGRG
145224397YP_001135075.1 preprotein translocase subunit SecF [Mycobacterium gilvum PYR-GCK]MATGNRTDVESGAVEAADLEAASINAPKHGFFVRLYTGTGAFEVVGKRKL
WYTVSALIVAVSIGAMILRGFTFGIDFEGGTKVSFPRSDTQATTQQVETV
FNDTIGSPPEAVVIVGSGDSATFQIRSETLTNDEIIELRTALFDAFQPVG
PDGQPSEQAVSDSAVSETWGGQITQKALIALVVFLILAAIYITVRYEWSM
ALAALATLVFDLVVTAGVYALVGFEVTPATVIGLLTILGFSLYDTVIVFD
KVEENTDGFEHTTRRTYAEQANLAVNQTFMRSINTSVISVLPIIALMVIA
VWLLGVGTLMDLALVQLVGVIVGTYSSIYFATPLLVSLRERTEAVRKHNR
RVHNRRQTAAAKAAGVEVDDEISESATKSEAVAAAVAAQTAPADKPAPGA
RPVRPTSSRTGRPSGKRTPRNR
145224396YP_001135074.1 extracellular solute-binding protein [Mycobacterium gilvum PYR-GCK]MAGRWRALTAVLAVVGGLGLTSCGEATADSVDYAVDGVLTSYNTNTVVGA
ASAGPQAFARVLTGFSYHGPEGQIVGDHDFGTISVVGRTPLILDYEIKPE
AVYSDGKPITCDDMVLAWASQSGRFPAFDAASRSGYADIAAIECAPGQKK
ARVSFAPERAFTDYGQLFTATSMMPSHVVGDVLGLGDGAVTTALLNNDIP
AAERIAQVWNTTWNLGPDLDLKKFPSSGPYKLDSVTADGAVVLVANDKWW
GAKPVTDRVTVWPRSPDIQDRVNEGAYDVVDIAAGSSGTLNVPDDYVRTD
APSAGIEQLIFAPEGALAAVPARRALAFCTPRDVIARNAEVPVVNARLTT
ATEDAIGSAELTPQINEFAVANPDAARQALGNTPLTVRIGYQTPNARLAA
TVGTIAKACAPAGITVQDAANADTGPTALRDNQIDVLIASTGGAAGSGSS
GSSAVDAYTLHSGNGNNLPRYANGRIDAIISTLAVTTDPKEFARLLGEAG
PILWADMPTLPLYRQQRTLLTSTKMSAVIGNPTRWGAGWNMDRWKLSR
145224395YP_001135073.1 adenine phosphoribosyltransferase [Mycobacterium gilvum PYR-GCK]MSGEPGTDIAEVIRSLMREVPDFPEPGVHFKDLTPVLADAYGLAEVSRAI
ADSARGADLVAGVDARGFLLGGAVAVTLGIGVLAVRKGGKLPPPVLGETY
TLEYGSATLEVPADGVELAGRSVVVIDDVLATGGTLAAAHQLLTKAGANV
TGAVVMMELTALGGRAAVDPLEVTSLYSV
145224394YP_001135072.1 (p)ppGpp synthetase I SpoT/RelA [Mycobacterium gilvum PYR-GCK]MADKVRTDPGSGQAVQTPPPAASASPETQPMEIVKPAPTSASRRVRARLA
RRMTSQRSTVNPVLEPLVAVHREIYPKADLTLLQKAYEVAEQRHADQLRK
SGDPYITHPLAVANILAELGMDTTTLIAALLHDTVEDTGYTLEALTQEFG
VEVGHLVDGVTKLDKVALGTAAEGETIRKMIIAMARDPRVLVIKVADRLH
NMRTMRFLPPEKQARKARETLEVIAPLAHRLGMATVKWELEDLSFAILHP
KKYEEIVRLVADRAPSRDTYLAKVRAEITATLNASKIKATVEGRPKHYWS
IYQKMIVKGRDFDDIHDLVGVRILCDEVRDCYAAVGVVHSLWQPIAGRFK
DYIAQPRFGVYQSLHTTVVGPEGKPLEVQIRTIDMHKTAEYGIAAHWRYK
EVKGRNGVPAGSAATEIDDMAWMRQLLDWQREAADPGEFLESLRYDLAVQ
EIFVFTPKGDVITLPTGSTPVDFAYAVHTEVGHRCIGARVNGRLVALERK
LENGEVVEVFTSKAQNAGPSRDWQGFVVSPRAKAKIRQWFAKERREEALD
SGKEAIAREVRRGGLPLQRLMNAETMAALARELRYLDVSALYTAVGEGHV
SARHVVQRLVAQLGGDDEAADELAERSTPATMPIRQRTSDDVGVAVPGAP
GVLTKLAKCCTPVPGDNILGFVTRGGGVSVHRTDCTNAASLEQQSERIID
VQWAPSPSSVFLVAIQVEALDRHRLLSDVTRVLADEKVNILSASVTTSND
RVAISRFTFEMGDPKHLGHVLNVVRNVEGVYDVYRVTSAA
145224393YP_001135071.1 cyclophilin type peptidyl-prolyl cis-trans isomerase [MycobacteriumMPTNEQRRATAKRKLERQLEHRAERERKRRQYTIIGSAVGGVLVVAAVVA
TIVLVNRDSGTETASASTSTTETSSPFDVPPPAEAVTLPEFVAPEGLGGN
CQYPEAEPASKPNNAPRTGKVPTEPAQVSASMETDQGNIGLQLDNGKSPC
TVNSFASLAQQGYFANTPCHRLTTSDSLGVLQCGDPTGEGTGGPGYQFDN
EYPTDQYQPDDPKLGEPVVYPRGTLAMANAGPGTNGSQFFLVYKDSQLPP
QYTVFGTIDETGLETLDKIAEAGVDGGGPDGAPKLPVTVKNIQLD
145224392YP_001135070.1 beta-lactamase domain-containing protein [Mycobacterium gilvum PYR-MLITGFPAGLLACNCYVLAPRQGADAIVVDPGQRAMGSLARILDENRLTP
AAVLLTHGHIDHMWSAQKVADTYGCPTFVHPADRHMLTDPIAGLGQGFLA
GLGRLALSPVFREPRQVLELDRDGDKIELGGITVTVDHTPGHTKGSVVFR
VEQGPDQVAFTGDTLFRASVGRTDLPGGSGRDLLESIVTKLLVLDDDTLV
LPGHGARSTIGVERHTNPFLEGLKP
145224391YP_001135069.1 histidyl-tRNA synthetase [Mycobacterium gilvum PYR-GCK]MTDSFKAPKGVPDYFPPDSAEFVAVRSGLLTAARRAGYGDIELPIFEDTA
LFARGVGESTDVVSKEMYTFADRGERSVTLRPEGTAGVMRAVIEHGLDRG
QLPVKLCYSGPFFRYERPQAGRYRQLQQVGIEAIGVDDPALDAEVMAVAD
AGFRSLGLDGFRLEITSLGDDSCRPQYRELLQEFLFKLDLDEETRQRAQL
NPLRVLDDKRPHVREMTANAPVMLDHLSDAAKEHFDTVLAHLDALSVPYV
INPRMVRGLDYYTKTTFEFVHDGLGAQSGIGGGGRYDGLMAQLGGRDLSG
IGFGLGVDRTLLALRAEGKAAGETARVDVYAVPLGADAKVRLAVLAAQLR
AAGVRVDVAYGDRSLKGAMKGADRSGASIALVAGDRDLEAGTVGVKSMAT
GEQVDVASDDVVAEVLSRLT
145224390YP_001135068.1 hypothetical protein Mflv_3808 [Mycobacterium gilvum PYR-GCK]MRMRLLIGGLGIVALLVGIVGLIAPVSVSAEGKVVGCGSVIAPDLSAARA
NDDAGAANTPVPGGLVNDANFTRLCDMDLEDRQLWTITSGALGALIIAAA
VAHGITSRRAGSTR
145224389YP_001135067.1 hypothetical protein Mflv_3807 [Mycobacterium gilvum PYR-GCK]MDVRPATWVPRHPVRFGAVAALMTVPLVTVACSTAYEALGHRTAYVLVNG
IEVADQPRVRCDQVEWVWFIESVQDNPGFSAQIRTGDDVAALLVRIENLG
GFTGSSWNAAETAPASAAAVEADAEVADGDFVITGTATGFYRDDPAETAT
ATFEIRTDC
145224388YP_001135066.1 hypothetical protein Mflv_3806 [Mycobacterium gilvum PYR-GCK]MPSEKLSKSGSALAVSVALLTSTVGCADDPLPESSNRGSGSDTVDTSVEN
AYIVPTYVPGRCAVQLNAGGALRFTLTNNRPAETERLLGISTSAAEQARV
IRDVVIPPKSTVSFGEPNAEPGVDDASAPAVVLDRLDPDLVPATSTDVTF
RFERAGEVTLPVPVEACPVQQP
145224387YP_001135065.1 FliA/WhiG family RNA polymerase sigma factor [Mycobacterium gilvum MPYPGRRSADCPQKPPIASAIQREAAMTVVERIGNTELTGAGTGAARDLD
WMDVEKQLSSMAACGDRAERRRRRQHIITECLPLADHIACRFAGRGEPSD
DLIQVARIGLVKSVDRYVPDKGRFMAFAVPTIRGEVRRHFRDSTWSMRVP
RKIQDTQLRMRHAAEELSQRLKRAPTDREIARELGVDDGEVSRCHSAHWA
YRPVSLDAPRGDAEQECAGIGELRGADDPGFDSVEDLIVLSGVIAELDPR
RRAILGMRFYDCLTQREIALRLNVSQVQVSRLLDSTLARLRQRMFVEVAA
V
145224386YP_001135064.1 hypothetical protein Mflv_3804 [Mycobacterium gilvum PYR-GCK]MSRDRGGDRDRPWLLEAVRRRRTVFVDAWRSRLWPVPALGVVFAIVAGVA
LPELDAALDKRMPETLSAYLFGGGADAAREVLGAIATSLITVTSLTFSLT
VVTLQLASTQYTPRLLRTFAADPFVQRTLALFLATFVYALTVLRTVRNDA
DAGAEFVPQLSVTVAYLLAMVSVLALVLFLGHLVRQIRIETMLDHVSSDI
ETTARRMLKRLDDTPDHDYTPFPPTDASVVTARSSGFLVEVDEQALFAAA
VEADVVVWIDRPVGSDIVSGVPAALCWSTGPPGDPLSGERLSRLREQVRG
ALSTGLERTAAQDIGYGLRQLTDVVVRALSPGINDPTTAVHGLNSCSATL
CELARYRLGRRTLRDDDGVVRVVLARPDLPDLLDMVCDQPQLYGASDPTV
LARLVSMLRELAWVVVVPAHREALSDRLRRMERVVAEQDFDSTDRDRLDR
LINHVREALDRRWPAT
145224385YP_001135063.1 hypothetical protein Mflv_3803 [Mycobacterium gilvum PYR-GCK]MAAASPRKSRRTPGRHRKPSNHAHWLRVGAVGFGLAAAIISGQGVATADT
DDSSGSGESSATARGKQAAVADRPSASEQSESPSSPDSDNDGVGTDDETT
DDTDTDTGAESPDVEVDEQDQDPQPDTVEEPDEDTSEVTVDESDGSRTHQ
KPVVTETTPPAEASPPSTPADGTDAPQPETAPPATGGNKADPGTTPAPSS
PGGSTGGPSTAAPDDEAATPETEAETEAAYLLNFVKELVKVFGGATTDGG
GTAPPMSWDKVLQGLFLGRKDQETRNATRELIELANEKTLAELGTSIGWV
PFVGTGLYGASFVGNLGALISAVLRGDSADIADEFRDLGRDVVGMVPVVG
APTAAKLYAGGSDAVGASAQMSAQLSAQMTAMATATPPPPVGTQAHFLWV
LQRAVNRLAGWPGPAGQNFVDITNRVTDQTLDNADNQLDILIANAFAGSP
AVWLPDLGRVLGLFVLTAIPGYSYTDSLNAWGSFLNKIMPPYKIADGAGT
LDVISNYKITGAAVVGAATLLRDMLNGIYDPVQWEINIIKTTTGATVTAS
DLNDFNTIMTKVAAAQAGAILIGGDGGAFDDPTRAWNVTLPTWTEAQVNP
YTITTYVALVAIYKRFQEMATLTTFTTWTTYDSWHYTNALGMYAAGTFHA
VDPDGGSIEFRADGTLGRTYTTEGNALVTINTVGGGFTYTPPALWDPQAQ
GAAFRHRSTAEDPEERFDWVTVDAYSADGVPYSLRMGIEIIDGTNAVPVY
TGVTGQSTDALGVVKGKLNATDSDGDPIRYYLVESSVNGLNGNSAYTKNG
AGNGGIVTVNENGDFTYVSSATAGATQSFQVRVNDAHHGNTIVTVTVPNT
TSITPGNVNTSTPYVVTGTVPASTNKPGAFTSYTLVGGTTKGTVTSFNPV
TGAFTYTSSVGRVLDNDDVITVIGTDADGRSVTLRLNVKPTTVTVAPTLT
LTTAPTVGTLVGTTQTSTGKFTYFDADGDAPIWPTSVTSSRGGTVTVAAD
GTFTYTSNLTVAQRHAVARIGAAGSTFNGVALAAWEDAFAMTVSDGFGGT
ATQTVKVPIYAINANPTLGLGGLACGFGTCTITITTTDPDGDDLSGSLNT
SNNGQGDPWYTLERGSVTINAGNQHTMSWTGNSGGLGTQQTGVQRYTVYD
GYYRVTNGVVDSSYFARAWVNWNNTTRTTGN
145224384YP_001135062.1 ABC transporter-like protein [Mycobacterium gilvum PYR-GCK]MLQLIDVRTGYGRSEVIHGVSIEVPTDGVAAVMGHNGAGKTTLLRAAVGL
LKCTAGKVLFGGEDITRLRPSARVHRGLAYVPQGQQSFGQLTTAENLQVV
ADGRKNGKALIDEQLDLFPALKELLTRRAGLLSGGQRQQLAIARALITTP
KCLILDEPTEGIQPSVVHEIEEAITALTNRGDLGVLLVEQHIGFALESAQ
RYYILEAGRVTSSGTGGSASEADVRAAMAI
145224383YP_001135061.1 ABC transporter-like protein [Mycobacterium gilvum PYR-GCK]MSDVQASIAAKEPAEGGNAGMGAQYLEVRGLTVDFDGFKAVSDVDLTLFQ
GDLRFLIGPNGAGKTTVIDAITGLVSASGSVNKSGVELLGKKVNQIARLG
VGRTFQTASVFEQLTVLQNLDIAAGAGRSVWTLLRRRNGVLPAIEQALHT
TGLTHLADKPAGVLAHGQKQWLEIGMLLVQNADVLLLDEPVAGMSAEERE
ETGNLLRRIGAERTVVVVEHDMDFMRAFATSVTVLARGQVIAEGSVAEVQ
ANPRVQEVYLGTAAAGADGIELVEENS
145224382YP_001135060.1 inner-membrane translocator [Mycobacterium gilvum PYR-GCK]MRALLGRWQTWAGFGVAALVLFVLAPAILSDFRLSLLGKFLCFAIVAVGI
GLAWGRGGMLVLGQGVFFGLGGYMMAMHLKIADAQLRGDDVPDFMQIQGI
RELPSYWTPFASPAVTLIAIVVIPTGIAVVLGLGVFKRKVKGAYFAILSQ
ALAAALAILLVGQTSLGGSNGLNRFRTFFGFTLNDPANRRMLYFIAAAVL
LLVVAVVRQLMQSRYGELLVAVRDGEERVRFLGYDPANIKVVAYAVAALF
ASIAGALFAPIVGFIAPSQVGILPSIAFLIGVAIGGRATLLGPVLGAIGV
AWAQTLFSERFPSAWTYGQGLLFILVVGFLPAGLAGLGVFLKRRRKAEAD
TEPDKASDTDPDAEKVGASS
145224381YP_001135059.1 inner-membrane translocator [Mycobacterium gilvum PYR-GCK]MDVVIGQLATGLSLGSILLLAALGLSLTFGQMGVINMAHGEFIMAGCYTA
YVVQQVVSNAGVSLILSLVIGFLVGGAMGALLEVTLIQRMYHRPLDTLLV
TFGVGLILQQVARDIFGAPAVNVIAPVWLSGGVEIFGAVVPKTRIFILVL
AIACVAVLAAVLKVSPMGRRIRAVVQNRDLAETSGISSRKTDITTFFIGS
GLAAVAGVALTLIGSTSPTIGQSYLIDAFLVVVIGGLGQIKGTVIAAFAL
GFLNSFIEYNTTASLAKVIVFVIIVIVLQVRPQGLFTVRTRSLV
145224380YP_001135058.1 extracellular ligand-binding receptor [Mycobacterium gilvum PYR-GCKMAVASLLLAGCGSKASETDSANAESCVDTSGSSIKVGALNSLSGTMAISE
VTVRNAIDLAVEQINASGGVLGKQIQLVSEDGASEPTVFAEKAEKLISSD
CVAAVFGGWTSSSRKAMLPVFESANSLLYYPVQYEGLESSPNIFYTGATT
NQQIVPALDYLKEKGVTSLYLVGSDYVFPQTANRIIKAYAEANGIEIKGE
DYTPLGSTDFSTIINKVRSADADAVFNTLNGDSNVAFFREYKNVGLTPQD
MPVVSVSIAEEEVGGIGVQNIDGQLTAWDYYQTIDTPVNNEFVKAYKDKF
GADKPTSDPMEAAYVSVYLWKNTVEKAQSFDVKAIQDNADGVTFDAPEGL
VTIDGDNHHITKTARIGEIRPDGLIYTVWESPAPIEPDPFLKSYPWAAGL
SG
145224379YP_001135057.1 hypothetical protein Mflv_3797 [Mycobacterium gilvum PYR-GCK]MRTATAKVGTAVGASLLAAATSMMIGQPAASAQDAHQVRYTLTSAGAYEF
DLFYLTTQPPSMQAFNADAYAYAKREKVNLAPGVPWTFETTMADPNWAIL
QVSSTTRGGQAAPNAHCDIAVDGEIRTEHNDPYNVRCQLGQW
145224378YP_001135056.1 putative helicase [Mycobacterium gilvum PYR-GCK]MSTHHPSHYEAELQSEQAYVNDLYSRLDTERARVKARYSAALRGDVDTQN
GATLLARDAEVRATAAQMDRLNVADAGLCFGRLDGVDGEHLYIGRIGVLD
DTHDHEPLLLDWRAPAARAFYTATGANPEGMRRRRQFHSLGRRLLDFTDE
VFGRPRDGDAGDQPGDSSDAALLAAVDAPRGEGMRDIVATIQAEQDAIIR
LDHPGVLVIEGGPGTGKTVVALHRVAYLLYTQRKRMESHGVLVVGPNSAF
LRHIGRVLPSLGETNVVFTTTGDLFPGLRATAEDDPAAATAKGSLAMLDV
LAAAVADRQRVPEEPLPIDLSDVSISIGPDIAQWAVQEARATEQPHNDAR
ATFVDVLTWALSERAIAKIGRGWLTRDDRAAWEHLRADLLDELEDHAAFK
AALDLLWPVLTPETVLAELYSSHERLRAAGADPVLYREDGAAWTLSDIPL
LDELVDLLGRDKSGEEAAEWERQEEAAYAAGVLDLMIGREDLMDDEDQLM
AQDVIAAEDLAERFLERDTRELAERAAADRDWTYGHIVVDEAQELSEMDW
RVLMRRCPSRSFTIVGDLAQRRSPAGTTSWDEMLKTYVPDRWVYRTLTVN
YRTPAEIMIVAAAVLADFSPDVVPPESVRSTGVAPWARQVSDAELPSAIA
DFVRDEDNRDGTHVVIGPSDIPGAVLPTETKGLEFDAVLVVHPERILAEG
SRGAADLYVALTRATQRLGVLHRDPLPPALAGLGQ
145224377YP_001135055.1 radical SAM domain-containing protein [Mycobacterium gilvum PYR-GCKMRWAGQGVAVDDGALPGLQRLGLVRSVRTPQFDGITFHEVLCKTALNKIP
AASMLPFRFTVNGYRGCSHACRYCFARPTHEYLEFDPGRDFDTQVVVKTN
VAEVLRRELRRPSWSRETVALGTNTDPYQRAEGRYALMPGIIGALTDFGT
PFSILTKGTLLRRDLPLLTDASRRVDVSVAVSLAVGDPDLHGRLEPGTPT
PEARLSLISAIREAGLRCHVMVAPVLPGLTDSDDHLDDLLGRIAGAGATS
ATVFGLHLRGSTRGWFMDWLAEAYPDLVGEYRRLYRRGAYLPAEYRADLA
CRAAPLLARHGLARAPRFAAPLPGAGPVDAAPELQPTLF
145224376YP_001135054.1 acyl-CoA dehydrogenase domain-containing protein [Mycobacterium gilMTETMTSTESTGTVETVEQFAARARTWLAENMPSIDPDNPPFSVRADQES
WDRAKELQKRLYEGGFAGICFPREYGGLGLDYAYQRAFNAECRSYEMPLI
LNVPTFTICAATILDMGTEDQKRDRISAAVRGDEILCQLLSEPSGGSDLA
GVITRADKQGDTWIINGAKTWSTSAFAADYGLLLARTDWTVPKHEGLTMF
LVPLDSPGITMRRIKEVNGNEEFCEEFFDGLELGADAVVGEVNKGWEVAT
RQLHHERRAVGGGSEFASGTAAENASEMPPDHVGLAEATGQSDNPLVQDL
AGRALVRRIVKEQLIDHVFRSITDGSLPPNAGTLIRLFHAETTELEVDTA
LAIAGTAGVIDEGSDDAPELSGLLEIGVRYLSRQTGSLGGGSSEMARNVI
GERILGFPRELAADKGIPFNEVKRNKS
145224375YP_001135053.1 acyl-CoA dehydrogenase domain-containing protein [Mycobacterium gilMTSPNPEQLLFASTTTTFLEKQASLTHVRGLHASEVSFQPEWWQRAAELG
WASLLVPEELGGGSVSGDGVADLAIVAEQIGHTVAPGPLHPVSAVLAALV
EAPNGHEQTIEALVSGELVASWAVYEPRRPFAPSQAATTATRTDRGYRID
GVKDRVEAGAESGALVVVAELDGVVRQFVVPTDADGVTVTPQSSVDLVKR
YARVQFDAVEVDESAVVGTADQTPAIIERQRQIVLVLQCAEIVGILDAVL
AMTNQWLFDRHSFGRPLASYQALKHRAADMKMWFEAARGTTAGAVRAVGN
RSPDAELLVSVAKAYVAERAPVMLQDCVQLHGGIGVTWEHDLHLYLRRVA
LYRAMFGSPEDHHRAVYARSSAQEATA
145224374YP_001135052.1 amidohydrolase 2 [Mycobacterium gilvum PYR-GCK]MPSRSLDYPVFDADNHFYEPKEALTQFLPDHRKGVIDYIDVHGRTKIVVR
NHISDYIPNPTFEVVARPGAQEEYFKHGSGGKSFREVMGKPMKAIPAFRN
PEARLEVLDGLGLDYTIMFPTLASLVEERMKDDPDLILDIVHALNQWMYE
TWQFDYQGRILSTPVINLSVVDRALEELQWCLERGARTVLVRPAPVPGYR
GSRSLGLPEFDPFWDACVQAGIPVCMHASDSGYAQYLNDWEPADEFLPFR
PTAFRMVAMGKRPIEDTMAALVCHGALTRNPDLRILSIENGASWVPYLFY
QFEDVYKKMPQEFPENPIDAFRRGVYVAPFWEDDFGKMADLLGIDRVIFG
SDWPHPEGLADPITLVDQLEENGLDEDGIRKVMGGNLVDLFKVPNKVVHK
PDAPALVIA
145224373YP_001135051.1 TetR family transcriptional regulator [Mycobacterium gilvum PYR-GCKMSAKAQPDPTVRQDPAVRQDRAQSRAGRFMRSALDILGETGRTDFTVLEV
VERSKTSLRAFYQHFSTKDELLLALVEKIMAEATERWRAETEQLAGPDAL
RVLIDRISAPAQSSTQDSINRGLTYYNDHLLETRPKEFATVLAPLHRLLG
DILRRGIAEGSFRADLDVDTDAAILMQTVLGTLRLRELGADLNGIPIEGS
HVHTFCLRGLTPP
145224372YP_001135050.1 hypothetical protein Mflv_3790 [Mycobacterium gilvum PYR-GCK]MAEAQWTVQGLLDLFDAEPTGDNMFTVQTGPAGEDERQVVEGTQILAASI
VAAAKRFPDKSIRSVYTVFARAVMVAAGPVELEIDVVSEGRSTATAVVTA
KQNGKRCITTTVLADVPTGDVIRHHLPKPEVAGPAEAHLSPMPMAGRELR
LVDVVDVNSPDEVGPPELYAWLHYDPIPDRDDLAKALIAYFTGHLGISTT
MRAHEGIGTAQAHLTVSTAPMTVSVSFHEPVTWGGWLLYTHESTQVGSGM
SYVRGAVHTEEGELIASFTQDALIRPLRTTDTAIKEQSRL
145224371YP_001135049.1 hypothetical protein Mflv_3789 [Mycobacterium gilvum PYR-GCK]MGRAATAVDAVAERYLETSAALDPCAATESGIAGHDDQITDYSPDGVRER
AEAARAALRELDGTAPVDDVDVVTIAAMRERLGVLVDLHDAGLDVGELNV
IASPLQTMRDVFDLMATDSEDDWTVYSARLAQIPQRVAGYADSLRSAAAS
GRAPAARQVRRGIQQAGQIAELFVEMVAGAPAENSTLQAELQQRAQDAAN
AYASLTTVLRDEVGPHARDTDGCGRDAYALLSRTFLGAAVDFDEIYEWGL
DLLSRIVAEQDDIADKLYPGASAAEALRRLDGEERYLVHGTDALQEWMQQ
LSDRVVDALADKHFDIDPALRNLECRIAPTQTGGIYYTGPSEDLTRPGRM
WWSVPPGVHTFHTWQEMTTVFHEGVPGHHLQIGRAVVLADQLNRWRRLGC
WVSGHGEGWALYAERLMAELGWLEDAGNRMGMLDAQRFRAARVVIDIGVH
CGLTAPDGGVWDADRAWTFLQTHSAMAEENLRFELDRYLGWPGQAPSYAI
GQRIWQQLRDQTPARGVSLKDFHSRALDLGGLPLEVLQSALAAG
145224370YP_001135048.1 hypothetical protein Mflv_3788 [Mycobacterium gilvum PYR-GCK]MRSWTSPGTSVGRVDSTHSDGGGAMTFNEGMRIDTSTTSTSSGGRGPGRG
IAVGGGLGGLLIVVVALFLGVDPSSVVPQQTDTQGVEAPGFDLSQCRTGA
DANEIVQCRVVATGNSLDGVWAQLMPDYTRPRVEIFTNGVQTEGCGPASS
EVGPFYCPVDQTAYFDTGFFDVLKTQFGSSGGPFAEEYVVAHEFGHHVQN
LQGVLGRAQQDPTGPTGGGVRTELQADCYAGVWAHYAAITKQEGTDVPFL
EPLTDQQIADALSAAAAVGDDRIQETATGRVNPESWTHGSSEQRQKWFTT
GYQTGDPARCDTFATNNLG
145224369YP_001135047.1 type B carboxylesterase [Mycobacterium gilvum PYR-GCK]MAIVDGDSTLVSTPSGDLRGDIDGGVGVWRGVPYAEQPVGLRRFLAPAEL
APWMGVRDAVEHGPLPPQTKSFVGGGRDDPKARDEACLTLTVWSPDTTGS
LPVMVWIPGGAFVYGAGQFQLYNGSRLAANGDVVVVNVTYRIGVFGGFEL
SDLGEGFDDNLALRDQIAALRWVRDNIAAFGGDPGRVTVFGESAGATSVL
ALMAAPSATGLFGRAIAQSPALPLIADRHLRAANAQEFLRRLGVDAAEVK
TLPQRQLRRAAGLVQLTSAATTPTLAYGLTTGTDLLPLHPLDAARQGRMS
SVPLIVGTNSHEASMFAWTKPPMLPTTRESIDGFFERTAPHAKRQVLQAY
PGYPRRSALVAIGADAMFGGPTWAFADAYSAHAPTRMYRFDHFGMSLRML
GLGATHGSEIVHIHHSYASFVGRKLHPLGRRIQPGVGRRMQRSWLDFARD
NAEVDEGHWPLYEIGARLTRLITSTRDVMASDPDRDRREAWAQVYQPPKR
SSV
145224368YP_001135046.1 hypothetical protein Mflv_3786 [Mycobacterium gilvum PYR-GCK]MHSCERVGLDFIDSAPYRFVSTVDLAITPEQLFEVLADETSWPHWATVIT
DVTWTTPEPRGVGTTRTVQMRGGITGDEVFLAWEPFSRMAFRFNAASTRS
ISAFAEDYRVVPTQNGCHLTWIMALQPNGVAGRAGLFLGRPVMARMFQKF
LHNLRDYTDERFGG
145224367YP_001135045.1 aspartyl-tRNA synthetase [Mycobacterium gilvum PYR-GCK]MLRTRTAGSLRPADAGQTVTLAGWVARRRDHGGVIFIDLRDASGVSQVVF
RDGAVLEQAHRLRSEFCVAVTGVVEIRPEGNANADIPTGEVEVNATSLTV
LGESAALPFQLDETAGEEARLKYRYLDLRREVPGNAIRLRSKVNAAARGV
LAGHDFVEIETPTLTRSTPEGARDFLVPARLQPGSFYALPQSPQLFKQLL
MVAGMERYYQIARCYRDEDFRADRQPEFTQLDMEMSFVDADDVMALSEEV
LRAVWATIGYDLPLPLPRISYADAMRRFGSDKPDLRFGLELVECTEYFAD
TPFRVFQAPYVGAVVMPGGASQPRRTLDGWQEFAKQRGHKGLAYVLVGKD
GELTGPVAKNLTDAERAGLTAHVGANPGDCVFFAAGTAKSARALLGATRI
EVAKRLDLIDPDAWAFTWVVDWPMFESAAEATASGDVAVGSGAWTAMHHA
FTAPTPESEATFDTDPGSALSNAYDIVCNGNEIGGGSLRIHRRDVQERVF
AMMGISQEEAEDKFGFLLEAFTFGAPPHGGIAFGWDRIVALLAGLDSIRE
VIAFPKSGGGVDPLTEAPAPITAQQRKESGIDAKPGKDGA
145224366YP_001135044.1 hypothetical protein Mflv_3784 [Mycobacterium gilvum PYR-GCK]MQPESAPATDATSETPRSSRALNATVLTTLAVVIAVYVGALVGYRLLETP
PQPFEFTESSVIGETAVILRLGKMETVENKLTLDVLVHPDRDLLASGPEA
AANPVVRLSSWTQDGDLIHMHDDLKSNASTVELTAVGDPDHWPLDTYVSN
TIGVEVFYGEGPNRRSVPAVIVVAGAINGWDVDSDMGVLDAPWGPVPSVS
FHLERTRGAHAVDFGILLVLMVLPGTALFVAIEMLLNRRKFLPPFITWYA
AMLFAVVPLRNILPGAPPTGAWIDVAVILWVLLALSAAMVVFLAAWWRQT
RAEEHPVPKPDPDPSAPKAGTMKQ
145224365YP_001135043.1 hypothetical protein Mflv_3783 [Mycobacterium gilvum PYR-GCK]MTADDKDKLIADTAALDEFNRAIVEEFRANGGKVGGPFEGATLLLLHTTG
AKSGKTRLSPLAYLTIDGRMIIVGSYAGAPRHPAWVHNVRAHPRAFIEIG
TDAYDVDVRELPDGERDAMYPKLVELAPAFGEYQAKTTRVIPLFELTRAE
145224364YP_001135042.1 acetyl-CoA acetyltransferase [Mycobacterium gilvum PYR-GCK]MAAHSDRDAVIVGAVRTPVGKGKAGGALHGVLPADLLAHSLRELVGRTGV
DPAEVDDVIAGAVTQVGDQAVNIARNALLGAGFPESVPGTTVDRQCGSSQ
QAISFAAQGVLSGAYDVVIAAGVESMSRVPMGSSVLPGSNPFGRDMAGRY
PEGLVSQGISAELIAAKWNLSRARLDEFSAESHQKAARATKDGLFDNELA
PIAGLEYDEIIRPDTTVETLAGLRPAFFDDAIGARFPQIGWEITPGNSSP
LSDGSAAVMITSGAAARRLGLRPLARIHTTVVVGSDPLYMLTGVIPATEK
ALARSGLTLSDIDLFEVNEAFAPVVLSWAADVGGGDGADVLSRTNVHGGA
IAIGHPLGASGARIMTTLVNALEQRAGRYGLQTMCEGGGMANATIIERL
145224363YP_001135041.1 HxlR family transcriptional regulator [Mycobacterium gilvum PYR-GCKMTVLQGPLADRSAWSAVGRCPIEKTMALVGTRSAMLLMREAYYGTTRFDD
FSRRVGITKAATSARLAELTEAGLLTKRPYREPGQRVRDEYVLTEAGTEF
MPVVWAMFEWGRKHLDDTSLRLTHLGCGADASVDIVCDKGHSVPPDELGM
RLVRRNRSADGG
145224362YP_001135040.1 photosystem I assembly BtpA [Mycobacterium gilvum PYR-GCK]MTTTWLDEVFNVTKPVIAMLHLSALPGDPGYDSAGGIAAVVNRARTELEA
LQSGGVDAVMISNEFSLPYLTKTEPITAITMARIIGELLPDISVPYGVNV
LWDARASIDLAVATGAKFVREIFTGVYASDFGLWDTNVGEVARHRARVGG
AGVKLLYNIVPESATYLADRDLASITRTTVFATAPDGICVSGATAGSPTD
TDALRVVKSAAGDVPVFVNTGVRAENVADQLSVADGAVVGTYFKKDGLFA
NAAEKSRVEELMGAARDFRATLG
145224361YP_001135039.1 short-chain dehydrogenase/reductase SDR [Mycobacterium gilvum PYR-GMTRTVVVTGAGSGIGRAIASTLAQRDWRVVVTDVNGEAARSVAAELPNPS
AGHESAPLDVTSPDAAAAVASDIAERFGLDAWVSNAGISFMHRFLDAPIE
RFDQTMDVNLKGVFVCGQAAAREMVRSGVPGVIVNTASMAGKQGRVPFLA
DYVASKFGVVGLTQAMAYELGEHGITVNCVCPGFVETPMQSRELEWEAEL
RGTTPDGVRAMMIADTPLGRLEQADDVARAVAFLLSDDARFITGEALAVN
GGAYMD
145224360YP_001135038.1 ABC transporter-like protein [Mycobacterium gilvum PYR-GCK]MATVRFSGVTKAYGSTSVVSDLDLELPDGSLSVLVGPSGCGKSTTLRMLA
GLETVTSGTITIGDRDVTHLQPRDRDIAMVFQNYALYPHLTVAENIAFPL
RANKTPRREALARAATVAESLGLSALLGRKPKDLSGGQQQRVAIGRAIIR
EPSVFLFDEPLSNLDAKLRVETRTELAQIQRRLGITSVYVTHDQEEAMTL
SDRMIVMRDGKIAQQGAPQDVYARPADTFVAAFVGSPKMNLLEGTLTGGT
FTLANGFALPIDEGATDGPLTLGVRPDDLLPTVGAADAPARVALIEHLGP
RAIVTVDARGTELTSVVDTARLSGITEGTGVELAVRQGATHLFDTTTGRR
IAGETR
145224359YP_001135037.1 binding-protein-dependent transport systems inner membrane componenMNRPSVVTVLRVALLWAAAISVLFPIVWIALASVKTPEQLNDPFLLTFTP
DFSGWRNVLESGILGAAGRSALVALVTVGISVVVGSMGAYAIARYRAGGT
LTRFGMLAAQVLPPAVLVFPFLTMAYALRLTDTLVPVIFAHLSFVLPVVT
WFLIGFFEAVPRSLEEQAQVDGLTRFAAFRLVVLPQVLPGIGAAAIFGFT
LSWNDLFYGLILAPGKAAILPVAIAGFNTFRGVQIGSMSAAILIAVVPVV
IASFFIQRKLVQGISGGAVKF
145224358YP_001135036.1 binding-protein-dependent transport systems inner membrane componenMKFQHGMVAPLVALFVGVVGFPLGYAAYLSVTDYKLTDQGAPDIVGADNF
VATFGDSGFWNAFGTTALYVLVAVGLELVIGLAIALALQKQRWARDLTRS
MLLAPMFITPIAVGLTFRFLLNDQLGAIPAMLHAIGIDYDFFGPGRALYT
LAFIDVWQWTPFMVLLLLAGLESIPKEPLDAARVDGARGLYVLRRVTLPL
LAPVLVVAILLRSLDAMKVFEYVFATTRGGPGTETETLQYFIYQTGIQFF
RLGSASSMAFVVLIVVLAAIVFAFRRMDRAREAGIR
145224357YP_001135035.1 extracellular solute-binding protein [Mycobacterium gilvum PYR-GCK]MRFAQIPTARRGGKTARSAVLALLAVLALVLSACAGSGGPEQAESTGSGE
VSADTSGTVRILMENVPDTDIVKSMVADFNAEYPGVEINIESLTFDQMRD
KLVSSFQSSSPAYDLIVVDNPWMVDFANAKFLQPLDARIDSTPDYDAGDF
FTPLTDITTVDGTRYGVPFYNYALGYLYNADDLAAANQQVPTTLDELVST
SKALKSGDRAGIAMQPQRGYKIFEEWGNWLFAAGGSIYDADGKITLNTPE
AKRALEAYIDTYNTAAPANSLSWGMDEAQRSVSANQSASMINYNWQLPAL
NEPGSGPAAGKIKLATIPGGKQVLGSWSWAIPANSATPDAAWAFVSWITA
KPNDVVRTEKGGAAIRKSTLQNPAVLQGQFGEEYYRTVEQLLADAAPLTQ
GPSGEEMIQAVGTALNEAVAGEKSVDDALATAQAEAEKIQG
145224356YP_001135034.1 carbohydrate kinase [Mycobacterium gilvum PYR-GCK]MSRYTIGVDIGTTGTKTVLLDTTSGIVATASRETALHSPAPGFAEADTTQ
WHANVIDSVREVLAHSGVAPDEIGALATSGMVPAVVPIDDAGKPLRRAIL
QNDARAHREVDDLAGALADVDLVTLTGSALTQQSVAPTTVWLREHEPEVY
ARTAHWVGSYDWVLSALGADVHVEQNWALESGLFSIVGDTADAVLGAAGL
DPATLAPLRRPGTRVGELSAAAADATGLRAGTPLVVGGADHVLSAYAAGV
NGAGDALVKLGGAGDILVASDTEIVDERLYLDAHPVPGRWLPNGCMATSG
SLIRWFQTLIGGAELTELDDEAAQRAPGEILCLPYFLGEKSPVHDPDLRG
VFAGMHLGHTRADMYRSVLEAIAFGFRHHVDVFGEIGIPFTRVMITNGGS
RSTLWKQIHADVLGCEMNPVIGHPGASLGAAVIAAIGVGALDDWADADRF
ITLDAPYRPDPARRHAYDDAYQTWRELGAVMTPVSHKIARTTR
145224355YP_001135033.1 DeoR family transcriptional regulator [Mycobacterium gilvum PYR-GCKMKTRRERIEQRVRSAREVNFADLAAEFDVSEMTIRRDVEALEALGVLRRV
VGGAIALQGKDNEPAFATRVADAAQEKAHIAEVVADLIGRKETLILDSGS
TALAVANSLKGRDLGLTVVTPSVLAALALVDEPDTSVVLTGGELRAGELS
LIGPGAEDTLANYNCDTYVMGVAGIDGERGISDYHQAESRVKRAATRRAD
RVIVAADKSKLGRVTFVSISALAEVQIIVSDGPPDHPALVAARDAGVEVI
CVADQQDSVQDISAVGSR
145224354YP_001135032.1 hypothetical protein Mflv_3772 [Mycobacterium gilvum PYR-GCK]MLHLRVVVPEDMRDDVLDVLRSQVGVAHVLLHPGAAVDPAGDVIAADLAR
ECANDVIKNLKDLDAQHRGAITLTVLDTVLSTRAHRAEEEAVGDPADAVV
WDELIGRTREEATLSVTFVLFLTLACLLTAIGVVTDSTVTVVGAMVLGPE
FGPLAALSVALVQRRMALARRAAVALVVGFPIAMAITAIATWAAESLGWI
TLDSVAHVEEVDFIFRVGPVSFMVALLAGAAGMLSLVSARSAGLVGVFIS
VYTVTAAGFAVVAATVGAWDVAAKSALQLVVNLVGIVLAGVLVLVLRPRG
RLVARTARK
145224353YP_001135031.1 transglutaminase domain-containing protein [Mycobacterium gilvum PYMGIKVALEHRTSYTFDRLVEVHPHVVRLRPAPHSRTPIEAYSLQVEPADH
FVNWQQDAFGNFLARLVFTTRARSLTITVGLIADLKVVNPFDFFIEDYAE
RVGFAYPKALAEDLKPYLRPVDEDGEGTGPGDLAAAWVSNFSVATGTRTI
DFLVALNRAVNADVGYSVRMEPGVQTPDVTLRTGIGSCRDSAWLLVSILR
QLGLAARFVSGYLVQLTSDVEALDGPSGPAADFTDLHAWTEVYIPGAGWI
GLDPTSGLFAGEGHIPLSATPHPESAAPITGATEPCETVLEFSNVVTRVH
EDPRVTLPYTDASWAAINALGRRVDERLREADVRLTMGGEPTFVSIDNQV
DPEWTTAADGPHKRERASALTARLKKVWAPQGLVQRSQGKWYPGEPLPRW
QIGLYWRADGEPLWSDDRLLADPWPETPGVRGIAPDAHRALLAAIADGLG
LPADRVRPAYEDPLTRLIAAVRRPEGPPVAADDDLAADDAAGRAALMQRL
DESVGEPTAFVLPLHRRDDDAGWASADWTLRRGRIVLLDGDSPAGLRLPL
NSISWKPPKPTFEADPIHRRPALGRGAALARSATATPEETSDDDEWVPTT
ALVGEIRDGLLYVFLPPVDELEHFIDLIARIESAAASIDCPVVIEGYGPP
PDPRLTTMSITPDPGVIEVNVAPTESFVEQRAQLETLYREARLARLSTEA
FDVDGTHGGTGGGNHITLGGVTPADSPLLRRPDLLVSMLTYWQRHPALSY
LFAGRFIGTTSQSPRVDEGRPDALYELEIAFAEIARLSKAEGGAAPEHGR
SASSAPEHGRSASSAPPWLVDRALRHLLTDITGNTHRAEFCIDKLYSPDS
ARGRLGLLELRGFEMPPHPQMAMVQSLLVRSLVAWFWDEPLRAPLIRHGA
NLHGRYLLPHFLIHDIAEVAADLRAHGVEFDTSWLDPFTEFRFPRIGTAV
LGGVEIELRGAIEPWNVLGEESTAGGTARYVDSSVERLQVRLIGADRSRY
LVTVNGHPVPMLATDNPDVQVGGVRYRAWQPPSALHPTITVDGPLRFELI
DAATGVSRGGCTYHVSHPGGRSYDSPPVNAVEAESRRARRFEATGFTPGA
VDLAALREKLARQSTDVGAPGILDLRRVRTVLQ
145224352YP_001135030.1 hypothetical protein Mflv_3770 [Mycobacterium gilvum PYR-GCK]MAVPATPPTPRLGAGRTDVDNPLEPYGSMRAQPSLFDVASAFGGLAGYDE
FVDTAGDVRPAWQELADCVRDRGRGGLDRLRAVVRDLVDNDGITYVQTDR
EGEPVAGPWRLDALPLVISASDWDHLEAGLVQRSRLLDAVLTDVYGERRV
VTGGVLPPELLFSHPGYLRAANGIEIPGRHQLFLHGCDISRNGTGDFVVN
ADYTQAPSGAGYALADRRVVAHAIPDLYEQIGPRQSSPWAQALRLALVDA
APDAVDEPMVVVLSPGIHSETAFDQAYLASVLGLPLVESADLVVRDGMLW
MRSMGTLKRVDVVLRRVDADYADPLDLRPASRLGVVGLVEVLRRGAVTVV
NSLGSGVLESPGLLRFLPEMAEHLLGETPLLPTPHLYWGGIDIERSHLVS
NLGSLVIRPVTGGEPIVGATLSAARREELAARITATPWQWVGQEPPEFSS
APSDFLPGGLSSSSVGMRLFTVSQRSGYAPMIGGLGYLLAPGADAYRLKS
VAAKDVWVRTATRVTAEAVPLPALATSSPTQEVSSPRVLSDLFWIGRYAE
RAEHTARLLTVTRERYHEYRYRRTMDGSECVPVLLTALGEITGTDTGAAG
DYAEMVATAPTTLWSLTADRHRPGSLAQSVERLGLAARAVRDQMSNDTWM
VLSALDRALLNAPDTPPDSQAEGDAFLASTNTLALAGMMALSGVAAESMV
HDVGWTMMDIGKRIERGLALTALLRATLTTVRTPGAEQTVTESALVACES
LVIYRRRNPGKISVAGVADLMLFDADNPRSLAYQLERLRTHLRSLPESTG
SSRPERMVDEIAARLRRMEPGELEEVAADGTRDGLRALLTAIHRDLRELS
AVITTVHLSLPGDMQPLWGPDERRVVP
145224351YP_001135029.1 transglutaminase domain-containing protein [Mycobacterium gilvum PYMTAFPDGPVATGGSRCYEVTHRTEYRYSDVVTSSYGRGFLTPRDSARQRC
LFHELAIEPDAADSSTSRDVYGNISSYFHVTARHRRLVITSRSVVEVDPP
PPDLYQGPSARAPWEIARPVGADGALAKEFTLDLQPPEITEELRAYAAPS
FVAGRPLIEVLRDLNERIYTDFTYRSGSTTVSTQVAEVLAAREGVCQDFA
RLAIACLRANGLAASYVSGYLATDPPPGKERMVGVDATHAWASVWTPQNL
WLGLDPTNNQMVDERYVTVGFGRDYADVPPLRGIIYTDSESSVIDVSVDV
APYLGGVLNA
145224350YP_001135028.1 hypothetical protein Mflv_3768 [Mycobacterium gilvum PYR-GCK]MRDFTCPNCGQRLSFENSVCLNCKSALGFSLDDMALLVIAPTEESEHAGA
VDEREYQLCANLHLAECNWLVEKGPIAKLCVSCALTRTRPNDADVVALAA
FATAESAKRRLIAELCELKLPIVGRDLDPQFGLAFDLLSSQFEKVFTGHE
NGVITLDLAEGDDVHREQLRISMDEPYRTLLGHFRHEIGHYYQYRLIGTS
QDYLDRYHELFGDPEADYQAALDRHYSEGAPAGWEQDYVSSYATMHPAED
WAETFAHYLHIRDTLDTAAAFGFAPATATYDRRVLGPSGFDTLIDLWLPL
SWALNQVNRSMGKEDVYPFVLPPPVLEKMRFIHTVIDEITSSPAKLAEVG
APAEDQSQQLD
145224349YP_001135027.1 hypothetical protein Mflv_3767 [Mycobacterium gilvum PYR-GCK]MADRYGTDILADNPHRARKPRSVETPIEIGMVVEDAQTGFVGAIVRVEYG
RMELEDRNGRRKPFPVGPGYLIDGKPVILTAPKKAGPAAPTRTASGSVAV
QGARAKVALASRIYVEGRHDAELVEQVWGEDLRIEGVVVEYLGGVDDLAA
IVADFRPGPGRRLGVLVDHLVAGSKEARIAEAVRRGPGGEHTLVVGHPFI
DIWEAVKPARLGMKAWPVIPKGQDWKHGVCAALGWRHRDQADIAAAWQKI
RGRVRDWTDLEPELIGRVEELIDFVTAPV
145224348YP_001135026.1 recombination factor protein RarA [Mycobacterium gilvum PYR-GCK]MSDSLFDVPGEPAPPAAGPVGASVPLAVRMRPANLDEVVGQDHLLKPNSP
LRRLIEGSGAASVILYGPPGTGKTTLASMISQATGRRFEALSALAAGVKE
VRAVIDVARQAAVRGEQTVLFIDEVHRFSKTQQDALLAAVENRVVLLVAA
TTENPSFSVVAPLLSRSLILQLQPLTPADVTTVIRRAITDERGLGGRVTV
SDDAIEQLVLLSAGDARRALTALEVATETVSESGETVTVEVIEQSLDKAA
LRYDRDGDQHYDVVSAFIKSVRGSDVDAALHYLARMLVAGEDPRFVARRL
MILASEDIGMADPTALQIAVAAAQTVQLIGMPEAQLTLAQATVHLATAPK
SNAVTTALGAAMADIRAGKAGQVPAHLRDGHYSGAQKLGNAVGYKYAHDH
PGGVASQQYPPDELVGTDYYRPTNHGVEREISARVEKLRAIIRRSR
145224347YP_001135025.1 hypothetical protein Mflv_3765 [Mycobacterium gilvum PYR-GCK]MTITGIISAILIGIVVGVLGRLVLPGKQSIGMLVTILVGIVSAFLGTALA
RAIGIPTATSGIDWLELLVQVVVAAIGVALVAALMGRRAGVAGRGRTGTL
R
145224346YP_001135024.1 hypothetical protein Mflv_3764 [Mycobacterium gilvum PYR-GCK]MQTETLDIDTSRRRFVDLTSAVRDFCAERGPDAGGLCNVFVPHATAGIAV
IETGSGSDHDLIDAIERLLPRDDRYRHAHGSPGHGADHVMPGLVSPSVTI
PVAGGEPLLGTWQSVVLIDLNRDNRRRSVRLSFVSG
145224345YP_001135023.1 alanyl-tRNA synthetase [Mycobacterium gilvum PYR-GCK]MQTHEIRKRFLDHFVKAGHTEVPSASVILDDPNLLFVNAGMVQFVPYFLG
QRTPPWDRATSVQKCIRTPDIDEVGITTRHNTFFQMAGNFSFGDYFKKGA
IELAWSLLTNPVSEGGYGFDPERLWATVYLDDDEAIELWQEVAGLPAERI
QRRGMADNYWSMGIPGPCGPCSEIYYDRGPDYGIDGGPEANEDRYIEIWN
LVFMQNERGEGTSKDDFEILGPLPRKNIDTGMGVERIACLLQGVDNVYET
DLVRPVIDLVAGIAPRGYGQGNHTDDVRYRIIGDHSRTAAIIIGDGVTPG
NEGRGYVLRRLLRRIIRAAKLLGVEQPIMGELMATVRDEMGPSYPELVTD
FERINRIAIAEETAFNRTLTAGSRLFEDAAETTRKAGSTVLSGDDAFTLH
DTFGFPIDLTLEMAAEAGLSVDEEGFRGLMAEQRRRAKADAAARKQAHTD
LSAYRELVDAGPTEFTGFDELTTEARILGIFVDGRRVPVVSHVQGGDAPG
RVELILNRSPFYAESGGQIADEGTVTGTGASQTAKAAVTDVQKIAKTLWA
HRITVESGEFVEGDTIVAAVDPRWRHGATQGHSGTHMVHAALRQVLGPNA
VQAGSLNRPGYLRFDFNWQGALSDDQRSQIEEVTNEAVEADYEVHNFTTE
LEKAKSMGAMALFGENYPDEVRVVEIGGPFSIELCGGTHVRSSAQIGPVT
ILGESSVGSGVRRVEAYVGLDSFRHLAKERALMAGLASSLKVPSDEVPAR
VENLVERLRAAEKELDRLRLVNARAAAANAAAGAEQIGGIRLVAQRMAGG
ISAGDLRSLVGDIRGKLGSDPAVVALISEADDDTVPFVVAVNQAAQDRGL
RANDLVKVLGAAVNGRGGGKADLAQGSGKGAAGIDAALAAIRAEMGRS
145224344YP_001135022.1 Holliday junction resolvase YqgF [Mycobacterium gilvum PYR-GCK]MPDTDWTSRVPDRPGDPNAAPDPGRGRRLGIDVGSVRIGVAVSDPDAVLA
TPVETVTRDRRSGRHLRRLTTLVGEYEAVEVVIGLPRTLGNRAGSSAQDA
TEVADQLAARIAPVPVRLADERFTTVTAQRELREAGVRARGQKSMIDQAA
AVGILQNWLDQRRAALPAHGEVLDD
145224343YP_001135021.1 aminodeoxychorismate lyase [Mycobacterium gilvum PYR-GCK]MTDEWQSGRAEPLAVGPPRQRMTRRERARAERQRRRRRAGLVITLSMLVV
VVVVAVFLGSKMWHSLFGGTTGDYAGDGVSDVVIQVHDGDSTTAIGQTLQ
DNNVVANVKTFVDAADGNSAISAIQPGFYKVRTEIPASSAVQRLADPANR
VGKLTIPEGRQLDDVRDVKTNAVTAGILTLIANASCVDLDGDRRCVSADD
LKQIAGAAAPADLGVPQWATDAVDRMGADHRRLEGLIAPGTWNIDPSAQP
QDILFTLISTSASQYEQSGLLTAAESVDLSPYEILTVASLVQREATPEDF
SKVARVIYNRLDERRTLEFDSTVNYPLDRVEVATTDADRGQATPWNTYVR
PGLPATPICSPGNPALVAAENPEPGDWLYFVTIDLQGTTLFTREYEQHLA
NIQLALRNGVLDSGR
145224342YP_001135020.1 shikimate 5-dehydrogenase [Mycobacterium gilvum PYR-GCK]MSSTPAADRPRRAAVLGSPIAHSRSPQLHLAAYAALGLSSWRYDRIECGE
DELPGFVAGLGDEWVGLSVTMPGKFAALRCADEATERARLVGSANTLVHT
ATGWRADNTDIDGVAGALADAGVSGSAVVVGSGGTAPAVVAGLVQLGAHH
VTVVARNAEKAQGLVALGRRCGATTEWVDLTGDDVTGAVAAADVVVNTVP
ADAVAPYAPRLAGTPVLLDAIYDPWPTPLAAAVTAAGGRVISGLEMLLNQ
AFAQVEQFTGMPAPQKAMRGALGLA
145224341YP_001135019.1 peptidase A24A- prepilin type IV [Mycobacterium gilvum PYR-GCK]MGDVAAGVAAAGVLVWLIALSAFDIRHRRLPNVLTLPGAAVILVAATVVG
HGGPALLGATALFAVYVTVHLFSPGALGAGDVKLAIGLGALTGAYGADVW
VVAALGASLMTGALALCRRLQGAGPDVPHGPSMCLAAGTALGLAALA
145224340YP_001135018.1 chorismate synthase [Mycobacterium gilvum PYR-GCK]MRWTTAGESHGRALVAMVEGMVAGVEVTSGDVAGQLARRRLGYGRGARMK
FEQDQVTMLTGLRHGVTLGGPIAIEIGNTEWPKWETVMAPDPVDPESLAD
SAARNAPLTRPRPGHADYAGMLKYGFDDARPVLERASARETAARVAAGTV
ARAFLRQALGVEIVSHVISIGASKPYDGPPPSAADLAAIDDSPVRAFDSD
SEALMIAEIEAAKRDGDTLGGVVEVVAHGLPVGLGSFTSGDDRLDSQLAG
AVMGIQAIKGVEIGDGFETARRRGSVAHDEIYPGPDGVMRSTNRAGGLEG
GMTNGLPVRVRAAMKPISTVPRALATIDMTTGEEAVAIHQRSDVCAVPAA
GVVVETMVALVLARAALAKFGGDSLGETRANIDGYLRAVSAREPSANGAP
T
145224339YP_001135017.1 shikimate kinase [Mycobacterium gilvum PYR-GCK]MAPKAVLIGLPGSGKSTIGRRLAKSLGVPLLDTDNAIEETTGRTIADIFA
TDGESEFRRIEEQVIRDALATHDGVLSLGGGAVTTEGVREALAGHTVIYL
EISAAEGVRRTGGSTVRPLLAGPDRGEKFKALMAERVPLYRQVATMRVNT
NHRNPGAVVRYICARLENPDAEPDRRRRRSVWRRAPLSLTASPSTEAPPS
PATVAARKARGSSCMRKDPQ
145224338YP_001135016.1 3-dehydroquinate synthase [Mycobacterium gilvum PYR-GCK]MTEPVTVDVRTDPPYPVIIGRGLLGDLGRVLDGRHKVAILHQPTLTQTAE
AIRTHLSEKGIDAHRIEIPDAEGGKELPVVGFIWQVLGRIGVGRKDAIVS
LGGGAATDVAGFAAATWLRGIDIVHVPTTLLGMVDAAVGGKTGINTDAGK
NLVGAFHQPAAVLIDLATLESLPRNEIVAGMAEIVKAGFIADPVILDMIE
ADPEAALDPSGAVLPELIRRAVVVKAEVVAADEKESQLREILNYGHTLAH
AIERRERYQWRHGAAVSVGLVFAAELGRLAGRLDDDTTERHRAILTSLGL
PVTYDADALPQLMESMLGDKKTRAGVLRFVVLDGLAKPGRLEGPDPSLLA
AAYAEVARD
145224337YP_001135015.1 hypothetical protein Mflv_3755 [Mycobacterium gilvum PYR-GCK]MIPDELCTSDTWSPLAAAAGHSQLAGVLGGFLITAIALLFDRNSREGVHI
LALFSSAVLILMLDSFLFSLISGNQTPDAGERGAVCAISWTQTALATGML
AAGTTALFGGLGWMLAGHAVNRAGAADTDDIAAYSFLADLGGWLTFAAAM
SSTLILSETTVDYLRAVYDRSPSDAVVAAITTTAALAVLVEFLFVYVRTR
ELRRSLASAAEQTRLALRSIKVATIGLVGLAVVAGWFALSVPRFPRGWLT
EPNLAVVAVVVALAFAAPIFVATAICYSVPSTDVRRIRLRGRQSRATSA
145224336YP_001135014.1 hypothetical protein Mflv_3754 [Mycobacterium gilvum PYR-GCK]MSKWLVRGLVLAALMVIVRLLQGAMINAWETKAGLISAVLVAAYAVVALI
WGYADGRSDARRNPDPDRRDDLAMSWLLAGLFAGVVSGAVAWFIGLFYKN
LYVEGLINELTTFAAFTALLVFISAIIGVALGHWLVDRKAPAQERRREDD
DRADTDVFAAVRDTGSSEGNSEDYDRYADGTESQQQSSSVAVADDETRPV
DKRDN
145224335YP_001135013.1 peptidase M24 [Mycobacterium gilvum PYR-GCK]MTISARRDRLRRLLADAGLDAMLVSDLVNVRYLSGFTGSNAALLVLAQDE
TPVLATDGRYRTQAAHQAPDAEVVIERACGPHLAARAAADGVRRLGFESH
VVTVDAFTALSEAAGNGCEFVRAAGTVEGLREVKDAGEVALLRLACEAAD
AALKDLLERGGLRAGRTERDVRNELESLMLAHGADGASFETIVAAGANSA
IPHHRPTDAVLAAGDFVKIDFGALVAGYHSDMTRTFVLAPVADWQREIYS
LVAASQQAGRDALAPGVALSTVDAAARQVIADAGYAENFGHGLGHGVGLQ
IHEAPGINSAAAGTLLAGSAVTVEPGVYLPDRGGVRIEDTLVVDKHPELL
TRFPKELVII
145224334YP_001135012.1 elongation factor P [Mycobacterium gilvum PYR-GCK]MASTADFKNGLVLQIDGQLWQIVEFQHVKPGKGPAFVRTKLKNVVSGKVV
DKTYNAGVKVETATVDRRDATYLYRDGSDFVFMDSEDFEQHPLPEALVGR
LAGFLLESMPVQIAFHDGVPLYLELPVTVELLVAHTEPGLQGDRSSAGTK
PATMETGAEIQVPLFINTGDKLKVDSRDGSYLGRVNA
145224333YP_001135011.1 transcription antitermination protein NusB [Mycobacterium gilvum PYMPDRKGDRGRHQARKRAVDLLFEAEARGITAAEVAEARNALADNGADDIA
PLNPYTVTVARGVTDHAAHIDDLISAHLQGWTLDRLPAVDRAVLRVAVWE
LLHAVDVPEPVAVDEAVELAKQLSTDDSPGFVNGVLGQVMLVTPQIRAAA
AAVQASPDSGSATP
145224332YP_001135010.1 HNH nuclease [Mycobacterium gilvum PYR-GCK]MSAPGCSVPDMFESLFDYDTEASEKELRVLVEQYEALKSRAAAAQARVTA
LWAAKRAAAERAAGIGTRKRGKGLASEIALARHDAPVKGNQHLGFANALV
HEMPHTLAALECGVLSEYRATLIVRESACLSAEHRRRLDEELCSDPSKLA
GWGNNRVEAEAKRITARLDAAAVVERSAKAEQDRCVTTRPAPNCMVYVTV
LLPVAQGVGMYAALKRAADTTFDERSRGQVMADTAYARITGKVATQPVSV
SLNLVMADTTLAGDDTEPAWLDGYGPVPAGFACKLTGDAVADEDVKATLR
RLYRHPGSGQLVAMESRSRAFPKGLAAFIGIRDRTCRTPYCNAPIRHHDH
ATPDRDGGRTSAVNGLGLCEACNYAKEAPGWTVTTSVRAGEHRAEFVTPT
HATYYSIAPPLPGTRISRRSIVEDRFSIDLVTFEAA
145224331YP_001135009.1 beta-lactamase [Mycobacterium gilvum PYR-GCK]MNLDRNKASIVDAIDAGLLAGAVTLVWHAGEVRQVNELGYRDVDAQLPMQ
RDTIFRIASMTKPVTVAAAMSLVEEGRLSLTDRVATWLPELADMRVLAEP
RGALDRTVPAQRHITIEDLMTHRSGLAYMFSVLGPLSDAYRKLPTRQDQD
RWLTELSALPLVHQPGERLTYSHATDVLGIALSRIEGKPLSEVLAERIFE
PLGMTDTGFSVGSEGRRRAATMYQLDKDGTLRHDVMGPAPIVDPPFCTGG
AGLFSTVDDYLRFARMLLNGGTLDGTRVLSEDSAMSMRTDRLTAEQKRQD
FLGAPFWIGRGFGLNLSVVTDPAKSRQLFGPGGLGTFSWPGAYGTWWQAD
PSADVILIYLIQNLPSMSVDVAAAIAGNTSLAKLQTAQPKFVRSTYQALE
L
145224330YP_001135008.1 bifunctional pyrimidine regulatory protein PyrR/uracil phosphoribosMGAPDQSGSDRELMSAADVSRTIARIAHQIIEKTALDGPDGPRVILLGIP
TRGVTLASRLATNIAEFSGVQVAHGALDTTLYRDDLMTKPPRALAETSIP
AGGIDGALVILVDDVLYTGRSVRSALDALRDLGRPKAVQLAVLVDRGHRE
LPIRADYVGKNVPTSRSENVKVRLTENDGVDIIAIAPYGGPPR
145224329YP_001135007.1 aspartate carbamoyltransferase catalytic subunit [Mycobacterium gilMKHLLTAADLSRDDATAILDNADRFREALVGREVKKLPTLRGRTIITMFY
ENSTRTRVSFEVAGKWMSADVINVSASGSSVAKGESLRDTALTLRAAGAD
ALIIRHPASGAPQQLAAWTLDEHGGPSVINAGDGTHEHPTQALLDALTIR
QRLGSVEGKRVVIVGDVLHSRVARSNVALLHTLGAEVVLVAPPTLLPVGV
TEWPVTVSHELDAELPLADAVLMLRVQAERMNGGFFPSSREYSVRYGLSE
KRQSTLADHAVVLHPGPMLRGMEIAYSVADSSQSAVLQQVSNGVHVRMAV
LFHLLVGSEEEAISA
145224328YP_001135006.1 dihydroorotase [Mycobacterium gilvum PYR-GCK]MSVVLKSVRLYGEGDAVDVLVRDGIIAEIGTGLSADETIDCTGRVLLPGF
VDLHTHLREPGREYAEDIETGSAAAALGGYTAVFAMANTDPVADSVVVTD
HVWQRGQQVGLVDVHPVGAVTVGLAGKQLTEMGLMAAGTGRVRMFSDDGV
CVDDPLLMRRALEYASGLGVLIAQHAEEPRLTVGAVAHEGPNAARLGLAG
WPRAAEESIVARDALLARDAGARVHICHASTAGTVELVRWAKEQGIAITA
EVTPHHLLLDDTRLETYDGRNRVNPPLREVSDTLALRQALADGVIDCVAT
DHAPHGEHEKMCEFANARPGMLGLQTALSVVVETMVQPGPLTWRDVARVM
SEAPARIVGLPDQGRPLEVGEPANLTVVDPDARWTVSGPALASRSDNTPY
EAMELPGVVTATLLRGTVTARDGKAGA
145224327YP_001135005.1 hypothetical protein Mflv_3745 [Mycobacterium gilvum PYR-GCK]MNTPTLVTSLVMAAVVAILIAVLIQAMMRGWRHRVARQMQIIGNLPPLPD
TVGPTLVPATKGLYVGSTLAPHWNDRVAAGDLGFRAKAVLTRYPEGIMLQ
RTGAGPIWIPDESIAEIRTEKSLAGKALTHEGILAIRWRLPSGTEIDTGF
RADDRRDYSKWLPEEVA
145224326YP_001135004.1 carbamoyl phosphate synthase small subunit [Mycobacterium gilvum PYMTAHKALRSASQIARLVLEDGRVFTGTPFGAEGETLGEAVFSTGMSGYQE
TLTDPSYHRQIVVATAPQIGNTGWNHEDSESRGDKIWVAGYAVRDPSPRA
SNWRATGTLDDELKRQGIVGIAGIDTRAVVRHLRSRGSMKAGIFSGEQAD
ASVDDLIARVRDQAAMLGADLAGEVSTDTDYEVDSEGPQRFTVAALDLGI
KTNTPRNFAKRGVRSIVLPSSATFDHIAELKPDGVFLSNGPGDPATADHI
VGVTREVLDAGIPLFGICFGNQILGRALGLSTYKMVFGHRGINIPVMDHT
TGRVAITAQNHGFALEGEAGQTFDTPFGQAEVSHTCANDGVVEGVRLSNG
RAFSVQYHPEAAAGPRDAEYLFDTFIDLMNEGKGESK
145224325YP_001135003.1 carbamoyl phosphate synthase large subunit [Mycobacterium gilvum PYMPRRSDLNHVLVIGSGPILIGQAAEFDYSGTQACRVLRAEGLQVTLINSN
PATIMTDPEYADHTYVEPITADFVEKVIAQQAERGNKIDALLPTLGGQTA
LNTAVKLYENGALERYDVELIGANFDAIQRGEDRQKFKDIVTKVGGESAK
SRVCFTMDEVRDTVAELGLPVVVRPSFTMGGLGSGMAYSADDVERMAGEG
LAASPSANVLIEESIYGWKEYELELMRDGRDNVVVVCSIENFDPMGVHTG
DSVTVAPAMTLTDREYQKMRTLGIEILREVGVDTGGCNIQFAVNPKDGRL
IVIEMNPRVSRSSALASKATGFPIAKIAAKLAIGYTLDEIVNDITKETPA
CFEPTLDYVVVKAPRFAFEKFPGADATLTTTMKSVGEAMSLGRNFIEALG
KVMRSLETGRAGFWTGEDPVGELGEVLARLRTPTDGRLYDIEYALRIGAT
VEEVAEASGVDPWFVDQIGGLVELRAELTDAPVLGEELLRRSKHHGLSDR
QIAALRPELAGEMGVRALRQRLGIHPVFKTVDTCAAEFEAKTPYHYSSYE
MDPAAETEVAPQTERGKVLILGSGPNRIGQGIEFDYSCVHAATTLSEAGF
ETVMINCNPETVSTDYDTADRLYFEPLTFEDVLEIYYAEQRSGEGGPGVI
GVIVQLGGQTPLGLAERLEKAGVPIVGTKPEAIDLAEDRGEFGEVLRRAG
LPAPRFGMATSFDQARRIAAEIGYPVLVRPSYVLGGRGMEIVYDEDTLEG
YITRATQLSPEHPVLVDRFLEDAIEIDVDALCDGTEVYIGGVMEHIEEAG
IHSGDSACALPPVTLGRSDIEAVRRATEAIAFGVGVVGLLNVQYALKDDV
LYVLEANPRASRTVPFVSKATAVPLAKACARIMLGASIAELREEGVLART
GDGAATARNAPVAVKEAVLPFHRFRKADGAQIDSLLGPEMKSTGEVMGIA
HDFGSAFAKSQTAAYGSLPASGTVFVSVANRDKRSLVFPVKRLADLGFKI
LATEGTAEMLRRNGIPCEEVRKHFEEPSADRPLRSAVEAIKAGDVDMVLN
TPYGNSGPRIDGYEIRSAAVSMNIPCVTTVQGASAAVQGIEAGIRGDIGV
MSLQELHSTLVS
145224324YP_001135002.1 orotidine 5'-phosphate decarboxylase [Mycobacterium gilvum PYR-GCK]MTDSGFGERLAVARVRRGPLCLGIDPHPELLRSWNLGVDVDGLSRFADLC
VTAFAGFAVVKPQVAFFEAYGSAGFAVLERTIAALRASGVLVLADAKRGD
IGTTMAAYATAWAGDSPLASDAVTASPYLGFGSLQPLLDTAQQNGRGVFV
LAATSNPEGASVQRADVAGRTVAQTVVDAAAELNSPGAPGSVGVVVGATL
SDPPDVSALNGPVLVPGVGAQGGRPEALAGLAGAGPGQLLPAVSREVLRS
GPDVAALRDAAERMRDAVAYLA
145224323YP_001135001.1 protein MihF [Mycobacterium gilvum PYR-GCK]MALPQLTDEQRAAALEKAAAARRARAELKDRLKRGGTNLKQVLTDAETDE
VLGKMKVSALLEALPKVGKVKAQEIMTELEIAPTRRLRGLGDRQRKALLE
KFDFS
145224322YP_001135000.1 guanylate kinase [Mycobacterium gilvum PYR-GCK]MSEGRGPDSASGATVLVLSGPSAVGKSTVVRCLRERVADLYFSVSVTTRA
PRPGEVDGVDYFFVTPERFQQLIDDNALLEWADIHGGLHRSGTPAAPVRE
AAAAGRPVLIEVDLAGARAVKKAMPEATSVFLAPPSWETLESRLIGRGTE
TPEVIARRLETARAELAAQDDFDEIVVNSQLESACAELVALLVAHAPERR
DQP
145224321YP_001134999.1 DNA-directed RNA polymerase subunit omega [Mycobacterium gilvum PYRMSTPLTPTADSRLAAADIDPSAASAYDTPLGITNPPIDELLDRASSKYAL
VIYAAKRARQINDYYNQLGDGILEYVGPLVEPGLQEKPLSIAMREIHGDL
LEHTEGE
145224320YP_001134998.1 bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantoMAAKRIIVGVAGGIAAYKAATVVRQLTEAGHSVRVVPTESALKFVGAATF
EALSGNPVHTGVFEDVHEVPHVRIGQAADLVVVAPATADLLARAAVGRAD
DLLTATLLTARCPVLYAPAMHTEMWQHPATVDNVATLRRRGCVVMEPASG
RLTGADTGPGRLPEAEEITTVAQLLLARGDALPHDLAGVRALVTAGGTRE
PIDPVRFIGNRSSGKQGYAVARVMAQRGADVTLIAGNTAGLIDPAGVHVV
HVGSATQLRDAVSKHAPDANVLVMAAAVADFRPAHPATSKIKKGPDATTD
PAIELIRNDDVLAGAVRARDDGQLPNMAAIVGFAAETGDANGDVLFHARA
KLTRKGCDLLVVNAVGENRAFEVDHNDGWLLSSDGSESALEHGSKTVIAS
RIVDAIAAFLHSGAG
145224319YP_001134997.1 S-adenosylmethionine synthetase [Mycobacterium gilvum PYR-GCK]MSEARLFTSESVTEGHPDKICDAISDSVLDALLAGDPKSRVAVETLVTTG
QVHVVGEVTTNAKEAFADITNTVRERILEIGYDHSDKGFDGETCGVNIGI
GRQSPDIAQGVDTAHETRVGGAADPLDSQGAGDQGLMFGYAIADTPELMP
LPIALAHRLSRKLTEVRKNGTLDYLRPDGKTQVTVQYDGTTPVRLDTVVL
STQHADGIELDSQLEPEIKQHVIDAVLTELGHQTLDTSNPRILVNPTGKF
VLGGPMGDAGLTGRKIIVDTYGGWARHGGGAFSGKDPSKVDRSAAYAMRW
VAKNVVAAGLAERVEVQVAYAIGKAAPVGLFVETFGSETVDPVKIEKAIG
EVFDLRPGAIVRDLDLLRPIYAPTAAYGHFGRTDIELPWEQLNKVDDLKS
AV
145224318YP_001134996.1 cyclohexanone monooxygenase [Mycobacterium gilvum PYR-GCK]MVLEHLSRCRSGHSVVPHQFSFEQSTEWSRTYAPGRELKSYADHCFDKYG
LRSRTRFATTVRSAEFDDSAGLWRLAVESGGVQSTVTARFVINAGGALTV
PNLPDIPGVDSFAGTTIHTARWDHDVDLTGKRVAIIGTGASAVQVIPEIA
PIVARLTVFQRTPIWCFPKFDVPLSRTARAMMRLPFGQTLQRFLSQAYVE
LTFPLAAQYFTVNPMAKRMSRMGLAYLRRQVKDPVVREKLTPRYAVGCKR
PGFHNTYLATFNRDNVELVTEPIDKITGAGVATTDGQLRDADVLILATGF
KVLDTENVPTYRVTGSGGRSLSRFWEENRLQAYEGVSVPGFPNFFTVFGP
YGYVGSSYFALIEAQTRHIVRCLAEAGRRGASRVEVRREANDRYFAEMMR
KRHRQIFWQDSCRLSNSYYFDQHGDVPLRPASTLEAHWRSRSFPIDDYEF
AVS
145224317YP_001134995.1 alpha/beta hydrolase domain-containing protein [Mycobacterium gilvuMGMAALDPVLQTVLDAVPFQLTTDGGPEAARRRFRDLPRSPVHPDVETQD
RAIDGPAGPIALRIYRPPTEQSVLPVVVFLHGGGWTVGDLDTYDGQARMH
AAGAGAVVVSVDYRLAPEHPYPAAVEDVWAATRWVADNADQIGADADRVA
VAGDSAGGNLAAVTAQSARDAGIALRFQLLWYPSTTFDTSLPSFRENADA
PILDLASCKGFSRWYVGDLDLSGPSGPPVTLVPARGDLTGLPPAYIAVAG
HDPLRDDGVRYAELLTAAGVPVELHHAESLVHGYLGYAGIVPAATEATER
GLEALRAALA
145224316YP_001134994.1 YhhN family protein [Mycobacterium gilvum PYR-GCK]MTRTLWISAAVVAAAYGVFLIVTATQVHAGAELTGRFVLQPAVKALAAVL
LAGAALTHGVVRERVWLVGALLFSAAGDYLLAMPWWEPSFVLGLAAFLVA
HLCFLAALLPLARRTPVRVAAVIVTVLACAALLVWFWPRLLEQGMAVPVT
AYIGVLGAMVCVALLADLPTPWTALGAVCFAVSDAMIGINVFVLGSEALA
VPIWWVYATSLLLITAGLLFGRRSEPSATPAL
145224315YP_001134993.1 primosome assembly protein PriA [Mycobacterium gilvum PYR-GCK]MLTVPHLDREFDYLVPAEQSDDAQPGVRAKVRFHGRLVDAFVLERRSDTD
HVGKLGWLDKIVSPECVLTHDVRRLVDAVAARYAGTRADVLRLAVPPRHA
TVEKKPPVSVEPFTVAPVDTAAWAAYSGGAQFVSALQDARAARAVWQALP
GETWPHRLAEAAAVTVGAGRGVLAVVPDQRDVDLLHAAAIERVDAGRVVA
LSAGLGPAERYRRWLSVLRGQARVVIGTRSAVFAPVADLGLVLMWDDGDD
SLAEPRAPYPHAREVAMLRAHQLRCAAMVGGYARTAEAQALVRSGWAHDL
TATRQTVRAHAPRVIALEDSAYAHERDAAARTARLPTVALDAARSALAAN
MPVLVQVPRRGYVPALSCAKCRAVARCRHCTGPLSLPARDAPGVVCRWCG
REEPSMRCARCGSDAIRAVVVGARRTAEELGRAFPGAQVITSGGDDVVAS
VPQRAAVVVATPGVEPVADGGYGAALLLDSWALLGRQDLRAAEDTLRRWM
AASAMVRSRADGGVVAVVAESAIPTVQALIRWDPVGHAEAELDGRTEVGL
PPATHMAALDGVPAAVDALLHAAALPDGAEVLGPVDLPVGARRPAGIAVD
VTVSRMLVRVPRDGGLELAAALRRATVVQSARHDHEPVRVQIDPLHIG
145224314YP_001134992.1 hypothetical protein Mflv_3732 [Mycobacterium gilvum PYR-GCK]MTAGRVLKALIPLILIAFGVLWPVVFDGGSGDPTDIDDPVVISHYDVNMA
IAADGTMTAVETITTEFYSTDRHGIFRYWDVANQNDPHLRQKPEIQSILL
DGRPVTYQMLWEDAGRFRVAKIGDADRYLSDGTHVFEIRYTIPGVLDPGD
VGADRQFAETVGGGTPSESVFFWNVIAPAWNNRIERADVTLTLPGGAGAA
QCSVGFGVGRGCDGLTVDGNRVRFSAQDLPPRTPVTVRAGVDVPTPPRAT
LPWPYTWDRVLGQSVSGAVGVGALAVLLGAVALLWFRSVLEKPPGFPLQY
APPPGLGPVQAEYIRTESVSKHGLTATLFYLAEQDLIRLRQVNDTHWKIT
STAEPGRWGDVDPVSVAVASRLKIINRGSEFEAKKTAKSGEKLNKAKTDM
AKAVESWALDSGLMVPRRKELWLRAANAVAFILMVCAFFRWGFPATMWAV
PFAVFFLLSAGSWRDGVGTRRTAAGRDLWSRVGGFHRLLSTDSAESRFDF
SARKDLYIAYVPFAVAAGVAAVWAQKYQDYTGSVAPQPEWYGSSHSSSSG
TAFSGGAGGGDFDSFESALSSSIGAYTASQASSSSSGGGSSSSSGGGGGG
GGGGGGGSW
145224313YP_001134991.1 LemA family protein [Mycobacterium gilvum PYR-GCK]MVSFLLAVILVVAVLVLIGFVMGYNRIRSADVRVAEALSGIDVELTRRAS
LIPSLVHTVQTFAAHEKAVLDHVTDARAALTSATGGNSVAERSAAEQRLD
SALEPLWALGQSYPQLNSSTNFLDLQRNLADTEDKLAFARQYYNDAVATL
NRQLSTIPWMFVAPLTGVTEREYYQTPRA
145224312YP_001134990.1 methionyl-tRNA formyltransferase [Mycobacterium gilvum PYR-GCK]MRLVFAGTPEPALPSLQRLIDSARHDVIAVLTRPDAAAGRRGRPSPSPVA
ELAAAHGIPVLKPPRPNSEEFVAELAALAPDCCAVVAYGALLREELLAVP
ALGWVNLHFSVLPAWRGAAPVQAALAAGDEVTGATTFQIELSLDSGPVYG
VVTETIRPTDTAGDLLGRLAESGAGLLEATMDGIEDGTLTAVPQPAEGVS
IAPKVSVDDARIRWELPAHVVDRRIRSVTPNPGAWTMAGELRIKVGPVTV
PDDGPKDLEPGEIRVGKKHVHVGTATDAVLLGTVQPPGKKSMNAADWARG
ARAEDIRRAR
145224311YP_001134989.1 Fmu (Sun) domain-containing protein [Mycobacterium gilvum PYR-GCK]MTRPDKKRPPRRKRLDPARQAAFDVLRAVSERDSYANLALPALLRDRRIT
GRDAAFATELTYGTCRAKGLLDAVIAAAAGRPVDHIDPILLDLLRLGAYQ
ILRTRVDDHAAVSTTVEQAGLEFDTARAGFVNGVLRTIARRDEADWVAEL
APPAATDPVGHLAFVHAHPRWIGQAFADALGARAGELGALLASDDSRPEV
HLAARPGMLTAAELAEQTGGTVGRYSPYAVYLGDGDPGGVAAVRESRALV
QDEGSQLVARALTLAPVDGPDGGRWLDLCAGPGGKTALLAALGQPSGATV
TAVEPAPRRAELVEQNTAGLPVDVVRVDGRESGLTPGFDRVLVDAPCTGL
GALRRRPEARWRRQPGDVPALAKLQRELLAAAIRLTRPGGVVLYATCSPH
LAETAGVVADALRRQPVTALDTGELFSPATDTGDGPSVQLWPHRHGTDAM
FAAALRVDAAAR
145224310YP_001134988.1 ribulose-phosphate 3-epimerase [Mycobacterium gilvum PYR-GCK]MPKPLIAPSILAADFARLAEEAAAVDGADWLHVDVMDNHFVPNLTLGLPV
VESLLKVTDIPMDCHLMIENPERWAPPYAEAGAYNVTIHAEATDNPVAVA
RDIRAAGAKAGLSIKPGTPIEPYLEILREFDTLLVMSVEPGFGGQKFIAE
VLPKVGIARRLVDSGELTIVIEIDGGINADTIEEAAEAGVDCFVAGSAVY
SAEDPAAAVQSLRSQAAAASRHLVL
145224309YP_001134987.1 riboflavin biosynthesis protein RibD [Mycobacterium gilvum PYR-GCK]MNLDAAMAAAIVQSERVKGRTYPNPPVGAVILDSDGEIAGVGATAPTGGP
HAEVVALRRAGERAAGGTAVVTLEPCNHFGRTPPCVDALIDAGVAAVAFA
VADPNPAAAGGAARLAAAGVRVSAGVVADAVTGGPLREWLHKQRTGKPHV
TWKFAASVDGRSAAADGTSQWITSEASRADVHRRRAAADAIVAGTGTVFA
DDPALTARLPDGSLADHQPLRVVVGMREISPDATVLNDDSRTMVIRTRDP
HEVIQALTDRTDVLVEGGPTLAGAFLRAGAIDRILAYVAPILLGGPVTAV
DDVGVSSITQAHRWRFDGMQAIGPDVLLSLVPN
145224308YP_001134986.1 hypothetical protein Mflv_3726 [Mycobacterium gilvum PYR-GCK]MFGLTGVMLIQSCSAVMVVVSFVRAHHAQLNGESAIFPPYSAYSAASGRS
LPRSGVRSARHASWARCVLAHPSGYTPILETIE
145224307YP_001134985.1 major facilitator transporter [Mycobacterium gilvum PYR-GCK]MPTITAPAATNRLIAISAGSLAVILGALDTYVVVTIMVDIMSDVGIGINE
IQRVTPIITGYLLGYIAAMPLLGRASDRFGRKMLIQVSLAGFALGSVVTA
MSTDLDILVLGRVIQGTASGALLPVTLALAADLWAARNRAAVLGWVGAAQ
ELGSVLGPIYGISLVWLFHHWQSVFWVNVPLALVAMVMIHFSLPGRMETE
VPQKIDVVGGLLLAVALGLAVIGLYNPKPDGKEVLPSWGVPVLIAALIAA
VAFFVWEKFARTRLLDPKGVRFRPFLAALGASLAAGAALMVTLVNVELFA
QGVLGKDQIEAAFLLLWFLAALPVGALLGGWLATRVGDRIIAFAGLLIAA
GGYLLISHWPADVLEARHSIGFLSLPVLGTDLIITGFGLGLVIGPLTSAT
LRVVPSAQHGIASAAVVVSRMIGMLIGIAALSAWGLYRFNQHLASLPASA
GGDSLAERLAAEANRVREAYVLQYAEIFTITAVVCVVGAVLGLLIAARDT
HAEETDPVENAQQRSSPRPIS
145224306YP_001134984.1 hypothetical protein Mflv_3724 [Mycobacterium gilvum PYR-GCK]MPPGRPAARSTRPDTRTLYDAGMQTRLLAIFAALFAAVALLAGCSSSSTE
DSGKDLPDPTTLLSESSETTRNQTSAHLTLSVQGQIAELPVEQLEGDLTQ
TPAVAAKGTANIIFLGQRLNDVEFVVSDGDLWATITAGGSLSNFGPAADV
YDVAAILDPNVGLANVLANFSNPSADGRETVEGTQTVRVTGEVSADAVNK
IAPQIGATGPVPGTAWVAEEGDHKLMQVRLEPSPGNSVTMTLSKWGEPVT
VDKPAV
145224305YP_001134983.1 alpha amylase [Mycobacterium gilvum PYR-GCK]MRTIETGDLWWKNAVVYCADIETFYDWNGDGCGDIRGMTERIEYLADLGI
TCLWLMPFYPTARKDDGYDITDFFGVDERLGNLGDFVELIRTAGSHGIRV
IVDFVMNHTSDAHPWFKSARRGTDDPYRDYYVWTATEPPDTSEDVVFPDQ
EDSLWELDPKTGQWYLHHFYKHQPDLNIANPQVQEEISRTLGFWLQLGVA
GFRVDAVPFLFARDGAPGDPGVFDPFQYLGDVRNFVTRRVGDAVLLGEVN
VPYKDQKAFFGGSDGDGLNMQFDFIGMQSMYLSLARGDARPLAKALRSRP
SLDVTSQWANFARNHDELTLDKLSDSERQEVFDAFGPDPDMQLYDRGLRR
RLPSMLGADQRRMRMVYSLAFSLPGTPVLFYGEEIGMAENLDVPGRFAVR
TPMQWTSGTNGGFSTAPKRRLPRPLPEGLFGPDRVNVADQRRDHRSFWWF
VRDLIYTYRQQPEIGWSTVEILKQPHTAVLAHVCRESSGWAMVGLHNFGA
DGCLVPLTLGDLPEGSRLVDLLDGRAEFPVDARGGIELSLEGYGYRWLRL
LRPDDPPII
145224304YP_001134982.1 dehydrogenase [Mycobacterium gilvum PYR-GCK]MTVIGFHCSHEQIPPGQLLHDVQHAEQAGFTAAMSSDHFSPWSERQNESG
FAWAFLGAALATTKLPFGVVNAPGQRYHPAIIAQAIATLAQMFPGRIWAA
LGSGEASNERITGDVWPRKEIRDQRLVECVDVIRRLLKGEEVSVDGLIHV
NRARLWTLPETVPDLVGPAVTPATAARHAAWADALITVNQPAETLRQVLD
SYRDAGGRGPARLQIHLSWAPTDEEALAIAHDQWRTNVLGPPVSWDIETV
EAFDTIGEAVTPEQMEPSVRISSDLGRHAAWLQEYLDQGWDELYLHFVGQ
HQRSFIDAFGEHVLPQLSPSAPAVP
145224303YP_001134981.1 riboflavin synthase subunit alpha [Mycobacterium gilvum PYR-GCK]MVFTGIVEELGEVVGVEDLGDSARLVIRGPIVTSDAGHGDSIAVNGVCLT
VVDVLADGSFSADVMAETLNRSSLRGVDVGARVNLERAAAINSRLGGHIV
QGHVDGTGHIVSRTPSEHWTVVRIALPETLARYVVQKGSITVDGVSLTVS
GLGPDWFEVSLIPTTLDMTTLGRAAVGAPVNLEVDVIAKYVERLLGQRDP
SGG
145224302YP_001134980.1 hypothetical protein Mflv_3720 [Mycobacterium gilvum PYR-GCK]MGPVRDDRTGRGGGRPAGRRPYRRDTGHAGAPAVGEHLRRRHQAGDRSRG
RGAVPPDGRQFPGALCSGGIESHLRGLSPQPRNGDRLHRPTYNESEADAA
AKIVRGIRQARADDPTGTIYVVGYSQGAGTVAGALAELERDPDFHTGDVE
FVLASNPRRNSGGILTRLPAGVYVPLVGVTFGEGTTPERTKVLQVSKMYD
GISDAPDFVLNIAADANAVLGFVYLHSGYYQEIDPNDPSAIVTTSRDGLV
TDKLIPTPVGQLPLTMPLLELGVPPDLVTALDPFLRAVIETGYERPDAGV
AGTFPSEPVPFRLVPPPTRWVSDAQTVAAGAVRSAQLLSDVAESTPTIVR
QRPVVSAPRRDDALPAVELDFGDVAEPSDDIERPARLRGPRLWAADREDT
GRAFSGWRPGDLMRSAWEQQPPTGSRAADAEPDDDAGKTDAGKTDAAKTD
PSTADDQS
145224301YP_001134979.1 bifunctional 3-4-dihydroxy-2-butanone 4-phosphate synthase/GTP cyclMTRLDSVERAVADIAAGKAVVVIDDEDRENEGDLIFAAEKATPELVAFMV
RYTSGYLCVPLAGEICDRLGLLPMYAVNQDKHGTAYTVTVDAKVGVGTGI
SASDRATTMRLLADPDSVADDFTKPGHVVPLRAKDGGVLRRPGHTEAAVD
LARLAGLQAAGTICEIVSQKDEGAMAQTDELRIFADEHDLALISIADLIE
WRRKHEKHIARVAEARIPTRHGEFRAVGYTSIYEDVEHVALVKGDIAGPH
GDGHDVLVRVHSECLTGDVFGSRRCDCGPQLDAALAMVAREGRGIVLYMR
GHEGRGIGLMHKLQAYQLQDAGDDTVDANLKLGLPADARDYGTGAQILVD
LGVRSMRLLTNNPAKRVGLDGYGLHIIERVPLPVRANAENIRYLMTKRDR
MGHDLVGLDDFDEAVPGEFGGAV
145224300YP_001134978.1 6-7-dimethyl-8-ribityllumazine synthase [Mycobacterium gilvum PYR-GMSGAGVPDMPALHAEDVTLAIVASTWHETICDALLDGARKVAEQAGVTDP
TVVRVLGAIEIPVVAQALARTHDAVIALGVVIRGETPHFDYVCDAVTQGL
TRVSLDASTPVANGVLTVNTENQALDRAGLPNSAEDKGAQAAAAALSTAL
TLRQLASPS
145224299YP_001134977.1 hypothetical protein Mflv_3717 [Mycobacterium gilvum PYR-GCK]MSGDWDLEVKPHLTPIFAWGAAVIIVVAHVAVGALLKVGSSGVVFRTADQ
VAIALVGVVIACFVTLFARPRLRVGPSGVAVRNLFGYRLFPWTEVVDVSF
HEGARWARLDLPDDEYVPVMAIQAVDKGRAVESMDTVRALITRYLDDVNS
QERPRRP
145224298YP_001134976.1 gamma-glutamyltransferase [Mycobacterium gilvum PYR-GCK]MAVMWATRRTTTSALRVLLGLSLILTGCTARQDTPAAPPGPCDIVANGTP
VSSDGGRSDDTAPETATGYRSDMTAVHTRSYAVATANPLATRAACEVLRD
GGTAADALVTAQAVLGLVEPQSSGLGGGGFLLYYDAAAQSVQAFDGRETA
PAAATENSLRWISDTDRTEPKPDARASGRSIGVPGIVAMLAQVHAEHGRT
PWRDLFSPAVTLADDGFDVSARLAAAIAAAAPKLALDDDAAAYFLNADRT
PKSAGTTLTNPAYAKTLGAVAADPEAFYTGDIARAIVASVTDPSGGRTPG
LMTVEDLADYTVKQRDPLCTPYRGKEICGMPPPSSGGIAVAATLGMLERF
PMADHAPTDVDLNGGRPSVMGVHLISEAERLAYADRDRYVADTDFVALPG
GSPDTLLGNDYLAGRAALISPDRSMGTAEPGNFGPPTAPVPPTPEHGTSH
VSVVDRDGNAASLTTTVESAFGSFHMVDGFLLNNQLTDFSAEPAGPDGAP
VANRLEPGKRPRSTMAPTLIFDTSGPDRRLYAVAGSPGGSTIIQFVVKTV
VGMLDWGLDPQQAVSMVDFGADNSPETNVGGEHPVIDTADDGADDPLVRG
LRELGHKVDLADQSSGLSAIVRAGDGWVGGADPRREGAVMGDGDAPVS
145224297YP_001134975.1 excinuclease ABC subunit C [Mycobacterium gilvum PYR-GCK]MPDPATYRPAPGSIPVEPGVYRFRDPHGRVIYVGKAKSLRSRLNSYFADI
SGLAPRTRQMVMTASSVEWTVVGTEVEALQLEYNWIKEFDPRFNIRYRDD
KSYPVLAVTLNEEYPRLKVYRGPRRKGVRYFGPYSHAWAIRETVDLLTRV
FPARTCSNGVFKRHSQIDRPCLLGYIDKCSAPCVGRVSAEQHRQIVQDFC
DFLAGKTDRLIREMEQQMTAAAEDLDFERAARLRDNIGAMRRAMEKQTVV
LGDGTDADVVAFADDELEAAVQVFHVRGGRVRGQRGWVIEKSGEPGESTL
EYLVEQFLTQFYGDQAELGGASDAGGDEASNPVPKQVLVPVLPETTDELE
TWLSQLRGSRVALRVPQRGDKRALAETVKRNAEGALNQHKLKRAGDFTAR
SAALQSIQENLGLQDAPLRIECIDISHVQGTDVVASLVVFEDGLPRKSDY
RHFAIREAAGDGRSDDVASIAEVTRRRFHRHLRDMQEPGEMVAEGRSRRF
AYPPNLFVVDGGAPQVNAAQAVLDDLGISDVAVIGLAKRLEEVWVPNLDG
TAPDPIIFPRNSDGLYLLQRVRDEAHRFAISYHRSKRSKRMTASALDSVR
GLGEHRRKALVTHFGSLARLKQATVEEITEVPGIGAATARAVLDALGIEA
PPEPGAEAPPDSGAAAAVMGNDQSRVPG
145224296YP_001134974.1 hypothetical protein Mflv_3714 [Mycobacterium gilvum PYR-GCK]MTRQGMRDDLRGEADSVVHDGTDDIDNENDIDNGIDNENGNGIDVVLVTG
LSGAGRGTAAKVLEDLGWYVADNLPPELIAQMVDLGLAAGSRITQLAAVM
DVRSRGFTGDLDWVRSELATRNIVPRVVFLEASDDILVRRYEQNRRSHPL
QGNQTLAEGIAAERAMLAPVRASADLVIDTSALSVHGLRDSIERAFAAET
VAHTNVTVESFGYKYGLPMDADTVMDVRFLPNPHWIDRLRPHTGQNADVR
DYVLGQPGADEFLDSYHQLLNVVIDGYRREGKRYMTVAIGCTGGKHRSVA
MAEALAARLAGSDALTVRVLHRDLGRE
145224295YP_001134973.1 hypothetical protein Mflv_3713 [Mycobacterium gilvum PYR-GCK]MSPRIVALGGGHGLYATLSAARRLTPHVTAIVTVADDGGSSGRLRNELDV
VPPGDLRMALAALASDSPHGRLWATIIQHRFGGSGALAGHPIGNLMLAGL
NEVLADPVAALDELGRVLGVKGRVLPMCPVGLSIEADVVGLESDPRVSRA
IRGQVAIATTVGKVRRVRLLPSDPPATPQAIDAIMNADLVVLGPGSWFTS
VIPHVLVPQLAAALQATTARRALVLNLVAEPGETAGFSVERHIHVLAQHA
PGFTVHDIIVDSARVTGDRDREQLRRTATIIGADVEFADVSRPGTPLHDP
ARLAAALDGVRKRGSTTAVAQPTVPTPTVNGPRGDDPWR
145224294YP_001134972.1 hypothetical protein Mflv_3712 [Mycobacterium gilvum PYR-GCK]MTAEVKDELSRLVVNSVSARRAEVASLLRFAGGLHIVSGRVVVEAEVDLG
IIARRLRKDIYDLYGYSAVVHVLSASGIRKSTRYVVRVAKDGEALARQTG
LLDLRGRPVRGLPAQVVGGSVADAEAAWRGAFLAHGSLTEPGRSSALEVS
CPGPEAALALVGAARRLGVSAKAREVRGSDRVVVRDGEAIGALLTRMGAQ
DTRLTWEERRMRREVRATANRLANFDDANLRRSARAAVAAAARVERALEI
LGDTVPDHLAAAGTLRVAHRQASLEELGRLADPPMTKDAVAGRIRRLLSM
ADRKAKQDGIPDTESAVTPDLLEDA
145224293YP_001134971.1 extracellular solute-binding protein [Mycobacterium gilvum PYR-GCK]MTLRVGVVCPEPPFNSMPGQTGLDIEVMTALADAIGEQAEFTDCDCADYD
GVFDRLAAGDVDCVIAGSTVTPEREGRAAFLPPYLISGQGLAVDTTRLPH
VRSADDLSGLTIGVQRGTTSERVAEELVAEGRAERVRVYDYGAIGTAIAD
LVTGGCDAVMKLAPALAELVKDVPEVDVVQRGLSVEEIAIAVNPSDQQLL
ARLQVAQAELEADGTLQRIRRRWLGNPYVNQSSGVF
145224292YP_001134970.1 glyceraldehyde-3-phosphate dehydrogenase- type I [Mycobacterium gilMERLLLGWLPSIADDSLIEPEETHVTIRVGVNGFGRIGRNFFRALDAQKA
AGKNTDIEIIAVNDLTSNATLAHLLKFDSILGRLPYDVSLEGEDTIVVGD
TKIKALEVKEGPAALPWGDLGVDVVVESTGIFTKRDKAQGHLDAGAKKVI
ISAPASDEDITIVLGVNDDKYDGSQNIISNASCTTNCLGPLAKVLNDEFG
IVKGLMTTIHAYTQDQNLQDGPHGDLRRARAAAINIVPTSTGAAKAIGLV
LPELKGKLDGYALRVPIPTGSVTDLTAELAKPGTVDEINAAMKAAADGPL
KGILKYYDAPIVSSDIVTDPHSSLYDAGLTKVIDNQAKVVSWYDNEWGYS
NRLVDLVGLVGKSL
145224291YP_001134969.1 phosphoglycerate kinase [Mycobacterium gilvum PYR-GCK]MGIKSLDDLLAEGVSGRGVLVRSDLNVPLDGGSITDPGRIIASVPTLKAL
SDAGAKVVVTAHLGRPKGEPDPKFSLAPVGAALGEKLGRHVQLAGDVVGS
DALARAEGLTDGDILLLENIRFDGRETSKDDAERLKLAKALVELVGDDGA
FVSDGFGVVHRKQASVYDVATLLPHYAGTLVDTEVKVLAQLTESTERPYA
VVLGGSKVSDKLAVIENLATKADSLIIGGGMCFTFLAAQGLSVGSSLLEE
SMIDTCRTLLDDYGDVLHLPVDIVVAEKFSADSEPQTVAADKIPDDKMGL
DIGPESVRRFSALLSNAKTIFWNGPMGVFEFPAFAAGTKGVAEAIIGATG
KGAFSVVGGGDSAAAVRQLGLPEDGFSHISTGGGASLEYLEGKELPGIEV
LN
145224290YP_001134968.1 triosephosphate isomerase [Mycobacterium gilvum PYR-GCK]MTRKPLIAGNWKMNLNHFEAIALVQKIAFSLPDKYFDRVDVTVIPPFTDL
RSVQTLVDGDKLRLTYGAQDVSQHDSGAYTGEISGAFLAKLGCTFAVVGH
SERRTYHGETDELVAAKATAALKHGLTPIVCIGEQLEVREAGNHVEFNVN
SLRGSLAGLSAEQIAQTVIAYEPVWAIGTGRVASAADAQEVCKAIRDELG
NLASADVAAGVRVLYGGSVNAKNVGEIVGQGDVDGALVGGASLDGEQFAT
LSAIAAGGPLP
145224289YP_001134967.1 preprotein translocase subunit SecG [Mycobacterium gilvum PYR-GCK]MQLALQITLVVTSVLVVLLVLLHRAKGGGLSSLFGGGVQSSLSGSTVVEK
NLDRVTLFVTGIWIVSIIGMALSIKYGV
145224288YP_001134966.1 phosphoenolpyruvate carboxylase [Mycobacterium gilvum PYR-GCK]MPSSPATPDQSLEPIGAVQRTQVGREATEPMREDIRLLGTILGDTVREQN
GDEVFDLVERARVEAFRVRRSEIDRADMAKLFDDVDVHRAIPVIRAFTHF
ALLANVAEDIHRERRRRIHEAAGEPPQDSRLDATYLKLDDAGLDAGAVAD
ALAGALVSPVITAHPTETRRRTVFDTQHRITELMRLRLHGHDTSPDGRDV
EQELRRHILTLWQTALIRLSRLKIQDEIETGLRYYEAALFEVIPQVNAEV
RAALQQRFPEAGLLEQPIVRPGSWIGGDRDGNPNVTAEVVRLATGSAAYT
ALAHYFAELTGLEQELSMSARLVHITDELAALADSCHEPARADEPYRRAL
RVVHARLTATAQQILDRQPEHELDLGMEPYAAPGELLDDLDVIDASLRAN
GSAVLADDRLGRLREAVRVFGFHLSGLDMRQNSDVHEEVVAELLAWAGVH
SDYTSLSEDDRVEVLAAELATRRPLTSPDADLSELARKELDIVAAAARAV
HVFGPQAVPNYIISMCQSVSDMLEAAILLKEAGLLDASSEHPYAPVGIVP
LFETIDDLQRGSSILEAALELPLYRGLVSARGDSQEVMLGYSDSNKDGGY
LAANWALYRAELELVESSRKTGIRLRLFHGRGGTVGRGGGPSYDAILAQP
PGAVQGSLRITEQGEVIAAKYAEPRIAHRNLETLLAATLEATLLDMEGLG
DLAGTAYEVLDDLAARAQRAYAELVHDTPGFVDYFKASTPVSEIGALNIG
SRPTSRKPTTSISDLRAIPWVLAWSQSRVMLPGWYGTGTAFEDYVGDGDD
AEARLQVLQDLYRRWPFFATVLSNMAQVLAKSDLGLAAHYSELVEDEELR
RRVFDKIVDEHARTIRMHRLITGHEDLLADNPSLARSVFNRFPYLEPLNH
LQVELLRRYRSGDEDDLVQRGILLTMSGLATALRNSG
145224287YP_001134965.1 hypothetical protein Mflv_3705 [Mycobacterium gilvum PYR-GCK]MADKGGRPVRTGPERIRKLAQAALNADVTVEQVDTILEGLSETLEDLNHS
MEKLDVTLERFNGAITHINELAPRLIAVVDRMEGIVTRVERIVGMGESVI
MPLAATEQVIRGALGRVRKSAGL
145224286YP_001134964.1 hypothetical protein Mflv_3704 [Mycobacterium gilvum PYR-GCK]MNMRVALFATCYNDLMWPETPKAVVRLLRRLGCEVEFPAEQTCCGQMFTN
TGYAEEAIPAVRNFIATFAGYDAVVAPSGSCVGSVRHQHRDIAARAGCRA
MQNEVDTLAPNVYELSEFLVDVLGVTDVGAYFPHRVTYHPTCHSLRMLRV
GDRPLALLRAVRGIDLVELPGADQCCGFGGTFAVKNADTSVAMGADKARA
VRETEAEVLVAGDNSCLAHIGGLLSRQRSGVRVMHLAEVLAAEGAS
145224285YP_001134963.1 iron-sulfur cluster binding protein [Mycobacterium gilvum PYR-GCK]MSGHPHVGVTRQFLGMPTFQTAAREALQDAVLRRNLAHATGTIRAKRARV
VAELDNWEQLRLAAEAIKDAALHRLDEHLVEFEAKATAAGATVHWARDAE
EANLIVVDLVRAAGATEVVKVKSMATQEIELNEALAEAGIDAWETDLAEL
IVQLGDDWPSHILVPAIHRNRAEVREIFLREMGKVGRPAPEDLTDEPRRL
AEAARLHLREKFLRATVAVSGANFAIADTGSLVVVDSEGNGRMCLTLPET
LISVVGIEKVLPSWRDLEVLLQVLPRSSTGERENPYTSIWTGPADGDGPQ
NVHIVLLDNGRTQVLADPKGRDALRCIRCSACLNVCPVYERAGGHSYGSV
YPGPIGAVLTPQLRGTASEIDRSLPYASSLCGACFDVCPVRIDIPSMLVH
LRTRVVDENRGGIPSAEQIAMKAGGWVMADHRRLSGVEKMAGAGGKVLRS
RALGGKENLTSLPWPARGWSEARDAPVPPVESFRSWWERTEGGTRE
145224284YP_001134962.1 hypothetical protein Mflv_3702 [Mycobacterium gilvum PYR-GCK]MSEAREQILGRIRAALSDRPDAPGVPWTYGSAVGTGAVDVVDRFIERVAD
YRAQVSRVDDAGPAIALALNGFGHVVADEDVIREWPEVESWVSDSGLSAA
ELDAVDAVVTTATVGIANTGTIVLSHGPGQGRRALSLVPDVHVCVVRVDQ
IVDDVPHAVARLIESGLHTRPLTWISGPSATSDIELDRVEGVHGPRTLRV
IVVG
145224283YP_001134961.1 hypothetical protein Mflv_3701 [Mycobacterium gilvum PYR-GCK]MIKTFLPGWADTQHPDGTLTITTPTGTHCVTKPLSSLLFPNWNTTTTPTP
PRPQSPSPPRPGRNLRMPIRRRTRAHNRAAYITRERRLNATERAAEGGRG
RVTPKATPRPTLWPDPAHPPDYGNDPPPF
145224282YP_001134960.1 integrase catalytic subunit [Mycobacterium gilvum PYR-GCK]MSQKYAFIAAEHADGATFAGMAPTIVQMLKWLGVSKSGFYEWWGRPASAA
MCRREELKLKIAALFTSFGAVYGYRRIHAELVRAGERVGPELVRTLMREL
NLVALQPKPYKRTTIAGESATAVPDLVARDFTADRPGVKLVGDITYIRTW
AGWLYLATVIDCFNKEVIGYAMADHMRTELATGALEMAARNHALEPGCIM
HTDRGTQYTSTDYAIKIADLDMRASLGRTGICWDNALAESFFAALKNERV
HHMVYPTRKKARADIARYIELFYNRRRLHSALGYRTPHEVRIEYMNSQLA
A
145224281YP_001134959.1 hypothetical protein Mflv_3697 [Mycobacterium gilvum PYR-GCK]MTATTSYPLLQIALVVFGAVMLLLYPLAAVWPSGWAWHDGAPHESQYFMM
IVGIYAVLGASLCNAARRPEANVSLIWFTVWSSVVHAAIMAVQSMSDTHH
HGHLWGDVPALLLAAGVLAFLVRRSELGRRGFVE
145224280YP_001134958.1 6-phosphogluconolactonase [Mycobacterium gilvum PYR-GCK]MTMNIETYPDTEALVAATGDRLVEAIKAAIAARDVAAIALTGGGTGIGLL
RRVGERGDEIDWSKVHIYWGDERFVPADDDERNEKQAREALLDHVGIPEA
NVHVMAPSDGEFGDAIDAAAEAYAQVLAEAGPDPTPAFDVHLLGMGPEGH
VNSLFPDTDAVKESKRFVVGVTDCPKPPPRRITLTLPAVQRSREVWLVVS
GEGKADAVAAAIGGAQPVDIPAAGAVGTEATVWLLDEAAASKL
145224279YP_001134957.1 OpcA protein [Mycobacterium gilvum PYR-GCK]MIVELSDTTTNEINKKITGLREEGGALTLGRVLTLVITPDCEENLASAIE
AANFASREHPCRVIVALQADRSAAARLDAELRVGRDAGAGEVVVLRLYGE
LADHADSVVLPFLLPDTPVVAWWPASAPETPAEDPVGKLAIRRITDATLA
SDPLAAIKSRLPGYSPGDTDIAWSRITYWRALLASAIDEPPHEPIERAVV
SGLKAEPALDILAGWLASRIDGEVTRVVGTLKVELHRASETVTLSRPQEG
LTATLSRTSRPVALIPLARRDIPDCLAEELRRLDADEIYREALTGLDKVI
YQ
145224278YP_001134956.1 glucose-6-phosphate 1-dehydrogenase [Mycobacterium gilvum PYR-GCK]MTEPWRNPLRDKRDKRMPRIAGPCSVIIFGVTGDLARKKLMPAIYDLANR
GLLPPSFALVGFARRDWADEDFGQVVYEAVKKHARTPFRQEVWDRLAEGF
RFVQGTFDDDDSFARLAETLNTLDVERGTGGNHAFYLSIPPNAFPVVCEQ
LQKSGLARQKDHSWSRVVIEKPFGHDLDSARELNNVVNSVFPEESVFRID
HYLGKETVQNILALRFANELYEPIWNSHYVDHVQITMAEDIGLGGRAGYY
DGIGAARDVIQNHLIQLLALTAMEEPVNFSPHELQAEKIKVLGATRPLGP
LDQTTARGQYAAGWQGSERVPGLLEEDGFATDSVTETFAAITLEVDTRRW
AGVPFFLRTGKRLARRVTEVALVFKRAPHLPFDATMTEELGKNALVLRIQ
PDEGITMRFGSKVPGSAMEVRDVNMDFSYGSAFAEDSPEAYERLILDVLL
GEPSLFPVNAEVELSWEILDPVLENWAQNDDASAPLDPYVSGTWGPPSAN
DMVRRLDREWRRP
145224277YP_001134955.1 transaldolase [Mycobacterium gilvum PYR-GCK]MTQNPNLAALSEAGVSVWLDDLSRERLQTGNLQELIDTKSIVGVTTNPSI
FQAALSAGEAYDDQIRELAERGADVDATIRTVTTDDVRNACDVFAKIYEQ
SGGVDGRVSIEVDPRLAHDTDKTILQAIELWKIVDRPNLLIKIPATEAGV
PAIASVLAEGISVNVTLIFSVERYRLVMDAYLQGLEKAKEAGHDLSRIHS
VASFFVSRVDTEIDNRLEKIGSEEALALRGKAGVANARLAYAAYEEIFLG
GERFAALKDAGARVQRPLWASTGVKNPDYSDTLYVTELVAPDTVNTMPEK
TLDAVADHGVVTGDTVTGRAGESQEIFDQLAALGIDLTDVFLVLENEGVE
KFEKSWQELLEATQGQLDDKK
145224276YP_001134954.1 transketolase [Mycobacterium gilvum PYR-GCK]MTTIEEINSLTRPNHPDDWTDLDSRAVDTVRILAADAVQKVGNGHPGTAM
SLAPLAYTLFQRQMRHDPSDVHWLGRDRFVLSCGHSSLTLYIQLYLGGFG
LELSDIEALRTFKSKTPGHPEFRHTPGVEITTGPLGQGLASAVGMAMAAR
YERGLFDPDTAPGESPFDHHIFVIASDGDIEEGVTSEASSLAGTQQLGNL
IVFYDKNHISIEHDTDIALSEDVAARYRAYGWHVQEVEGGENVVGIEEAV
QAAKAVTDKPSLISVRTIIGYPAPNKMNTGGVHGSALGDDEVAEVKKILG
FDPDKTFEVSEDVITHTRGLVARGKEAHEAWQQEFDAWAQREPERKKLLD
RLTAEELPDGWDADITYWEPGSKAVATRAAFGQVLNDVAPKLPELWGGSA
DLAGSNNTTIKGVKSFGPPSISTDDFSADWYGRVLHFGIREHAMGSILSG
IVLHGPTRAFGGTFLQFSDYMRPAVRLASLMDIDTIYIWTHDSIGLGEDG
PTHQPIEHLAALRAIPNLSVVRPGDPNETAYAWKSIIARGNGSGPVGFIL
TRQGIPVLEGTDAEGVSRGGYVLGGGNPADDADVILIATGSELQLAVEAK
KLLADKDINAAVVSMPCVEWFESQPKEYRDSVLPPGVSARVAIEAGVAQS
WYKLVGDTGEIISIEHYGESADDKTLFREFGFTPEAVVAAAERTIEN
145224275YP_001134953.1 protoheme IX farnesyltransferase [Mycobacterium gilvum PYR-GCK]MRIREGHLINDSAEGPIGLRTRLMGYIGLTKPRVIELLLVTTIPAMLLAD
RGTVDPLLIINTLVGGLLAAAGANTLNCVADADIDKKMKRTERRALARAT
VPRSHALIFGLTLSVASFFWLWSTTNMLSAHLAGATIAFYVLVYTLLLKR
RTSQNVVWGGAAGCMPVMIGWSAVTGTIQWPALVMFLIIFFWTPPHTWAL
AMRYKEDYEAAGVPMLPVVATEQQVTKQILVYTWLTVLATLALALTTGWL
YASVAILAGTWFLVMAHQLYAGVKRGEAVKPLRLFLQSNNYLAVVFVALA
VDSALALPTLLHV
145224274YP_001134952.1 hypothetical protein Mflv_3690 [Mycobacterium gilvum PYR-GCK]MHVSPDNFIRAETDLYFGNIVGDGALGEFTHFRDFGPLDNQLVVRQNRDT
LYSAGVFDLDAGPVTVTLPDAGARFRSLQIITEDHYVPRVIYTPGRHTFD
RAGIGTRYVMLALRTLVDPNDPADLAAVHALQDGVVVDQVACPLFSGLRT
K
145224273YP_001134951.1 transposase IS3/IS911 family protein [Mycobacterium gilvum PYR-GCK]MAKKYQKFSPEFREETARLVVDGQKSIAEVAREHGLSDTTVGNWVRKYRE
THATDEPPLELSERARLRELERENREMAMELAFLKKAAAYFAKEPR
145224272YP_001134950.1 integrase catalytic subunit [Mycobacterium gilvum PYR-GCK]MSQKYAFIAAEHADGATFAGMAPTIVQMLKWLGVSKSGFYEWWGRPASAA
MCRREELKLKIAALFTSFGAVYGYRRIHAELVRAGERVGPELVRTLMREL
NLVALQPKPYKRTTIAGESATAVPDLVARDFTADRPGVKLVGDITYIRTW
AGWLYLATVIDCFNKEVIGYAMADHMRTELATGALEMAARNHALEPGCIM
HTDRGTQYTSTDYAIKIADLDMRASLGRTGICWDNALAESFFAALKNERV
HHMVYPTRKKARADIARYIELFYNRRRLHSALGYRTPHEVRIEYMNSQLA
A
145224271YP_001134949.1 hypothetical protein Mflv_3687 [Mycobacterium gilvum PYR-GCK]MPEWDPGSQKQVRDALAALFATLPDTRGMFGAAGEVDPVRRLIGAAAAWG
GNPERDALYLTVDPAADDGRTPHRLTVGDVPVDGFWSVTVYNAEGYFTPN
PAGAYSVNSVTAVKDADGSVMVRFGGPAGEPNHLPITPGWNYLVRLYRPR
AEILDGSWTFPVAEPG
145224270YP_001134948.1 alcohol dehydrogenase [Mycobacterium gilvum PYR-GCK]MVDMYAIEVAETGGPEVLSFVETSRPSPGPGQVLIKAEAIGVNFIDTYFR
SGLYPRETPFIAGSEVCGVIEEVGEDVAALNVGDRVVTTQSQGAYAEYCV
APADFVAYVPDAVAPEVAASALLKGMTAHYLLKSTYPVQQGDAILVHAGA
GGVGLLLTQWATSLAASVITTVSTPDKAELSRRAGAVEVLDYPSQDAGGA
AAFGDRIRELTDGDGVAAVYDGVGASTFEASLASLAIRGTLALFGAASGP
VPPIDPQRLNTAGSVFLTRPNLAHHTRTPDEFSWRAGELLTAIADGALTV
TVSNRYALREAEQAHRDLQGRRTVGSVVLIP
145224269YP_001134947.1 hypothetical protein Mflv_3685 [Mycobacterium gilvum PYR-GCK]MKLVRPDVFHPRIVLAGCRALPEGDGDDDGLVEALRARGLHARWLAWDDP
ETLGADLVILRATWDYTERPEQFLAWAHRVSHLLNPVEVVGWNTDKRYLS
DLAAAGVPVVPSAFFEPGEQVRIPDGEVVVKPAVGAGSVGAERFSDPTHA
HAHAAALQAAGRTALVQPYDARIGDGETALVFLAGEQSHAFTKGPMLPPP
GETPAFDASGTYAEERLAPADPDFELWDLGHRALGAAADHLGLQTSDFLY
ARVDVVGGPDDPRLLELELVEPSLGWRQLPDGDRARQQRRFALAVESALE
RFGLGPFAHRRP
145224268YP_001134946.1 cytochrome oxidase assembly [Mycobacterium gilvum PYR-GCK]MPVGRLFLRLVDLFPEPSLRTQRVIAAAVILTQGGIAVTGAIVRVTASGL
GCPTWPQCFPGSFTPVPHAEVAGIHQAVEFGNRLLTFLVVLTAAAAVIAV
TRARRRREVLFYAWLMPASTVAQAIIGGITVLTGLLWWTVAIHLLVSMAM
VWLAVLLFVKIGEPDDGVPEPRAPKPLRQLTVLSAVTLAAVLVTGTMVTG
AGPHAGDKSPDRPVPRLEIEITTLVHMHSSLLVAYLALLVGLGFGLLAVK
SSPAVRKRLGVVVVLVAAQGTLGAVQFFTGVPEALVALHVAGAAACTAAT
AALWASMRERTQPEPLQR
145224267YP_001134945.1 TetR family transcriptional regulator [Mycobacterium gilvum PYR-GCKMMTRRRGAELDAAIRSAVLDLLAGHGPEAVTMDAVAVAAGTSKPVLYRRW
PDRRALLRDTLMAVASTSFPRPDTGTFRGDLLAVLRAWAQLFTGDTGPLM
RSVIVAVASDPDLESTFRSDVLGMRKAEMTTLIGRAVERGEVRPDVPVEL
VRELGQSVLWHRLLITGDPITDELVTQLVDEVLIPVTRPYYDQ
145224266YP_001134944.1 hypothetical protein Mflv_3682 [Mycobacterium gilvum PYR-GCK]MSLPVLYPLRSVDTAAVHYVDCPHGRRRITIDHRPLAGVTPAMLLDWFTH
LGGTMQYGGHVVDRYHAWHPVDHIRWELARPAPGGGAAEGARFHMVEAFG
ARPEFLVDEIARVEKLDETGIRLVLRIGGVPVFQLEHTWSACADGAHYVT
VMDLGVRSRALAPVNRIMRRRFPEEKARAWVRHNIEEVGQLEHLLPRLAG
SDEAEPAQRAECGHGAPRGEDQQAEPVH
145224265YP_001134943.1 multidrug ABC transporter inner membrane protein [Mycobacterium gilMSVENRFAPGTFTPDPRPAKVPKMLAAQFALELRLLLRNGEQLLLTMFIP
ITLLIGLILLPLGSFGPNRAATFVPAIMALAVISTAFTGQAIAVAFDRRY
GALKRLGATALPVWGVIAGKSLAVVTVVSLQSVLFGAIGFALGWRPPLAG
LALGALIIALGTAVFAALGLLLGGTLRAEIVLALANLLWFVFAGLGALVL
ERGMVPAAVQWVARLTPSGALTEALVQAMTLSVDWFGLLVLAAWGAVAAL
CALRWFRFV
145224264YP_001134942.1 ABC transporter-like protein [Mycobacterium gilvum PYR-GCK]MTSVSPGAVPDGSPSAPVVLRGVSKRYGSTTAVAGLDLVVERAEVFALLG
PNGAGKTTTVEMCEGFIKPDAGSLRILGLDPIVDNAEVRARTGVMLQGGG
AYPAARAGEMLDLVAAYAADPLDPTWLLDTLGLTDAARTTYRRLSGGQQQ
RLALACAVVGRPELVFLDEPTAGMDAHARIVVWELIDALRRDGVTVVLTT
HQLSEAEELADRILIIDNGAAVATGTPAELMRNGAENQLRFRAPKMLDLS
LLVAALPEGYRATEPTAGEYLVEGHIDPQVLATVTAWCARLDVLATDMRV
EQRSLEDVFLDLTGRELRK
145224263YP_001134941.1 hypothetical protein Mflv_3679 [Mycobacterium gilvum PYR-GCK]MAARQLSLSSSIAGLHGDERTVGSPLTAAELVAMRRTRLFGATGTVLMAI
GALGAGARPVVQDPTFGVRLLNLPSRIATVSLTMTTTGAVMMALAWLMLG
RFALGQRKMSRSQLDRTLMLWVLPLLIAPPMYSKDVYSYLAQSEISLQGN
DPYEVGPATGLGLDHVFTLSVPSMWRETPAPYGPLFLWIGRGISRITGEN
IVEAVLFHRLVVLLGVALIVWATPRLARRCGVAEVSALWLGAANPLLFMH
LVAGIHNEALMLGLMLAGTEFALRGIDAAAPLIPRPLVRPRDRHQWLRWY
PLAMLFAGTVLITMSSQVKLPSLLALGFVAMALAYRWGGNVGAFLLASGA
LGAVALAVVALIGWASGLGFGWLFTLGTANVVRSWMSPPTLLALGTGQVG
ILLGLGDHTTAVLALTRAIGVSLIAVIVLWLLFAVLRGRLHPVGGLGVAL
GATLLLFPVVQPWYVLWAIIPLAAWATRPRFRIAAIVVTLVVGIFGPTAN
GDRFALFQIALATAASFLILVMLVALTYRYLPWRPLPEDSREKSDAYAES
P
145224262YP_001134940.1 putative transcriptional regulator [Mycobacterium gilvum PYR-GCK]MRHTGVVKFRSQSSEAPTSAPLHPVDGDHHGDTRSAIVRLLLESGPVTAG
HIGQQLGLSAAGVRRHLDALIEAGDAQANAAAAWQQEGRGRPAKRYRLTA
AGRAKLEHTYDDLASAAMRQLREIGGDDAVRTFARRRIDTILAGVEPVDD
ASRGEEIEAAADRIADALTGAGYATTTPRVRGPLSGVQICQHHCPVSHVA
EQFPELCEAEQQAMSDVLG