Antigen browsing page


The page has been created to visualized all the protein sequence their gene ID and protein ID from NCBI from selected strain. The strain can be selected from the option given in the form and then click submit to display all the proteins and their corresponding information available in our database. The output will be presented in a tabular format where Gene ID is linked to display an antigen card. If you click on gene ID of a proteins, the number of epitopes mapped and/or predicted will be displayed in result page.

Please select a strain:

Selected strain is M_intracellulare_MOTT-64
Gene IDProtein IDProtein DetailsSequence
379764686YP_005351083.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSQPAGDPVTFHRRPDGLADNESDVGRRRVAAVGFAPEVHDNVGLCHADP
VLHRRVKLN
379764685YP_005351082.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MARTILGDLQDSDRLVIRALPSSRTASSARLEQELRRCLRRMPATGIAP
379764684YP_005351081.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MASLTAANQLPRINPYSFSASTAYWLQVGTKRQVAGRSGDTICR
379764683YP_005351080.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSLLSFDVFSLDFVYYPVSWIMWVWYKLFASMLGPSNFFAWALSVMFLVF
SLRALLYKPFVRQIRTTRQMQELQPQIKALQKKYGKDRQRMALEMQKLQR
EHGFNPILGCLPMLAQIPVFIGLYHVLRSFNRTTGGFGQPHLSVAENRLT
GNYVFTPTDVAHFLDANLFGAPIGAFMTQRTGLDAFTVFSRPAVIAVGLP
VMILAGVATYFNSRASVARQSPEAAANPQTAMMNKLALYVFPLGVVVGGP
FLPLAIILYWFANNIWTFGQQHYVFGMIEKEDEAKKQEAIARRAANAPAP
GAKPKRTPKAAAPGGNGSAKAGGDTEGSGSAEAESDDADGQAPEATDTPS
NRTPRPGARPKKRKR
379764682YP_005351079.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MDEGEKDMTDADTTERDVDTDLETQAAAEDTVQGDAEEGDDLEERLVAEG
EIAGDYLEELLDLLDFDGDIDLDVEGSRAVVSIDGGDDLNKLVGRGGEVL
DALQELTRLAVHQKTGVRSRLMLDIASWRRRRREELAALGDKVARRVLES
GEREELAPMTPFERKIVHDAVAAVPGVHSESEGVEPSRRVVVLHD
379764681YP_005351078.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MFHVKHGSGAAPDSAVDAFGDRVGIAQRYATLLAGAGVERGLLGPREVER
IWDRHILNSAAVAELLGAGERVIDIGSGAGLPGIPLAIARPDLEVVLLEP
LLRRSEFLNEVVDELGLAVEVVRGRAEEPGVRDRFGSRDAAVSRAVAALD
KLTKWSMPLLRPGGRMLAIKGERASEEVEQFRRVMAASGAADVRVVTCGA
NYLRPPATVVSARRGQPPHRKSARTGKARTR
379764680YP_005351077.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTAQPAEAAPQAAPTPAPPAEPAAAPAAQPNVSRETSAEYDTPIGAAAER
AMRVLHTTYPPLRRPARRRVFTVANQKGGVGKTTTAVNLAAALALQGLKT
LVIDLDPQGNASTALGITDRKSGTPSSYEVLLGEVSVHDALRQSPHNDRL
FCIPATIDLAGAEIELVSMVARENRLRTALADLDSLDFDCVFIDCPPSLG
LLTINALVAAPEVMIPIQCEYYALEGVSQLMRNIEMVKAHLNPKLEVSTV
VLTMYDGRTKLADQVAEEVRRYFGAKVLRTVIPRSVKVSEAPGYSMTIID
YDPGSRGAMSYLDASRELAERD
379764679YP_005351076.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MGDAAADVLIGGPPPQDASATASMGAVYREIAPADIERNPRQPRQVFDEE
ALAELVHSIREFGLLQPIVVRAVKDSASGAHYQIVMGERRWRAAQEAGLA
TIPAIVRETGDDDLLRDALLENIHRVQLNPLEEAAAYQQLLDEFGVTHDE
LAARIGRSRPLITNMIRLLKLPIAVQRRVAAGVLSAGHARALLSLEAGPE
AQEELATRIVAEGLSVRATEEAVTLANRSGATAPTPPRRKPIQMPGLQDV
ADRLSTAFDTRVTVSLGKRKGKIVVEFGSVDDLQRIIEVMSPPKA
379764678YP_005351075.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MPLRLEAFEQLPKHARRCVFWEVDPATLGNQDHLTDPEFEKEAWLSMVML
EWGSCGQVATAIPDERSQAEPPCLGYVFYAPPRAVPRAQRFPTGPVSADA
VMLTSMGIEPGPAADDLPHGLIARVIDELVRRGVRALEAFGRTPAASELQ
DPRLVGPDVRAVLEAVGDCSVERCVMDAEFLKDAGFVVVAPHTYFPRLRL
ELDKGLGWKAEVEAALERLLESAHLEQPVGAGSTAGNALGTTLGG
379764677YP_005351074.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSSPRREYGDALRCGDRSAAVTEIRATLASLGMLDGSDDEDLTTGRHVAL
ELFDAELDQAVRAFQQHRGLLVDGIVGEATYRALKEASYRLGARTLYHQF
GAPLFGDDVATLQARLQDLGFYTGLVDGYFGLQTHNALMSYQREYGLSAD
GICGPETLRSLYFLSSRVTGGSPHALREEELVRRSGPKLSGKRIIIDPGR
GGADHGLIVHGASGPVSEADVLWDLASRLEGRMTAIGMETFLSRPVNSSP
SDAERAATANNVGADLMISLRCESQLSAAANGVASFHFGNSHGSVSTIGR
NLADFIQREVVARTGLRDCRTHGRTWDLLRLTRMPTVQVDIGYITNPRDR
AMLVSTQTRDAIAEGILAAVKRLYLLGKNDRPTGTFTFAELLAHELSVER
TSQLGGS
379764676YP_005351073.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MVAPVLEEIAGERSDHLTVAKLDVDANPETAQNFQVVSIPTMILFKDGQP
VKRIVGAKGKAALLRELSDAVPGLS
379764675YP_005351072.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTADTVHDVIIIGSGPAGYTAALYAARAQLAPVVFEGTSFGGALMTTTEV
ENYPGFRDGIMGPELMDQMREQALRFGADLRMEDVESVSLEGAVKSVTTS
EGDTVRGRAVILAMGAAARYLGVPGEQELLGRGVSSCATCDGFFFKDQDI
AVIGGGDSAMEEATFLTRFARSVTLVHRREEFRASRIMLERARANDKITF
VTNKAVEAVEGAETVTGLRLRDTVSGAESTLAVSGVFVAIGHDPRSELVR
EVLDTDADGYVLVRGRTTSTSIEGVFAAGDLVDRTYRQAVTAAGSGCSAA
IDAERWLADHEESSAAAQGDATEFPGSTDTLIGAPQ
379764674YP_005351071.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MDAADNDGADHRSAESDPPLTVELLADLQAGALDDEAAARVRRQVRADPQ
AAGVLAALNRVRRDLAAVGADPACAPDPPPGVAARISAALRSAEPPPGRA
AHSARPRLRPARLIATVAGLCAALAAIGFGTVALLHAPEPAPSTPGDVQH
ITVSTPPMEVPLSADEIVGLLDRAPDFGSSGGTLSDPARRASCLTGLGYP
AATQVLGARPVEVNARPGVVLVIPGDSPHVLAVYVVSPNCSAADTGLLAN
TQVPRP
379764673YP_005351070.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MGFGGDVKRDRSDAELLAAHVAGDRYAFSELFLRHQRHLHRLARLTTRTP
EDAEDALQDAMLSAHRGAGAFRHDAAVGSWLHRIVVNACLDRLRRTKAHP
TVPLEDVYPVADRTAQVETTMAVQRALMRLPLEQRAAVVAVDMQGYSVAD
TARLLGVAEGTIKSRCARGRGRLAELLGYLNAGAHATPEGATGQA
379764672YP_005351069.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MQGSPPTGPLPPVPAGIDRRRPELSDAALVSRSWAMAFATLISRLTGFAR
VVLLAAILGAALSSAFSVANQLPNLVAALVLEATFTAIFVPVLARAEQGD
PDGGAAFVRRLVTLTTALLVFATAVSVLAAPLLVRLMLGRDPQVNEPLTV
AFAYLLLPQVLAYGLTSVFMAILNTRNVFGPTAWAPVVNNVVALATLAIY
AAVPGELSVDPVRMGNAKLLVLAIGTTLGVFAQTGMLLVALRRQRIDLRP
LWGIDARLKRFGTMAAAMVLYVLISQLGLVVGNQIASTAAASGPAIYNYT
WMVLMLPFGMIGVTVLTVVMPRLSRNAAADDTKAVLADLSLATRLTLITL
IPIVAFMTVGGPAMGSALFAYGHFGNVDAGYLGAAIALSAFTLIPYGLVL
LQLRVFYAREQPWTPIVIILVITAVKILGSVLAPHLTDDPKLVAGFLGMA
NGVGFLAGALVGYLLLRRALLPAGGHLIGVAEVRTILVTLTASMLAGLTA
HVADRLFGLDGLTEHGGAGSLVRLFVLGLIMLPITATVMLRAQVPEAQAA
LDALRFRITGRGPRPRRPKPADRSSHRRPVTYPEQRNSSPPGVNAVQEPI
RRRPPERANRARLAKGPEVTDRPMESPASSAGPGTGSGTSRPVADDFQPD
IPADEPQRSTSRPPEPANGDIGGETRRGPASFDAPRERAADSPGDDVHLV
PGARIAGGRYRLLVFHGGAPPLQFWQALDTALDRQVALTFVDPDGALPDE
VLQEILSRTLRLSRIDKPGIARVLDVVHTGSGGLVVSEWIRGGSLQEVAD
TAPSPVGAVRAMQSLAAAADAAHRAGVALSIDHPSRVRVSIEGDVVLAYP
ATMPDANPQDDIRGIGAALYALLVNRWPLRESGVRSGLAPAERDSSGNPV
EPMAVDRDIPFQISAVAVRAVQEDGGIRSASTLLNLLQQATAVADRTEVL
GPIDDSPSPSTALISPGQEQATFARRRRNLLIGAGAGLAVIVVALLVLAS
VVSKIFGNVGGGLNKDELGLNGPSSSASASSSTTPSAAAGSVVKPTRASV
YSPDGEVDNPGTAGQAIDGDPSTAWATEVYTDAVPFPSFKQGEGLILQLP
NPTVVGQVTIDTPSSGTKVEIRAASSSAPASLNDTKLLAQAFTLKPGHNV
IPVRAGSPTSNLLVWISTLGTTNGKSQAGFFEITVQAAS
379764671YP_005351068.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MLRIAAVLGIVAGLAVLAGPVVPPAAAGEPGVTPFVRVRIDQVTPDVVTT
TSPPVVTVSGMVINIGDRPVRDVMVRLEHAGAVTTSAGLRTTLDGDTDRY
EAAADFLTVAPELQRGQKVGFTLSAPLRALTKPSLGAEKPGIYPVLVNVN
GTPDYGAPARLDNARFLLPVVGVPPDRADDVGSAVAPDTSKPVGITMLWP
LADRPRLAPGVPGGTIPVRLVDDDLATSLASGGRLDILLSAAEVATSHDV
DPDGAVGRALCLAIDPDLLVTVNAMTAGYIVSNSPDGPGQIPGTPTHAGT
GQAAATEWLNRLRALAHRTCVAPLPYAQTDLDALQRVNDPGLTATATTTG
NSIVDKILDVSSTRGATLVPDAPLTNRAVKLLGANESTVAITAADLSAAD
AQGSSETAVDTAPRRLSPQVAVAPFDPAVGAALAGAGSSPEVPTYLDPSL
TVRLAHDSVTARRQDALGSIFWHALRPGDAPRTQILVPPATWNLQADDAQ
VMLTALSTSIRSGLAVPRPLPAVIADASSHTEPPEEAGAYASARGQFNDD
VTAAIAGQVGRLSGLTSALMTDDRTGLTGVQYTAPLREDMLRALSQSEPP
DSRNGLAQERLAVVGKTINDLFGAVTIVNPGGSYTLATEHSPLPLALHNG
LSVPIRVRVHVDAPPGMNVTDVGQIELPPGYLPLRIPIEVNFTQRVAVDV
TLRTSDGLRLGEPVRLSVHSNAYGKVLFAITLSAAAVLVLLAGRRLWHRF
RGQPDPADLDRPDPPHARHAAESGATHDDADQRVEQEHRV
379764670YP_005351067.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSDGEQGKPRRRRGRRRGRGAAASSEKQTNGQVNGDSTATKPRRSRGSRR
GPERLRTVHETSAGGLVIDGLDGPRDSQVAALIGRIDRRGRMLWSLPKGH
IELGETAEQTAIREVAEETGIKGSVLAALGRIDYWFVTDGRRVHKTVHHY
LMRFSGGELSDEDLEVAEVAWVPMQELPSRLAYADERRLARVADELIDKL
QSDGPSALPPLPPSAPRRRPQTHSRTRHSDKPATGRKNGHGPGP
379764669YP_005351066.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTDKATSHISADRYGPRTFSLVLVHIFVVELATWLLMPYSIVFVLPVVLV
YMAIAAFLAWAWPSGAVGRLGRAMFIGSLSGPLSLILFGTAFAIAHAIGP
L
379764668YP_005351065.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MVQAVLAVLLIAMWLLGKWPFETHSAYAGERAWMLTATAITTLTSLLFSA
ALLRSRSPRNRGLGFSLASCSVAVLIGGASFALVVLR
379764667YP_005351064.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MPDAAQDAELLTAAAVALNRHAPVLAELGSAFEGAGHQLYLVGGSVRDAL
LGRLSPDLDFTTDARPEQVQNILRRWADNLWDTGIQFGTVGVGKGDHRLE
ITTFRADTYDQVSRNPDVQYGDRLEDDLVRRDFTANAMAVRITPEGPGEF
LDPLGGLAALRERVLDTPAAPEVSFGDDPLRMLRAARFVSQLGFTVAPRV
RAAIEQMASQLGRISAERVAAELDKLVLGDDPTAGIDLLVQTGMGEVVLP
EIGGMQMAIDEHHQHKDVYQHSLTVLRQAIALEDDGPDLVLRWAALLHDI
GKPATRRHEANGGVSFHHHEVVGAKMVRKRLRALKYSKQMVEDISQLVYL
HLRFHGYGDGKWTDSAVRRYVTDAGPLLPRLHKLVRADCTTRNKRRAARL
QSSYDRLETRIAELAAQEDLARVRPDLDGNQIMELLGIPAGPQVGEAWRF
LKELRLERGPLDTDEAAAELLAWWRSRGNA
379764666YP_005351063.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MDYCLAGDNGAAAIWHGQPDLDLDGDGRFESIGMDFDHDGLRDDALADLD
GDGLVDHAVLDVDNDGTPEAYFTDDGSGTWAVAMDRGGQLRWFGLDGVEH
TGGPLVDLDGHGRPDDRLLDTDGDGLADRVLRSDDTGVTGYVDTDGDGKW
NVRLTDSDGDGLADGASSL
379764665YP_005351062.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MELRYISIPFLVAEAGGDPWSLNAGLQAGRPARISDLARAFRAAGTSTSE
AAAAFEAARRRFDAAWNHRNGEHPINDSDEVQRVSRSLGLQAAQLPKIAI
DLEVIAATLAEVQRAAAGYIVALEYDLEDIDDEICEALTDGNHCGVDGLR
GEAVAESRAIVFALGQIRDRYAAALRAALDRLRTDGADPAEVNGVDELLI
PPSDTSADRVKRWWDSLSANQKRLLTDQHPPELGNLNGIPADVRNSVNQT
AMNDDLRRVEDAVRRRGVVPDALRDNALNNRDADVFANPAEYGLCVTDIT
RYQNAVKTNDFLTRDEGSAPQHGLPIMLWAYDPLAFGGKGRAAIAIGNPD
KSRNTAVMVPGTNSSVRGGWMSDGPDDAINLYEQAAKADPFHTTAVLAWM
GYDAPEFDHPHWQRTLTEPAELEQVGTPWRARQAGALLAADVNGLAATHE
GSTPSHVTVLGHSYGSTTVADAFVNSGMRANDAVLTGCPGTDLAHRAADF
RLEGGSLYVGAASTDAISWIGESGNGLPNGLNKTLGGPLGPWAGLGADPA
HEAFGAVRFRAEVAGSHSLTPWFTDHAHYYDVGSEALHNMTQIVTGHGDR
LAAEGMLAADRAQARIAIPRQVHLPWGTVSLPRVDIQMPIAVDPEWDRPG
PAVTNGHGF
379764664YP_005351061.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MFVNTEQLHSGGNQSHRAGGHAQEGADHLAGGTLESGMFGDFEAANSFHN
AVTTAHGQHVKNLQGHSETLTSVGTKAHHAANGFTNMDQNNAEELKAVRP
SSGPSALNA
379764663YP_005351060.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MLDMGARNPALDASLRDTALALESAYLTVTAKSTYGVATDAEFQSALDDV
IAKDAAMKKACGGG
379764662YP_005351059.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTGSSWSSAATVGGGPSIPSGSLPAYGSDLRPPVVAPPSVPSAPAGPISG
APVAPSPASSPSAGGPLVSPVERTASGAAAAQAGTGSSAMASASAASAAT
GATAGATSARAAEQQRLQRLVDAVARQEPRLSWAAGLRDDGTTTLLVTDL
AGGWIPPHVRLPAHVSLLEPSARRHDANVVDLLGAITVAAAHHANTYVAE
PGSDEPALSGDRPARSAAPQVDELGPTLVEAVRRRDGLPRIAQAVAAPAV
RKTGVLESEIEMLHECVADIQHSVMSAYPNHDPAAVGDWMLLAAIEALID
GHEYLTNYHLAWFEAISHRSGS
379764661YP_005351058.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MVGAAGNAGVPQDAADAEAADADRRAHAADAAAKFPANEANGQQEMQMIQ
QMLSSVTGAMGGAMGGVMGPMTQLPQQAMQAGQSALQPLMSAVQGAHGAA
SLADSAHLVDSVGSGGAGLGGGSGGGAGLGGGGTVPASSLGPPPVPTSSP
PTTPAGAKAPIMPATGGMPAMPGQTGMTGMPMMPPGAMGAGGEGGNKDKP
VEKRVTAPGVPNGQPVKGRLTVPPSAPGSKSGEAKPTVVTNRPNRRIVIM
PSEDEPKD
379764660YP_005351057.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTDPLRMQAVAALVRAHNLFAGTPISPHIGDVAEQTHAMARHAAALPKTA
SARSGASIKLLNHSSHADRTVGDIIAAARADHERARAATRAVLEAAESDV
TPAADTPMGRREAMARTATRLRTQHRHVTKARRRAKLLAHRLRRLHYPQR
RSMHGNHASGRQAVLAAIRKALDIKGIHDPAARARWERGMDLVARRESNY
NANAINNWDSNAARGTPSKGAFQFIAPTFSAYHQPGTSRDIHNLVAQACA
FINYAMGRYGVAVDASNLADRIQQADPRRSPKGY
379764659YP_005351056.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MPLSLSNRDQNSGHLFYNRRLRAATTRFSVRMKHDDRKQTAALMLSILLV
AIASGWMLLLNVLKPTGIVGDSAIIGDRDSGALYAKIDGRLYPALNLTSA
RLATGTANQPTWVKPAEIAKYPTGPLVGIPGAPAAMPVHRGATSAWAVCD
TAGRPRSPERPVVTSIAGQLDAYDRATPLRDDAGLLVTFEGNTFVIWGGK
RSQIDPVNRAVTLSLGLDPGVTLPVEISRALYDALPATEPLGVPQVPLAG
TPSTWVSGSQVGAVLQAQTASGGKQFYVLLPEGVQKITSFVADLLRSANS
YGSTAPRVVTPDVLVNIPEVTSLAVDYYPTKRLNFIDTAADPTTCVGWEK
ASTDPRARVVVYNGRGLPTPSYLDNRIVHLVRDDNDPASVVANQVLVLPG
AANFVTSTSGVVTSDSRESLFWVSDNGVRFGIANDETTLRALGLDPGSAV
QAPWPLLRTFAAGPALSREAALLARDTVPALGKVAVVTTSAKPGG
379764658YP_005351055.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSKKAFPINRVKIEPPKPVRVAPSAPIALPEREPRNIWVMIGVPALIVAL
IGTIVMLYVSGVRSLTTGFFPLMGIGAFSMLAFSGRFGRARKITWGEMEK
GRRRYLRDLDSNRDEIQTAVCAQREWQNSVHSDPRGLGAIIGGPRMWERG
RADADFLEVRLGTGVQHAPDSVLSVTWPDIASDEELEPVTGQALRDFILE
QRKIRDIAKVVNLRSAPGFSFVGEDLDRLRSLMRSVLCSLAVFHNPRDVK
LMVVTRNPEVWSWIVWLPHNLHDELFDACGFRRLVFATPEELEETLGAEL
HMKGKRGAWTPLAAASPTAMGSALETATDTVDLGPHLVIVDDNTGSPDAW
ESVVGQVGKAGITLLRIASRVGTGVGFATDQVFELSERHSSPNGSVNGEV
ALLRNGSDSDGEDGRPAPLLRVRNKFFAHADQLSVHRAYRYARAMARWSP
TSRSEIADSVSGATELLRALGISDPRDLDVDRLWAERRGRGDERWCEVPV
GAKPNGELQNITIRAKDFGGFGFHSVVIGTSGSGKSEFFLSLVYGIALTH
SPETFNVIFVDMKFESAAQDILGIPHVVAALSNLGKDERHLAERMRRVID
GEIKQRYELFTSVGARDANDYEEIRLAGRDLPPVPVLLVIVDEYLELFAN
HEKWINLIIHIGQEGRGANVFFMLGGQRLDLSSLQKVKSNIAFRIALRAE
SGDDSREVIGSDAAYHLPSKENGFGLLKVGPRDLEPFRCFYLSAPFVVPK
TKEVAETVDMTLTKPRLYNWQFQPLDAADATALEAAAAVDAEPDEFLYYD
DGFKRKKIVDVLRESLHNVPHRSPRRPWLEPLEDPEPIDVLVAGYRGKPW
HVDYGQNPGLMFPVGVMDIPEESKQVVHAVDALRSNVIVVGAKQRGKTTT
LMTLMCSAATMYSPARVTFFCIGGATLAQAASLPHVTDIVSPKDAEGIER
ILSSMDALIDAREDSFRRLKIDLDGFRERRFAPGSDGLGGTDANDPFGDV
FVVVDDYDDLYSKDTVLGDRIISLSSRGPEYGVHVMCSAGGWIHGQRQSL
LQNATARIQLRLADPSESQMGHSSLESRDAARRTLNRPGFGLTDSLHELR
VGVPALSDPATGAMVSIVDVGARIADVAGVTKHATLQRLPQRVELKAILE
YEAAHPTGDHLSISFAIGERHELGPVPIKLRESPGVMILGRQGCGKTLSL
VSIGEAIMNRFSPEEAQLTLIDPKTAPHGLRDLHGPGYVRAYAYDQDEID
EVITALAQQVLLPRLPPKGLSQEELRALKPWEGPRHFVLIDDIGDLRPDQ
SYPPKPPVGAALWKLMERARQIGLHVFTTRNSANWATLQMDPWIRFQNSA
KVAQLYMDNDPQNRINRNVRAQALPPGRGLLVSADGDVEGVLVGLPSTFT
PPPQ
379764657YP_005351054.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MHDRTGLLARLTGRYAVLVVGLWVLAAAAANLAVPQLERVVDSHARSFMP
PEAPSAVAAARAAQLFNQTPSNNFVYVVLERDQRLAPGDRQFYDALTTKL
GSDHRHVYAVTDLWSQPATAAGAQSSDGQAVSVMVRLAGMLGTSQARDSV
DSVRAAIQTLSPPAGLEVHVTGPGATIVDEFSAIDRQMLGITAATIGLIL
LLLLMVYRSPVAAAIPLISVGLALALARAIAAALGRANVVEVSLFSVALM
AAMTLGAGTDYAIFLVGRYHEGRRHGIPPERALTQAYRSVAPVVIGSALT
VSVALACLVFAHVGAFRSAGLPCAIGILATMVAALTLTPALMGLAVRRGY
LEPRPSRTARRWRRVGTAVARWPGPILVAALGLTLLAALPLAGMRVGFNE
PAATPSSTDSNRGYASADRHFSANALLPDVIAIQADHDLRNPAGLIAIER
VTRHIMAVPGVRAVQSASRPDGKVPEQATLSYQAGVLGRQFGDTMDSLTR
RLQRVSELDGALAQTQAAVDGLGNGLRGGSAGLADMSGAAEDMRAGMDGL
QRNVTTVSGYLDPLRDIVGRTPDCAANPICSTVDRVLQPVDSLVQTSARL
DAGATKLTSGSSTAATAMAGLPQSVSAMKGALGQARSATHDLLGLTDTLG
PQMRQLTDYMNEIATQFQGSAAADFYMPQRALTDPRYTAVLGHLISENGR
AAYLLVYGDGSEWGADGANRADQVRAAIKEATKEGTLTPLEVDLAGVGPV
TADLQRFVASDTTLLVGAALVLIFLIVTAMLRSPVAGLVVVGTVVLSYAS
AVGASVLIWQHLLHQDLHWSVAPIAFIALIAVGADYNLLLALRIKQEAAA
GLRTGIIRAFGGTGGVVTVAGIVFGLTMLALLSSSVLSIAQTGTTIAVGL
LLDTLVVRAFVVPSIVALLGRWFWWPSRPPRRAMAEAVNTPEPQLLTAAG
V
379764656YP_005351053.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTWTLLHDRMAFMAEVIKAADTDPQAALALIDNSSEVPELFGDEEGLMLS
LGQRWITMLVAKLDQAAYEGASAEQVRADLEAAEPGLHALVKIGSRRSLR
VRSLSRGEHVAVGLFGGPTGDRQTVA
379764655YP_005351052.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MLRAAADHLREQLRRRSELLPVGITWTSLIAVDVSLVLGGVIGTLQRPAA
DLPVSLSAFALALSTELAFFVFNMKITPGPLWATWSAATALTLFGTSTPI
QADFAPALLILMVLVVATLASVLAGLLAAVSAAALLLTASALHRLDAIAL
YLGFIAVGWLLGYVMRAQRLLLAEQIEAQNLLAEHAAADERRRIAREVHD
VIAHSLSITLLHVTGARRALQQDRDVDDAVDALEQAEKLGRQAMADIRRT
VGLLDNWPTKTAQTTPEPGIDDVPALVAGFQQAGLAVTLCVEGPTDHVSA
AVGLALYRITQESLANIAKHAPESKASVVLDISPVSARLAVSNLLPAAVL
AAKSAEGRGLRGMRQRADLLGGALDVGPTRDGWSVRAEIPLHEGDTTWRP
RWCKL
379764654YP_005351051.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTDPAPEITVLLVDDQDLVRSGLRRILRRKDGFVIVAECADGDEVPAAVA
EHRPDVVVMDLRMRRVDGIEATRRLGGRPPVLALTTFNEDELLSGALRAG
AAGFVLKDSSAEELIRAVRAVARGDSYLDPAVTSRVLTTYRKAAPGPRGA
AIAELTTRELDVLTLIGQGLSNTEIAGKLCISGVTVKSHIGRIFGKLDLR
DRAAAIVYAYDNGIVAPR
379764653YP_005351050.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MGVRTAPERLRAMLEGAPLAAHEMINLNFALIAIRLDRESRAARYKRLRQ
RGARSLMFAGLVMVVLNFLVCMAYLLLNLAEPTAPL
379764652YP_005351049.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MATAARNPTRTRSHVQEDAIGAPPENPTLVPAERYYSPAFAALEVERMWP
RVWQLACMVDHIAAPGDYFEYRCGPYGVLIVRDDDGEIRAFQNVCRHRGN
SLCTGSGSGLRELKCGYHGWTWDLAGALKRVPNRKGFGSLRMSDFPLIPA
RVETWAGLVFVNLDLDAMPLIEYLEAVPDDIAWCRLEDFRCYATLTVDVD
ANWKTIADGYSETYHIQTLHPELLRCVDDIHAPQRIWGHTGKSDQPYGVP
SPRLGGALTDEEVWDAYVYTQGALMGAAEGTPFPADERRPGQTVAELIAE
RTRAFAAGRGVDLNWADTDRMTRLHQYNVFPNMTLLANADHLTVMCSRPG
ADPDKGELVMFLTTRMPPGAPRAKPADVRMAADAAEPGVVLTQDIAVLPG
LQRGMHQPGFTHLVLSSEERRVINMHRNLERYLDLPAAQQMSGGAAK
379764651YP_005351048.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MFDLKITGGTIVDGTGAERYRADVGVKDGKIVDVVRRSADGPEMGGEAAE
TIDASGHVVAPGFVDIHTHYDGQVTWDGLLEPSSGHGVTTIVTGNCGVGF
APVRPGTEQWLIELMEGVEDIPGTALTEGITWGWETYPEYLDAIDKHKFS
VDVGSQVAHGAIRAYAMGERGARNEPATPDDIEAMGRLVREAIEAGALGF
STSRTMGHRAMDGEPVPGTFAAEEELFGLGRAMAAGGQAVFELAPQGAAG
EDIIGPKKELDWMRRLSGEIDRPVSFALIQVDADPNLWREMLDLSADAHA
AGARLYPQIAARPFGMMIGFQGHHGFSHRPTYRRLKAECSREELARRLAD
PAVKAAILSEDDLPVDPTLLFDGMFALVQHSLGRLYSLGNPPDYEPTPDR
TVAAIAQARGEDPLSTLYDLMLESDATNMLMLPLFNYADGNCDAIREMML
HPAGVLGLSDGGAHCGMICDASYPTFLLTHWARDRKRGEKLSLEYVIRKQ
SRDTAHLFGLTDRGTIEPGKKADINVIDMDALRLHPAAMAFDLPAGGNRI
LQGASGYAATIVSGTVTRRKDVDTGARPGRLVRGAR
379764650YP_005351047.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MDMKNPVGQAFSFVGLAAHLGRGAGRVATDALVGGRFGLPRSADEIDPAV
LSRVMGTTVRSVRVLSRDAGTSSRARLVLTGKNVPESVFVKVAAQTAATR
LMGELGRLGHTEVRFYRQLAPQVIGVPYCYGAAFDPWTGRYLLVLEDLPA
ESCEFPDTLHPLSTDQAGLIVELLAELHATFWDRLPRDGRGPLGWLYTPS
GDVTSLLTGSLMHTSIKRLAERTTIPVEKAAFIADNYRDVAALIDTPPHT
VMHGDAHPGNMYFHGGKAGLLDWQAVRRGHPSRELAYTLITSLTPEDRRA
SQRELLDDYRRALVAAGGPELDRDDLWLRFRQGALYAYVAPLITTGMGGM
QVEDIAMEGLRRGVAALDDLETVAALKSSL
379764649YP_005351046.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MEPSRRWGDDRAILDDEEARRRILAAAGRCIVRRGNTQFRMGEVADEAGV
SRSTVYRYFPGRDDVLLGLMLARIDTALGELVRSLPAPDDPVRSVPEMVL
ARVESVDGNPLNEALFAAESTAVASALEKGSEPIVELLLRHYGPLLDRWK
AAGLLYPDVDFRSIVQWLHAATLFLLAPSWRYRPAADKREFVEQLVVRAL
VPQIRQ
379764648YP_005351045.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAAMLRDALCCFGIGCQFIPDAVLRRNALRRNDEPRQKGRMMAYSAADES
FTHQLPSTFDQVHNADPTWSDRCYFFAASPDGTLLLASGYGNNPNTGTGL
GYVKVSLADGRHWDLLSGRPVTGDDRGDLSAGPMRWTCVEPLKKWRLDVE
PNNSGIEWELYYEPTAPMWELLPMKVRGKNGELLADMYHMKEPGRWSGWV
TIDGERVSVDGFHGGRDRTFGVRVSDKIDFWLWLDAGFDDHAIEAWIIES
SDGTVNYVDGGITYADGRPSKRFVKIEHDVEFDGDRKRPARAILVFTDED
GQAHRVIAEAPHQQVNAYYGLPMAHCQYEDLGGGAYFIHFAWDSSDPDQL
SETESKSMALDQLMRFERGGETGWGIFELLMGGQGYARYPNWTAMDMSAF
TQDKTPVDRLQEDSDGVRR
379764647YP_005351044.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTLDADRERRLTDWVRTQVPDADDVRLEGIDRVSFGHSAEMMTLSVVTRR
AGRHDRRDVVLRLRPRPPALLEPYDLARQFAILRALAGTPVRVPAALWLE
PTGEVLGRPFFVMEHVAGDVYEMEPPTGAADHTVVRMCQSLVEQLAAIHT
VDLTRTGLATLDDGADHLERELDHWAAEMNRVKRDRLPALERLHGALLAG
KPDPCPTVSLVHGDAKPGNFAFTAGEVSAVFDWEMTTVGDPLTDIGWLEM
LWMQPVGINSHPAALSIDALLAHYESASGISVANRPWYRAFNAYKMAVIC
LIGAMLVEDGHSDDQKLVLAAYGTSLLTKAGLTDLGIDEPLDDGPVLPRE
DRIAQVLAG
379764646YP_005351043.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSNLDDRTLFVRTGVAADAGSAARTRAEFGAWLNRYFSLCADRFSDLLLA
VNEAIANAAEFAYVGATQRGTVDVRAAYDAGSDTLAVTVDDRGRWRQQVP
AQRNAQMRGRGIPLMEALADEAAIECTPRGTRVTLIWTGLTRSACTA
379764645YP_005351042.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MGEQSGDVVDPTAFEVGKHQVDQAVVLTVSGEVDMLSSPQLADAIQTALA
TKPAALIVDLSKVGFLASAGMTVLVTAQAEVEPPTKFAVVANGSATSRPI
KLMGIDSVLALYSSLDGALSGVAGE
379764644YP_005351041.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSNQQQADRMTSGKGFIAALDQSGGSTPKALRLYGIEDSAYSSDKEMFDL
IHEMRSRIITAPSFTGDRVLAAILFEQTMDREIEGKPSTTYLWETKGVVP
ILKIDKGLADASNDVQLMKPMPGLDELLERAVGKGVFGTKERSVIGGANA
EGIAAVVAQQFEVARQVLAHGLVPIIEPEVTISISDKAEAERILRDEITK
QLDSVPDGQRVMLKLSLPTEANYYRPLIEHPKVMRVVALSGGYSREEANE
LLAKNTGLIASFSRALTEGLSVDQTDEQFNTTLDKAIQSIYDASVAG
379764643YP_005351040.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MGAAVDEDCLKLTTYLAERRRSGGGFVSDVLLGLYERHRIAAGVALRGIS
GFGTMRHFRTDQSLTLSEDPPVVIVAVDTRTKIEALLDPVLTIKQRGLVT
LERARLLHEDIGSPQLPEDLHDAVKLTIYVGRKQRVNGTPAYIALCDLMH
RRGLAGATVLLGVDGVAHGERQRANFFGRNADVPMMIVVVGSGERIARVL
PELAGLLRTPLFTLERVRVCKRDGQFLERPHALPGTDEHGLPLWQKLTIF
TSESAQRGGAPIHRAIVQRLRQAGTADGATVLRGVWGFHGDHPPHGDKLL
SLTRRVPVVTIVIDTPANVAESFAVIDELTSEEGLVTSEMVPALVSDEGD
SGQGPPRMARHRY
379764642YP_005351039.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MMTLQDRFAPERLIAAACEEVGSDDFGAEGWRPGLHRVTDGLINDARLSD
IGVEIAHLDLMRALKNRLGVIAWRKQHPEVAEQKITAPIFIVGQPRTGTT
ILYDLLAQDPELRAPLTWEVDEPCPVPQPETYHDDPRIAQIQASIDMSEQ
IMPGFLAFHPMGALVGQECVRITAAEFVSMIFSVQYRLPGYYRWLLYEAD
HAGAYRFHRIFLQHLQSGVPGQWLLKSPAHLWQLDALLAEYPDALIVQTH
RDPVNVISSIAALTHHLRRMCSDESGITECAAQSYEEIVVGLDREMALRD
SGAVPAGRVIDVRFADFMTDPWTTIKDIYRRLDRELRPDTEQKMREFLAS
HPSDGGHGRYTWSDTGLDAGEVRERVTAYQDRYGVPAEPLR
379764641YP_005351038.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSQTGVPSVQAAPKARAALEFFQQMLTDVSKIVAEDAESERELAEGLRVV
ARVSSLCAQMSVEADPERPSFFDMCSDNRMVGGPNPDGNYYLAMIRGDRR
YRITGSRGTSAYLGFQILAGTGLTPRRMAGYVSDTDLKLDSGDFTLVLSA
DEPPDLAGAQWVKIPADASSVVVREYIGDRTAEKLAALRIEALDPGPLTA
LTDDELADQFTAMAWSLMKLTTLHRTIKPELLEAPNTLLTAQAADLGAAD
TTPDNLYMMGTFRLEPGQALVLDIAPPDTRYWNVTLESIWHECLEPRRRH
SSVTNRGVRPGADGRVRIAVSDEDFGLGHWLDTGGRQRGFIVLRWLDNPS
PPDVTVSVHQGRQR
379764640YP_005351037.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MPASEAVTSLAERKRAAMRQRIATAAARLVASRGLAGATVDLIADAADIG
RATFFRYFNSKEDAVAEGMNGHWLDRITAALAAQPPELGAMEAVIGAFGE
LARDFAEIENQVRELATLTRSSETLDAWTLHVYVRYEVAIAELVAPRMAG
PAEHDPRPRLIGALAMAAVRIALDDWLSHGGSLPDRVSRGLAAISVDRAA
AVSPG
379764639YP_005351036.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MPSDLTEVGTPANTPRRRSEKSRTAIVTATRELLLERGFDGLSIEAVAAR
AGVGKQTIYRWWPTRPALVADVMLEDADTLLASVNHSGDLAADLVRWVGK
LFASLTTPRGSAMLRTLTVACMEHEDTAVKLRAGFSAPLHDSVRARLLAD
GIDEAVAESAADAIVGGVVYPILSGAQPYSRRRAERTTRLIVDALTRG
379764638YP_005351035.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTLGLSPEQQELCDAVGQFAARNAPIATTRGSFDELSAGRPPGWWDALVG
NGFHAVHLPEDLGGQGGRLIDAACVLEAAGKSLLPGPLLPTVAAGAVALL
ADPTPSAQSLVRDLAAGVTAAVVLPGDGDLHAWAVDGRWSLNGASEITPG
VCAARIILVGAPTREGDVVWVPVDTQKRAVTVEPVRGTDLVADAGIMRLD
DYTATDDEALTGIDAARARCVLLGLVAATTAGIVQWCLQAVTAHLRSREQ
FGKVIGTFQALQHSAAMLLVNSELATAAAWDAVRAVDESLDQHRMAAAGA
AVIAISPAPDLVLDALTMLGAIGFTWEHDVHLYWRRAISLAGSIGPANRW
ARRLGELTCTQTRDMSVNLGDAEPEFRSWVAETLDAALQLRNDKPAPHGD
YEHLATGPQRTLIADAGLMAPHWPAPWGVDADPLKQLIIDEEFAKRPGLV
RPSLNIAEWILPSVLAAAPKDLQERLIPATQRGDILWCQLFSEPGAGSDL
ASLTTRATKVDGGWRINGHKIWTSLAQYADLGALLARTDPEASKHRGIGY
FILDMRSPGVEIQPIKTATGQAHFNEVFLNDVFIPDEMLLGGPTDGWSLA
IATMAEERSAISGYVKFDRAVALRRLAAQPGPDRDDALRELGELDAYTNA
IRALGVRETIRLLDGQASGPASSIAKVAMNVLLRRTFQATLQLTGQVAMV
DDPDTAVVEPYLHLPAELIGGGTREIQLNIIAQMILGLPRK
379764637YP_005351034.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MGLRGEAAIVGYVELPPERMTKASPAPFVIEQWAELGAAALADAGLPFEV
VDGIVASHLAESEIFIPSTIAEYLGVGARFAEHVDLGGASAAAMVWRAAA
AVELGICDAVLCALPARYITPMSPKKPRSLGDALYFGSSSNQYGSPQAEF
EIPYGNLGQNGPYGQVAQRYAAIYGYDERAMAKIVVDQRTNANHTEGAIW
KDKPLTVDDVLASPVIADPLHMLEIVMPCVGGAAVVVANADVARRSRNRP
VWVKGFGEHVPFKTPTYAQDLLQTPIAAAADTAFAMTDLTREEMDMVSIY
DCYTITVLLSLEDAGFCEKGKGMEFVAGHDLTFRGDFPLNTAGGQLGFGQ
AGLAGGMHHVCDATRQIMGRAGAAQVADCHRAFVSGNGGILSEQTTLILE
GD
379764636YP_005351033.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTTFERPMPVKTPTSAPFWDALAQHRIVIQYSPSLQAYVFYPRVRAPRTL
ADDLEWREISGMGTLYSYTVAHRPVSPHFADAVPQLLAIVEWDEGPRFST
EMVNVDPARLRVGMRVKPVFCDYPEHDVTLLRYEPAD
379764635YP_005351032.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MARLASVSTATVSYVLNNAQGRRISPETRDAVYRAAKLLGYRPNLAARNL
ARGKSGVVLYVVPHVAVGEMPMQAGSRMTTALARQGLLQVQVFETDDDHH
VVDAIENLDPVAITSLFPLSAAAREAVAKAGIPHIEIGTLPALNNPHLSV
GEMRVEHLVERGHRRIAFAYTGVDRWRPLGDYWFEGVSRAAQARDLPPVR
VDQVTLDNAADVVTGWVGDGVTAVCAQSDEIACLVLYGIHRARLRCPSDL
AVMGVDASPMGMVSTPPLTTVQFDPCAVADAALAAVFERLGQPAPPSPEL
TDIAHLVVRAST
379764634YP_005351031.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTEERGMNKDDLILISVDDHIAEPADMFDAHVPAKYKDRAPRVVLEPDGV
QQWYYGEVRGRNMGLNAVAGKPREMYNIDAARYDEMRPGCFNVDERVRDM
NAGGQLAGLNFPNFTGFSGQVLNQGPDREVNLVMIKAYNDWHVDEWCGAY
PGRFIPCGILPLFDVAEAAKEVKRLADKGCHAVTFSENPEALQMPSIHTK
YWYPLFEAACENKTVLCTHVGSASRSPQVSTDAPPSVQMTASSMMSMFTF
TELIWAEFWADFPQLKFSLTEGDVGWIPYFLWRAEHVYNRHSGWTLATFP
PGYSGPTDVFKRHFYTCFISDKVGVHNMEWFNEDMLCWESDFPHSDSNWP
FAPEDIIATMGHLDDRVIDKITHENAMAAYSFDPFQHIPKEQARAGRLRA
QATDVDVVTHVGRRASQRDRDAWTRMTQFALQAGAAAPVTAEAAGIAGRA
TTLGN
379764633YP_005351030.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAGAAPFAGWRVLELCNGLAVSYCGKMFADAGAEVVKIESPQGDSLRAWS
AAGGPPGALFGYLAAGKKSVINRGQAEVASLLAGADLVLTDLTDGWTLDG
ITALSAASAVVVAVTPFGTTGPYAENQVAANEFILQALCGSIAGRGWPDD
EPVQAGGRLGEWLAGTFAAAAAAATARHAARSGRGRVIDVSTYEAMVIAM
GGLSAMSASVLGPDSLLHERSLELPSIVPTADGMVGFCTITAQQFQDFLV
MIDRADLVGDAELASFAGRVARRDEFLDMVTAWTRSRTTQEIVDVAVAFR
IPVAPIASPEMLPKLDHFVERGVFVESRDGVLAPRVPYRSEAMATRPPRQ
PPALGADNARLHWPPRPQSPRTDEADALPLSDVLPLSDVRITDFTAFWAG
PVATQLLGALGADVIKVEGVRRPDGMRFSAGRPPDWDQWWEWGPVFLCSN
NNKRGVSVDLGTDAGRSVALELIAASDLLIENFSPRVMANFGLEWDAVRA
ANPHAIMVRMPAFGLDGPWRDRVGFAQTMEQATGMAWMTGHADGPPVIPR
GVCDPIAGLHAAFAAVAALAIRDREGAGMQVESTMVEAALNVAAEMLVEY
SRNGIALRRNGNRGPGASPQGVYRCRGDDEWVALAALDTAARASLAGLLD
QPDLHDTAWDERADDIDKLICAWAATRSVTEAVDALRAAGVAAARVTPAA
ALLTDPHLHARGFWETVDHPVAGSFLCTGMPFAFLDRPRRWIRRVPPLYG
QHTQEVLTDILGHSEADLADLRRSGTISDRPAGL
379764632YP_005351029.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAVSLCVPPRAGELCAPVRFLVRRDSVVMELTARHRITSVEWDEDEHAVA
MVVEITDPQTARPVDVRIDVVAVAGTDHSPAPGTIIGTITRDGRRYEVRG
TYLGVVADEN
379764631YP_005351028.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSATRRTAAIVGVHNTRQGRRLDGETSRGLAIKAILGALDDAGLTLDDVD
GISASPQSTSLIYDLRIGPAWQGLAFGVGMITEAVTAIEHGMADVVVLVA
AQAGEYRDHEATAPWTRPENEFVAPWGMFTTAEFALIARRHMHVYGTTRE
QLSLVAATIRNNGSRNPEAVYYQRGPFAPEDITASRPIADPFHLLDCATT
SEGGCALVVANVDAIDVKSQPIYVLGSGADFHGPSYQHPPAYDLAGRRGD
HVNGVVGRRAAECAFTHAGLRREDVDVLELYDPFSFEIIRQLEAFGFCGD
GEGGPFVADGHIAIDGSHPITTDGGTMSFSHAGSNPQMMQRAIRAVQQLR
GQAGDLQVPDAHIALCSNGGAGALFTTVLILGDEPR
379764630YP_005351027.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MPFWEGCRSRQLRYQRCAGCGLANFPPTEHCRQCLSQVVDWREGSGRGEI
YSWTVVYRPVTPEFEPPYAPAIVTLDEGYQMLTNVVGVPPEDIEVGLRVR
VRFHDVGPGVTLPYFTAEGTDSS
379764629YP_005351026.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MADDTIQALLRKRLSDSSIAVKYGDAQWSWRQYLEGSTARAAALLAAADP
SRPVHVGALLGNTPEMLSQMAAAGLGGYVLCGLNTTRRGEALAADIRRAD
CQFVVTDAEHRPLLDGLDLADTRVLDTSTPQWAELIDSAGELTPHRQVTA
MDAFMMIFTSGTSGNPKAVQVSHFMATVAGLSLAERFTLTDQDTCYVSMP
LFHSNAVVAGWAPAVCSGAAIVPAKFSASNFLDDIRRHGATYMNYVGKPL
AYILATAERDDDADNPLRVAFGNEANDKDIEEFARRFGVQVEDGFGSTEN
AVIVIREPGTPKGSIGRGADGVAIYHSDTVTECAVARFDADGALVNADEA
VGELVNTAGSGFFTGYYNDPDANAERMRHGMYWSGDLAYRDSDGWIYLAG
RTADWMRVDGENLAAAPIERILLRHSAINRVAVYAVADGHVGDQVMAAVV
LNDGHTLAPDEFEAFLDAQPDLSPKARPRYVRIAADLPSTATHKVLKRQL
IAQGTAIGQGEVLWERESRGTAYAVTGSGAPYGGSAPSTVAPV
379764628YP_005351025.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MEHVLQGRRILVTGAATGIGAAAVGVLIEAGAEVAATYHRTPPPEGLAAK
WFQCDARDPDGVSATVTDAAHHLGGLDVLVNAAGLWQAGIPGYIGADDIS
FLLDTNVKATILTNQAAYAVMRDQDPKGGRIINFGSSEAVMGSPISAVYA
ATKGAVQAWTRSAAKAWAADNVTVNALAPAVQTPGADRLRDFLGPDAAAL
IDQQMKMMIPLGGTLGDPTRDLGPMLVFLAGSGSGFITGQLLAVDGGLMM
VGG
379764627YP_005351024.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSTIDISAGTIHYEATGPENGRPVVFVHGYMMGGQLWRQVSERLAARGLR
CIAPTWPLGAHPEPLRRGADRTITGVAAMVAEALAALNLEDVVLVGNDTG
GVVTQLVAVHHRERLGALVLTSCDAFEHFPPPILKPVILAAKSKTTFRAV
AQAMRVPTVRKRAFDGLAHRNIDDLTELWVRPAQSLPAVAEDLRQFTLSM
RPEVTTTVAARLYDFDKPTLVAWSADDVFFEQEDGARLAATIPNARLEVI
AGARTFSMVDQPDRLADLLSTVAVRA
379764626YP_005351023.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MESKRRTQEERSAATREALIAAARKLWGLRGYADVGTPEIASAAGVTRGA
MYHQFADKAALFREVVEVVEQDVMARMAVVVAESGAATPTAAVRGAVDAW
LEVSADPEVRQLILLDAPSVLGWAGFRDVAQRYSLGMTEQMLTEAIRAGE
LAEQPVRPLAHVLIGALDEAAMVIATADDPDRTRDETREVLHRLIDGMFD
AR
379764625YP_005351022.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MLGSNGVHGVSHPKVDDHAGVPAGTTSFYFRTRRALVHAIATRLAELDVA
DFSMMAELAEDHATQFTGTAGLARIVMYVNSEPWLTRAKARYELALLAGR
DPELAAALSESADRLYALARDVVTQWHPEGSAPDPALVDDQATATLAFIN
GIMLTFVAGQPAVDDPEHLDRLIQGVIAGVAHVRGD
379764624YP_005351021.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MGTGIARADGGDEPQYADFYAAPDPLPPGQPGDLIRTEPSRLVLEPSGQL
GAIMASGTRIMYRSTDTRGNPIAVTGTYFEPYNDWPGAGPRPLISYAPGT
QGQGNQCAPSRMFNQGIHYSGGWDIMFNYEELFVATMVARGFAIVMTDYE
GLGTAPMHTYVGRVAEGQAVLDAARAAMRLPGTSLDPHGPVAFWGYSQGG
GATASAAELASQYAPDLHIVGTYAGAPPADLKELLPYADGSALVGVVGYA
LNSVMAAYPEFADIIRSKMTPRGLAMLESVSRQCVGQTLLDFMFRHIQPY
FTEDINQLVNEEPFNSLFEAQRLGRFKPNAPVMIDSNRYDPLVPWTAANQ
LGRDWCAQDADVEFRTNEEPPFLNKLVINHALPMLVDGEPAMQWIAARFN
GEPTTPNCGQF
379764623YP_005351020.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MNRRQFLGSLAASVVAGVGTARLIVDPQPRTFAQTPGVDIPTSGPTAPQA
LLPPPPLSARIPLPGGGALMKLPGEGDLLALTVDDGVNSEVVRAYTQFAR
DTGVRLTYFVNGIYDSWTENSELLRPLVDSGQIQLGNHTWSHPDLTTLTK
EQVAEQLTRNDTFLKKTYGIGAKPYWRPPYAKRNAAVDAVAADLGYKVPT
LWSGSLSDSTLITEDYIVQMADQYFTPQAIVIGHLNHLPVTHVYPQLVDI
IRDRNLRTVTLNDVFLKTP
379764622YP_005351019.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MEQFFGQLSLLHGWFPPAVQGLALLVLIVAIQWRARSWLKRVLPVALIAA
VAVTALSRWYITSLGVAGDPAPTTLWLWIAMSGLAAAVFLVGWRGARWWR
RGVAVLSIPLCVLCAGMALNGWVGYFPTALAAWNQLTSVPLPDQVDRLRV
TEMQIAGTRPTKGVVVPVDIDSSASHFAHRRELVYLPPAWFNSNPPPRLP
AVMMISSAFNTPADWLGPGGAFTAIDNFAAAHHGFSPVLVFVDPTGSFDN
DTECVNGPRGNAADHLSKDVIPFTVSNFGVSADRANWGVAGWSMGGTCAV
DLAVMHPELFSAFVDIAGDRGPNVGSKDQSVARLFGGDQAAWAAFDPVTV
MTKHGHYAGLSGWFDVPVSSGPGNVAEQASPTLVASSDPAANPEGQDAAA
RSLCAVGTAHGIACAVVTQEGKHDWPFAAQAFATALPWLAFTLGTPAAEP
VQLPQRGAGEPH
379764621YP_005351018.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSTPPRNIDEGTLPEDTPAAAPPIELEITGMTCASCAARIERKLNKLAGV
SATVNYATETAAVSAPAGYDPRILIAEVEKAGYAAALPRRSPVRDAELTS
LRRRLIAAAVLAGPVIAMAMVPAWQFHHWHWASLALTAPVVLWCGLPFHA
AAWANLKHGVATMDTLVSIGTLAAFLWSLYALFLGTAAQPGMQHDFELTV
GRDDAPCHVYFEVAAGVTLFVLAGRYFEKRAKRSAGDALRALVALGAKDV
GVLRDGTETRLPIERLAVGDQFVVRPGERIATDGVVVTGSSAVDASMLTG
ESVPVEVGAGDAVTGGTVNAGGRLVVRATGIGDDTQLAQMAKLVERAQSG
KARVQRLADRVSGVFVPVVLALAVATLGGWLAAGFSPTTALTAAVAVLII
ACPCAMGLATPTALLVGTGRAAQLGVLIQGPEVLESTRRIDTIVLDKTGT
VTTGRMALVDVVVGAGTDRATLLRYAGALEAASEHPVAQAIARAAAAQLG
ALPTPADFAGVHGMGVHGTVDGHAVVVGRASLMDERGARLDAALAAAKSR
AEGDGKTAVVVGWDGAARGLLVLADTVKPSSGDAVRQLQRLGLTPVLLTG
DNHTVAARIAAELGIAEVIAEAMPDDKVAAVKRLQAEGKVVAMVGDGVND
AAALAAADLGLAMGAGTDVAIEAADLTVIRDDLRAAVDAIRLSRRTLATI
KTNLVWAFGYNLAAIPLAALGMLNPMLAGAAMALSSVLVVGNSLRLRSFT
SVVTDT
379764620YP_005351017.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MPTSEYRVSGMSCAHCEAAVQGEVAGIPGVDGVTVSADTGRLVVTSAVPI
DADAVLAAVDEAGFQAVQVA
379764619YP_005351016.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MRGLTGKTFVVAGGATGIGAATAERLATEGARVAIGDNNIAGAAATAQRI
VSAGGRAIAVEFDLADEQSVRRLVETTLDEFGAIDGLHNVGADLSEGNLG
RDTTILDTDMDVWQRTLDVNLLGYVRTIRAVLPHLLARGGGSIVNTSSGA
ALGSDPMHVAYGASKAAVNHLTRHVAVNWGKHNIRSNGVMPGLVMGETQE
RQNDVALQQAFLTFGKTSRLGKPDDLAAITAFLLSDEAEWITGQVWYIGG
GSHLRQ
379764618YP_005351015.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSQSLSGKVALITGAARGQGRAHAVRLAAEGADIIAVDLAGPLPPSVPYD
SPTSDDLAETARLVSEGGRRVVTAEADIRDLDALSAAVDKGVGELGRLDV
IVANAGICSPAPWDQITAQAFRDTIDTNVIGTWNTVMAGVRHIIDGGRGG
SIILIGSAAGIKMQSFMIHYTASKHAVVGMARAFAAELGRYNIRVNSLNP
GAVATPMGTGRMREALQAAADDYPHLRGMHKPLLPEGIAQPEDIADAVAW
LASDQSRLVTATQVSVDIGVGYV
379764617YP_005351014.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAVDLTGGIDPSREYVLAQRPEDPEMRDSVSFWVVDDRGEIGLPRVGIEA
VGANWDSHDIQVNAAFPDGRVYRLRTNGPSLPARGADGRPTVLGAGGLAF
QCLEPFDTWTMSYDGPAVQTSSVDLVAGRKDGPTTNIGFHVEARMAVPPW
VQGALQADAGTQLQTTSVGAIMGGPRYEQLFTATGEFRFGDERHTFTGSG
LRIRRTGVRKLAGFWGHCWQSAVFGSGRAFGYIAYPPRPDGQPTFNEGFV
FTGDGGLVPARAVRAPWLTRLRPLGEDASLVLETADGLVEIAGETVFSTH
DVHHDDDMYSMHALKEEMAEFPAVQQAGVRYRWDGEEAYGMLERSNPLDK
LARD
379764616YP_005351013.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MLTSGELMEEAAAQTGLTDFGDDSFTEGLNVLLSALRDEAHLNERGEAFL
RQRIAGYLSQRLQVEDWFRRHPEIGDVPIREPLVGLGLPRTGSTALSMLL
AQDPEVRYLRRWESTQPCPPPSTVHGVDPRVPADRGEMVGTRRHVPGDTH
GPMECHELMALDFKSHIFQSFAEIPSYSTWLVHHADLTPTFRYQRRVMQL
LQWGEPERPWRLKCPSHVLWLDALDAVFPDARFVMTHRDPTDVLLSVADL
YADIIGSFNTRIDRRYIGRLNVEHWSLGMERALRFRAAGADDRFYDIDFR
AMQADPVGEVAGLYAWLGAPVSDEFEARMHSWWEHAAAQREPSSHADPVE
FGIDLDEVRPRFARYVDSARRWTRHPKVRSEESNGG
379764615YP_005351012.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTVQDDQDWVQLLGLDRLPEHIVGKRVTELMDLSGKKAFVTGAGGDGLGQ
AIANRLAGCGAEVALIGRTFEKVERRAEEVERRWGVRAIPVKADMSDWDQ
VHGAVRQAHHELGGLDIMVNNPVMVAAGPFEKQTKEDIDYTVLGSLTMMM
YGAHAALAYMLDQGSGKIINIGSVGGRIQQRGLVVYNACKAGVIGFTRNL
AHEVALRGVNVLGVAPGIMIKPEMRQYLLDPQDDKQRAGRGAIQEAITHQ
VQLGRASLPEEAANMVAFLASEAADYLCGQTIDVAGGQWMG
379764614YP_005351011.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MEAMDTHRLKYFLRIAEEGSITRAAAVLGIAQPALSRQIRLLEEDLGITL
FERTRRGVHLTEEGERLRSSTAAPLRQLELAVRYAGSPLARIERGLLFGI
VPTAAGVLAAPLAASVGAAFPNVHFHVAVAETDDLVERLLKGAIDLAVIN
PVSDDRLFHRHLVTEDLVLVGGPASELSPASPIRFTDLAKLPLVMPSGLT
GIRNTLENTALRLKVAITARFSTDSVEVAKHLVAAGLGYAVLPMAACGAD
VEAGRLRWTSIHEPPIDQQLGVAATAALELPREFAAKIGIVLREEVARLT
KSGFWPARFEPSPVWDPNIPEPRN
379764613YP_005351010.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAAPASELYAIVADPRRHHELDGSGTVRDNITMPPQLLEGSKFSTSMKMF
GVPYRITSTITALTPNEVVEWRHPLGHRWRWEFEALSPNLTQVTETFDYR
DAGALKNKLKYYERMGFVKANASGIEATLTKLRDRYAG
379764612YP_005351009.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MFGYRRRHDGPAMSVVYYIPTDTDDLLVSTMAGRGKARIVQRDGKVSLCV
LDERWPFAYLQVYADAAVEDDRDLAIDVMMAVAGRMSGQPLGDEARPHIE
AMCERENRVVIRCRPYSTYATPPRHLHRNDQASELSHWVSGVMPWDAADP
VAN
379764611YP_005351008.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MDRILGAAVELLDAEGADALSMRSLAQRLGSGTATLYRHFSNRSELVSQV
IDHILGEVDLDARALAALPWQQACITFAQHMFDALRRHGNVAPLLIEYTP
TGPSALANRERCLVILLDNGFAPAVAAHAYATLARYVLGFALQLPGATDG
GGEAELSAAFHRLDPSRYPATVTVADELPVPLADEFAFGLRLIVSGLERL
RE
379764610YP_005351007.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MIANTLSRWGQLVGRYGLVVVLVWIGVGKYVKMESRVLIEHSPLMSWLYD
VFSVTFVARALGTMEIVAALLIALRPWRPRVSAAGSALAVVLFLGTVSFL
FTTPGVIATHAHGMPVLSALPGQFLLKDLVLLGVAVWTLGDSLSAGGVTA
RPYPARSE
379764609YP_005351006.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTSRKARWLYAVGRLRATTRRGRSPRVAIIGAGFGGLGAAVALRRAGIDD
LVIIEGADGVGGTWRRNTYPGAACDIQSHLYSFSFAPNASWTRTYARQPE
ILAYLESVADDFDLRRHLMLDTTVRSLHWNPGAGTWECRVDRNGESATLV
ADVVVCAVGLFGSAKLPDIDGLTGFAGPVLHTAQWDHQLDLAGRDVAVIG
TGASGVQLVPELAKTAGHVTVFQRTPPWMVPKDDRPYSASELARFRRSPV
ALRRTRWKIWKFQHDNTATFADDPVVAARTQIATSFLDRTVDDEPLRRAL
TPDYPFRCKRVLLGDDYYRALQRDNVELVTEPIARVGETSVITASGREIA
SDAIVLATGFETSRYLSGIDVTGTGGRRLHEHWGDDPCAYLGVAVSGFPN
FFMLYGPNTNQGGNSIVYILESAARLVASAVSRLARRGGYLDVRPEAERR
YNDQLSADLARTIWTQCDSYFRSPTGRIVTQWPYTELDYARRTWRLRRRD
WIHRCGAPPRDDAHPVDGETRCAPAPSG
379764608YP_005351005.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MGLATAKIVGRDHTVVLCDVRQDRLTTAAATLQELGINPTVVNCDVTDRR
AVVDLLGTATNLGSVVSVIHTAGVSPSMGPADYVMRTNAVGTVNVDEEFY
AVAGEGAVIVNVASMAAHMLPAEIIPTGQFPLALDDADAFMGAMMTACDI
APEEARSGLAYALSKSFVKWYSQSQAERFNARGLRIVSVSPGSIDTEMGR
LEEQAGAGAMVADAAVPRWGKPEEMAELLAFCASEKAGYLTGTDILNDGG
VIASMTERARAAAASSA
379764607YP_005351004.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTMLAIDRPAADVTMTAQWRRRTLTRSGLITGAFVAPAVAIRIAGLHVGA
VPALLIFGAAVVAASFLLAWAAEAAQIDVSGGLATALLALIAVLPEYAVD
LYYAYVSGHNAEYTQYAAANMTGSNRLLMGLGWPVVVLVSIVVARRSGSG
KPTGLTLEPANRVELGFLLIAGVIAFAVPVAGEIHFGLGLALLAWFGFYL
YKLSHGEVEEPDLIGTAAALGELPDVRRRVAVVGLFAASGAVILLCAKPF
ADNLVAAGTELGVNRFLLVQWLAPLASEAPEFIIATIFATRGKGTAAIAT
LISSKVNQWTLLIGSLPISHLLGGGGFALHLDSRQVEEMLLTATQTMMGV
ALILALRFHRGAALALLGMFVVQFPIASTHGRLLLCGVYAAVAVVALIRY
RRHLPATVRAPFFGTAVRHTGHPLHPVPDP
379764606YP_005351003.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTFATKYGPWALVAGASDGVGAAFAEGLAERGVNVVLLARRQSVLDRVAA
EIENTTSAQTRTVAIDLAQPGAAAAIAAATGDLEIGMLVYCAGADPKFTP
FLANSIEAAEAMVQRNCMVPMQLCHHFAPAMVRRGSGGIVLFGSGAGLAG
GPNMVAYGASKAFDMVFAEALWAELQPKGVDVLGLILGKTDTPALRALEY
SRGQIGSPDEAPADAAPVSEVIAEAFENLGNGPTLMVGDTMRAAAQLLAS
LSRNQAVELFAQAAAAAMGPDH
379764605YP_005351002.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSEREDRQDISDLLVRYATGIDRRDWPLFRTVFTDDCELDYGEIGRWSGV
DEVTDFMDKTHAMAGHTLHRLSNQVIAVEGDNATARTYVDAVIMFGDNQA
GVNAWGFYDDEIVRTGEGWRIARRRFTQVRVATFGAP
379764604YP_005351001.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MVLRDGRLQVRETADPIPGQGELLLRTLSTAICASDVHFMDHPELAIDDP
TGRSLYDTDRDIVLGHEFVGEVIGHGPGCTDQFAAGTRVTAMPVRLVDGG
AGGMRIIGQHPEAQGSFGELLVVSEAATKRVPGDVPSDAVALTDAFAVGE
FYVRSARLGQGEVAIVIGAGAIGLSAVAALAARGVEPIIVADYKSDRREL
ARDRFGAHVVVDPSEKSPFEAFNEVRARRGLPGPAVVFECVGAPGLIQKL
VESAEMGTRIYCAGGWYTGDTLDITTATRQGVTIQFGGGPHPQDWYGTLD
AIASGRLDPLPSVGTIIGLDEVPDALELARRSDGPPRIIVHPNGDRP
379764603YP_005351000.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MLDVVELLARSGSARLRFSDVVRELDLTQATAHAILKTLCDRGWASRDPI
AKTFALGPALAVVAARTDTARPLAHAARSAALRLSGEVGYACSVVEKFGD
SLVVTAFEGEPATQPSGIPGDRIPYAPPFGVAMAAWDTDEEQRAWIRRGA
GSNADRTQRLQQVLARTRERGFDIDWTTPALAQAVQVVGTLDSNEMPTPV
RHIMDQLLVEFTTIGFLSDDNPGRRKQPVVTIAAPVFDDRGRVSLMVAVH
PLCPLSARQIRDIGAHLTDETTALSGSPASAG
379764602YP_005350999.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MDELAQFVVGAQASDLTGRPRALLTRNVLDSVACAVGSLNGELIATVREH
TAQFSGDPTATLVGGGRASVDQAAFFNAVLVRYPDLLDTYLTVGGLCHPA
DNFGAVLAVAEHTGAGGADFLLALAVAYEVQCRFSAQVPVMARGLNHALQ
LAMSVAAGTAKLLGLSAEQTANAIAAAAADNVSLAGVHAEPVSYWKGISP
ASTGMRAVYTTMLAARGVTGPKSLFDGPHGLVQLFGQPIDFHTADRALSC
VEQTYLKQYCSLIHGQVVIGAVLVLRAENSLRGEDVARVGLEVFQGAFDI
AGGGAYGNKDHPRTKEQADYNLKYLSAVALLDGGVGPEQLETERVLRADV
QDLLSRVDVTAADDLTAGYPQRTAARVHLRTHDGREFSREQDDYEGSPTR
PMSWDRVVDKFWWLAGPFCERALGDEIIAAVARLDEIPVATLTGLLGAVS
PTARRPRTGPRF
379764601YP_005350998.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MPKERGLNRWELVTCALAGHVTYAPDDHALAQRLSGTTGLGEVWRCLRCG
EFTVGPPHGRGHAEDAPMIMHGKALRQAIIIRALAVERLFRAMVIVLAAY
AVWKFRGARGAIQATLDRDLPIFRAAGFKVDQMTIVHELEKALAAKPSTL
ALLTLMLAGYALLEVVEGVGLWLLKRWGEYFAVIATSVFLPLEIHDLAKG
ITMTRVVTFTINVAAVIYLLISKRLFGLRGGRKAYDEERRGEQLLDVERA
AART
379764600YP_005350997.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MHDQTPCIDFGELESVYAPLAESLRRLIDISIRTEAGAAAVAAATSKIDS
AAAELSGALKPGPFGVHRNPDGQTIAWGNAVVGLRNPIAPPLVIHHEPDG
LVWSEFVLGAAYEGPPDTVHGGVCALVLDHVLGATAHQPDKPAFTGTLTL
RYRRPTALGRPLRAQAHVERVEGVKTFAVGHLADEHGVTVEAEGIFIHPR
PAAE
379764599YP_005350996.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MGTYAITGSASGMGRETAQRLRDGGHTVIGVDIKDADVVADLSTPHGRSE
AVERVLAASGGRLDGAVLAAGLGPSPGPDRLRQIAQVNYFGVVDLLTAWR
AALAASGRAKAVVVASNSTTTVPAVPRRAVRSLLAHDADKALRSVRLFGP
AAPTMMYAASKIAVSRWVRRHAVLPEWAGSGVRLNALAPGAIMTPLLAEQ
LSDPRQAKAVESFPVPVGGFGDPGQMAEWMCFMLSDAADFLCGTVIFVDG
GTDAYFRSDDWPKAVPVGRLSGYLRRFRAFP
379764598YP_005350995.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MRYPTARLFVTFTSARRPRKTAVVQLNESAHGRKTKDQL
379764597YP_005350994.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTTLPSWVSQGSANLDVGAPLKARACDALYAVLGSKRRPGATAPRIMPRG
VERC
379764596YP_005350993.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MPEYAKHDDYWNHNSAYHPWLVGLAARRHGDVFDVGCGEGLLAQRLAAVS
RSVVGIDADPVSVWRAAQRLQSIDNASVEHGRFEDLDGAERRYDLITFVA
SLHHLPLRDALHKARQMLRPAGQLAVVGLSANKSIADWVWAGLCVPGARV
GGLLHRETRDIGVPVADPREGLDEIRRVAADVLPGAAIRRGLYYRYRLLW
RNR
379764595YP_005350992.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MVQDFLNTRGVDGYGPDLLADPGQAREWADAAVRAWSSARGVDVSPPELG
EADLGRLRAVRSTIERMVDGEPPRSRGAHGVVASFGLSDAGEVRLDPSGN
GWRWLASALWGEILLSQHADTWRRIKRCHNHRCGSTFYDRSKNNSGVWHD
VKTCGNAVNLRASRARRREREKATRSAVSPQ
379764594YP_005350991.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MVNVNGAAVVVTGGQRGLGKAIVAELLDRGAAKIYATARVPKPSEDPRVI
GVELDVTRPDSVAALATTAADAEIVINNAGVLGARTLLDSDIEEVRAVFE
TNYFGALRVAKAFAPVLADNGGGALVDIASILSWMPGSGGYGDSKAALWS
MTNSLRAELEKQGTLVIAAHLSFTDTDMTSGFDAPKNDPRQVARAIVDGI
EADDKEVLADDDTRYVKAALAGPVEALPRMP
379764593YP_005350990.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSDTERIVTATRVMSANAARIFELIADPSRQPSWDGNGNLASSAPGQRVR
AVGDVFKTTLTNGAVRENHVTEFVEGSKIAWRPAEPGKQPPGHLWRWELS
PVNAELTTVTHTYDWTELTDATRLERARATTTDMLRESMDRLAALAQSAE
379764592YP_005350989.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTDVDITLPPALRRALDLLIDPPADPDVSHGYLDLLGSGSAGDDGVGKNT
GPIQAAWASRVGSMLYDNAQAFARQWISAWQLPLEWLQIPPGGIALDVGS
GPGNVTASLARAAGPDGLALGVDISEPMLARAVRNEAGPQVGFIKADAQR
LPLRDNTFDAAVSTAVLQLVPDPKAALAEIARVLRPGGRVAIMVPTAGRL
ARYWQLLPNVGAHAFDDDEIGDTLEDNGFSSVRVKNVGTFQWVRAKLG
379764591YP_005350988.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAGSSAAPRTRYASCGEIDIAYQVFGDGPIDLLVLPGPFIPIDCVDSEPS
MYRFHRRLASFCRVIRFDQRGIGLSSRVPSLDMIGAESWANDAIAVMNAV
GCERATILAPSFTSLAGVVLAADFPERVNSLVIVNGQARTLRAPDYPFGS
DLAEADPYTTVAIEPDAVERGFDILGIIAPSVAHDDAFRSWWDMAGNRAA
SPSMARAFIGKIREGDVRDRLDRVGVPTLILHRDNPRFSPVGHARYLAER
IPGSRLVELPGEDVLYWVGDTGPMLDEIEEFITGIRGASDAERLLTTIVF
TDIVGSTERAAELGDYRWRDLLDNHDRIVRHELQRFGGREVNTAGDGFVA
TFSSPSAALACADALVDAVQVLGIEVRVGIHAGEVEVRGAGKDDIAGMAV
HIGARVAALAGPSEVLVSSTLRDIVTGSRHRFGDRGESALKGVPGYWRLY
ALVREHAAVRR
379764590YP_005350987.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MQSEPGSASHSASAEALTDLDRTILDTARGVFETYGVRRANIDDVATRAG
VSRSTIYRRFPTKEKLFGQVVRREAELFFSTLDQATAGCDPREAVVEAFA
LGVRLVQDSPLYSRIAESEPELFGMFSRSHVFPIRQFADGIAHTLRRCGA
EMSGTDLDNVADILLRVALGIIVFPTDRLDTSDPAAVREYAARYLVPIIG
P
379764589YP_005350986.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MGMTAQNDELAAPSAGSRFDSGVREAVPMPTDGPDWSATDDTSPRLGPDS
LIWKFYGDNRTQLFGFQRTAGVENCIEQLAQGVLDHSVIFSDTLGRAKRT
APPLMNTVYSEDPHEWGRKVRDFHKTIKGTISDGSRYHALNPELFYWAHA
SFVDQVIYNTDTFIRRLSHAEKEQIFNEGKVWYSLYGVSDRGQPQTYDDF
VAYWDEMLDRFVPHKTVLYGTGYIRKGIPGPRWMPKPIWNVVSAPLNAYT
RLVVVGTLPPQMREVCQLHWDAKKEKRFQRFAGVIRALNPLINRLPVKAL
YTPWAARAWARAGVDPRKLHNRAAAA
379764588YP_005350985.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MPVERIRRRTAMQMTGNTVLVTGGGSGIGRGLAESFHRLGNQVIIAARRS
DQLRAVAEANPGIQTLSLDQGDAADIRRFATEVTDHYPDLNVLINNAGIQ
RVEDLTSGNVGLAEQSVAINLLGPMRLTASLLPALLRKSHATILNVTSGL
AFMPSALTPTYCASKAALHSYTESLRFQLRDTSVQVIEIIPPHVRTALQG
ERGFDPRAMPLDEYITETMTLLQTQPQANEIVVERVKMFRYAERDGTYDD
IYPRFNETITAMFGS
379764587YP_005350984.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAASAVSGSLIPTAAAQCPDVQVVFARGTGEEPGVGPTGQAFVDALHQRV
GDRSFDVYPVNYPATDQWDTGIDGIRDAGAHVVSMAHDCPNTKMVLGGYS
QGAAVMGFVTSAAVPEGIDPATVPKPLSPDVANHVSSVVLFGMPNVRAMN
FLGEPPVVIGPAYQDKTLKVCATEDPVCSDGMNFAAHNTYADDGSIIDKG
VAFASSHLGMGSPGAMSVASPHGGFGE
379764586YP_005350983.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MLNAVAQALNAVLTAAGDHVANPARVSDPDKLRAATSGKTALVTGASYGI
GEATARRLAAAGATVLAVARSEGRLGDLTASIHAGGGHAVAYPTDLTDES
AVSGLAKQITEEHGPLDIVVSNAGKSLRRSLHHQYDRPHDFQRTIDINYL
GPVRLLLGLVPAMRDNGSGHIVNVSSVGVRVAPGPQWGAYQASKGAFDRW
LRSVAPELHADGVDVTTIYFALVRTRMIAPTPLLGRFPGLSPDDAADVIA
KAVIERPRTLEPPWVLPAEFASVLLAGPADHAARLWHRRFLTDSDGGDRD
H
379764585YP_005350982.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTTDRVATTAARALVHSGLLTPPSPAAGVRLLREARRGGTNPYTLLAVTA
ARWPDRTAIVDDDGALSYRELQRETESLARRLAADGVAPGRAVGVMCRNG
RGFVAGVFAAALLGADVVPVSTEFRSDALAAAVQAHRISTMVADNEFAER
IRAADESVVTVDPATVTAEEGARRPRVAAPGRIVLLTSGTTGKPKGVPRA
PQLRSAVGVWVTILDRTRLRTGSRISVAMPMFHGLALGMLMLTIALGGTV
LTHRQFDAEAALAQASLHRADAFTAVPVVLARILELPERVRARNPVPHLR
VVMSSGDRLDPTLGQRFMDTYGEILYNGYGSTEVGIGSLATPADLREAPE
TVGRPVAGCPVRILNKSDRPVGPRVTGRIFVGGDLAGKGYTEGAGEAKAV
VDGMTSTGDMGYLDNAGRLFIVGREDDMIISGGENVYPRAVENALARHPA
VADNVVIGVPDERFGQRLVAFVVARPGSDIDVPELREYLKSRVSRFEQPR
DINVVDRIPRNPTGKVLRRELSG
379764584YP_005350981.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MKIPGVSDVVAGVAGGAAQVVRAGVSTAAGAAGALQTLAGPVAELAGPVL
QSVVQTTGRAIGADTSTDNAAAPITPPVRWHSGQRVHLDLDPLLPFPRWG
EYAPAVEEPVRRIPGVAEAHVEGALGRLVVELSDGTDHDAVLDEVRSTVA
SIAADITWSKSEAATPSAPFADPGNPLAILVPLTAAALDLIAMGAAVTGW
VTRLPAAPQTTRAAAALINHQPRMVSILEERLGRVGTDIALAATTAAAHG
LTQSFGTPMLDLTQRTLQVSEAAAHRRVWRDREPHLASPQRPQAPVVPVI
SSAKSEVPRHSWAAAAAGEASHVVVGGTIDAAMDKAKGSMAGPVESYVDS
AANGSLIAAVSALMAGGGTDDAAAAIEAGVPRAAHMGRQAFAAILGRGLA
NSGQLVLDPGALRRLDRVKVVVIDGAALRGDHRAVLRVRGDAPGWDDDRV
YEVADALLHGEQAPEPDPDELPATGARLKWVRNQGPSATPAQGLESADLI
VDGECVGSVDVGWEVDPYAIPLFQTAHRTGARVVLRHVAGTEDLTASVGA
THPPGTPLLNVVRELRADRGPVLLITALHRDFASTDTLAALAIADVGVAL
DDPRAATAWTADIITGTDLADAVRILSAIPVARSASESAVHLAQGGTTLA
GLLLVTGEQEKTTNPVSFRRWLNPVNAAAATALVAGTFSATRVLRLPDPT
PQPLTAWHALDPEIVYSRLAGGARPLAVETEPSWRRRLDDLSYSPGLAPL
RKPLHNMARLASATRTELADPLTPILAVGAAASAIVGSNIDALLVAGVMT
VNAITGGAQRLRAESAAAELFAEQDQMVRRVVVPAVATTRRRLEAAKHAT
RTATVSAKSLRPGDVIDLAAPEVVPADARLLVAEDLEVDESLLTGESLPV
DKQVDPVAVNDPDRASMLFEGSTIVAGHARAIVVATGVGTAAHRAISAVA
DVETAAGIQARLRELTSKVLPLTLAGGATVSALALLRRAPLRQAVADGVA
IAVAAVPEGLPLVATLSQLSAAQRLTARGALVRAPRTIEALGRVDTICFD
KTGTLTENRLRVVCAVPVGVDPHDPLPQLTDPQSAGLLRAAARASAQPQD
GQGHAHATDEAILTAANSLNGYGDSDWTMIAEVPFESSRGFAAAIGALGS
SNGHPADAPVLILKGAPEVILPRCRFADPQADQERAEGVVRGLAEQGLRV
LAVAQRGWKHETDDDDTDADAVDAAAEDLELLGYVGLADTARASARPLIE
ALTDADRDVVLITGDHPITARAIARQLGLPADARVITGAELAGLDEDACS
KMVADVQVFARVSPEQKVQIVAALQRCGRVTAMVGDGANDAAAIRMADVG
IGVSGRGSSAARGAADIVLTDEDLGVLMDALVEGRSMWAGVRDAVTILVG
GNVGEVLFTIIGTAFGAGRAPVGTRQLLLVNLLTDMFPALAVAVTSQYVE
PDEAEYASPEEAEEARRQHRRAVLTGPTPSLDAPLMRQIVTRGAVTAAGA
TAAWAIGRWTPGTERRTATMGLTALVTTQLAQTLLTRRHSPLVIATALGS
AGVLVGIVQTPVLSQFFGCTPLGPVAWSGVLGSTAGATVISALAPNWLAK
QVAALEPAEE
379764583YP_005350980.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MPAQEEFVERAAPFRAELIAHCYRMLGSVHDAEDLVQETYLRGWRGYQAF
EERAALKTWLYRIATTACLRALENRARRVLPAGLGEGSMDPDADLGAAGA
HAWLEPIPDDMMFKSPEEDFTAKQSVRLAVMTALQELPARQRAVLILRDV
VQFSAAEVAELLETTPAAVNSSLQRARAHLAELSPSEEQMAEPGDARRRE
LLDRYCAAFENADMAALTALLQADVKLEMPPLPVWFAGRDTVLKFLAERA
VAQPGDIAMVPTAANAQPAVAEYRRAADHVLRAHSIHVLTPGRDGIAGIT
VFLDPDLFSAFGLSATR
379764582YP_005350979.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MNKTPNPGADGFAGSTAIVTGAGRGFGRAIATALATAGAEVVGVARTRSQ
LEEVRAQLGDTFTPVVADAADPVTAGRLIDRHRPRTLVLCAGAAPRMAPL
QDQTWESFSDNWNSDVAQVFHWVRHALRRPLAPGSSVIVMSSGAALAGSP
LSGGYAGAKATVRFLAGYAALESQRAGLGIGFTAVLPRLTPATGLGAAAV
AAYAERQGVDVDTFLQAAGPALTAEQVGKSVLEIATAGPDHDAYLLTSAG
LAPLT
379764581YP_005350978.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MNTPPIVTAQEWASAHRELLEEEKKLTRARDALAARRRRMPWMEVDSDYR
FEGPEGTVNLAGLFGGRRQLIVYRAFYGPDIDGWPERGCRGCSMMADHVG
NLAHLNARDTTLVFASRAPQADIARLKERMDWKMPWYTITDGFDADFGVD
EWHGTNAFIRDGDRVFRTYFINNRGDEALGTTWSFLDMTALGRQETWEDS
PEGYPQTAPYEWWDWHDAYGEHEPSRWFGDPDPNNPNDIRPPKS
379764580YP_005350977.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MEADGTPESVPVEKLHSGDPITDCGQRYIVLESKALSDCVVLELESRVDH
QLQVIEKSFPTGYQVGRANHRIL
379764579YP_005350976.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MMGDAAEGQAVERYLQCLTDHDWDGLAGTLAEDGLTREGPFCDVVEGKAH
YVAYLRKVCTALQGHRLQVRRISHVDARTSYAELSETFEIDGVATTWPEC
ILFERDDDGLIVHVSVFFKQRQAGAAT
379764578YP_005350975.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MALHARARSLLFVHADRTLSERVPAPPDAVRGFYVDLDNIRLVHPLIVSV
ETLSRGETPEGYQQSYRVVDRIPLGPLTIRTAYHARLRVPADGDVLTEAA
QSPGVRLRGMVSFVPDDGGTRVTERIRISAPRLLAGVTVREAVKAHAEML
AGIRRHFEVTHPRNR
379764577YP_005350974.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MIRGVGQDWEIREIELDPPRGGEVLVRMAVAGICHSDDHLFTGDVVPTPE
ALAASGQPAPDWFPLLGGHEGAGVVEEIGPGVTSVRPGDHVALSFIPACG
SCRFCVNGQSYICDIGASLFVREMPTDGTCRRHLGDENLLAYGQLGTFAE
YAVLSERSVIKIDDAIPFHAASLVSCGVSTGWGSATISAGTEPGDTVVVI
GAGGVGMNALQGARAVGAKYVVAVDPVESKRDSAKVFGATHTAASAEDAI
PLVREITAGLMADRVVVCPGVVHVDLLPLAMALLRKGGICVLTGITPFTE
PPVPLVLQEMTLSAKQLRGALYGGMNPRTSVPMLLSLYQAGAVKLDELVT
RHYRLDQINEAFVDLREGRNIRGVIDFAGA
379764576YP_005350973.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MDGAVNLFAMLDQAASRHPHRGAVYHGTRRLYTWIELRDRALRLAASIRK
QHAAGARLAIATHNRPEIIELMFAIWAAECVVVPINYKLHPREMAEILDD
AGAARVFASTAIAGELAPITTTPMETFESQDYSRRVTVAPSAKPRTDPSA
LAWLFYTSGTTGRSKGAMLSHRNLTAMTVAHLADIDDPDERCSLLHAAPM
SHGSGLYVLPYVLRAARQVVPASGAFDPDEFLDLCEHHPAGSAFLAPTMV
QRLVGTGRARPANLKSIVYGGGPMYVESLRKAIAAFGPIFAQIYGQGESP
MTITGLRRADHESGDDAILGSVGYARSGMDVAVLRAGGDPAPVDEIGEIV
CRGDAVMSGYWRNPDATRATLKEGWLYTGDMGSFDARGFLTLRDRSKDVV
ISGGSNIYPREVEEVLLEHPAVAEACVVGAPDAEWGEVVVAFVVGTGDPV
DAAALDAHLLTRIARFKRPKRYEFVDELPKNSYGKVLKRELRARLAPLRE
CHETSGRSQ
379764575YP_005350972.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MGEMQVAIVTGASSGIGLGCATKLAEMGMAVLGTGRDQDRLAELHTAIGD
PDRVATLAVDLTDDDAPRRIVDLAVQRWGHIDFLINNAGVGSPKPLHETD
DETLDYFLGLMLRAPFRLARDVLPHMGPGSAIINVTSTFAVVGGLRGGAY
SAAKGGLTALTTHIACQYGASGIRCNAVAPGVTVTPMVEKRLQDERFRKI
NTEMTPHPRLGRVDDIASTVAFLCSPGGSFINGQTIVVDGGWSSTKYLSE
FALSSRWTER
379764574YP_005350971.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MLARARHDAAHASEAYRRGLWVHTTLADSLRAAAQTSPHRTVLVDKDVRL
DCATLHAQAGALAAAMLARMPTGSVVSFMLPNWHESAVIYLAATLAGMVV
NPILPSLRDRDLRFILEDAGTAMLFAPHRFGGHDYGAMLERVTAAMDTAP
EVVVLRETGHAGPHTPYPDLLDHAPDPATLPALDPDAARMILYTSGTASR
PKGVLHTHNSLHALIRQLREHWSIEPGDTFLVPSPVAHIGGSIYAFECPL
LLGTTAVLMDRWDPAQAVALMNAERCTHMAGATPFLQQLLSAAEGRGTRL
PDLKVFICGGASVSPSLIRRAADYFARAVVTRVYGCTEVPVATVGAPRPD
EADSAADTDGRAGIAEIKLVPHDAAPAGDGEIYLRGPQMLLGYRHPQDDS
FDADGFFRTGDLGRWVSTGSGDRYLVVTGRAKDVIIRSGENISAKEVEDL
LADHPGIAEIAVVGLPDERTGERACAVIVPVGAQRPDVASLLALLVSKGV
AKFKAPEQVVIWDALPKNDAGKVLKHRIRAALTRVETKDG
379764573YP_005350970.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSQAIAGDHRYLQIARTLRKEIVDGVYPVGSQLPTEHQLCERFAVSRYTV
REALRRLREDNLVASRPRAGTRVVPRPASSSYAQDAMSIDDLLAFAAGAQ
LTIESNAMVTIDDDLAARTGLEPGTQWLSVRGYRQADGASVPMCRTEYYI
SRSFAAVGRLLQRHAGPIFPLIEDLFGVSVAQLHQEIAAVLLSPELADGL
GVDAGTAALQMRRTYTTSDGEVAQVTINTHLSSRFRYAMTMRRVTGQAG
379764572YP_005350969.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTAPSRLFGANGLRTGPDGRIYIAQVTGSQISALDHRTGELVTTSPKGGD
IVAPDDVAFDPRGNLYATEVMDGRVSVRETSGRTRVLRDDVPSANGITFH
DRRLFIGECREGGRLLEFDLSGGPPRVLLENVPSPNAMEVGPDGLLYFPV
MGANEIWRVDPDGGEPHCVAKDLGVPDSVKFDARGYLVSTQVASGQVLRI
DPRSGERRLLAQLNPGLDNCTFVGDRLFVSNFSGEITEISPDGATTSVLP
GGLNWPLDLAVGQDGQLYIADGTYFYVVLPDGSLQTAGMLFSPGYPGFLR
GLAAGGPGEFVVTTSGGQVARYRPEAGETEVLADGFDQLYGVAVTPGGVV
VAELGTGRVLSLRSGGVDVLATDLREPVGVAIDADGAPLVAEAGAGRVVR
PAGSRADTVVADLQRPQGILVRDGVLYVVDAGAKELIAFDLAGHGRRTIA
SGLPVGPPPGVTPKPLRGMPPFSGPQGPFAGITAAADGTLYISADGEGSV
LALRPTGH
379764571YP_005350968.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MDDQFGHLRLDGRVVVVSGAGGGGIGTTVTAMTARAGATVIAVSRSKENL
DEHIAPLPAHGLAVVPVAADASTDEGIAAVIDHARRADGSLYGLVNVAGG
AEPSTWMPSTRVTRGDWRKIFADNLETAFFMSQAVAAELVAQRLPGSIVS
ISSISGMNTAPFHIAYGTAKAAITAMTRTMALELAQAGIRVNAVAPGVTE
TAASRTYVDEDPERDRQAIAMGRRGRPEEQAGAILFLLSEMSSYITGQTL
LVDGGLDLKWSHLGADNTSLFLRDESFRAAIRRM
379764570YP_005350967.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MMTDLAKGTNSAGAEELSSPMTIGVEAYISEDYARAERDKLWRRVWQQVG
RVEELPEVGSYLTYDILDDSIIVVRTGHNEFHAHHNVCMHRGRRLIDTPE
GAKNACARTRKSFVCGFHGWTYGLDGACTRIREQQDWQGALTPDNTHLRP
VRVDTWGGWLWINMDPDCEPLADYLFPAAKILDPFGCENLRYKWRKWLEF
DCNWKVALEAFNETYHVYTTHPEFNKFGEFKGWAKAQGRHSNIGYDAPED
MEATKSKIRLGIGADPRVSTAEMQVYTMEETNATTTQTLVNAAKRLVDEL
PEGTPADKVLEHWLASARRDDEARGVVWPTIPADILGQAGTAWQIFPNFQ
IGQGLTSALCYGARPHPSYNPDKCIFEVSVFELYPKGQEPQTEWEYTPVG
DPRWRSVLPQDFSNMAAVQQGMKSLGFAGTKPNPYRERSTVNLHYQLSRY
MGTGEPQELSRKESPSA
379764569YP_005350966.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTMHQDSCGPTQTPDDVDIAALREKYRLEREKRLRKEGSKQYIELEDDFA
GYYEVDPYTPAAPRDPISEDIDVAVLGGGFGGLLSAAHLKKAGVDDVRVI
ELGGDFGGVWYWNRYPGIQCDNESYCYIPLLEELDFMPSKKFADGAEIYQ
HCRNIGKHFGLYDSAIFSTQVRDLRWDEEIKRWRIGTNRGDDIRARFVVL
ASGPFHRPKLPGIPGIKDFKGHAFHSSRWDYDYTGGDSGGNLHKLADKRV
AVIGTGATAIQIVPFLARDAQHLYVFQRTPSTVDERNNAPTDPEWAKSLR
PGWQRERQRNFHSWTFEGMALGQPDLVCDFWTELGRNTAARVLALDDPAS
LTPEQFMAIREEEDYKLMERLRRRIDVIVEDAQTAEALKPYYRFLCKRPL
SNDEYLPMFNRPNVTLVDVSDSKGVERITEKGLVAGGVEYEVDCIIYASG
FEITTEISRRYSMETIEGRDGLSLFDHWRDGYKTLHGMTSRGFPNQFYTG
FTQVGISANIAANYELQGEHIAYIIAEALKRGATTVEPSAAAQEQWCATI
RETAVDNSAFDAQCTPGYYNNEGGGGGEGIRSHLGEPYGPGFYAFEDLLR
VWRDRGDLDGLVLGT
379764568YP_005350965.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSETPAEQLRFDGRVAVVTGAGRGLGRAYAQLLASRGAKVVVNDVGGGLD
GEGVDAGPAERVVAEITAAGGQAVACSASVATAAGGDAIIATALEHYGRV
DILVHNAGNVRRGSLKEMSYGDFDAVLDVHLRGAFNVVRPAFPLMCGAGY
GRIVLTSSIGGLYGNRDVANYAAAKAGVIGLSNVAALEGAAEGVRCNVIV
PAAVTRMADGIDTSAYPPMGPELVAPVVGWLAHESCSVTGEIYIALAGRV
ARAVVAESPGVCRSSWTIEDVGSHLDAIRYAEAPLIFPVVPDGHDEHIRY
SFELAQRSSELHGSPDQGALNG
379764567YP_005350964.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAGVRVIDLTAMVMGPYCTQIMADMGADVIKVEPPQGDNTRYISVGPAPG
MSGVFVNVNRGKRSVVLDLQTDAGKRALRALVETADVFIHSMRAKAIAKL
GFGYDDVAAINPKVVYTNCYGYGRRGPDRDRPAYDDTIQAECGLPAVQQQ
LTGEADYVGTIMADKIAGLTALYATTMALFHRERTGQGQEVEVAMFETMA
SFMLVEHANGALFDPPLGPAVYPRTVAPNRRPYRTSDGHIAALIYNDKHW
NAFMNAVRPPWASELYATLEQRAREIDTIYGLVAETMKERSTAEWLELLR
ELEIPAAPLNTPGALFDDPHLKAVGMFETVDTPHGPVRFPGVPTWFSQTP
GRVAGPAPELGAHTEDVLAEIGASGPGLARNTPPEHDFASARQGEELQQ
379764566YP_005350963.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTVPVYKRILDLFEAEGVNTLFGIPDPNFVHMFAEADARGWSVVAPHHEL
SAGFMAEAASRMTGKPGLCIGTLGPGMANMAGAIQCALVENSPVIFLGGQ
RARITERRVRRGRIQFVRQEPLFAPSVKYSASIEYADQTDEIIHEAIRRA
MSSTPGPAYVEYPSHVILEELDVADPLPPHRYRLVNQGAGAPEIAKAAKL
IREAKSPILLVGHGVHTSRTGPAVKELADLMACPVIQTSGGTSYIPGLQE
RTFPYLFSPAANEAVEQSDLCVALGTELGEPMHYGRTQHWAGNDANRKWV
YVEQDPAAIGVNRQFDVPLVGDLRGVVPQLVEALRDTPRTPSPSLEKLVK
ADAEELAQLAETAPSGRSPIHPARYVVEATKAFNELDDAIMVRDGGATVI
FQWTYSQAKPRDVIWNQNFGHLGTGLPYAVGASVAEGGKRPVMLLTSDSA
FLFHIAELETAARQNLPLVCVVGVDHQWGLEVGVYKRTFAQPSPQPGVHW
SKDVRMDKIAEGFGCHGEFVEKESEIGPAIARAYASGKVGVVHVCIDPKA
NSEEMPKYDRFRTWYAEGTQ
379764565YP_005350962.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MREYLKFYIDGQWVDPVRPNPFEVENPATEQVSGKISLGSAADVDVAVQA
ARRAFAGWSLSTREQRLDLLQSILAEYQKRADDLAEAVTEEIGAPPSLAA
GPQVFLGIGHLTTAIDVLKNFPFSEHKGETLIAKEPIGVCGLITPWNWPI
NQVAVKVYPALATGCTVVLKPSEVAPYSPYIFAEILAAAGVPAGVFNLVN
GDGAGVGAALASHPDIDMVSFTGSTRAGIEVAKNAAPTVKRVTQELGGKS
PNIVLDDGGFADGVRAGVANMMPNSGQSCNAPSRMLVPNSRMAEAITIAR
EVAEQVKVGSADDATAIGPVASRTQFEKVQRLIQQGIDEGATVVAGGPGR
PAGLDTGYYVKPTVFAHVTNDMTIAREEIFGPVLCILGYDDIDQAVEIAN
DTEYGLAGYVSGADLDTAREVARRIRAGWVTINHAFDMNAPFGGYKRSGN
GREWSEFGFHEYLEVKSTLGYAPGKA
379764564YP_005350961.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MRRVGRLGVWDGPEGRSGIPALDGLRAIAVALVLIGHGGIPGVSGGFIGV
DVFFVLSGFLITSLLLDELGRTGRIDLTGFWIRRARRLLPALVLMVLTVA
AARQLLPERSLTGLRDDAIAAFVWLANWRFVAQKTDYFTQGAPPSPLQHT
WSLGVEEQYYFVWPLLLIAVTLALAARARRRFTRATVGGVRFATFVIATV
GALASAALAIVMVSDGTRDRIYFGTDTRAQALLVGASAAALLVRDWPSMN
RGWCMIRTRWGRRAARILPLLGLAGLAAATHYATGASGEFRHGLLIGVAI
AAVFVIAPVALEQRGVVARALALPPLVWLGTISYGVYLWHWPIFLALNGE
RTGWSGLPLFAARCAAAVVLAAASYWVLEQPIRRWRPARVPLLPLAAATV
ASAAAVTLLVVPVGAGPGLREPGLPPGVSAVAAVSPSPPGESRPRDPNRP
FTVSVFGDSIGWTWMHYLPPTPGFTFLDHTVIGCSLVRGTPYRYVGQTLE
QRSECDGWPIRWARQVAQDQPDVALLIIGRWETVDRVNEGQWTHIGDPTF
DAYLNGELERALTIAGSTGVRVVVATVPYSRGGEKPDGRLYPEDQPDRVN
LWNTMLRKTVSHHPNVAILDLNKKLCPDGVYTAKVDGIKVRSDGVHLTPE
GVKWLTPWLEESLR
379764563YP_005350960.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTTTLQDPRVASTLDRMYAESKNQMSLLRERRGTFDQPMSAQERADAMSE
FYIPVTPEAGRLLYSLVRATRPATVVEFGMSFGISAVHLAAAVRDNGSGR
VVTTELSAAKIAAAKKTFAETGLDDVITILEGDALSTLKSVDGAVDFLLL
DGWKDLYLPVIELLEPRLSTGALVIADNASSADMAPYLDRVRDQANGYVS
FNFQVRDSDSMEISCRTGT
379764562YP_005350959.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MLRAGRLLADKLHLRTNLTPQERANLYVSRMPIAVVTASLGGHASGRPDN
HW
379764561YP_005350958.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MHPHALTRGESDSYSEDQMTSIHTGGGRGLGSGRTAAAAENPRAEAPAST
VLDTAHVGDIVGAFGRIGRTDGTVTGSWRRLKTLAVITGPGLIVMVGDND
AGGVATYAQAGQDYGMGLLWTLVLMIPVLYVNQEMVLRLGAVARVGHARL
IFERFGKFWGAFSVGDLLILNALTIVTEFIGVSMALGFLGCPKFVAVPAA
AVLLFAVVAGGSFRRWERLMFLLIAVNVLIIPMVLLAHPAPKATAAGLIP
QFPGGLNSTVLLLVVAIVGTTVAPWQLFFQQSNVVDKRITARWIPYGRAD
LVIGIVVVMVGATALMAVTAFGMAGTADAGHFTDAGAVAAGLSRHLGGTV
GALFAIILLDASLIGANAVGLATTYAVGDALGKRHSLHWKIGEAPVFYGG
YAVLLAVSAAVSFSPDHVLGLVTQGVQALAGVLLPSATVFLVLLCNDRAV
LGPWVNTVRQNIVAWSIVWCLVLLSLALTATTFFPDLSTATIETGLAAGA
AVGIAGGAVMVVVGRRHRSLAAAEAIVRTLGGGLDPEQVDELDDAASLTR
AERRAVRRQDRAGWVTPNLALLDRPAMSPMRRAGLFTLRGYLVVAVAFVI
IKIVQAGVVGPVSSL
379764560YP_005350957.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTAAAARAVRFDRYGGREVLYVADIDMPTPGPGEVVVEVRAAGINPGEAG
IRVGAMHERFPATFPSGEGSDLAGVVTAVAPGVTEFAVGDEVLGFSLRRS
SHATHAAVPVGQLIRKPAQLGWETAGSLYVAGVTAYAAVRAVAPQAGETV
AVSAAAGGVGSLVVQLLALRGARVLGIAGPGNADWLRAHGVVPIAYGEGL
AGRLRDAAPDGIDAFIDLFGPDYVQLAVDLGVAPERINTIIAFQKAGEVG
AKTEGSMDASTPEVLAEMAGLIASGAVDFDIAATYPLDRVADAFAELERR
HTHGKIVLLPTDSQ
379764559YP_005350956.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MGAPRIGIAGRVVWHAAAIVAVGAASTGCGGSDKPPPPSAAESGPSASPT
DSGAVTGPPPGQPTDYGYLLIKPGDVGGGLTAPQSPMLNPNNAPGVAQLF
ANADSGRRLWDTIVVTADPSAAAAELAGSKSEYAGKVVGDWRPLAVGANG
SAISGASPDNSQAMTVLLFTEGKALVTLEFDSAPDDPFDPAVTVDIARKQ
DDAIKRGLPG
379764558YP_005350955.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTGDVKRTKVSSRGPARERVAARIRELAATDEQFRNAQPDLSLQQAARQP
GLRLPQILELFVEGYADRPAVGWRAKTLSTDPATGRTTTRLLPRFDTMTY
RELWADVRAIAAAWRHDAANPVSPGDFVATVGFASAEYLTLDLVCGYLGL
VAVPLQHNTTPSRLRPIVDEVEPSILAAGVGYLDLAVEAASGSSSLRRLV
VFDYQPEVDEQREALQRAQATLAAAGAAVTIETLDEIIERGRALPPEPMY
TGDTDQRLAMIMYTSGSTGLPKGAMYTEQMLAKVWTNELMPDFADTPVFN
VNFMPLNHLGGRIPLSTAFQAGGTSYFVPESDLSTLFDDWNLVRPTEMGL
VPRVAEMLYQRYQSAVDRLVASGADAGSAEARARAELREQVLGGRIVTAF
CGTAPLAAEMRAFVETCLDVHVLDGYGLTEVGMVTKDGRMTRPPVLDYKL
IDVPELGYFHTDKPYPRGELLVKSLTATPGYFKRPDVTANAFDPDGYYRT
GDVMAELEPDRLAYVDRRNNVLKLAQGEFVAVARLEAVFASAPLIRQIFV
YGNSERPYLLAVVVPTADAAERFTEDPEGLKAAVAESLRQSAQLAELQSY
EVPVDFIVETEPFSEDNGLLSGVGKLLRPKLKERYADRLEQLYAELAENR
VTELRALREGADKHPVVFTLTRAAEALLGVAGGPPAPDALFIELGGDSLS
ALTFSNLLRDIFDVDVPVGMITGPATDLGQLAEYVESERKSGSRRPTFAT
VHGRDAAEVRAAELTLDKFIDATTLAAAPNLPRATGTPHTVLLTGANGYL
GRFLALEWLERLAETGGKLVSIVRATDTATAGKRLEAVFDSGDPQLLERF
RTLAAEHLEVIVGDIGEPNLGLDQSTWQRLAQSVDLIVHPAALVNHVLPY
DQLFGPNVVGTAELIRLAITTRIKPVTYLSTVAVAMTVDPGEFAEDGDIR
AVSAVRPIDDSYANGYANSKWAGEVLLREAHDLCGLPVAVFRSDMILAHS
RYAGQLNVPDAFTRLMFSLLTTGIAPTTFYRTDEHGNRAVAHYDGLPADF
VAEAVTTLGEQMAAEESGECRSYDVMNPHDDGVSLDVFVDWLIAAGHDIR
RIEDYDEWLGRFTTALRALPDKQRQHSVLPLLDAYREPAAPLRGAPAPTD
VFRHAVRTAKIGADEDIPHLSAALIDKYVADLRLLGLV
379764557YP_005350954.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MVAITVMGLVGSAARGSAAVPTPHAAPEVASILPADGAVVGVAHPVVVTF
TAPVADRAAVERSIRVTSPGGTPGHFEWVHNTVVQWVPDQYWAPHTHVSV
GVQALTTGFDTGEALLGVASISKHTFTVSRDGEVLRTMPASMGKPSRPTP
MGSFTALEKQRTVVMDSRTIGIPLSSPEGYKITAQYAVRVTWSGVYVHSA
PWSVDSQGYANVSHGCINLSPDNAAWYFNQVNVGDPIQVVA
379764556YP_005350953.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MLFRQLEYFVAVASERHFARAAEKCFVSQPALSAAIAKLERELNVTLINR
GHSFEGLTPEGERLVVWARRILAEHDAFKAEVDAVRSGITGTLRLGTVPT
ASTTASLVLSAFCSAHPLVKVQILSRLAATELYRRLREFELDAAIVHAAP
DEADVNLVPLYQERYVLLSPAEMLGSGAATMTWAQAAQLPLALLTPDMRD
RQIIDKAFDDHGITVSPQVETDSVASLFAQASAGKWASIVPHTWLWTSPL
GPEVRAVEMVDPVLKADVVLATNASGPGSPIARALAASAAGLALNEFFDA
QLLGVTRRR
379764555YP_005350952.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MMASHYRPRTEESPMSTVSASGSDARGSTRVIDGFHLVVDALMANDVETI
YGLVGIPITDLARTAQAAGIRYIGFRQEASAGNAAAAAGFLTRRPGVCLT
TSGPGFLNALPALANATTNCFPMIQISGSSNRALVDLQRGDYQDLDQLNA
ARPFAKAAFRVNRIEDIGRGVARAIRTAVSGRPGGVYLDIPGDVLGQALE
ASAAAGTIWRVVDPAPRQLPAPDAVDRALEVLARARRPLIVLGKGAAYAQ
ADNEIRRFVEATGIPFLPMSMAKGLLPDSHPQSAATARSLAISRADAVLL
IGARLNWLLGHGESPQWSADTQFVQVDIAASEFDSNQPIAAPLAGDIGSA
MSALCDAVTARPFAAPTEWATELADRKARNDAKMRERLADDPHPMRFYNA
LGAIRAVLQDNRDVYVVNEGANALDLARNVIDMELPRHRLDTGTWGVMGI
GMGYAIAAAVETGGPVVAIEGDSAFGFSGMEIETICRYRLPVTVVILNNG
GVYRGDETAAHPSDPAPTVLNARARHELIAEAFGGKGYHVATPDELRAAL
TEAIGSGAPSVIDCELDPAAGVESGHLAGLNPARAAAVSGGG
379764554YP_005350951.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MGSDSTTGGEVTASTGPRIADLVEAAARRAPQACALVVTAERVPVSYHDL
TRLVDDLAAQLAAGGLVPGDRVALRAGSNAEFVVGLLAASRADLVAVPLD
PALPGTEQRARSEAVGARAVLVDRLGDDETAGATPPAWPIAVSAGPDGAA
PAVTLTVSAAPQRDVSTPQGLRDDDAMIMFTGGTTGMPKMVPWTRHNIAG
SVAAIVAGYALGERDSTVAVMPLYHGHGLLAALLATLASGGTVLLPAGGR
FSAHTFWDDIEAVRATWYTAVPTIHQILLERARTERPAGAGGLRFIRSCS
APLTAETAQALQDTFSAPVVCAFGMTEATHQVATTAVEGAGHSENPGATP
GLVGRSTGPQIRIVGPDGQSLPAETVGEVWLHGPTVVRGYLGDPSITDAN
FTQGWLHTGDLGTLSPAGDLVIRGRIKELINRGGEKISPERVEAVLASHP
GVLEVAVFGKPDTLYGETVAAVIVARGSAAPTADELASFCRDRLAPFEVP
TDFQQAAELPHTAKGSLDRRAVAERFARGA
379764553YP_005350950.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MVLVGPSGGGKTTLVEALLVAAGVLTRSGSVADGSTVCDYDEAEIRQQRS
VGLAVASLSHDGVKVNLIDTPGYADFVGELRAGLRAADCALFVIAANEGV
DEPTKSLWQECNQVGMPRAVVITKLDHTRANYSEALAAAQDAFGDKVLPL
YLPTGLPSCRGLIGLLSQARYEYADGKRSVQAPDPSDAAQIEEARGALIE
GIIEESEDESLMERYLGGESIDEAVLIADLERAVARGSFFPVIPVCSTTG
VGTYELLEVATRGFPSPMEHPLPEVFTQVGAPRAGLTCDTDAPLLAEVVK
TTSDPYVGRVSLVRVFSGTIRPDTTIHVSGHFASFFGTSNGNGHAHPDHD
EDERVGVLSFPLGKQQRPAAAVVAGDICAIGKLSRAETGDTLSDKSEPLV
LKPWTMPEPLLPVAIAAHAKTDEDKLSVGLGRLAAEDPTLRIEQNQETHQ
VVLWCMGESHAGVVLDALANRYGVTVDTVELRVPLRETFSGKAKGHGRHV
KQSGGHGQYAVCDIEVEPLPEGSGFEFVDKVVGGAVPRQFIPSVEKGVRA
QMEKGVHAGYPVVDIRVTLLDGKAHSVDSSDFAFQMAGSLALREAAAATK
VALLEPIDEISVLVPDDFVGAVMGDLSSRRGRVLGSDTAGNERTVVKAEV
PQVELTRYAIDLRSLAHGAASFTRSFARYEPMPESAAARVNAGV
379764552YP_005350949.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MGEFDPRARFIESPVARLATVTPGGAPHLVPVVFAVAADPGGRDVVYTAV
DAKPKTTRRLRRLANIEADPRVSLLVDHYSDDWARLWWVRADGVATIHDD
GRALESGRRLLRAKYPQYQSVSLDGPVIAVAVHRWSSWYP
379764551YP_005350948.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MVSVVAVVALGLGLDAGIGLGMATASPPALPLDPSAMVGQVGPQVVNIDT
KFGYNNAVGAGTGIVIDPNGVVLTNNHVISGATDISAFAVGNGQTYAVDV
VGYDRTQDIAVLQLRGAAGLPTAAIGGEARVGEPIVALGNAGGQGGTPSA
VTGKVLALNQSVSATDTLTGAQENLGGLIQADAPIRPGDSGGPMVNSAGQ
VIGVDTAATDSYKMSGGQGFAIPIGRAMGVANQIRSGAGSNTVHIGPTAF
LGLGVMDNNGNGARVQRVVNGGPAGAAGIAAGDVITGVDNVAITGATSMT
EVLVPHHPGDTIAVHYRSTDGGDRTANITLAEGPPA
379764550YP_005350947.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MDLMNDAKEAVEHHPEGGSHVQDGVVEHPDAEDFNNAAALPTDPTWFKHA
VFYEVLVRAFFDANADGAGDLRGLLGQLDYLQWLGIDCIWLPPFYDSPLR
DGGYDIRDFYKVLPEFGTVEDFVALLNAAHERGIRVITDLVMNHTSDSHP
WFQESRHDPDGPYGDYYVWSDTSERYTDARIIFIDTEESNWTFDPVRKQF
YWHRFFSHQPDLNYENPAVQEAMIDVLRFWLGLGIDGFRLDAVPYLFERE
GTNCENLPETHAFLKRVRKVVDDEFPGRVLLAEANQWPADVVEYFGDPST
GGDECHMAFHFPLMPRIFMAVRRESRFPISEILAQTPEIPDMAQWGIFLR
NHDELTLEMVTDEERDYMYSEYAKDPRMKANVGIRRRLAPLLDNDRNQIE
LFTALLLSLPGSPVLYYGDEIGMGDVIWLGDRDGVRTPMQWTPDRNAGFS
KANPGRLYLPPSQDSVYGYQAVNVEAQRDTSTSLLNFTRTMLAVRRRHEA
FAIGSFEELGGSNPSVLAFLRQVSGDGDTVLCVNNLSRFPQPIELNLQHW
SGRTPVELTGQVEFPRIGHLPYLLTLPGHGFYWFRLSGCEEDA
379764549YP_005350946.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTSPEKLPWSEWLPQQRWYAGRNRELSSAEPSVVVALRDDLDLVLVDASY
ADGSRDRYQVIVRWDSAPVVEYSNVATIGAADDRTGFDAMYDADAPQFLL
SLIDSSAARGASGVEVRFAKEPDAELPLEAMAHVSDAEQSNTSVIFDRDA
IFKVFRRVSGGINPDIELNRVLGRAGNPHVARLLGTYEMTGPGDETWPLG
MVTEFAANAAEGWAMASASVRDLFAEADLYAYEVGGDFAGESFRLGEAVA
SVHATLAETLGTAQAVFPVENVLARLSSTVALVPELEEFAATIDERFRKL
VAETITVQRVHGDLHLGQVLRTPESWLLIDFEGEPGQPLEERRAPDSPLR
DVAGVLRSFEYAAYGPLVDQADDKQLAARAREWVERNRTAFCDGYAAASG
IDPRDSAQLLAAYELDKAVYEAGYEARHRPGWLPIPLRSIARLTAV
379764548YP_005350945.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MPNEINNSESRLSWVLAVLAGILGATAFTHSAGYFVTFMTGNAQRAMLGY
FRGDVLLSVTAGVLIVCFVSGVVIASVCRRHFWVAHPHGPTVLTTFSLLA
ATMVDVIDEGWEENLLDFAPIMLVAFGIGALNTSFVKDGEVSVSLSYVTG
TLVKMGQGIERHLAGGTAAEWLGYFLLFASFVVGATVGGFISLFVNGTWM
LVVATVVCALTTGYTYFHSDRRALLDAGEKEHRQ
379764547YP_005350944.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSFIEKVRKLRGAGANMPRRLAIAAVGASLLSGLVAATGGFPTASAFSKP
GLPVEYLEVPSPSMGRNIKVQFQPGGAHAVYLLDGLRAQDDYNGWDINTP
AFEEFYQSGLSVIMPVGGQSSFYSNWYQPSSGNGQNYTYKWETFLTQEMP
LWMQANKQISPAGNAAVGLSMSGGSALILAAYYPQQFPYAAALSGFLNPS
EGWWPTLIGLAMNDAGGYNANSMWGPSTDPAWKRNDPMVQIPRLVANNTR
IWVYCGNGTPSDLGGDNMPAKFLEGLTLRTNEQFQNNYAAAGGRNGVFNF
PANGTHSWPYWNQQLMAMKPDMQQVLLASNTTAQPAQPAQPAQPAQPAT
379764546YP_005350943.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSVDGAAAATLIRAPRGWQRVGALTGRIGAFAIVELQKLQHDRTELVTRM
VQPALWLLIFGTTFSHLHVIATGSVSYLAFLAPGIIAQSALFISIFYGIQ
IIWDRDAGVLAKLMVTPAPASALITGKAFAAGVRSVAQVVGVMALAYLMG
VGLTINPLRIAAAMGVVMLGAAFFACLSMTLAGLVRNRDRLMGIGQAITM
PLFFASNALYPVDVMPAWLRALSKVNPLSYEVDALRALLIGTPFNPVGIV
VLVVAAVLGITTASTLLRRLVA
379764545YP_005350942.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSATLPMAIDARHLTYRYGQFTAVDDVTLQVRPGETMGLLGPNGAGKTTM
VRMLTTLAPVQQGELHIFGMDARRQTTDIRSNIGYVPQQLSIEPALTGRQ
NVEWFARLYGVPRAERSDRVDQALVAMDLLSVADRMASAYSGGMVRRLEV
AQALVNRPSLLVLDEPTVGLDPIARDGVWSQVRKMQAQFGMTVLLTTHYM
EEADALCDRVALMHHGALRAVGAPDALKARLSNGSPGATLEDVFRHYAAT
GLDEEAASTEEPGSIREIRSSRKVARRVG
379764544YP_005350941.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAEVKTRTDVATDLFGVVGRFRRQLRRSAGRAFDSSRLSESQSELLWLVG
RRPGISVSAAAAELGLVPNTASTLVTRLVSDGLLLRTAGDTDRRVCQLRL
AEPAQQILDASRAARRDLLSELLDELDADEIESLAKGLEVLDTMTRMLQE
RRS
379764543YP_005350940.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MRLLLIADTHIPKRARDLPAQVWDEVAQADVVIHAGDWISPEFLDRLESA
ATRLVGCWGNNDGPALRARLPERADVTLAGVRFTVTHETGAAAGRDARMS
RLYPDSQVLVFGHSHIPWDSTTETGLRLLNPGSPTDRRRQPFCTYMTVDV
DDGAVTGVALHRLPR
379764542YP_005350939.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTPGLSTTLHTSFEDAVERTTRALADQGFGVLSTIDVKATLKQKLGEEME
DYLILGACNPALAHRALNAYRQIGQLLPCNVVVRSDPAGDAVLVEAMDPQ
LMVKVTGEAGALQEVADQATTRLQAAIGALG
379764541YP_005350938.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MPDRKGHKAEEDVEPDTHQARSRAAAGEDDGSYVGAAGSDDSFDAGESGA
EARSERG
379764540YP_005350937.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MRTFESVADLAAAAGEELGHSDWATITQEDVNLFADATGDHQWIHVDPER
AASGPFGTTIAHGFMTLALLPRLQHQIYTVNGIKLAINYGLNKVRFPAPV
PVGSRVRAQSSLVSVDDVGNGAVQATISTTVEIEGSAKPACVAESVVRFV
A
379764539YP_005350936.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MRIAELAREIATPRSLDDVFADVTTAAVELIPAADIAGVLLLKAGGEFES
VADTDSLVAKLDKLQHDFGEGPCHDAALNETIVRSDDLRDEPRWPKYAPA
AVEHGVLSSLSFKLYTAERTAGALNLFSFRPNVWDTEAETIGTVFAAHAA
SAIMAGRHGRQMQSALSSRDRIGQAKGIIMERYGVDDVRAFELLRRLSQE
SQTKLIDIAQRVIDTRGED
379764538YP_005350935.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MFVHNKDLQFEVRVDRPDPRFASLLMDQFGGANGELTAALQYFTQAFVLR
QKNPKMYDLFMDIATEELSHLEMVGSMITMLLDGLNDNLKIANEKCDWMP
AVTANGGGRDGLIHSVAVNPLFLVLSGGGPDVKDSGGNNWTGAYIDANGD
PTVDLRNNVAAESRAKIVYEYLKQFTDDPGVQDTLTFLMTREVAHYQQFT
AALNELPVNFPPGQLPGDPRFQNVAFNMSNGGGESVRGPWNQGQGPWPEG
TEWEYVEKPEQQWLGGATRKNTGAKENPQGSPAVNAEKPFTHEQHVPTG
379764537YP_005350934.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MDAITFLRQDHKSVLGLLETLDGAPSGPGAQASGLETMVNNLIIAESQHE
AIEEQFFWPAVRDAMGDGLVDKAIEQEQAGKKLLQRLEDGKPGEPDYHEA
LQEFVAAGRDHIAYEQNEVWPQVETVLSREELEKIGEKLEAAKKIAPTRP
HPDTPPNPAVLKTMGMGAAIVDHVRDAVTGRGKDNPPDPQMH
379764536YP_005350933.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MPTRVTGMSRRAFGRVAAGAGMLGSVGLSDGCTTRGTDHATSAGPPPPSG
KGVGFVLSHEQFRTDRLVAQAQAAEEAGFHHVWASDHIQPWQDNQGHSMF
PWLTLALVGSATSRISFGTGVTCPTYRYHPATVAQAFASLAILNPGRVFL
GVGTGERLNEQATTNAYGDYAERHDRLVEAIDLIRRLWSGSRISFSGRYF
QTNSLKLYDVPATPPPIFVAAGGPKSAKLAGQHGDGWITQAHDVMDPKLL
AAFGSGAQAAGRDVATLGKRAELFAVVGGNAEAARAATLWRFTAGAVDQP
NPVEIQRAAESNPVDKVLAGWTVGADAAPHISAVQRVLDAGAVPFLHFPQ
DDPITAIDFYRTDVLPKLR
379764535YP_005350932.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTWMTPHVRPALKADVRELSRTLARAFYDDPVMVWLMPDQNKRTAGLARL
FATMTRHHHLGRGGVEVATEDSGIGAAALWDPPGQWQETPGAQLAMTPTF
LRVFGLRSMRGRAVQELMKSVHPEEPHWYLAVIGSDPAVRGQGFGQALMR
SRLDRCDAEYCPAYLESTKFENVPYYERFGFTVTREIVLPDGGPTMWAMW
RAPRAV
379764534YP_005350931.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSENPQADDLVDPADFPEEGGPGDTLNASEGTDSDELRNDDGDIVVDPPV
GWSEANRFGVTAREEREGESLDERLAAEEPDVPDDIEPVDDGPRRAHRGQ
IDGTPEDGDSLYDVVDE
379764533YP_005350930.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MNSRTPSSRARGSGRERSRESQSREERKEATRRAIIAAALKLLQDRSFSS
LSLREVTREVGIVPAAFYRHFESMEALGLVLIDESFRSLRDTLRDARAGK
LDPNRVIESSVEILVASVADRREHWRLIGRERNSGLSVLRYAIRTEIRLI
TSELATDLARFPGLNKWTTEDLNVLATLFVNAMIVIAEAIEDSQSAEATE
DIRRLAVKQLRMIATGIAGWQSTP
379764532YP_005350929.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MLGSELLDLLTGPHGVDRYTELVAPTWTLGDARAKVTDVRRTTPRSVTLA
LTPNDTFLATHTVRAGQYVNLTVEIDGRRHTRCYSPTNAEGAATLELTIG
RHEGGLVSNHLYEHARPGMVVGLAGAGGDFTLPAPRPRRILFVSGGSGIT
PVMAMLRTLVAQGHRGEIAFVHYARTPAEACYRDELAALESVRVLRGYTR
ADGGDLAGRFGPEHLAAAMPSPDAVFVCGPPALVEAVREHCDTVYTESFV
PPAFETPADPSGGRVTFSDSGVDIVDDGRPLLEQAESAGLSPENGCRMGI
CHTCTRRKTAGTVRNLVTGAVSTAPDEDVQICVSVPVGDVDVSL
379764531YP_005350928.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTPNKITLTSEQAEDFGRELDAIKERVMADLGEKDADYIRRVIKTQRALE
VGGRVLLFLPPAWLLGTGMLGIAKILDNMEIGHNIMHGQYDWMRDPAISG
RTFEWDTACPADQWRHSHNYMHHTHTNIVGMDRDIGYGILRMSEDQRWQP
YFLGNPLYAFLLMVLFQYGVALHELETERIRSGEIRLEDKREVLRAIWRK
TRRQTLKDYVAFPLLAGPFAPFVFTGNLTANLMRNVWSYMIIFCGHFPDG
TQEFTVEETRDESRGMWYFRQVLGSANLTGGRLFHLLSGNLSHQIEHHLF
PDMPARRYAEIAPEVQEICERYGIPYNRGPLLRQFGTVVRKIVRLTFPDS
WRPKAGADAPAAREPVAA
379764530YP_005350927.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MEWTGARYADTPTVEASTWIDADPQRVWNLVCDIELMPAVSNELQAVEWA
EGSDGPRVGARFVGYNEHEAFGQWSTTSEIVACDEPREFAWAVGGPDNPA
SIWRFRLAPRDGGTALNYWMQMGPGRSGLSTAIDSMPDKEQKIVFVRMRE
FEAAIGKTLASIKRLAEHGVR
379764529YP_005350926.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MMRTATTVEFSGTGDDAGQAVALAVEAEKLGLDVCWVAEAWGADAPSALG
YLAARTERMLLGSGVIQVGTRSPVLIAQTAITLANLSNGRFLLGLGASGP
QVIEGLHGVSFERPLARTSETIDIIRQAFAGGKISYTGKEFELPRPGGEA
VPMRLSTRPQHPIPIYLATLSPAMLRLTGRVADGWLGTSFVPEGAEDAYF
RHLDDGLAAAGRARADIDICQGAEVAFAADEVELRGMVAGRKKELAFSLG
GMGSSSTNFYNRAYGRQGWSEVAAEVRERWQRGDRDGAATLVTDEMVLAT
TLIGTEEMVAARLAVWRDAGVNTVRLYPAGDTLDAKLETLGRAIELVRAA
SDS
379764528YP_005350925.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTHESTVAWQDLLKTLGGLDRSFLEGDRAVTDDRHIADGYRMLATTLGVA
LDTYLFPEPDRPQFVAVNTPFRRDRRWGGDNTDAYYHICPVDPARRYRIS
GNKGDSVYFSVTAYNEPTLGAWSDRVVAIVRDTDLDVDADGNFAFEFPPT
ADAAVLMTRDYQADPLTGRPVVWRIEALDEPAPIRHGDAETAARLRAVAT
WLQTMFAIVPLAVGNRVEDAHALGHETAHAANAFAEPYQVPDANFGWSAR
DACYSYGSFVLDEDEALVITHRPPACRFWNMVVWNQFMATYGASEGPDAR
CSINGHSAVANSDGSVTIVLSGAKTAHPNSLTTLGYPRGNLAFRWFLADG
VPQRPEVKLVKAADAPTTTS
379764527YP_005350924.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MDGDFGRPRDPRIDAAVLRATVELLAESGYPGLLVSAIAERAGTSKPAIY
RRWPSKAHLVHEAVFPIGAGTAIPDTGSTADGLREMVRRTMVFLTTPSAR
AALPGLIGEMAADPSLHSALLERFAGVIGGGLGDWLAAAAARGDVRPEVT
AAELAETIAGITLVALLTRPTELDDAWVDRTTRLLLEGISA
379764526YP_005350923.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTDAVRSVSLDDLATPRFSVEGQQILDMMSAMAPQCPLDADALHAQASAD
TGLHDFGPDDYRERLDVFLAALREIDGLHGAGAVNFYGQLLQILKNRLLL
ADLLRRHPEINDIELTSPVVIAGLPRTGTTHLHNLLAAPPTFRTMPYWES
NEPFPMPNEVAVQPDPRRARMDVAVGVINTVMPHFALMHEMTTDHVHEEI
QLLANDVSTMLLETLADVPHWRDYYQSHDQTPHYEYLATQLRAMQFLRGG
RRWLLKSPQHLEQVPVLDRVFPDSIVVFTHRDPVPVALSMITMITYSARM
HRSPVPVEQIANSWIDRLDQMLSALVRDRDTIGPDRSVDIRFDDFMADEA
GVAERVYALADEPYTDEARQAVAGYLAGHRRGRLGNVKTSYEMFGLNEHS
LRQRFAPYVERFLA
379764525YP_005350922.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MVTMPTLDGVEHRYVELGNGVTIHVADAGPASGPAVMLVHGFPQNWWEWR
ELIGPLAADGYRVLCPDLRGSGWSSAPRTSYRKDEMADDLAGVLDRLGVA
SVKLVAHDWGGPAAFIMMLRHPDKVTGFFGVNTSAPFVKRSPSMLRNVWR
FWYQIPISLPVIGPRVISASNPRFLRLLGSWVGGGYTLPEEDVRLYLECM
RQPGHAEAGSRWYRSFQTGEMLSWMRGEYDGARVDVPVRWLTGTEDPVIT
ADLTEGYADHIKDFEVELVDGVGHWIVDQRPDLVLDRVRAFLAEK
379764524YP_005350921.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MMAVVKVTLDGGDQVVTSSVTRDAATDLGLKVGQPATVFIKSTEVTIGVD
379764523YP_005350920.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTATDGDPALEEVDPFRLRLLDGLATSITERGYRASTVADVVRCARTSKR
TFYDHFAGKEECFLELLAVDIEKLGAKIAASVDPDADWHAQIRQAVEAYV
GYIEARPAITLSWIRELPSLGAAARPVQRRGLQLLTSLLIDLSASPGFRR
AKLPPLTAPLAVILLGGLRELTALAVEDGTPVREIVEPAVDASVALLGPR
H
379764522YP_005350919.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MGSNDAMSELATVPPATVHLPPAVRSPKLVQGIGFAVSRRMMMRRLSRRY
GNVFTLRLPMWGRVIMVSDPQLAKQIFTTSPDELGNIQPNLSRLFGPGSV
FGLEGDDHRRRRRLLAPPFHGKSMKNYESIIEEETLREMAGWPEGSPFAT
LPPMMRITLNAILRAVFGAEGAELDELRRLIPPWVTLGSRLAALPKPKRY
PRFGPWGRLDKWRRQYDIVIEKLIAAERADPDFAERTDVLALLLRSTYDD
GSAMSHKDIGDELLALLAAGHETTASTLAWAFERISRHPELLARLVEEAD
GADEGGNELRQATILEVQRARTVIDFAGRHVYPEAYRLGEWAIPRGYSII
VGIAQIHDNPDVFPDPRRFDPQRFIDTKPSALSWIPFGGGTRRCVGAAFA
NMEMDVVLRTVLRHLTIETTDAPGERWHCRGVAFTPKDGGRITVRRR
379764521YP_005350918.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTNQKAILAGGCFWGMQELIRKQPGVVSTRVGYTGGDVPNATYRNHGTHA
EAIEIIYDPAETDYRAILEFFFQIHDPTTKDRQGNDRGPSYRSAIFYLDE
EQKRIALDTIADVEASGLWPGKVVTEVSPAGDFWEAEPEHQDYLQRYPSG
YTCHFIRPGWKLPHRAASSQ
379764520YP_005350917.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSTPKFSRSELAAAFEQFEATVDAAAQSHDWDAWVQHYTPDVLYIEHAAG
TMHGRDEVREWISRTMGSFPGSHMVAFPSLWSVIDEATGRIIMELDNPMR
DPGDGTVIGATNISIITYAGDGLWRQQEDIYNPLRFVQATLKWCRKAQEL
GTLDEAGAQFMEQYGGAQ
379764519YP_005350916.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTARPKLVIGANGFLGSHVTRQLVAKGHEVRAMVRENANTRSIDDLELTR
FHGDVFDTAVLREAMDGVDDVYYCVVDTRAWLRDTSPLFRTNVEGLRNVL
DVAVAQPDLRRFVFTSTYATVGRRRGRVATEDDIVATRGLSDYVQSRVQA
ENLVMRYVAESGLPAVAMCVSTTYGSGDWGRTPHGAFIAGAVFGKLPFTM
DGIQLEVVGVTDAAEAMLLAAERGRVGERYLISERMIALTEVVRIAADEA
GVPPPRRSIPVPVLYALGALGSLRARLTGKDAELSLASVRMMRAEAPVDH
SKAVRELGWQPRPVEESIREAARFWAAMRNAKGKSATPR
379764518YP_005350915.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSVDLTGAPQTMLATFYAKALDADFDKPILGDRYAKEIVDRIDYDWKKTT
ITARRAPSVTTRSAHFDEWTRKFLAAHPRSVVLHVGCGLDSRFFRVQPGP
DVQWYDVDYPEVAALRAQLYPSREHYRVIAASVTDPSWLSEIPTDRPTLM
IGEGLTMYLTEQDGTALLRRVVDRFGSGELQFDVFNWLGIKSQWLNSVVR
RSGSTLRWAINGPDDIIAAVPAVRLLACERWFESDTFARLPRSSRLLGRV
MSLIPAAANMSQYHRYAFGPPDGKG
379764517YP_005350914.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAHRQVLEPNAGHPITIEPTQGRVQVRVNGELVADTTAALELREATIPAV
QYIPIADVQQDRLTRTDTSTYCPFKGDASYYSVTTSSGDTVDDVIWTYEQ
PYPAVAAIAGHVAFYPNKADITVSAQ
379764516YP_005350913.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MMTPFDDPQGELAWMFLQSISDGGDLDEGFALLRDDFTFWTLYTRTACDK
DTFRRAVERRKQDVELVIDLVRCVNEGETVVVEAQATGTTSDGTSYDSPF
VCIFDTRAGLIVSMRLYGDTRATASALPGWVPY
379764515YP_005350912.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MKSTRTVVFPGAASFGHTLSPLRRGPADPCFRATGDGSIWRTSLLPTGPV
TARISRAAPNAAHCVAWGSGAGEFVEMLPALLGLEDDASDFVPRHPTVAA
AHRRVPHLRLGRTGLVLEALIPAIIEQRVPGADAFRSWRVLVTKYGTPAP
GPAPEGMRVAPSAQRWRTIPSWEFHRANVDPRRAQTVVTCAQRAASLERL
TSRPAAQARAALTSLPGVGEWTAAETAQRAFGDADAVSVGDYHIPKMIGW
TLLGEPVDDAGMLDLLEPMRPHRQRVVRLLEASGLAYEPRRGPRLPVQQI
HSL
379764514YP_005350911.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTQFTIPGLTDKQAARLTELLQKQLSTYNDLHLTLKHIHWNVVGPNFIGV
HEMIDPQVEAVRGFADDVAERIAALGSSPQGTPGAIIKDRSWDDYSVGRD
TVQAHLAALDLVYNGVIEDIRQYIDETDELDPVTQDLLIGQAGQLEKFQW
FVRAHLESAGGQLAHAGKSTEKSAAKSARSKS
379764513YP_005350910.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MPAVTANPLTLPRVRGPGPADTERPVRSITTGPRGYEGEGFPVVRAFAGV
GSAALDPFVHMDQMGEVNYQPGEPRGTDWHPHRGFETVTYMLDGKFAHQD
SHGGGGLITDGATQWMTAGSGILHIETPPAELVDSGGLFHGVQLWVNLPK
KDKFAPPRYQAIEGGDAALVASDDGGALIRIIAGEIDGHRGPGVTHTPVT
LAHATVENGARLNIPWRRDFNALVYVLSGSGYVGPIAHPIHQGQLAVLGP
GDRITVGAERARDSGDATAIDVLLLGGRPIREPVFHYGPFVMNTRAELIE
ALEDYQAGKFGAIPPNALMPHHGGGTL
379764512YP_005350909.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MFSERGYDGATFQAIASRADLTRPAINHYFSSKRALYREVLEDTNEFVIA
AGIKEADAETGLVARLTAFISVAVRANSENPAGSAFLISGVLESQRHPDL
TGTDNSSVRVCREFLLRAVNDAIENGELAADVDASALVETLLVIICGVGL
YSGYVESYQQMLAVTGMLRQLLEGALWRPGA
379764511YP_005350908.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTDLDASTPPSVRSAGDSWSITELVGATALGVAASRAAETAGADPLIRDE
FARLLVSSAGPAWARLADPELSWLADDQHGRRAHRTGIDYQAVRTHFFDE
YFDGAVRSGIRQAVILAAGLDSRAYRLDWPTGTTVYEIDQPKVLQYKSGI
LQQHGAVPTAIRHPVPADLREDWPTALAAAGFDRTQPTAWLAEGLLPYLP
SDAQDRLFEMLTALSAPGSQVAIEVFGINSRSNSQRWLRMRERLGLDVNV
QALTYHEPDRSDAAAWLSDHGWHVHAVDNREEMARLGRPVPDDLSDEAVR
STLLRARLGETTF
379764510YP_005350907.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSSLRTHDDTWDIKSSVGTTAVMVAAARAIETEQPDALIRDPYARLLVNN
AGADVLWEAMLDPDVVAKIEAIDEESAARIQHMRGYQAVRTHFFDEYFAD
AVATGIRQVVILASGLDSRAYRLDWPAGTTVYEIDQPQVLDYKTTTLAES
GVTPSADRREVAIDLREDWPAALRAAGFDPTRPTAWLAEGLLMYLPAEAQ
DKLFTQIGELSPAGSRVSAETAPMHAEERRQQMRERFKKVADQLGLEETI
DVGELMYRDEHRANLADWLNDHGWRATAQNSIDEMHRLNRGVQSFELDQD
KDAFSDFVIAERL
379764509YP_005350906.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MGGGAAQRSHRWVLLKGRLVAGIASAFVMAITGIGWTGYHTALGRIIISH
ALPNGAASLGDNQNILLMGLDSRLDQNGRPLPQEVYDALHAGDETSGGYN
ANVLIVVHISDRDGPVTAVSIPRDDYAELPGCPGSVCTGKIKQAYGLAYQ
QSLNTQAAGDSGGAGSTDLAAREQTAREAGRKAEISAVSDFLGISVDHFV
EVTLGAFYQIAKAVEPITVCLNGDTRDSYSGADFHQGVQRIDAAEAMAFV
RQRRDENDGSFTDFDRTRRQQAFLVSLVEAARSGGALSSVSGLRKMLEVA
RDNVAVDAGLDLGQFAARASRLTGRPLSLYTLPISGFGKDANGSDINLVD
LAAIRRIVNERFMSDAPAALDAASPAAQSPPALTEPVILDVVNASSRDGL
AAALEEALTGRGFTRGSATTAAAAADDSTIEYGPGADAGAQVLSGQLHVP
ATADPSVASGTVRLTVGTRFPAADYLSHSEAQPGAAGDAPSSGQVSAVAA
TGSGDRAPAPTDLSQMTASSVPCVK
379764508YP_005350905.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MMTTESVASQASLSKDSTNGTGSADVAATVARLRQTFATGRTRDVDWRKR
QLLQLVKLMEENEAALAAALAEDLDRSPFEAYIADIATTAGEAKYAAKRV
RKWTRRKYQLLELPQLPGRGWVEYEPYGTVLIIGAWNYPFYLTLGPAVGA
IAAGNTVILKPSEIAAASSRVMAELVPKYLDNDAIAVIEGDGATSQELIA
QGLDRVMFTGGTEIGRKVYEGAAPHLTPCTLELGGKSPVIVAADADVEVA
AKRIAWMKLLNAGQTCVAPDYVLADATIRDELVDKIGAAITKFTSDKPDG
MRVVNQRQFDRISGYLSGKDGTVTVGGACDASTLRIQPAVVVDPDPDGPL
MRNEIFGPVLPVITVQNLDEAIRFVNSRPKPLSAYLFTKRRETRERVIKE
VPAGGMLVNHVAFQVSTAKLPFGGVGASGMGAYHGKWGFDEFSHRKAVLT
KPTRPDLSSFIYPPYTERAFKMARRMF
379764507YP_005350904.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MQDRVVIVTGAGGGLGREYALTLAKEGASVVVNDLGGARDGTGAGHNMAD
EVVKEIKDAGGRAVANYDSVAEPEGAENMVKTALDEFGKVDGVVSNAGIL
RDGTFHKMSFENWDAVLKVHLYGGYNVIRAAWPHFREQSFGRVVVATSTS
GLFGNFGQANYGAAKLGLVGLINTLAQEGAKYNIKTNAVAPIAATRMTQD
ILPPEVFEKLTPEYVAPVVAYLMTEELTDTDSVFIVGGGKVQRTALFQND
GITFDSVPSVEDIAAKWGQITDLSAAQQASFKLG
379764506YP_005350903.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTEALRELSGAWNFRDVSDGAPALKPGRLFRSGELSGLDDDGRATLSRLG
ITDVADLRAAREVARRGPGLVPDGVEVHLLPFPDLGEQDAGTDDAAPHEH
AFQRLLTGEGVEESEQSVNEAATRYMIDEYRQFPTRNGAQRALHRVISLL
ADGHSVLTHCFAGKDRTGFVVATVLEAIGIDRDTILADFLRSNDAAPALR
AQISAMIAQRQDAELTPEVVTWTEARLSDGVLGVREVYLAAARQTIDEEF
GSLDAYLRAASVSESDVERLREALLA
379764505YP_005350902.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTGMDFAMSAKASDYHKRLTDFMTEYVFPAEADYDKFRHEAGPRDHTVPP
VVEELKIKAKQQGLWNLFLPAESGLTNLEYAPLAEITGWSLEIAPEALNC
AAPDTGNMETLHLFATEEQRKQWLEPLLAGEIRSAFSMTEPAVASSDARN
IETSIVRDGADYVINGRKWWTSGAADPRCKILIVMGRTNPDAASHQQQSM
VLVPMDTPGVTVVRSTPVFGWQDQHGHCEIVYDNVRVPATNLLGEEGGGF
AIAQARLGPGRIHHCMRALGGAERALALMSDRAQKRVAFGRPLAEQGVVR
ESIAKSRNEIDQARLLCEKAAWTIDQHGNKAAHLLVSQIKAVAPQVACDV
IDRAIQVHGAAGVSDDTVLARLYGWHRAMRIFDGPDEVHMRTIARAELGR
EKSALAAAVTAHD
379764504YP_005350901.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTESRPPFPPFTRETALQKVQAAEDAWNTRDPHRVSLAYTVDSRWRNRGE
HIVGRDEIVAFLTRKWQRELDYALRKVLWDFHDNRIAVRFQYECRDQSGQ
WYRSYGNELWEFAESGLMARREASINDVPIDESQRRIFGPRPSSEHAHDI
PLW
379764503YP_005350900.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MVSESGADERRVALVPKAVASLVGSGVAVVVESGAGERALLPDALYTEAG
ATIGDAWAADVVVKVAPPTADEVGKLHSGQTLIGFLAPRNAENSIGALKQ
AGVQAFALEAIPRISRAQAMDALSSQGNVAGYKAVLLAASEATRFFPMLT
TAAGTVKPATVLVLGVGVAGLQALATAKRLGARTTGYDVRPEVADQVRSV
GAQWLDIGIDAAGEGGYARELTDEERAQQQQALEKAISGFDVVITTALVP
GRPAPRLVTAAAVEAMKPGSVVVDLAGETGGNCELTEPGKTVVKHDVTIA
SPLNLPATMPEHASELYSKNITALLDLLLTDGKLAPDFDDEVIADSCVTR
D
379764502YP_005350899.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MYDELLANVAILVLSGFVGFAVISKVPNTLHTPLMSGTNAIHGIVVLGAL
VVFGSVEHPSLAVQIILFVAVVFGTLNVIGGFIVTDRMLGMFKGKKKPVP
AASEEPAAK
379764501YP_005350898.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MNYLVIGLYIISFALFIYGLMGLTGPKTAVRGNLIAAVGMAIAVAATLVK
IRHTDQWVLIIAGLVVGVVLGVPPARYTKMTAMPQLVAFFNGVGGGTVAL
IALSEFIETQGFSAFQHGESPTVHIVVASLFAAVIGSISFWGSIIAFGKL
QEIISGAPIGFGRAQQPVNLLLLVAAVAAAVVVGVHAHPGTGGASLWWMI
GLLAAAGVLGLMVVLPIGGADMPVVISLLNAMTGLSAAAAGLALNNTAMI
VAGMIVGASGSILTNLMAKAMNRSIPAIVAGGFGGGGVAPSGDGGGDKTV
KATSAADAAIQMAYANQVIVVPGYGLAVAQAQHAVKDMAALLEDKGVEVK
YAIHPVAGRMPGHMNVLLAEAEVDYDAMKDMDDINDEFARTDVAIVIGAN
DVTNPAARNDASSPIYGMPILNVDKAKSVIVLKRSMNSGFAGIDNPLFYG
EGTSMLFGDAKKSVTEVAEELKAL
379764500YP_005350897.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MDPSPDYDGSDEIEFFMRYLTWGLRGVTDGNGYPPPAYPPV
379764499YP_005350896.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MPTDSVTPNGQTRREELLAVATKLFAARGYHGTRMDDVADVIGLNKATVY
HYYASKSLILFDIYRQAAEGTLAAVHDDPSWTAREALYQYTVRLLTGIAS
DPERAAVYFQEQPYITEWFTSEQVAEVREKEAQVYHHVHGLIDRGIASGE
FYQCDSHVLALGYIGMTLGSYRWLRPSGRRSAKEIAAEFSTALLRGLIRD
EAIRTTSPLGP
379764498YP_005350895.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTTREDLRFPSGDDLISAWLYRPPGDGPAPLLVMAHGLGAVRSMRLDAYA
ERFSAAGYACLVFDYRNFGDSGGRPRQVLDVGMQLADWAAAVDYARTLPG
VDPDRIALWGTSFAGGHVIATAARLPGIAAAVAQCPFTDGIASARTITNP
LITARITARAVRDVLASKRGRPPVMVATAGRPGEVALMNTPDAYEGYLRL
VPDGADVRNEVAARIALQVFTYRPGRLTPKIDCPILFCVCEADSVAPAAA
TLRHAARAPRGEVKLYPECHFAIYVDDAFERAVADQLAFLDKHLRG
379764497YP_005350894.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAIRVAHVGTGNVGGLALAELITNPQFELTGVCVSTPEKVGKDAGELCGV
GLDAGVVTGVAAVDDLDAIIAAKPECVVYCAMGDTRLPEAMADVMRILAA
GINVVGSSPGLLQYPWGVMPDKYIARVEDAAKQGNSSIFISGVDPGFAND
LIPFALAGTCQRIEQVRCMEIHDYASYNGTEVMDYMGFAKPMDEIPMLLQ
PGILSIAWGTAIRQLAAGLGIEVDEITESYQREPAPEDFDIAVGHVAKGT
VAVLQFEIRGMVKGHPAIVIEHVTRLRPDLRPDLPQPAAGDGSYRVEITG
EPSYAVDIIPSSRKGDHNHAAIAGAAGRVVNAIPAVIAAPPGIRTTLDLP
LVTGKGLYAPSTLVTS
379764496YP_005350893.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MGAEDARLLVEEGAKVVIGDILDDQGKALADEIGESARYVHLDVTQPDQW
EAAVATAVGEFGKLDVLVNNAGTVALGPLRSFDLAKWQKVIDVNLTGTFL
GMRVAVDPMIAAGGGSIINVSSIEGLRGAPMVHPYVASKWGVRGLAKSAA
LELAKHNIRVNSIHPGFIRTPMTKHLPEDMVTVPLGRPGQVREVATFVLF
LASDESSYATGSEFVMDGGLITDVNHKDLF
379764495YP_005350892.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MLRRLAGLVGSNHVVTDPDVLAARSVDHTGRYRGRASALVRPGSPEQVAE
VLRVCRDAGAHVTVQGGRTSLVAGTVPAHDDVLLSTERLHAIGDVDTVES
RIEVGAGATLAAVQRAAAAANLVFGVDLSARDTATVGGMASTNAGGLRTV
RYGNMGEQVIGVQVALPDGSLLRRHSRVRRDNTGYDLPALFVGAEGTLGV
ITGLDLRLHAIPPHRVTAICGFADLDALVSAGRIFRDVDGIAALELIDGR
AAALTREHRGVGAPVTGDWLLLVELAADHDQTERLAGLLENVPMCGEPAV
GVDLAAQQRLWQVRESLAEVLGVYGPPLKFDVSLPLSAISEFERHAVELV
STHAPGAVPVLFGHIGEGNLHLNVLRCPGEQERHLYEPMMDLIARCGGNV
SSEHGVGSRKRPYLAMSREPADIAAMRTLKAALDPTGYLNAAVLFE
379764494YP_005350891.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSHPIRATTIADTDTSTRQRILAATAEVLGRNGKTKLSLSDVATQAGVSR
PTLYRWFASKEELLSAFSAYERQIFESGLVKATAGLKGVDKLDAVLRFIV
DYQHSYSGVRMVDVEPEHTIAQFSWVIPQMREGLQRHLPGPNSAVKAATV
IRIAISHYIVRSDDADQFLAQLRHAVGIKGSS
379764493YP_005350890.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTDAYYELIDPADAPGEKFRATDLARGTWSAAIQHGGPVSGLLVRALERC
EQRDDTRLSRVVIDLLGGVPAEGDLWVRSQVQRPGKQIELVSAEMLAPGP
DGAPRPVARATGWRLQHQDTEELAHAAAPLPRPRAEAYDRNLKAKDWDRN
YVHSLEWLWLTEPLSEGPGESWINPTVDLVNGEPMTQLERLFAVADCANG
IGSKLDITKWTFLNTDLAVHVFRVPDGDWIGIRAETSYGPDGIGTTIGTL
FDEQGAVGAIQQSVLVRRRPPRA
379764492YP_005350889.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MIPEPLANGFCFGEGPRWFEGLLWFSDMLGEAVHTSTMGGSLTTLPLPGH
SPSGLGFRPDGSLLIASTEDRRVLRYDGESVATIADLADVAPANLGDMVI
DDVGRAYIGCQALRGGVIVRLDPDDSATVVAEDLDFPNGMVITPDRKTLI
VAESTGRRLTAFSIGGDGGLTDRRIFADGLDGPPDGIALDAEGGVWTSMT
LAHQFERIVAGGDVTDRIDMGDRVAIACALGGPQRRTLFLLSSTDAYPQR
LAGTRLSRLDAVTVTTPGAGLP
379764491YP_005350888.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MGIVTTTSETAFTQSAETVYDFVTNPLNWTKTYPGSAHIGGLPDLPLKVG
DTWEEAGPDGDRIFRWQLAAAVRPTLFVFTSIGRLGHGRDGNGGMEGRIT
VSYHFTRPGQDVTLFSRTMTIEAYKHAPLPDQLFIQANPAKIDAYHEAVA
RELARSAD
379764490YP_005350887.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTKASEESQQTEWTVQGLLDLFDVQADGQDRFTGETGIAGGDERQVVEGT
QVLAQAIVAVAKRFPDKSVRSAHAVFSRAVTVGPPIELILDVVAEGRSTA
TAVVAVHQNGRRCLSITVLADVPTADVIRHHLPRPEVAAPADANPSAMPM
VGRELRLVDVVDVNSPDEVGPPELYAWLHYDPIPTRDDLAKALLAYFTGH
LGISTTMRAHEGIGTAQAHLTVSTAPMSISVAFHEPARWSGWLLYTHEST
QVGAGMSYVRGTVHAEEGELLASFSQEALIRPLRTSDTAIDSRARF
379764489YP_005350886.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MRFTITHPMHSHPYNPELVSGDGIGKVAAATEAAGIHGFGFTDHPAPSQR
WLDAGGHDALDPFVALGFAAATTSTLRLIPNIVVLPYRNPFVVAKSGATL
DLLSGGRFTLAVGVGYLKREFAALGVSYDERAELFEEALQVIRAVWTEDD
ISFEGKHFSARGITAHPRPLSSPHPPIWIGGNTTASRQRVAQYGDGWCPF
PAPPQLAQTAGTATIDSVPKLAEGIEDLRRRCDAAGRDWSAIDITFTNFE
GGSPADDAFNADAYLDGLDRLAKLGVTWVSVHLPGDSMTHALETLDRFRT
LVIDAA
379764488YP_005350885.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MDFSRVALSPEDQDFYDQFREFIAEHVTDEVRRRDRETGENFSEPVHLAL
GEAGYLESDWKLESEGGFNPVRRRIFHLEIGRAHAPWFHWGTTAVVARLV
QQFGAAELVDAVLPGVLSGEIRLCLGYTEPEGGSDVATCKTRAVRDGDAW
VINGSKMFTSNAQNAKYVFLLTNTDPQGPKHKNLTMFLVPLDSEGIEIQG
IRTLDGDRTNIVYYSDVRVDDLYRIGEVNGGWTVMRFALDAEHGITEVQD
HGLQNISMLSEHGQLMAEAADGVAAILATPDADGRRPIDDEATKYRLGRA
MARIEAAMSTPGMYGRVGLIQTMREVSQELMDLLGTASALPTATTGSADD
GAIEFIFRHGVPAGIYGGTMEVFRNMIAQHELGLGRPSYGR
379764487YP_005350884.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MYVEPHPRRVQAVKDGRLVIDTERALMVHRRGRPLSYVFAPDDVGDLPTE
PEPEAPGFVHVPWDAVDTWFEEGRKLVHYPPNPYHRVDCRPTQRRLRVRV
GGTTLVDTDDTTILFETALEPRLYVDPAHVRTDLLVRSETSSYCNYKGFA
TYWSLVSGERVVEDVAWCYPDPPPESLPIKGFLSFDDTRADVLAELPGGP
HDPARV
379764486YP_005350883.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MKEAVIVATISGRTVLITGGNRGIGAALVAEALRRGARRVYVGTRKALAG
NGDSRVTPLALDITDPAQIRRAAARVDSLDVLVNNAGLAVYDDLSDASAL
RTHLAVNLLGTYDVIQAFLPMLTRSGGSIVNNLSVNALAPLPLIPAYSIS
KAAAFSLTQSLRVILAGRGVRVHAVLTGPVDTDMTRGLDIPKASPQSVAQ
GIFDGLENGDDEIFPDPMSRSLAQRWQVGVAKLLEQQYAALLAPGDRVTS
379764485YP_005350882.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAGPVEGVKVVELGVWVAGPAAGGILADWGADVIKIEPPTGDPARMFGRM
LGCDMGLNPPFEMDNRSKRSVVLDLGTDAGRATAFELLAGADVFLTNVRP
GALQRLGLDFESVSATNPRLVYGLITGYGENGPDADRAAFDVAAFWSRAG
VAHLLTRPGETPPFQRGGMGDHSAGMTMAAAVCAALLARERTGAGQLVTT
SLYRQGAYTVSFDLNTYLMSGQPIAIGQRESMGNPCMNNYAAQDGRRFWV
VGLEPERHWPALCRAVGRPEWRDDPRFADARSRAANSAALIVALDEIFAT
RPLDEWAQIFAGEPDFFWSPVNTLEDVVADEQFHAAGGIVDVPDGDAAVP
MVATPADFHGTPWAPRSAAPELGQHTEEVLADLEARRGS
379764484YP_005350881.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MVAPTFDISKTDAARATQANADGLRYRLDVVAASAVDVVQSAGGWLYDRA
MAGWEVTVLLPQGRDTRALRILGVRASDLEPSLGALGAGSTSLAVSADAF
TADARVRDAVLESLDNRLTEVALWGDGWPLGVQRATTRAQHLLSGAARMF
KGYALAAEGISDATVAPTETLLCDVGSGADSELIRLD
379764483YP_005350880.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MKKYYKHALLYLHETISLGSGRSDRFTEAFADTYQPMMEQLGARLFAIWE
STLYNGHWPQVTVIWEIDGFADYARIGAAQARGGSHEAAAGKWSAFLADL
GASGEGRIMYAGPSNRTLAQLREANFTAPLVIQEIMQTKPGRQDDYIREL
ERLYVPWSERTGKRWLGSFTTTFRFNEVIHYWALDGGWDCFAEHYPSWKE
SPPAEIVTWMSVAPALRDGWEDSILQALPPSPLQ
379764482YP_005350879.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MDHTDFSYDPFDAAVMANPLPYYRILRDQHPVYYMPQWDTFALSRFEDIW
KVLEVNNGTFVASEGTLPAASVLAQHNSGPVDDPPLHPLPFHAMFDADLY
GEIRRTHSRPFRPRSVTDLEGRIRELANERLDLLLPRGSFDLTQDYGGVV
VAAIVCELLGIPTDLAPQVLAAVNAGSLAQPGVGVDTGQARPNYFEFLLP
AVARRRADRSGPPLDVVDGLLGYHLPDGSALDDMEVATQMLCIFIGGTET
VPKIVAHGLWELSRRPDQLAAVRADPEGNVPVAREEMIRYCAPAQWFART
ARKPFDIHGQTINPGQRVITLLASASRDEREYPEPDEFIWDRPIRRSLAF
GRGQHFCIGYHLARLEIDVLLAEWLRRVPDYAIQTHAATRLPSSFQWGWN
NIPVEV
379764481YP_005350878.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MWSYRLIAPYLFERTTIADTAPESLTDGQVLLRFLAAGVCGSDLPAFRGA
KGRIPGDDGRSGPEKDGFPIHEVAGEVIASRHPAHRPGDLVVGWASGFDG
MMERIVTDGDGLAPYDPALTPAQAIGLQPLACVLYACEQLGDLAGRRVAI
IGQGSIGLLFSYVAKAAGARRVTGVDPIDRRDVARAFGVDEPVRATSDRW
ASQLEPGDRADVVIEAVGHQVATLTHAIDATAPGGTVFYFGVADDEMYPI
SMRAMLRNNLTLKSGVTLDRRRMLELASKFAAEHPWLLGAYLTHTFGVEQ
VQDAFELACRPVAERIKIAIAG
379764480YP_005350877.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTDASPGNLQLALSSKPAIFGGWVTGPTWLGPEEFARAGYDYVGFDAQHG
YLDDAGIARMLRRTEHLPLGTVVRLPNADAAPIGRVADAGADAVVIAMIE
SAGEAAAAVAATRYPPAGVRSFGPLRASLGHDPAAHESRIGVFAMIETAA
ALADIREICGVDGLTGIYVGPADLAISMGAGVLGATRHPEVLDAITRIHR
AASDAGLVTGIHAGDGMTGQAMARLGFGMITLAAESQALRRGAAEHLREA
TQ
379764479YP_005350876.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTAYPPDDEAAIRDLIAGYALALDAGDVDGCVRLFAPDGEFLAYGRTFAG
HDGIADMFRAAARGLHLTGVSRITVDGDRASARSQVLFVRAGDLQLRPAL
YDDELTRVDGQWRFARRRCRFITSGGLAESPEVTPA
379764478YP_005350875.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MNPRVALVTGAAGGQGRAIAERLRAKGFSVAACDRRADDLAAAVRESGDE
ELIAVELDVTAERQWDSAVAAVVERFGSLSTLVNCAGVLHRASLTEETAE
GFENSWRVNCLGAFLGMRATLEHLRAAPDASIVNICSTGAIRPFPQHGAY
GSSKWALRGLTQTAAAELAPSGIRVNAVFPGPIATTMLDETTQARLAAAS
MFGRIGRADEVADAVAFLVSGEASFITGSELIIDGGQCLQIR
379764477YP_005350874.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTDLSVGIIGAGPGGLALGIMLSRAGFGNFTIFDREDGVGGTWRINTYPG
LACDVKSHLYSFSFDLNAHWSRLWSGQPEILDYFQRSADKHGLGPHLKLR
TEIRSARWDSDTQRWCLTTATGERHHFNVVVSAVGLFTRPLLPDLVEEEP
FTGTVMHSSRWDHSIPLEGKKIAVLGTGSTASQLIPELAKVAGTVYSVQR
SPTWILPKPDRRYTRGERWAFAHLPFAKKIYRTRLWLRSESNIAVIEHGS
EKTEQFTALALRLLENTVDDEELRRKLTPDHPMGCKRLVFSSDYLPALTR
PNVEVLTSPARSLRARSLVTEDGTEREVDLVVCATGYAAADYLGELDVSG
EHGITLRQVWRDGAHAYLGMAVPDFPNFFMLYGPNTNVGSNSVIFILEAQ
ARYIVRAVRHLRRRRKRYVAVRASALAEFVAKVDRWMVGTVWTTQCSNYF
RAPNGRVVTQWPRSARTFWGMTRRFRPADFRFEPPATSAAPPVAVPERGT
R
379764476YP_005350873.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTELDGADRLDPALRALATTRTDFSAAAIQLTRGPFNERRRITAEQTDAG
DVRIDEDNAAGVGVRIYRGGPAPAPTVVYCHAGGFALGNLDTDHRQCVEL
ARRGRCTVVSVDYRLAPEHPYPAGLDDASAVLRWVIDDAASLGVDPARVA
VAGSSAGAALAACLAQRAADGSLPPVVFQLLHQPVLDDRPTGSKSEFRTS
PAFDGEGAELMWRHYLDPKAAPEAAVPARRPEFAGLAPALITCAEIDPFR
DEAIDYALRLLHAGISAELHVFARACHGFDSLLPEWPGSQRLFALQGEAL
AGALHGD
379764475YP_005350872.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MYSSMSGIRGAVLEHIGAPRPYARSRPISIADVDLAPPGRDEVLVRIEAA
GLCHSDLSVVDGNRVRPVPMLLGHEAAGIVERVGDGVGDVAVGQRVVLVF
LPRCGHCAACATEGLTPCEPGSAANGAGTLLGGDIRLSRAGQPVYHHLGV
SGFATHAVVNRASAVAVPPDVPADVAALLGCAVLTGGGAVLNVGQPRPGQ
TVAVVGLGGVGMAALLTALTYDDVRVVAVDQLPDKLAAARALGAHEAYTP
QQADDARVKAAVVVEAVGHPAALETAIALTAPGGRTITVGLPPPDARITV
SPLGFVAEGRSLIGSYLGSAVPSRDIPRFVELWRSGRLPVQSLVSSTIAL
DEINEAMDHLADGTAVRQLIRFDA
379764474YP_005350871.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTSNDFPVLWPVGTRWADNDMFGHLNNAVYYQLFDTAITAWINTATGLDP
ITTAALGIVAESGCRYFSELHFPQDLTVGLAVTRLGRSSVTYRLGVFESG
DGDPRPITALGHWVHVYVDRVTRKSVPIPDPVRTLLSTASVGESA
379764473YP_005350870.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MLSKTVEIGADAGLIMKIVGDFEAYPQWNEEIKGLWVLARYDDGRPSQVR
LDTDYQGMQSMFIQAVYYPGENQIQTVLQQGDLFTKQEQLFSVVAMGASS
LLTVDLDVETSMPVPAPMVKQLLNNVLDHLAESLKQRAEQLAAT
379764472YP_005350869.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSMQPRSRRPLRRAQLSDEVAGHLRASIMSGTLRPGTFIRLDETAAQLGV
SVTPVREALLKLRGEGMVQLEPHRGHVVLPLTRQDIEDIFWLQASIAKEL
AAAATDHITDAEIDELDRINESLAAAVGSGDAETIAGIEFAFHRVFNQAS
GRIKLAWFLLNAARYMPVLVYAADPHWGKAAVDNHRKLIAALRHRDTAAV
IEHTVWQFTDAAARLTEMRDRAGNPF
379764471YP_005350868.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSSLTAQLADHLTEQPYLARRQNWVNQLERHALMQPNATALRFLGKTLTW
GELRGRVAALADALSRRGVGFGDRVMILMLNRTEFVESVLAINMLGAIAV
PLNFRLTAAEIAFLVQDCEARVIITESVLAPVATGVRDIESMLGTIVVAG
GSTDDTVLGYEDLVNETGESHQPVDIPNDSPALIMYTSGTTGRPKGAVLT
HTNLTGQTMTGLYTNGADINSDVGFIGVPFFHIAGIGNLLTGVLLGIPTV
IYPLGAFEPGQLLDVLAAEKVTGIFLVPAQWQAVCAEQQARPRDLKLRVI
SWGAAPAPDALLREMSARFPGTQILAAFGQTEMSPVTCMLLGEDAIRKRG
SVGKVIPTVAARVVDENMNDVPIGEVGEIVYRAPTLMSGYWNNPEATAEA
FAGGWFHSGDLVRMDSDGYVWVVDRKKDMIISGGENIYCAEVENVLASHP
SIVEVAVIGRAHDKWGEVPIAVAAVAGEGLALDELDEFLTERLARYKHPK
ALEIVDALPRNPAGKVLKTELRIRYGAAKID
379764470YP_005350867.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTSTSTSRRGPYLVGYVRDQLQTPLELVGGFFRMCVLTGKALFRWPFQWR
EFVLQCWFIMRVAFLPTIMVSIPLTVLLIFTLNVLLAQFGAADLSGAGAA
IGAVTQLGPLTTVLVVAGAGSTAICADLGARTIREEIDAMEVLGIDPIHR
LVVPRVIAATLVATLLNGLVITVGLVGGYLFGVYLQNVSGGAYLATLTTI
TGLPEVVIATVKAAVFGLIAGLVGCFRGLTVRGGSKGLGTAVNETVVLCV
VALYAVNVVLTTIGVRFGTGH
379764469YP_005350866.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSTTTVFRSRFPRAAENLNRYGLAAARGLDDIGQMAWFGGVALAHIPHAL
RNYRKETLRLVAQIGMGTGAMAVIGGTVAIVGFVTLSGSSLVAIQGFASL
GNIGVEAFTGFFAALINVRIAAPVVTGIAMAATVGAGATAELGAMRISEE
IDALEVMGIKSISFLATTRIMAGLVVIIPLYALAMIMSFLSPQITTTVLY
GQSNGTYEHYFRTFLRPDDVFWSFLEAILITAVVMITHCFYGYNAGGGPV
GVGEAVGRSMRFSLVSVQVVVLAAALALYGVNPNFALTV
379764468YP_005350865.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MPAPIQTNAPRTPPYKWAGLAALVIAALVLGFVYGQFRGDFTPKTNLTML
ASRAGLVMDPGSKVTYNGVEIGRVGSIAETVRDGKPAAKFTLEVYPRYLK
LIPSNVNADIKATTVFGGKYVSLTTPAHPSPQKISAHTVLDARSVTTEIN
TLFQTITSIAQKVDPVKLNLTLSAAAQSLAGLGEKFGQSVVNANAVLDEV
NPRMPQARKDIQQLAALGDTYADASPDLFDFLNNAVVTSRTINAQQKDLD
QALLSAAGFGNTGADLFTKGGPYLARGAADLVPTAQLLDTYSPELFCAVR
NYHDIEPKAASFLGGNGYSLNSHTQALSGLGLIANPLSLVAVAALTLGLG
ATAGLVGGAPNPYVWPENLPRVNARGGPGGAPGCWQPLTHDLWPAPELVM
DSGNSIAPYNHLDTGSPYAIEYVWGRQVGDNTINP
379764467YP_005350864.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MKISGTITRLSIFSVVLLIFTVMIFVVFGQMRFDRTNGYSAEFSNISGLR
AGQFVRASGVEVGKVDKVELVDGGKRARVKFNVDRSIPLYQSTTAQIRYL
DLIGNRYLEIKRGQGEGADKVLPPGGFIPLSRTTPALDLDALIGGFKPLF
RALDPQKVNTIATALVTVFQGQGGTINDILDNTAQLTNQLGERDQAIGEV
IKNLNIVLDTTVRHRQQFDQTVDKLEVLITGLKNHGDSQAAGFAHISNAA
GTVADLLAEDRALLHKTINYLDAVQQPLIDQQDQLQDYLKKVPTALNMIG
RAIGSYGDFVNFYACDITLKINGLQAGGPVRTVRLFQQPTGRCTPQ
379764466YP_005350863.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MRTLEPPNRVRIGLMGIVVTVLVIGVGQSFTSVPMLFAKPSYYGQFTDSG
GINTGDKVRIAGLDVGKVEGIKIDGDHIRLKFSIGTNTIGTESRLAIKTD
TILGKKILDVEARGNQPLRPGASLPLGQSTTPYQIYDAFFDVTKAAQGWD
IDTVKQSLHVLSQTIDQTYPHLSPALEGVAKFSDTIGKRDEEVKHLLAQA
NQVAGVLGDRSDQIDRALVNAKTLLAAFNERGQAINALLANIAAFSEQVK
GLLDDNPNINHVLEQLRTLSDILVQRKDDLANGLTEVGKFLPSLNEAIAS
GPFFKVVLHNLALYQISQPWVDAAFKKRGIDPEDFWRSAGLPAYRFPDPN
GTRFPNGAPPPAPPVLEGTPDHPGPAVPPGSPCSYTPAADGLPRPDNPLP
CAGAVSGPFGGPGFPAPVDVMTSPPNPAGLPPTPGINIAGRPGDPPPDVP
GTPVPLPTQAPPGARTENLAPAGPVPPPSTFAPGLPPGPPAPPGPGNQLP
APFINPGGAGGSGVTGGSQN
379764465YP_005350862.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSTIFDIRNIRLPKLSRASVIIGSLVIVLALIVGYVGWRLYEKLTNNTVV
AYFPAANALYPGDKVQIMGLRVGAIDKIEPTGDKMKVTFHYENKYRVPAN
ASAVILNPTLVASRAIQLEPPYKGGPVLADNAVIPEERTQVPVEWDQLRN
SITNIISKLGPTAEQPKGPFGEVIESFANGLAGKGKQFNTTLSNLSQALT
ALNEGRGDFFAVVRSLALFVNALHQDDAQFVVLNQNLADFTTRLAHNDTD
LSNAIQQFDSLLTTVRPWLDKNAGVLTYDVNNLETATNALLQPDSLNGLE
TALHVLPTAAANINQIYHPSHGSVVAIPSITNFANPMQFICSAIQAGSRL
GYQESAELCAQYLAPILDAIKFNYPPFGLNLFSTAETLPKQVAYSEPRLQ
PPNGYKDTTVPGIWVPDTPTSHRNTQPGWIVAPGMQGQQVGPITAGLMTP
ESLEELMGGPNIEPVQSNLQTPPGPPNAYDENPILPPMGLNAPVPIQPPP
PGPGVAPGPVAPTPAPVSAPAPNAGGPASAADFGGGQ
379764464YP_005350861.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MRLIRHRAWQTLVLLVAAMVLSSCGWKGISNVSIPGGPGSGAGSMTIYVQ
VPDTLAINGNSKVMVADVFVGSIKAINLKNWVATLTLGLDKHTKLPKNAT
AKIGQTSLLGSQHVELASPPNPSPELLKDGDTIPLKNSSAYPTTEQTLAS
LSLILRGGGIPNLEVLQNEIYNIFNGRGEAIRSLLGKLDTFTTQLNAQRD
DITHAIDSTNRLLTYVGGRADVLDRVLTDIPPLIKHFADTQNLLINAVDS
VGRLSQVADQYLSEARAPLYTDLQALQCPLKELGRASPYLIGALKLILTQ
PFDIDTVPKIFRGDYINISLTLDLTYSAVDNAFLTGTGLSGALRALEQSF
GRDPETMIPDVRYTPNPNDAPGGPLVERGDRNC
379764463YP_005350860.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MLTPFIRRQLIAFGILTVISLLVLGVYYLQIPSLMGIGRYTLKAELPASG
GLYPTANVTYRGITIGKVTDVEPTERGAEATMSIDSHYKIPTDTIANVHS
VSAVGEQYLDLVSSGNPGKYLADGQTITKGTVPAEIGPALDTANRGLAVL
PKEKIGQLLDETAQSVGGLGPALQRLVDSTQAIVGDFKTQITDVNDIIEN
SGPVLDSQVKSRDNIERWARNLNRLAAQSAQQDQRLKSLLHQAAPTADQV
NDLFSGVRESLPQTLANLEVVFDLLKRYHTGVEQVLVFLPQGASIAQTVA
APFPNMAALDLALSINQPPPCLTGFIPASEWRSPADTSIQPLPTGTYCKI
PMETPANSVRGSRNIPCTDIPGKRAATPRECRDPKPYVPAGTNPWYGDPN
QILTCPAPGARCDQSVRPGMVIPAPSINNGLNPAPSDRVAGTPPPTSDPL
SRPGSGSVQCNGQQPNPCVYTPSGPPTAVYSPQSGELVGPDGVKYSVENS
TRTGDDGWKEMLAPAG
379764462YP_005350859.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MEGDAGTSRLNPIDTDDDSLSPEDKDEDSTAPDSGAEQANPQGDPQDPAE
SGEPGATAPRGPSRVGRGWLAAIAVLLVLCAGAIGAGGYLAQRYHRDSLV
IARNDATALKAAVECVTATQAPDTNAMTAAEQKIIECGTDTFRTQALLYT
SMLVQAYQAANIHVQVSDVRAAVERNNPDGSINILVALRVKVASDQTENE
TGYRLRVKMAFAEGQYRISKLDQVTK
379764461YP_005350858.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTVVVEQTAPTDVPEPPREALAPWHSRVGAFAIDVLPGVAVLATLALVSL
TVPARGVWWWVSICVMGLAVLAMLVNRLLLPTILGWSLGRGVAGIAVTRR
GGEAAGPWTLLLRDAAHLLDTATVVGWLWPLWDSRRRTFADMVARTEARR
LQPDQAPPNVRRWAAGAVLAATAVCLGGAALSYGAAYAPQRASDQTRAEI
ATQGPKIVAQMLTYDPKSLQDDFARAQSLATDKYRGQLAAQQDLVRKGTP
VINEYWVTNSSIESAAPNRATMLLFMQGRRGAAPEVRYISATVRVNFAKG
GGNAWRVDDLTVLSKPKPPGNGK
379764460YP_005350857.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSPRRKFTPGERPLLVEHPVPPRQGWLVPLAATVAAVLMVAAIGVCALMW
GSHESRARAASRDREVLTYVTGFMTQFTSIDPFHANDYVNRILAQATGDF
AKQYEKNANEILLQVARAEPATGSVLDAGLERWNDDGSANVMVATAITTK
SPDEKQVLENANRWAATATQEGNQWKISNLQQVI
379764459YP_005350856.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MEDQQPAAGDLTAEDEATVDEATVAAPDDADAGATDDATDAEATDDATDA
EATEDAAEQATDGPAPAPRKRRLAGKAWAIVALVAAVLFVGSAGFAGAMV
QPYLTDRAVAETKINVARTAANAITTLWTYTPENMDTLADRASAYLTGDF
AAQYRKFVDAIVAPNKQAKITNHTDVTGAAVESLDDNNAVVIIYTNTTST
SPLTKNVPSLKYLSYRLFMKRQKSRWLVTRMTTITSLDLTPKT
379764458YP_005350855.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAALLLLTFATGLADAISILVLGHVFVANMTGNVIFLGFWLAPRTSIDLT
AVVVALPTFVCTTVLSGRLSRHFGERTRAWITTVLATEIVLLVTVAILAG
AGVLTYQRNSTLVMIGILAVTFGLQHSSARQFGIPELSTTVLTSTIVSLG
LDSRLAGGTGERQRLRVGVVVTMGAGAFVGATMSRYTVAPVFVVAAAVIA
TSLLIFRFGPGATKGAAAVVS
379764457YP_005350854.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAERAIVLTRRASFRRLAACCTALLACFTLAATNGLPLARAADGRDLLAN
AIGSTRGSYLVYNFGPGHPAPMLNAAGSWYEMNNGGHLMIIKNAAGRLSP
HLLVDTHQGDQARCENNPGARTGEGLWQASELYTPLQAWQRMGQPTIAIN
ANFFDVRGQKGGSWRQTGCSSPLGAFVDNTNGRGRANQAVTGTLAYPGKQ
GLSGGGESWSALTTMILPSGGAPYVVWPKTKKDYDAATPVVQDLLSKNER
FVAVSGIGLLAPGNTEQLHDGGPSAARTALAYARQKDEMYIFEGGNYTPD
NMQDLFRGLGSDNAVLLDGGGSSAIVLRRDTGGMWAGAGSPRGSCDTRQV
LCDSHERALPSWLAFN
379764456YP_005350853.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MPQSHAQHAAPNPKHNIKAIRTVRFWAAPLIITLALMSALCALYLGGILN
PSTNLHHFPIAVVNEDAGPGGAQITDRLVNGLDKNKFDVRVLSRGEAKRQ
LDTGRVYGSVVIPPSFSSKLRDFGTSAVAPTRAERPSITVSTNPRAGTLG
ASIAGQTLSTAMGMANGIAGQRVTAEVAAQTGGAPLPGAAQVGLAAPIEI
QSVVYNPLPNGTGNGLSAFYYALLLLLAGFTGSIVVSTLVDALLGYVPAE
FGPVYRFAEQVRISRFQTLLLKWAMMVLLGLLTSAVYVWIADALGMPIDL
SWQLWAFGVFAIAAVGITSSSLLSVLGTAGMLVSMLIFVILGLPSAGATV
PLEATPSFFRWLAEFEPMHQVFLGARSLLYFGGRGDAGLSQALTMTSVGL
VIGLLLGGIVTHLYDRKGFHRIQGAAALALAQEHQAQHKARRGKRAEPAA
TESTPDVAEPESSSEQT
379764455YP_005350852.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSATAEIRRAADRAVTTTPWLTSRHSFSFGDHYDPDNTHYGLLLVNNDDI
VSPGTGFDTHPHRDMEIVTWVLRGELSHRDSTGNHGVVYPGLAQRMSAGS
GILHSERNDSPSEPVHFVQMWVVPDESGIDPSYQQHEIDPKMLDDNLVTI
ASGIPTHDAAITLHNRHAALHGTRLRAGAAAHLPAAPYLHLFLARGRVSV
EGIGELHAGDAVRLTDADGRRAAASEPSELLLWEMHAKLGD
379764454YP_005350851.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MDVLAALANSPGGLTSAELAKRCAISTSTCALVLAELERRAWVARRGDRR
YVLGSGLFGLVHGLREQFPLLDRGRDALRFLHDRLGAGCSMSKIGARHLI
TVDTVGHGTDGEHAVGQRFPIDPPFGLVAMAWRDEDFVQAWLHRVMPRLT
RAEISEHQRVLADIRARGYGAWRFDDTHQSLHHRLAEVLASLEPTAHVTR
QLTTLMTMVTLRSVTDVLETDLATAEFVVLPIFSPDGQPEYQIEIHLGHA
TGLTLPELDAALRHAQRLLTAAVG
379764453YP_005350850.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MGVVALRGVIDHPELQLVDVVVHSDAKAGRDAGELCGIAPVGVVATQDPA
AMLAGDADAVVYAAAANLRPLDAVEDMVSILRAGKNVVSCSVVPLVFPDA
VDAAFTEPLRQAAIDGGVSFFTTGIDSGFANDVLPLMLTGVSRVIESVRV
TEMFNYATYPDRSAVYEILGFGQQPDYPAFAAQPGIFTFGWGPVLHQLAA
GLGVKIDNIEEANERIPAGESFDTPTGHIAAGTIAAMRSTLTGYVGGKPT
FVLDHVTRMRDDIAPDWPQPRICIEPKDLGYGPASGRGLYRVEIEGSPSM
RCEFEMAEDHDHDLGARIAGSSRMVNAIPAVCAAAPGLLSALDLPLITGN
GLVRPVPGPPPDSRLF
379764452YP_005350849.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTNSTALVTAAPGKPLLLLSAYDLADVGYRVKEFFVSATASSYTPVTELG
PDGRWDVTPSGSADFTTRIVVLTPTDPARFNGTVLVEWLNVSGGIDAPAV
WMMAHREIIRSGYAYVGVSAQRVGVEGGDSLLGADMSLKTQDPQRYAPLH
HPGDAFCYDIFSQIGGLLKSDEGRALLGDLPVRRVIALGESQSAMFLTTY
INAVDPLARSYDGFLVHSRFGSAAPLDGTSIFAETEEPQGVAFRPELRVP
LLTVVTETDVFGGARQGYYFARQPDSNYLRVWEIAGAAHADNYTIQVAFI
DSGSAPLADIAAAYTPTNMLMGQQLAHCINFGPQHHYVVQAALAALNTWV
ASGEPAPSAEPLKARETEGPQPVLDGNGLARGGLRTPWVDVPVARTSGLG
GEESIMSMIFGSGELFDAATLRRLYPGGNTEYLERFTGALDAAIRSGFIL
AADRAEILELAAATYPGARS
379764451YP_005350848.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSLLAQDPEGDAVLGTDFSAQAEPYRRELLAHCYRMTGSLHDAEDLVQET
LLRAWKSYDRFEGKSSLRTWLHRIATNTCLSALEGKGRRALPVGLGAPSS
DPTAELVERREVPWLEPLPELTDHPADPSVVVGSRESVRLAFVAALQYLP
PRQRAVLLLRDVLQWRSAEVAEAVGTTTTAVNSLLQRARSQLDAVGPSAD
DQLAPPDSPEAQDLLARYIAAFETYDIDRLVELFTAEAIWEMPPYAGWYR
GAADIVTLIHQQCPAEAGGDMRLLPLVANGQLAAAMYMRAGDVHVPFQLH
VLDVHGEKVSHVVAFLDETLFTKFGLPGSLSAGQE
379764450YP_005350847.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MNRTERSFDGFGGVRIVYDVWTPDTPPRAVVVLAHGLGEYARRYDHVAQC
FGAAGLVTYALDHRGHGRSGGKRAVVRDIHEYTTDFDTLVGIAAREHHGL
KCVVLGHSMGGGIVFAYGVERPDNYDLMVLSGPAVAAQDQVSPLLALAAK
VLGALVPGLPAQDLDVDAISRDPAVVAAYKSDPLVYHGKVPAGIGRALLQ
VGETMPQRAPALTAPLLVVHGSEDRLIPVAGSRRLVECVGSTDVELKVYP
GLYHEVFNEPEREQVLDDVVSWITARL
379764449YP_005350846.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTDDKMLARIAALLRQAEGTDNSHEADAFMSAAQRLATAASIDLAVARSH
SAQRSAAQAPTQRTITIGAAGTKGLRTYVQLFVLIAAANDVRCDVASNST
FVYAYGFAEDIDASHALYAGLVVQMVRASDAYLASGAHRPTPTITARLNF
QLAFGARVGQRLAEARDEARREATKDRQRAPGTAIALRDKEVELVDYYRG
ASKARGTWQASRASAGYSSAARRAGDRAGKRARLGNSPELPGARSALSG
379764448YP_005350845.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTPGNFPRRDSQRSRVYAAEEFVRTLFDRAAQHGSPAVDFFGTQLTLPPE
GRFGSVASAQRYVDDVLALPAVRSRWPGVAPLRVRPRRAATAAHYENQDG
AGVIAVPDRDTADWALRELVMLHEVAHHLCRAEPPHGREFVATICELTEL
VMGPEVGHVLRVVYAKEGVR
379764447YP_005350844.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSDPDERAREIEAQMTDDERFSLLVSVMGAGDLWPVRDERIPADTPMSAG
YVPGIPRLGVPPLRMSDAGLGVTNPGYRPGDTATALPAGLALAAGFDPAL
ARSAGEVIGSEARSRGFNVQLAGAMNLARDPRNGRNFEYLSEDPLLTAAM
IAESIDGIQRHGVISTVKHYSLNCNETNRHFLDAVIDPDAHRESDLLAFE
IAIERAQPGAVMTAYNKVNGVYAAANDVLINEVLKGAWAYRGWVMSDWGA
TPSWECALAGLDQECGAQIDALLWQAEAFGAPLRDAYAEGRLPRERLSDM
VRRILRSMFAVGIDRDAAPPEPDRAAHNEIALRIARQGVVLLTNRGALPL
TPEPGTRIAVIGGYAHLGVPAGYGSSTVVPDGGYAGVVPIGGAGLEAGLR
NLYLLPSSPLQELRNQLPRAQIEFDPGISPAEAALAARLADVAIVFAVRA
EGEGYDLADLSLPWGQDEMIAAVAAANPNTVVVLETGNPVSMPWRDAVNA
VVQAWYPGQAGARASAEILTGRVNPSGRLPITFPADLDQTPRPRLPGVGT
PWGTASTIEYFEGADVGYRWYAASGHVPMFAFGHGLSYTRFDYRDLVVTG
GETITASFTVVNAGDRAGADVPQLYVTAEPGGPCLRLLGFERIELEPGAS
RRLRIEADPRLLARYDGGAGCWRIEAGDYTAAVGISALAMRLAAGVELTG
RTFGR
379764446YP_005350843.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSEKPTPHDVDAFLDSTVVGDDPSLTAALEASNAAGLPPIAVSVQQGKFL
SLLAGAIGARRILEIGTLGGFSTIWLARGAGPQGRVVTLEYEPKHAEVAR
GNLKRAGVDDRVEVIVGAALDTLPTVTGPFDLIFIDADKENNLAYVEWAV
RLARPGAVVVVDNVIRDGQILRPHSDDARVRATRETLQAMGEHPRLDTAV
IQTVGAKHWDGFALALVQ
379764445YP_005350842.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MDLADRLRLDHPVGQAGMGGGLAGAALAAAVANAGGLGTLGIDTPRRLRA
SIDEVREQAPGRAVAVNLLLPFVHRHHVAACVDARVDAVVLAFGDKRGLV
EHLRDAGVFVFVMVGTEAQARAAIACGADGLIAQGREAGGHLVGTVPALD
FLPHALRAAGNRPVFLAGGVATAADTRAALDGGASGVIAGTRFLLTHEAN
ASREYQRRILRADRTIETNLFGLSWPLRHRVVPNEATRRWCRADGRAKAV
PAALNAASRPLSALGYFDAGALMRLQSPALPFFTPLAPVAGVPDSWLDGA
ALYAGEAALRIGELTSAAQAVADLSPR
379764444YP_005350841.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MALRARYERVAESMSAHFTFGLALLTGLYVAASPWIVGFSATRSLATSDL
IAGIAVAFLAYGFATTLDRAHGMTWTLPVLGAWIIVSTWILPDVTLTTGM
TWSNVVAGALLTFLGLNATYFGMRTRATGTHA
379764443YP_005350840.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MPTTDSARTADIKPRSRDVTDGLEKAAARGMLRAVGMGDEDFAKPQIGVA
SSWNEITPCNLSLDRLAKAVKEGVFSAGGYPLEFGTISVSDGISMGHEGM
HFSLVSREVIADSVETVMQAERLDGSVLLAGCDKSLPGMLMAAARLDLAS
VFLYAGSILPGVAKLSDGSEREVTIIDAFEAVGACARGLMPREDVDAIER
AICPGEGACGGMYTANTMASAAEALGMSLPGSAAPPATDRRRDGFARRSG
AAVVELLRRGITARDILTKEAFENAIAVVMAFGGSTNAVLHLLAIAHEAD
VALTLDDFSRIGSKVPHLADVKPFGRHVMSHVDHIGGVPVMMKALLDAGL
LRGDCLTVTGATVAENLAEIAPPDPDGKVLRALSNPIHPTGGITILRGSL
APEGAVVKSAGFDSDVFEGTARVFDGERAALDALEDGTITKGDAVVIRYE
GPKGGPGMREMLAITGAIKGAGLGKDVLLLTDGRFSGGTTGLCVGHIAPE
AVDAGPIAFLRDGDRIRLDVANRVLDVLADPAEFDSRRKGFTPPPPRYKT
GVLAKYVKLVSSAAIGAVCG
379764442YP_005350839.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTDEHGYSQQKDNYAKRLRRIEGQVRGIARMIEEDKYCIDVLTQISAVNS
ALRSVALNLLDEHLSHCVTRAVAEGGDEADTKLSEASAAIARLVRS
379764441YP_005350838.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTVMTAETANAAARTWTPRIAAQLAILAAAAFTYVTAEILPVGALPAIAR
NLNVSLVLVGTLLSWYALVAALTTIPLVRWTAHLPRRRVLVASLTCLTAS
QLISALAPNFAVLAAGRVLCAITHGLLWSVIAPIATRLVPPSHAGRATTS
IYVGTSLALVVGSPLTAALSLMWGWRLAVVCVTVAAALVTVAARLMLPEM
VLTEDQLAHVGPRSRHHRNPRLIIVSVLAMIAVTGHFVSYTFIVELIRNV
LGVRGPNLAWVLAAYGLAGLLSVPLVARPLDHRPKGAVILCMTGLTAAFV
VLTALAFGGRSGATTALIGTAAIVLWGAMATAVSPMMQSAAMRNGADDPD
GASGLYVTAFQVGIMAGSLAGGLLYEHSVTMMLIASAILMAVALVGIAAN
RRMLDVPPPRPTSSLDS
379764440YP_005350837.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSGWTKAWTFKGLFAALNVTGWGAVLTLALVLSAAPALADPDPAPADPGA
VAAPPGPPAPPDPFAPPPPPDPLAPLPPPDPAATPPWLPPMAEPAAASAA
GQNPTPFTGTAPFGPPKIQPANGSTVGVAQPIIINFPGRVDDAGAAEGAV
HVSSVPAVPGKFYWMTPTQLRWRPLSFWPAHTAVTVDAGGTVSSFRTGDT
LVATADDATHQLTVTRNGTVEKTIPMSMGMTSGNHQTPNGTYYVQDKKAS
VVMDSSTYGVPVNSTYGYKVTVEDAVRFDNVGDYVHSAPWSVDDQGKRDV
SHGCINISPSNAKWFFDNFGAGDPIIVKNSTGGNYKKNDGSADWMN
379764439YP_005350836.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MRGPRDRMVVSAALLIRERGAHATAISDVLEHSGAPRGSAYHYFPGGRTQ
LLCEAVDYAGDHVAAIIADAASGLDLIDTLIDKFRQQLLDSDFRAGCPIV
AVSVEAGEQDAERMAPVVERAAAAFDRWTDLIAQRFIADGVAREQAGELA
VLATTALEGAILLARVRRDLMPLDVVRRQVRELLLATSSYRVTGEDVPQ
379764438YP_005350835.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTTDTTGEWHSTACILCECNCGIVVQLDDRRLARIRGDKAHPASQGYTCN
KALRLDHYQNSRTRLTAPLRRRADGSYEEIDWDTAIVEIAEGFKHIRDTY
GGDKIFYYGGGGQGNHLGGAYSGAFLKALGSRYRSNALAQEKTGESWVDG
QLYGGHTRGEFEHAEVAVFVGKNPWMSQSFPRARVVLNDIAKDPARSMIV
IDPVVTDTAKMSDFHLRVRPGTDGWCLAALAAVLVQENLCDETFLAEHVR
GADTVRDALRDVAVADYAQHCGVDEELLRAAARRIGAAASVSVFEDLGVQ
QAPNSTLCSYLNKLLWVLTGNFAKKGGQHLHSSFAPLFGQFSGRTPVTGA
PIISGLVPSNVVPEEILTDHPDRFRAVIVESSNPAHSLADSTACREAFQS
LELMVVIDVAMTETARLAHYVLPAASQFEKPEATFFNLEFPHNTFQLRRP
LLEPLPGTLPEPEIWARLVRALGVVDDADLRPLREAAQRGRQAYAEAFLS
AAATNPTVAQLLPYVLYETLGPTLPDGLRGAAALWGLAQKTAMNYPDAVR
RAGHADGNALFDAILDNPSGVTFTVHNYEDDFALISHSDQKIALEIPSML
DELAALARTPAELTTPDFPIVLSVGERRAYTANDIFRDPSWRKRDADGAL
RVSVEDAQALGLVDGCRARISTAAGSAEATVEITETMLAGHAALPNGFGL
DYLDDDGHTVVPGVAPNALTSIGWRDPYAGTPWHKHVPARIEALTPVSSR
S
379764437YP_005350834.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTNTALRSGIDLSYVDDSIRPQDDLFGHVNGRWLAEYEIPADRATDGAFR
QLYDRAEEQVRDLIVEASERGAAAGDADAQRIGDLYASFLDEETVQRRGV
RPLLDELAVIDDAADADALAAALGALQRTGVGGGVAMYVDTDAKNSARYL
VHFTQSGLGLPDESYYREEQHAEVLEAYPGHIARMFGLVFGGDPESHIRT
AERIVALETRLAEAHWDVVKRRDADLTYNLRTFAELRDESVGFAWGTWVA
ALGTQPEALAEVVVRQPDYVRSFAELWRSEDLEVWKSWARWRVIRARAAW
LTDEVVAADFDFYGRRLTGTEQIRDRWKRAVSLVESLMGDAVGKLYVQRH
FPPGAKARIDELVANLQAAYRMSINDLEWMTPQTRERALAKLDKFTAKVG
YPAKWRDYSTLVIDRDDLYGNYQRGYAVNHDRELAKLGGPVDKDEWFMTP
QTVNAYYNPGMNEIVFPAAILQPPFFDAEADDAANYGGIGAVIGHEIGHG
FDDQGAKYDGDGNLVDWWTDADRAEFGARTKALIAQYDTYIPRGLSSGHH
VNGAFTVGENIGDLGGLSIALLAYQLSLNGQPAPVIDGLTGVQRVFYGWA
QVWRTKSREAEAIRRLAVDPHSPPEFRCNGVLRNMDAFYDAFDGADTGAL
FLEPERRVKIWN
379764436YP_005350833.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSEGARTEPPAEEDVVDAGDDAEEGGHPTADDADDGEPGDGVFSHYGVAS
TVLGVLSVAAVVLGVIIWSGHRDQVAERGYLSRVMQTAAGWTNVLINMNS
GNVDASLQRLHDGTVGELNTYFDAAVQPYRAVVEKLQSKSAGRIDAVAIE
TVHHELDAQPGADRPPGSESVTTKLPPFASRTDSVLLVATSVSENAGAKP
QTVHWNLRLDVSDVDGKLMISGLSSIR
379764435YP_005350832.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MRNIWRLFAFDIAAPLAAIAALVAIGVVLGWPLWWVSACSVLVLLTLEGV
AVNFWLLRRDSVSLGTDDDAPGLRLAVALLCTAALAAAVATGYTHWTKTD
RDFTDDSRKVVRIATGMAEAMASFSPTAPTDAIDRATAMVVPEHAAAFKE
QYTKSSAELGQHKVTAQAATVSAGVEALGPTAASVAVILRVTQNAPGQPP
SQVAPALRVTLTKRGSDWLVADVLPIR
379764434YP_005350831.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MEFWPTAAIRSALQGGDIATWKRIAGALKRDPYGRTARQVEEVLGGTRPY
GIAKALWEVLERARTHLDANERAEVARHVRLLIDRSGLAQQEFASRIGVS
PEELGGYLDGSTSPTAALMIRIRRLSDRFVKVKSGPSAESN
379764433YP_005350830.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MMRLSRSLRKYRWLVFTGWLLALVPAVYLALTQSGNLTGGGFDVAGSQSL
AVHDQLEELYHDQGGSSLALVAAPRADATYQDMNEAVAQLRRLTAEVPGT
SEIPNPTQRPPQPDRPYVLSVRLDSRNTSDVAKKLRTKVGIKGDQPGQTA
NGRVRLYVIGQGALSAAAAANTKHDIAAAERWNLPVILIVLLAVFGSLAA
AAIPLALGVCTVVVTMGLVYLLSAYTTMSVFVTSTVSMFGIALAVDYSLF
ILMRFREELRSGRQPREAVDAAMATSGLAVVLSGATVVASLTGIYVINTP
ALKSMATGAILAVAVAMLTSTTLTPAALATFGRAAAKRSGFLHWSRRPES
TQSRFWNRWIGWVMRRPWMSALAASLVLLVMAAPAASMVLGNSLLRQFDS
SHEIRAGVGAAAQALGPGALGPIRVLINFPEGGAASPEHSHTVGAVRQRM
TQAPNIVSVSPPQYAEDNGSALLSAVLSVDPEDMRARETVGWMRAELPKV
QQLGTARVDVGGPTALIKDFDDQVSATEPLVLGFVALIAFVMLLVSVHSV
FLALKGVLMTLLSVAAAYGSLVMVFQWGWLKDLGFAQISSIDSTVPPLVL
AMTFGLSMDYEIFLLTRIRERFLHSGNTRDAVAYGVSTSARTITSAALIM
IAVFVGFAFAGMPLVAEIGVACAVAIAVDATVVRLVMVPALMAMFAQWNW
WLPPWLSRVLPSVDFDRPLPEVDLGDVVVIPDDISALVAPSADLRMVLKS
AAKLKHLAPDAICVTDPLAFSGCGRGRGQASSGPDEERTRGLGPGQIPHQ
VALGEEKVAVGVTAADRKTATNGHANGSSGPKKLVGGLAARNGIAKAISG
SDRPVHPVTLWRGRLSVAIDALETDPDAAPAGATDRPRYARRSPVETTHV
QLPTGDRLLVPTGAETLRLKGYLIMCRNSRRDYADFADMVDAMEPETAAV
VLAGMDRYYCCESSRRQCIATQLVRRLADPDPCDYPEDQGSEADANSDWE
GIRERCLSVAVAMLEEAR
379764432YP_005350829.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAVRANCEEFSMTTGSAGRRGKILAGLIAAAAPGAALAVLAGPPATGAND
PCAASEVARTIGSVSKSMGDYLDSHPETNQTMTSMLQQQAGPQSLSGLKS
YFDANPKVAGDMTSIAQPLTSLSLQCKLPISIPQMMGMMQQAQGAAGALP
ALPGNPPGASPLGGTAAPPAAPQPAPLPAGTNPLSGPPRGNTVG
379764431YP_005350828.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSHDAPAHHLDFPREQTPRGKYWWVRWVILGMVAIVLAVEVSLGWDQLAK
GWMSLYEANWWWLLASVVAAAASMHSFAQIQRTLLRSAGVHVKQLRSEAA
FYAANSLSTTLPGGPVLSATFLFRQQRLWGASTVVASWQLVMSGVLQAVG
LALLGLGGAFLLGAKNNPFSLLFTLGGFVALLLLAQAVASRPELIEGIGS
RVLAWVNSVRGRPADTGLDKWRETLRQLESVSLGRRDLGVAFGWSMFNWV
ADVACLGFAAYAAGDHASVAGLTVAYAAARAVGTIPLMPGGLLVVEAVLV
PGLVSSGMSLSSAISAMLIYRLISWLLIAAVGWVVFFFVFRTENVDDSDD
DPITGPLPIVPQPGDASADPTEAALQGPLPPDRNPETEGRDS
379764430YP_005350827.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSANIDDASVEPVIRKTAAWAWRLLVILAAAVALLWVIQKLEIIVVPVLV
ALLLSALLLPVVDWLDQRGLPRGGAVALVLLGGFAILGGILAFVILQFID
GLPGLTEQVAQSIESTRRWLINGPTHLRSEQIDSAGNAAIEALHNNQAKL
TSGALSTAATVTELVTAAVLVLFTLIFFLYGGRNIWQYVLQVIPSDVRAR
VHEAGKAGYGSLIGYVRATFLVALTDAAGVGAGLAIMGIPLALPLASLVF
LGAFIPLIGALISGLLAVVVALLAKGIVYALMTLGVLIAVNQVEAHLLQP
LVMGRAVSIHPLAVVLAIATGGVLAGIVGALLAVPTVAFLNNAFQVLLAP
NPEAEAERQTEEADETNAILQAEPDKPGDGSG
379764429YP_005350826.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MYRYRYIVIGVTVALCLLGGVFGISLGKHVTQSGFYDDGSQSVKASVLGD
ETYGRDRTSHVVATFTAPDGKTVEDPAWRDKVVAELNKFKADHPDQVVGW
AGWLAAPNSDNPVIKGMVSEDKKHTFVSVPLKGDDDDSILNNYKAIAPGL
QKLGGGNVELAGLEPIANALTGTIATDQRRMEVLAVPLVAVVLFLVFGGA
VAAGLPAIVGGLSIAGSLGILRLVSLFGPVHFFAQPVVSLIGLGIAIDYG
LFVVSRFREEIAEGYDTEAAVRRTVMTAGRTVTFSAVLIIASSASLLVLP
QGFVHSLTYAIFAAVGLAALLSITFLPACLGILGRHVDALGVRTAFRVPF
LRNWKYSRAYLNWLADRLQKTKTREEVEAGFWGKLVNWVMKRPLAFAIPI
AVGMILLVIPLGNLSFGGMSEKYLPPDNAVRLAQEHFDKRFPGYRTEQLT
VVIQSDNHSKVTDQQVADIRNRISSIGGFTDKQWEERACPTIAGNPCVAG
PNGTTVPKDGSVRVIQNGLVNKNDAAKKITELRAVNPPKGLNLYVGGTPA
LEQDSIHSLFDKAPLMLVLLLGATMLLMFLAFGSVVLPVKAAVMSALTLG
STMGILTWIFVDGHLSGVLNFTPTPLMVVVIALVVAVGFGLATDYEVFLV
SRMVEARERGMSTAEAIRIGTATTGRLITAAALVLAVVAGSFVFSDLVLM
KYLAFGLMAALLLDATVVRMFLVPSVMKLLGDDCWWAPRWARRLQNKIGL
GEIDLPDERKRPTLNGRPARPPVAASLVAAAPRPPHDPTHPAPLEPSRSA
RPAPEPRPAKEPTPSASTTRADDSVDTTRIPARPSQPTEAKTTRFSAQGA
PARDRPAAPKAPQAPQAPKRPPAPATPPSGDQTRAIPVPGNRPDDTNSDA
AGEQVNPRGQAENGDPARQRRRSGGGLSAADLLRREGRL
379764428YP_005350825.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MMSLTETTNAGAEPVAPPAVLPDDGVGALGGFSPSGGRVLLVWDAPNLDM
GLGSILGRRPTALERPRFDALGRWLLSRTAEISAQRPGVVVEPEATVFTN
IAPGSADVVRPWVDALRNVGFAVFAKPKIDEDSDVDRDMLAHIELRRTEG
LAALVVASADGQAFRQPLEEIARSGTSVQVIGFREHASWALASDTLDFVD
LEEIAGVFREPLPRIGLDSLPDQGAWLQPFRPLSALLTARV
379764427YP_005350824.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MHAQRGVAMSADTPIGESARPDQRYLPATAFRSRRSALSDAQRQTWERRW
PDLGLSVGAPADGTVGDEPPLDTRSWFGRQAPLVLEIGCGSGTSTLAMAK
DEPDVDVIAVEIYRRGLAQLLCAIDRDAVTNIRLVRGNALDVLQRLIAPA
SLTGVRVFFPDPWPKARHHKRRFLQPGTVGLIADRLLPGGVLHVATDHAG
YAEHIAEVGAGESRLRRAEPETPLPISTVRPTTKYETKAQEAGSAVTEFV
WLKR
379764426YP_005350823.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MRGQGHQIFVDELTRFADGVVDPRVTAIARRTAAPLRVVVRGRRGVGRRT
VARALDRAGTASGIAADLQLSASAPDPGADAVVYVVAEVVKPEDAHAIAA
AAQPVVAVLNKADLSGRRGDGPIAAARARCADLSALIGAPMEPMIGLLAV
ALDELDKADDHALWAALHTLATHPGAAACLDGSFAGFLAADGPVPTGVRQ
RLLDTLDLFGTALAVAAIRQGRTPAQVLTLLRRVSGVDAVLGKVGALGAE
VRYRRVLEAVGELEALAVGGGGLGEQIGGFLSRDDTVVARMAAAVDLAEA
AGLDADDSGFADAARYPSAHLPRAVRWQRYSRASMSELHRTCGADIARGS
LRLWSQARASLPGESW
379764425YP_005350822.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSGEGNNDPVAQVDALVAAAAPDLDPPAVHRCDVVLVTGPWMAGVSAVAT
ALQGRLPQHKFVESTDLGPGEVPMAVVFVVSAAAHLTASDCALLDAATEH
TDAVVGVVSKIDVHRGWREVVDANREALAAHSPRYGRAPWVGAAALPDAG
EPDVDALVAAVSAQLDDPDLARRNRLRAWESRLQTVKRRFDRDVEGSGRR
ARVEALREERSTALQRRRQAKSERTITLRGQIQQARVQLSHSARNQCATA
RTELQEHAAGLSRRDMSGFEAHTRARLDEVVAEVSDGTDTQLSDVAQAVG
VPVDLPALEKMPEVDVSAPPLKSRRQETWLMIVLGVGFGLGVALTLSRLL
SGVVSRLNPALAVVAAVVCVAISVALTFLVINIRALLHDRALLDRWAGDA
TSSLRSVVEELVATRVLVAESVLSKALLAHDEAENAQASAAVGVIDTELR
EHAMAAARAAAARDREMPAVAAALRAVRAELGEPGIQPAESPAETGDGDE
TEKPASRSEDGDPSGASESLL
379764424YP_005350821.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTSATIPGLDTAPTKHQGLLSWVQEVAELTQPDRVVFADGSDEEFNRLAA
QLVEAGTLKKLNEKKHPNSYLALSDPSDVARVESRTFICTEQESGAGPTN
NWMDPSEMRSIMTDLYRGCMRGRTMWVVPFCMGPLGADDPKLGVEITDSE
YVVISMKVMTRMGKAALEKMGDDGFFVKALHSVGAPLEEGQKDVPWPCND
TKYITHFPETREIMSYGSGYGGNALLGKKCYSLRIASAMAHDEGWLAEHM
LILKLISPENKAYYFAAAFPSACGKTNLAMLQPTIPGWRAETLGDDIAWM
RFGKDGRLYAVNPEFGFFGVAPGTNWKSNPNAMRTIEAGNTVFTNVALTD
DNDVWWEGLEGDPQHLIDWKGRDWTPDSDEKAAHPNSRYCTPMSQCPILA
PEWDDPQGVPISGILFGARRKTTVPLVTQARDWQHGVFMGATMGSEQTAA
AEGKVGTVRRDPMAMLPFLGYHVGDYFQHWLDLGKNADESKMPKVFFVNW
FRRGDDGGFLWPGFGENSRVLKWIVDRIEHKAGGQDTPIGIVPKAEDLDL
DGLDASGDEVAQALAVNPAEWREELPLIEEWFEFVGDKLPTGVRDEFEAL
KQRLSEAG
379764423YP_005350820.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTAEQESEPAASSFADSDYVDGMERLVHAIQELSLARTLPDLQRIVRSSA
RELTGCDGATFVLRDNDSCYYADEDAIAPLWKGSRFPIGSCISGWAMLNR
DAAVIPDIYGDPRIPHALYRPTFVKSLVMVPIRKLEPIGAIGNYWASRHQ
PSDQEVHLLQALADSTSIAMENVRVYSELERRVRDRTAALEDANEEIRRL
SVTDELTGLNNRRGFYLLAEQKLRGSHHLGHNCVLAFLDVDGLKKVNDEL
GHDTGDKLIKDVAGVLRTIRRESDILARIGGDEFCVMITESDGDTPSLEE
RLALAFGNFNKTSERPYRLSASIGFVRAPVSDTANVGELLARADELMYAQ
KKASPNSRLAG
379764422YP_005350819.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MQIRPYIGADKPAVILYPSGTVVTFDDLEARANRLAHRFRQAGLREGDTV
AILMENNEHIHAVMWAARRSGLYYVPINTHLTAAEAAYIVDNSAAKAIIG
SAALRDTCAGLAEQLPRGLPELLLIAAEKHDEGLPGWERYPECVAGQPDT
PIDDEIEGDLLQYSSGTTGRPKGIKRELPHVPPADAPGMMSALVGFWMTP
DSVYLSPAPLYHTAPSVWSMSAQAGGITTVVMEKFDAEGCLDAIQRHRVT
HGQFVPAMFTRMLKLPDAVRHSYDLSSLQRVMHAAAPCPVEIKKQMIDWW
GPIIDEYYASSEAHGSTLITAEDWLAHPGSVGKPMGGAVHILDENGDELP
PGQAGEIYFEGGYSFEYLNDPTKTASSRSKHGWATVGDIGYVDDEGYLYL
TDRRHHMIISGGVNIYPQEAENLLVTHPKVMDAAVFGVPDDEMGQRVTAV
VQTVDPADATDAFGDELLAWLRDRLAHYKCPRSIAFEAQLPRTDTGKLYK
NGLIEKYSV
379764421YP_005350818.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MVDLSSAPEDGPASPPGVIIAVGSADDIARAGTWLDAATFTLTEDACADR
RVITVDSVSDALVELTDRCRRWPHAGGICDDVLRAVDPEGPTLAGVVAES
LGYSTLQSGPEFARWLQERGRVRMPDIADPVLADRDGDILRIAFNRPQRH
NAFSTDARAALLEALSVAQLDPSVTGIVLIGNGPSFCSGGDLAEFGTFAD
PASAHLARTRHSPALALDALTARLGRACRAEVHGRVMGSGLEMAAFCGWV
TARGDAVFGLPELALGLIPGAGGTVSVTRRIGRWRTAYLVLSGHTVDAET
ALAWGLVDEA
379764420YP_005350817.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSYPPAPPGGSPEWPGQQPEWQGQQPEWQGQPPPDWQGQPPPGYPPQPPP
AWPGQPPAGWPAAQPGWQGQPEPENYLVWAILCTVLCCLPLGIVSIVYSN
KVSGLWAQGRYAEAHEAANNAKKWAIIGAIVGVVAAVIFVLIYVVAGVLV
VSHLPSTTTTTYSGF
379764419YP_005350816.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MNDEEDMLVATVRAFIDREVKPSVRETEHANTYPEAWIEQMKRIGIYGLA
VPEEYGGSPVSMPCYVRVTEELARGWMSLAGAMGGHTVVAKLLTLFGTEE
QKRTYLPPMAGGEVRATMALTEPGGGSDLQNMATTALSDDAGGLVINGSK
TWISNARRSGLIALLCKTDPNAKPRHTGISIVLVEHGPGLTVSRDLPKLG
YKGVESCELSFDNYRVPETAILGGVAGEGFSQMMKGLETGRIQVAARALG
VATAALEDALAYAQQRESFGQPIWQHQSVGNYLADMATKLTAARQLTRYA
AERYDSGERCDMEAGMAKLFASEVAMEIALNAVRIHGGYGYSTEYDVERY
FRDAPLMIVGEGTNEIQRNVIARQLVTRGGI
379764418YP_005350815.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTSDGYARIREGGPYFDDLSVGQVFDWAPSMTLSSGLAGAHQAIVGDRLR
LALDADLCGAVTGLPAPLAHPGLVCDVAIGQSTLVTQRVKANLFYRGLVF
HRFPVIGDSLYTRTEVVGLRANSPKPGRAPTGLVALRMITIDQADQLVLD
FYRCGMLPAGPDFDADNAPHDDLSTIGADVPGPAHDPTAQWDGEVFRTKV
PGPHFDPALAGSVLHSTADVVTNAPELARLTLNIAATHHDSRVGGRRLVY
GGHTIGLALAQAGRLLPNLVTVLGWESCDHTGPVHEGDTLYSELHIESAE
PTEHGGVLGLRSLVYAAGDAEGGPDRPVLDWRFRALQF
379764417YP_005350814.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSSAATAWGSSGLAYLTGPPDGPADFSRARVLSRAHEVAAAIGGRWGIDV
DAAGLLTGRAALRGLTRAGRVSPGGATRLLAARDGWCALTLSRADDLAAV
PALLQVDDAAVDPWPQLRRWAATRAVPDIVERAALLDIPAAGLGEATAAP
PHTRRIGPPAPPRAPRGCWWPICPRCGRARCAVGCWPTPGRRSSRSKALA
ARTEPAPGTEPSSTG
379764416YP_005350813.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MNHEKLCYGIDFDSQTDELRELLTVSDVVIEGSRPAGLARRGLGPDDVAP
RPGRIWLQITAYDGRRPGFGDDAAVGGGLVGTSAEGPVFCGDAIADPLTG
LQAALAVAESLARGGGELIRLSMAAVAATYAALPTGPSESPAPVSPPLMP
PAAPPASGLGADNAAVRHLVGQRRCPSC
379764415YP_005350812.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MLIRQATLLDGTVTDIRVGAQIEEMAPSGEGLTPRAGEGVLYAGGGTVLP
GLHDHHVHLRSAASALDSFFVGPPGVSTEAELTQLLANATPGPDGWIRAV
GYHDSVAGELDRTALDAMVRSVPVRIQHRSGALWILNSEALGRIGLAEHP
DGRLRSADDGWSQALDRRETDLAELSRRITATGVTGVTDATPDLDADDRA
LLAAAHGRGEFRPRVSFLSPGKKILHDDRLNLDGLTEWIAGQHNTGQPVA
VHCVTAAQLVVTIAALRAAGGHPQDRIEHAAVVPDDNVADLAELGVTVVT
QPNFVAERGDQYLAEVSAAEHDQLWRVAALRDAGVPVALSTDMPFGHGDP
WTAMRAAVHRTTPSGAVLGADECVSPSTALTMFLGCADRPDRVRAVRTGQ
PGDLCVLSEPPATALAELDAGMVAATVIGGELVYFAM
379764414YP_005350811.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTNDAVHPDLQKLARFAPRRLVGPRTLPIMRAAMDWRARLGKPVRDVEVI
TLESGAGVRLFRPAGVSEPTPALLWIHGGGYVIGTAQQDDRLCSGFSRRL
GITVASVEYRLAPEHPYPAPLEDCYAALTWLAGLPSVDRYRVAIGGASAG
GGLAAALALLARDRAEVSPSFQLLTYPMLDDRSSATEPSANYRLWDNRSN
RFGWAAYLGGADPQVAVPARRDDLSGLPPAWIGVGTHDLFHDEDLAYAER
LKAAGVPCQVEIVPGAFHGFDLIAPKLQVSQQFFGSQCDILRAALAPAS
379764413YP_005350810.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MWPSLLMTGDLWAGQAARFGDSHRLVLVDPPGHGGSAPLSGPFSFADCAR
CVVDLLDGLGIDRAHFVGNSWGGMIGGTFAALHPERLDRAVLMNCTASKA
GVAQKIQYAAMLWLARLLGGIRPPLTRSSIRAFLGPTTLRTRPDVVEAVR
TNVAAVNADSVRWAVHSVVSARPDQHALLARVTAPVLVVAGAEDATFPVA
ETRAMAESIPTASFTVLDGVAHLAALEDPARVNALLESFLFG
379764412YP_005350809.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MLGQLYDRALGGERCWIRHDDGELRPLPAHRWLGVRCPPDGSGGSGDAVD
EVFDEAVTQMCTGPTIELGCGPGRLVARLIQRGIPALGIDRSATAIQLAG
RGGAPALLGDVFEELPGTGLWQTVLLVDGNVGLGGDPLRILARAFELLAR
GGRCIAEFEAETIGIRSRWVRLESSCEVGPWFRWATVGVDSAAALAAQVG
LTLTGVRLIGDRVIASLAAV
379764411YP_005350808.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTANRPGFTPWMKWLLRAGPADYALALSVAGASLPVVGKHLEPLAGITAM
GVWGARHAPEAISAAKKDWFTPGINDARRRDRESTRQVSLAALRGVVSAA
DLEMDWPAAERTPPIWDGLRQRRHLYRRGVHYGDHPAQVLDVWRRKDLPA
QPAPVLIFLPGGAWVHGRCMGQGSALMSRLAEQGWVCLAVDYRVAPHHRW
PRHIVDVKTAIAWAHANVDKFGGDRNFVAIAGCSAGGHLCALAGLTPDDP
EYRAKLPEGADTSVDAVVGIYGRYDWEDRSTPERARFVEFLERVVVRKSI
ARHPEVFRAASPIARVHRNAPPFLVIHGSKDSVIPVEQARSFVERLRTVS
HSTVGYLELPGAGHGYDLIDGERAGAAAHVASLFLNQVYRTKTRIGAKEV
I
379764410YP_005350807.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MKRLSGWDSVLLYSETPNVHMHTIKAAVIELDVDRRSLDVDAFRQVIAGR
LNKLDPFCYQLIEVPLNFHHPMWRENCEVDLDYHIRPWRVSPPGGRRELD
EAIGQIASTPLDRSRPLWEMYFVEGLANNRIAVVGKIHHALADGVASANL
LARGMDLQPCPDGGPYMCDPPPTTRQLVASALADHVRHVGRLPHTIRYTA
QGLGRVRRSTRKFSPELTRPFEPPPTFMNHKLTPERRFATATLALADVKE
TGKRLGATINDMVLAMSTGALRTLLLRYDGKAEPLLASVPMSFDFSPERI
SGNRFTGVLVGLPTDSDDPLERVRCSHENAIAAKESNQLMGPELVSRWAA
YMPPGPTQAFFRWASGRDGHNKILNLNISNVPGPRERGRVGGALVTEIYS
VGPLTAGSGLNITVWSYVDQLNISVLADGATCEDPHEVTDAMVNDFIEIR
RAAGISEKLTTIEAAMAPA
379764409YP_005350806.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSEEANEPEVLVEQRDRILIITINRPKAKNAVNSAVANGLAAAVDRLDDE
PGLSVGILTGAGGSFCAGMDLKAFARGELPIVEGRGMGFTERPPVKPLIA
AVEGYALAGGTELALATDLIVASKDSAFGIPEVKRGLVAGGGGLLRLPQR
IPSAIAMELALTGENLSAERAHALGMVNVLAEPGSALDAAIELAEKIAAN
GPLAVAATKQIIVESRGWSPETMFAEQNKLLAPVFSSNDAKEGAIAFAEK
RPPKWTGT
379764408YP_005350805.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MNRQRIIDAARERFMRDGYERATVRAIAADAGVDVAMVYYFFGNKEGLFT
ASTLTGPEHPLHQLATLLDEGTERVGERLARRFLEHWEQGAVFEPFLTLW
RSAAIHPEARKVLHDSLAGPIAERVATEFGVADAELRVELVASHLAGLAF
ARYQLKIEPLASTSIEDLVGRLGPTLQRYLTD
379764407YP_005350804.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MVTRTRRRLWWRHLMSVLLFPATMTLVVPALIVGTAGVHEPRLDAAPTIA
LITVGCVLIAAGLALMIWTNVLFDRVGEGTLGLGNVMGEPVHLVVRGPYR
HVRNPMITGVLCILLGEAAIIASGPLLLWFAIFFTFQAIAIRFWEEPHLA
ERYGREYVDYRSNVPRWIPRVSAWDPPARS
379764406YP_005350803.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSISLLLEMAVSGDAERTAVVSGDLRLTTQQLSDLADGGAGVVAASGAKH
LVYVGTGGAMLPVLIFAAARAGVAFTPINYRLSAEGIQALIERLPEPLVV
VDGRYREMIGGVSDRVMVSDDFLDAAGGAEPAAEFPDPDAVAIVLFTSGT
TSQPKAVELSHNNLTSYVTGTVEFGAAADTDAALICVPPYHIAGVSAALS
NLYAGRKMVYLPNFDAQEWVRLINTENVTTATVVPTMLDRIVTVLENGDG
PAIELPSLRNLAYGGSKVGLPLVRRALELLPDVGFVNAYGLTETSSTIAV
LTPDDHRAALAASTPEGARRLGSVGQAVAGIELQIRDEAGNVLPPGETGE
LFVRGEQVSGRYTGIGSVLDENGWFPTKDIAMLDDEGYLFIGGRSDDTII
RGGENIAPAELEEVLVEHPHVRDVAVVGVEDPQWGQAIVAVVVPAPGVDP
DPAELREFVRKSLRGSRTPDEVVFRDELPTTATGKVLRREIIQTLTELRS
APAQQ
379764405YP_005350802.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MIKNGTRLASQVCDTQVIVVRSADSLDDLRCGGAPMVPVGAERSGELDPA
FSDGTVMGKRYVDESGAEVLVTKPGAGSLSIGQTALHLKEVKPLPASD
379764404YP_005350801.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MLASAAEVMRERGAAGVTIDAVLARSGAPRGSVYYHFPDGRNQILTEALR
YSGDSITALIDDAAGRGARELLAEFVGYWERLLTEGGFTAGCPVVAAAIG
CSDGDGPKLSTEAGAILGRWCTALTRAFVNDGFDDADAASLAVMSISALE
GAIVLSRSTRNAGPLHQVGEQLEFLIKAKEFVLRNKIPGKPAGSQ
379764403YP_005350800.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MWIIELNVAGYQFTREMPELRRRTFRFSPRHMHWPALRHSHAA
379764402YP_005350799.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTGQCDLNKQEEWRKMTDAKTEYDKLFIGGKWTEPSTSEVIEVTCPATGD
YVGKVPLAAAADVDAAVAAARAAFDNGPWPTTPPKERAAVIANALKVMEE
RKDLFTQLLAAETGQPPTTVETMHWMSSIGALNFFAGPAVDQVKWKEVRT
GGYGQSIVHREPIGVVGAIVAWNVPLFLAVNKLGPALLAGCTVVLKPAAE
TPLSANALAEAFAEAGLPDGVLSVVPGGIETGQALTSNPDVDIFSFTGSS
AVGKEIGRRAADMLKPCTLELGGKSAAIVLDDVDLPSAIPMLVFSGIMNT
GQACVAQTRILAPRSRYDEIVDAVSTFVQALPVGLPSDPAAQIGSLISEK
QRARVEGYIAKGIEEGARLVCGGGRPEGLDGGFFVQPTVFADVDNKMTIA
QEEIFGPVLSIIPYDTEEDAIKIANDSVYGLAGSVWTADVQRGIEVSEKI
RTGTYAINWYAFDPCCPFGGYKNSGIGRENGPEGVEHFTQQKSVLMPMGH
TIES
379764401YP_005350798.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAVTDLFARRATLARSVRLLSEFRYEQTDPARFYGALAADTVAMVSDLWR
AAHADSPAGRTLLDVGGGPGFFATAFARAGLDYVGVEPDPGEMHAAGPAD
AAAGGTFVRASGMALPFADDSVDICLSSNVAEHVPRPWQLGAEMLRVTRP
GGLAVLSYTVWLGPFGGHEMGLTHYLGGERAAARYARKHGHPAKNNYGSS
LFEVSAADGLTWAANTGAALAAFPRYHPRWAWWLTGVPVLREFLVSNLVL
VLQPQE
379764400YP_005350797.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MDVPDWVWALTVLAIVGLLAFDFFFHVRKAHAPTLREAALWSMAYVGIAL
LFGVGLLAFGGHEEGPEYFAGYVTEKALSVDNLFVFLMIMASFRVPREDQ
QKVLLFGIVFSLIARTGFIFLGATLINTFAWVFYLFGLILLLAAGGVLRP
DEREESHKADNVVIRIAKKVLHTTEHYDDDRLFTMVDGRRAMTPMLLVMV
AIGGTDIFFALDSIPAIFGLTQNVYIVFTATAFSLLGLRQLYFLIEGLLD
RLVYLSYGLGAILGFIGVKLILHALHENNVPFINDGEPVSLVEISTYLSL
AVIVGVLVVTVVASLLSPMGKARTAIAGARRHATAYLDSEYTHDAGERER
IFRKLLDERDQILALGPKYRQLVRDEPALIDLFDRAAAKHDEAVGRGEAE
PFVRMGLTS
379764399YP_005350796.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MFDSLLDALGNSWWAYPLILASCTFDAILPLLPSETALLTGGILAANGSM
LLGWVIVMAAIGAFVGDNLAYAIGHSADDFARRWITRGEKGQRSLDWAHR
ELERHGGPLVIVARFLPGGRTATTIACGVLDFPYRQFVVFDAIGAVVWAT
LNTLIGYIGGNAFADNTVAAFAVAFGTALALAGIIELIRWVRRRARQEGR
VRR
379764398YP_005350795.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MMSALRSVLLLCWRDTGHPQGGGSEAYLQRIGAQLAASGIDVTLRTARYP
GAARREVVDGVRIDRAGGRYSVYVWALLAMAAARLGVGPLRKVRPDVVVD
TQNGLPFLARLVYGRRVVVLVHHCHRQQWPVAGPVLGRLGWFVESTLSPR
VNRRNQYVTVSLPSARDLVTLGVNGAQIAVVRNGLDLAPAQSLSGPRAAA
PRVVVLSRLVPHKQIEDALEAVAALLPRTPGLHLDIVGDGWWRERLVEHA
RRLGICAAVTFHGHVDDVTKHHVLQAAWVHVLPSRKEGWGLAVIEAAQHS
VPTIGYRSSGGLSDSIVDEVTGILVDTHAELVDRLEELLADPVLRDQLGA
KAHTRSGEFSWAQSADAMRGVLDAVHCGRTVHGLVTGRG
379764397YP_005350794.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MRWTRPGYALVLALLVVGPLLAPGYLLLRDAVSTPRSYLSDTALGLTSAP
RATPQDFAVALASHVVDGGIVVKALLVVGLWLAGWGAARLVEVALPPAGA
PGQFVAITLAIWNPYVAERLLQGHWSLLVGYGCLPWVATAMLTLRAGSGS
LFGLAFWIALAGLTPTGLLLAATVALVCVAAPGDGTAGPWPRRWCAAAAL
GVALVAALPWLVASALGASLTAHTAANRLGVEAFAPRAEPGLGTLASLAS
LGGIWNGDAVPASRATLFAVSSAVVLLGIVAAGLPAVARRSVAVPLLVLA
AVSVLVPAALATGPGLHLLGAVVDAVPGFGVLRDGQKWVALAVPGYTVAG
AGAVVTLRRRTPPPADVAAALVCCLALLLALPDLAWGVWGKVSPVHYPHG
WTAVAAAINARPAAVAVLPAGTMRLFFWSGAAPVLDPLPRWVRAEVLSSG
DLVISGSTIAGEGAHAREVQRLLLAGPDPSALAAAGVGWLVVESDSAGDM
GAAARTLGALAPVYRDDAIALYRVGGQSAGVSADRRAATVIAHAAWLALL
VAGGAGAGIGAWRRRASVSPAR
379764396YP_005350793.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MLRFAACGIIGLGAALLIAALLLSTYTTSRITKVPLDLDATLVGDGTGTA
LDSASLSTDHVVVNQNVPLVSQQQISVESPANADVVTLQVGSSLRRTDKQ
KDSGLLLAIVDTVTLNRKTALAVSDDTHTGGSVQKPRAVNDENPPTAMPL
RHDGLSYRFPFHTEKKTYPYFDPIAQKPFDVNYDTEEDVNGLTTYKFTQN
VGYNADGKLVAPVAYPSLLAGNEDAKQTTSASMWGVQGGDPNEQITMTRY
YAAQRTFWVDPVSGTIVKQTVHADHYFARDPLKPELTLADYKVTSNEDTV
ESQVNAARDERDRLALWSRVLPITFTAVGLIALVGGGLLASFSLRSESAL
TDPGLDRGDQDFFGRSGLEEPVPGAEAETEKLPTQRPDLRQESGGDPPGS
AGSPGAPGPSGPDEPTEAGPTESNPPGPHDRE
379764395YP_005350792.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MVVSDDQRVGGVRSFLPAVEGMRACAAMGVVVTHVAFQTGHSSGASGRLF
GRFDLAVAVFFALSGFLLWRGHAGAARDLGPRPRTGHYLRSRVVRIMPAY
LVAVVVILTLLPDADHASPTVWLANLTLTQIYVPLTLTGGLTQMWSLSVE
VSFYLALPVLALLARRLPVRARVPAIAALGALSWAWGWVPGHAAEGVNPL
NWPPAFFSWFAAGMLLAEWVHSGVGFPHRIARHRLVMAVVAAAAYLVAAS
PLAGPEGLVPGKPAQFAVKTAMGALVAFALVAPLVLDRPDTPHRLLGTTA
MVTLGRWSYGLFIWHLAALAMVFPVVGTFPFTGNMPTVLVLTLVFGFAIA
AVSYALVESPCREALRRWEKRERPADSAQAVDAEADAIAP
379764394YP_005350791.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MRTRFDFDLTTASPHGVVELMTDFSPNRPHRWPALSAKAFEVYHVGATEA
DVREGQDFPVST
379764393YP_005350790.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MGRLYLRLAPPPIAVIDIIFGAFLSQAISASAQLGIADELAAGPLTKEEL
AGRIGADPDSVARLMRLLISRGVFRRRRDGRFALNALADTLRTDSPVSTR
GAALLFGSPQHRANWTRLADAVRTGEPNPPKVFGKDFFDYLRDDPEFAEI
FNSAMTSTSSVLEAAVVAAYDFTQFGVIADIGGGHGRLLSSILAAAPDAR
GVLFDLPEAVEGAPPVLTGHGVADRVTVTGGSFFESVPAADAYVMKNVIH
DWPDDKAVAILGTVKAAAPPGATLLLLEMVVPDHDREFLGHYADMEMLVM
AGALERSLTQWTDLLRQGGFRLQRVVQTAGPLCVIEAVPS
379764392YP_005350789.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSEPVPPIGTQISQLAQLAPDEPAVTCDGVTLTRAELDRSTNRLARAYAE
RGVGVGDYVTMVLPNSIEWIQAAVACWKLGAVPQPLSARLPDAELAGLLE
LRPPALLVGRDHVEFPCVPAGFVPDPALPDGALPEAVSPVWKAMGSGGST
GRPKLIESGGDSRIPPLIGYPLGAQEGDTTLVPVPLSHNTGFTTATIALL
MRHHLVLMSRFDPVQFLRLITDHRVTFLTTVPTIMQRTLPVYHADPASYD
LSSLRRFWHLGAPCPPAIKQAWIDLLGPEKVWELYGGTELQALTFISGDQ
WLAHRGSVGVVVAGEMKVLDDDGNPCPPGVVGEIYMRPGPDSAPTYRYVG
ATAKSRDGWDSLGDLGYFDDDGFLYLSDRRVDMFTVGGRNVYPAEIENAL
SAHPDVLSCLVVGVPHGDLGQVPYALVHTADGSTLDSVGVQAFLREHLAA
YKVPPSPDFIELVNTPLRDDAGKARRSAVRDRILQRLQTAEAG
379764391YP_005350788.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MHEHVFIMTTEIAENYPEAWGDEERRVADAIDRLNELKARGVDTIVDLTV
IGLGRYIPRIARVAAATELNIVVATGLYTYNDVPFRFHYEGPGGLLGGPE
IMTEMFVRDIEQGIADTGIKAGILKCATDEPGITPGVERVLRAVAQAHKR
TGVPISTHTHAGLRRGLEQQRIFEEEGVDLTRVVIGHSGDSTDIGYLEEL
ISAGSYLGMDRFGLDVISPFEERVRIVAEMCERGHADRMVLSHDANCYFD
ALPEELVPQMAPNWHYLHIHNDVIPALKERGVTDEQLHTMLVDNPRRIFE
RQGGYE
379764390YP_005350787.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MDAATGTDRWPSLRVDDWTPTRETLHMWTQIVGKVRMVRTPMVNHWWQVT
LYVSPRGLTTGAIPHETGVFDIEFDVIDAVLRIRHSDGRQVSVPLTAKPV
AQFYDETMSALDDLGVATRISASPNEVDPAIRFAEDHQHASYDSDAARLF
WRQLLQAHRVMSQFRASFIGKVSPVHFFWGAMDLACTRFSGRPAPKHPGG
APNCGDWVMVEGYSHELSSCGFWPGGGEEGAFYSYAYPQPDGYADYPIAP
AAAHFSADHGEFVLPYEAVRIAEDPDGDLLQFLQTTYAAAADLGRWDRGA
LEADPDRWQKP
379764389YP_005350786.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSTTPIADYALLSDRHTAALVSRGGSVDRLCMPRFDSPSVFRAPARR
379764388YP_005350785.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MLLNPNHLQRQYPDRRSAEIMAATVDFFESRGKARLKSDDHERVWYSEFL
DHIGRERIFASLLTPSAYGAPDCRWDTYRISAFAEIVGFYGLNYWYPFQV
TALGLGPIWMSANSDAKRKAAGLLEAGEVFAFGLSEQTHGADVYQTDMNL
TPSGGGWVANGEKYYIGNANVARMVSTFGKFAGASKNDAEYVFFAADSQH
ERYQLIKNVVNSQNYVANYALRDYPVTEADILHRGPEAFHAALNTVNVCK
YNLGWGAVGMCTHAMYEAVTHASNRILYGTVVTDFTHVRRLLTDAYARLV
AMRLVATRACDYMRSASTDDRRYLLYSPLTKAKITSEGERVITALWDVIA
AKGVEKDTIFEAMAREIGLLPRLEGTVHINIGLLGKFMPNFLFAPNDALP
SIGRRDDAADDTFLFAQGPTGGLGKVRFHDWRAPFESFGHLPNVALLRSQ
VDVLAEMLASATPDAAQQKDIDFAFAVGQLFATVPYAQLILEEAGLSGVD
EGLLDEIFAVLVRDFNAYAVELSDKPATTDAQARYAMRMIRRPVHDPSRY
AQIWKEHVLPLSGAYQMRP
379764387YP_005350784.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MPTVTWARVDPARRAAIIEAAEAEFGAHGFSRGSLNVIARRAGVAKGSLF
QYFADKRDLYAFIADIASQRVRAYMEGRIRELDPSRPFFEFLTDWLDTWV
AYFADHPHERALHAAATLEVDTEARVSVQNVIHRHYLEVMRPLVRDAHVR
GDLRAESDTDALLSLLLLIFPHLALAPYMRGLDPILGLDEPTPEQPALAV
RRLVGVLAAAFSADSSVNSAPQRSEEVS
379764386YP_005350783.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MNRTRIASMAEGGLNWDSLPLKLFAGGNAKFWNPADIDFSRDREDWERLT
EDERSYATRLCAEFIAGEESVTQDIQPFMAAMRAEGRLGDEMYLTQFAFE
EAKHVQVFRMWLDAVGITEDLHYFLDDVPTYRTIFYEELPACLNALTLDR
SPAAQVRASVTYNHMVEGMLALTGYFGWHKICVERGILPGMQELVRRIGD
DERRHMAWGTFTCRRHVAADDANWGVFETRMNELMPLGLRLIEEGFALYD
PMPFGLSVDEFMQYASDKGMRRFGTISSARGRPLGEIDLDYSPLQLEDTF
ADEDEKALAGASA
379764385YP_005350782.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MKEGQVPIATINPATGETVKTFTPATDQEVDAAIARAYERFLDYRHNTTF
AQRAGWANATADLLEAEADDVAAMMTLEMGKTLKSAKAEVLKCAKGFRYY
AEHAEQLLADEPADAKAVGAKKAYIRYQPLGVVLAVMPWNFPLWQAVRFA
APALMAGNVGILKHASNVPQSALYLSDVITRGGFPEGCFQTLLVSSGAVE
RILRDPRVAAATLTGSEPAGQSVAAIAGDEIKPTVLELGGSDPFIVMPSA
DLDEAAKTAVTARVQNNGQSCIAAKRFIVHTDIYDAFVDKFTERMQALTV
GDPTDPDTDVGPLATESGRDEIAKQVDDAAAAGATIRLGGKPIDGPGWFY
PPTVVTDITKDMALYTEEVFGPVASMYRAADIDEAIEIANATTFGLGSNA
WTNDEAEQQRFIDDIEAGQVFINGMTVSYPELGFGGVKRSGYGRELAGLG
IRAFVNAKTVWVGESESGSSSGDDKVE
379764384YP_005350781.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSRAAELIVKCLENEGVSVVFGVPGEENIRFVQALAASPIRYVLTRHEQA
ASFMAEMYGRVTGRAAVVSATLGPGAINMQLGVADATTNSTPLVAISAQV
GHDREFKESHQYVDLVSMFAPITRWAAGIPTPRAIPEMVRKAFKLAESER
PAAVYLAVPEHIDADEKDYDLGPLPRNVVRPDAPAPRQVERAVAILRNAK
RPVVLAGHGAARADATKALVRFSDEFGIQVANTFHGKGVMPDDHRNSIGT
LGFMRHDYVNFGFDNADVVIAVGYELQEFDPVRINPQADKKIIHIHRFPA
EVDAHYSVDVGIIGDISDSLNALTDALSGHSFSHAADVPGSGLLAEEFAR
GQQDSRYPLAPARVVADTRAALGRSDVVLVDTGATKMWMARLYPTYEKNT
CLISNGLSTMSFALPGALGVKLAQPESKVLAVVGDGAFLMNSQEIETAVR
ERIPLVVLIWEDGGYGLIEWKMDLELGAHYYVKFNNPDVVTYAESFGAKG
YRITHADELLPTLRAALDDEGVSLISCPVDYSENLRLTDRLGELDETL
379764383YP_005350780.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTERDRDESGRPRSARPRDALGRPLPPGSEGVPRIPDDLALAPVETLAYA
QDLLDRGLAFNAHEVLEAAWKNGPADEQALWQGLTQLAVGITHAQRGNVK
GATTLLSRARAHLAQQDRPAPHAVDAAGLVDFADALIDALAAGADITASR
LRPRLTA
379764382YP_005350779.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MKDNFFWPGFILLGVALCGIIASLAVAAYQHYEWLSTVAIIALLATVAAT
LWFVVELRRVTLLENQQDG
379764381YP_005350778.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MKHFVLRTAARSATWTIGLALAARTVPHVVLTASGLIVAVVFFSVTQTTL
SVKILKLPHGYASLLLGCTGLTLTIGAMSLASVSTHGLSIYGGASWLAAT
VMVWLVTTIGAILLFDVYVPRDIGFPKVAESLRN
379764380YP_005350777.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MDQLQRDAAGIGALADPVRYELYQFVCSQPGPVSRDQAAEVVGIARHQAK
FHLDRLTAEGLLECDYARLTGRTGPGAGRTSKLYRRVRRDIAVSLPQRQY
ELAGRLMGRAIVQSQQSGAPVVEVLHRNAHDYGRSIAESALSAARRRPAD
ARAALKLVASLLREYGYEPGHDDDGVYLVNCPFHALAQEQTELACGMNHA
LINGMVDAMTPRCLDARLQPTPGRCCVVVAASAD
379764379YP_005350776.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSDDGEIWTIGHWTCPVPTFLEPLDQARIDLLVDVRAQPGSRRNPQFRSA
EMARWLGDAGIGYLHLPALGGRRGRQSVDPTINAGWQNASFKNYADYTLT
DEYQRGLAELITLARSHRVAIMCGEPVPWRCHRQLIANSLVAQGWTVWHL
ISGSAPREHRLGQWGATPVVDERGRVTYPADAGGA
379764378YP_005350775.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAKQFEVGDHVRWNSEAGHVSGIVVKKHTRDTEYKGHKRHCTKDDPQYEI
RSDKTDHIAMHKGDALEKID
379764377YP_005350774.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MLFRQLEYFVALAQERHFARAARACYVSQPALSEAIRKLESELNVPLVRR
GQRFEGLTPEGERLVPWARRILADRDSLKREVTALQAGLTGELRLGVVPA
ASTTVALLTDPFCAAHPLVRVRLEVNLRSAGIVERVRKFELDAGILYPDQ
QDTADLLVTPLYHEQPVLIAAAELLGGESDTIAWSDAVQLPLCLLTQGMR
GRRVIDDALATHGLEVTPQLETDSVAALFAHVRTGRWASIVPQPWIHTLG
IPAGASVLRLRRPSVTALIALVTNRAEPGSLLARALRRTAREARIGATLS
ERS
379764376YP_005350773.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAKCVMVLYPDPVDGYPPAYARDSIPTIHGYPDGSTVPTPSTIDFTPGEL
LGCVSGALGLRKFFEDAGHELVVTSDKDGPDSEFERALPDAEIVISQPFW
PAYLTKERIAKAPKLKLALTAGIGSDHVDLDAAKERGITVAEVTYSNSIS
VAEHAVMQILALVRNFVPSHRWAVEGGWNIADCVERAYDLEGMDVGVIAA
GRIGRAVLRRLAPFDVNLHYTDTRRLAPEVEKELNVTFHPTVQELVRAVD
VVSIHSPLYADTRAMFDEKLISTMRRGSYIVNTARAEETVPEAIADALRS
GQLGGYAGDVWYPQPPPVAHPWRTMPNNAMTPHVSGTTLSAQARYAAGTR
EILESWLAGTPIRPEYLIVEGGRLAGTGALSYQK
379764375YP_005350772.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTRLLALLTVSLGITLAAPAHATPGEDEAPADDNNGSFLSDLHTVGISFK
DPGQAVAAGKSVCGMITRGVSGLQLLTDIRDNNPALTTHGAAQFATISAK
AYCPGQLEESKGKGGG
379764374YP_005350771.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MVFTDFAALPPEVISIQLYAGPGAAPMLSAAAAWQALAAELHSTASSYGA
AISELIGEDWQGPSSDSMASAAAPYVNWISTTAGLAEQTAAQAQAAAAAY
EAALASVVPPALIAANRTQLAALQATNLLGQNGAAIAATEAEYAQMWSQD
VTAMFGYAAASQSAGELAPFEQAPAVSKDTGSAAQASTTAAAASSSSSSW
TQQLQDYINSLTTGYTQSWQKLIEGMTGSKEVAPLWEALFSSVKGVGGQA
TWTNVVGASGGLGVSEWKGAFVYAPWSAGLPKASLGAGLASPGGLGAGVP
VRPVSAVLGTAPTVGKLSVPSSWATAAPAIRLASTALPATSAAAAAAAGF
PAELVNDATLGSLAGGALGGPAARVINTTTGIQTRAIAGQRRTQPVKLDR
IIAQLQEMPDQVQHWNVDESGLDDLVAQLRTTPGVHAVHVNDEPTPAAAH
PESQLG
379764373YP_005350770.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MLLKTNLIGKDERGVRGVRGRRRRKQMEFGALPPEINSGRIYSGPGPAPL
LAAAAAWDGLASELRATAASYGSVVAELRTAWNGPSSTSMAAAAAPYVAW
LIGSAAQAEQSASQAKAAAGAYEAVFAATVPPPVIAANRALLATLVATNI
LGQNTPAIAATEAQYAEMWAQDAAAMYGYAGSSAAATQLAPFTTPPTTTD
GSAETNQTTAVAAATQSSASSNVETAVSQALSQAPAAAQTAATTSPGISL
GLGEATGGLKSFNSFLSTLTGPYSPLGVADAGKGFYQLALNTKAMGGNVQ
SVDPTLHPKGLHGVLAPLLHSDLLTGATSFQAPSAGTVSAAVGRAGVVGS
LSVPANWASAAPAIRTLAAELPETMLDAAPAMTMNPGQGLFGPTALSSLA
GRAVGGSATRAVAGPAVRVPGAVAVDDIATTSTVIVIPPNPK
379764372YP_005350769.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSTRRHTALLLAAIALLLPACVSRQQAAGPGAVPDRVPLSQLADLTLKVG
DQKSVGTEAMLRAAGELQNLPYRIEFSTFTSGPPMVEAAAAGKIDFAITG
DTPPIFGAVANARIKVVSAFDGGGPGDQILVHADSPIHSVTDLRGKTIAL
AKGSSAHANVLDQLDKAGLKPDDVHLVFLQPADALSGFRNGQVDAWAVWD
PYTAQAEQQLPVRGLVTRKYKYSFGIASDQTLADAKRNTALADLLARYTR
AAVWAREHPQEWAAQYAGSAGIDPAVAAVAQGRTLRQPIPLDDTVIDAEQ
RLTDLLAAAGQIKSAPRFGNWVDRRFAATAAETH
379764371YP_005350768.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSAMTWFSAPEYWVGRLVLERGAAAIYLLAFVAAAAQFRALIGEHGMLPI
PRFVAAQSFWRTPSIFHLRYSDRLFAAVAWFGAALSAAVAAGAADAAPLW
AAMAMWLVLWVLYLSIVNVGQTWYSFGWESLLLETGFLMIFLGNEDVAPP
VLTLWMVRLLLFRVEFGAGLIKMRGDPCWRDLTCLYYHHETQPMPGPLSW
FFHHLPKPLHRVEVAGNHFAQLIVPFGLFAPQPVASVAAAIIVITQLWLV
ASGNFAWLNWVTILLACSAIDDASVASLLPGGLVPAHDGPAAPAWFAVLV
AAVSAAVLFMSYWPIRNMLSSRQRMNMSFNSFHLVNTYGAFGSIGRIRRE
VVIEGTDDDQLSDQTVWREYEFKGKPGGPRRLPRQWAPYHLRLDWLMWFA
AISPGYAQPWLRPFLQRLLRNDRPTLRLLRHNPFPDAPPRFVRAQLYQYR
FTTPAELRRDRAWWHRALVGGYAPPMTLSTPTTTN
379764370YP_005350767.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSRRWLWLVGAIALALTFAQSPGRISPDTKLDLTANPLRFLARATNLWNS
ELPFGQAQNQAYGYLFPHGTFFLIGHALGVPGWITQRLWWALLLTAGFWG
LMRVAEALRIGSPASRVIAAAAFALSPRVLTTLGSISSETLPMMLAPWVL
LPTILALRASTDRSVRALAARAGLAVALMGAVNAIATLAGCLPAVIWWAC
HRPNRRWWRYTGWWLLALLLATLWWVVALVMLRAISPPFLDFIESSGVTT
QWSSLTEMLRGTDSWTPYVAPNATAGAPLVTGSAAILGTCLVAAAGLAGL
ASAAMPARGRLVTMLLVGAVLMAVGYSGGLGSPVAHAVQAFLDAGGAPLR
NVHKLGSVIGIPVALGIAHLLGRIPLPGAAPTPVWLRAFAHPERDRRVAA
AMVVLTALMVSTSLAWTGRLAPPGTFTAIPPYWHEAADWLTEHNTGAPTP
GRVLVVPGAPFATQVWGTSHDEPLQVLGSSPWGVRDSIPLTPPQTIRALD
SVQRLFAAGRPSAGLADTLARQGISYLAVRNDLDPDTSRSARPILVHRAV
DGSPGLRKVAQFGAPVGPGTLAGFVADSGLRPRYPAVEIYRVTGGGDVSD
PAAPYLVDADRLARVDGGPEALLRLDERRRLLGQPPLGPALLTADAGAAG
LPLPPGGGVTVTDTPVTRETDYGRVDQHSSAIRAPGDARHTYNRVPDYPV
PGAEPVAGAWTGGRITVSSSSSDSTAMPDVAPATSPAAAIDGDSATAWVS
NSLQAAVGQWMRIDFDHPVTNAAITLTPSATAVGAQVRRILIETATGSTT
LRFDEPGKPLAAALPYGETPWVRITAAGTDDGSAGVQFGITDLTITQYDA
SGFAHQVDLRHTVRVPGPPPGAPIAGWDLGSELLGRPGCAPAPDTVRCAP
SMALTPEEPVNFSRTLTVPAPVSVTPTVWVRPRQGPKLAALIAEPDATVA
QGDSDAVDVLGSAYAGTDGDPATAWTAPQRVVQHKTPPTLTLRLPRPTEV
TGLRLVPSRAALPVRPTMVAVNLGDGPQVAAVKADSGGAQTLALKPRVTD
TVTLSLLDWDDVIDRNALGFDQLKPPGLAEVAALGADGNAIAPADAARNR
GREIFLGCDRGPVIAVAGRFVHTAIHTTVGAILDDQPLAAVPCDRDPIAL
PAGDQELLISPGAQFVVDGAQLSTSRAPESARAERLSSWRAWGPARREVQ
APPSATPRVMVIPESINPGWVARTGSGARLTPIAVNGWQQGWVVPAGDPG
TITLTFASNPLYRAGLVVGLALLPLLALLAFWRTRTRDAGAPTQPWRPGA
WAAVPALAAGALIAGAGGVVVMGAALGLRYALRARRWERLALVGSAGGLI
VAGAALSRQPWRSADGYAGHSANVQLLALVSLAVLTASVIVMPDRERRSG
DE
379764369YP_005350766.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MNRIVAPAAASVVVGLLLGAAAIFGITLMVQQDTKPPLPGGDPQSSVLNR
VEYGNRS
379764368YP_005350765.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSGFTVAAAASIAAGLAVGIATTVGITLAVADDTAVRVQAPARPALPYQV
QYGDRCFHGHCLHW
379764367YP_005350764.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAFSRTFAVLAAASALVAGCGHHPAPPAHSSTSSKPAAAPAPPVCADPAA
VPAALGIRDKLAQLLMVGVKNADDARAVVNGYHVGGIFIGSWTDLTIFQG
PLADISAKAGPLPLAVSVDEEGGRVSRLKTLIGTSPPARELAQTQTVQQV
HDLAADRGHKMRDLGITVDFAPVVDVSDEDDDAVIGNRSFGADPQTVTDY
AGAYAQGLRDAGLLPVLKHFPGHGHGSGDSHTGGVVTPPLADLQTSDLVP
YRSLVAAAPVAVMVGHLQVPGLTGDVPASLSPEAVQLLRNGVGYKGPPFT
GPVFSDDLSSMAAISDRYGVSEAVLRSLLAGVDVALWVTTDEVPAVLDRL
QKAVASGELPTRRVDEALVRVAKMKGPGPTCGH
379764366YP_005350763.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MREQQMLDAAVQMFSVNGYHETSMDAIAAEAQISKPMLYLYYGSKEDLFG
ACLNREMTRFIDVLRADIDFRQSPNDMLRNTIASFMRYIDANRASWIVMY
TQATSSQAFAHMVREGREQIIDLVAGLMRAGSRAPRPDIEHEMMAVALVG
AGEAVANRLSTGDIDVDEAAQLMIDLFWYGLKGSPEEREAARSQSDGSDA
AGD
379764365YP_005350762.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MPVARTDRGNLDFFCAVVIVGLLAGVAGLATTLVLRAVQHATYHYSFGTL
LAGVAASSPIRRVVGPMIGAALAALGWWLLRRRTDVPPLAETIARRERVP
RLSWSIDAMLQVVLVGSGASLGREGAPRQFAAVLSDLGTGWLKRLSGRDR
EILLACAAGAGLGAVYAVPLAGALFSTRILLGTWHPRAVGAAFLSSGLAV
AIGSAITRDQPNLQWPIEESTYLLTAHGLLLAPVAFAAGWAFNRLMAAAR
PPRPVRSWVLIPALAGAGLVMGVCSHWWPELPGNGRSILTVSLASGMTLV
SALAILALKPLLTALFLRAGGTGGLLTPSLATGAAAGAALVLAINWASGT
HLHVPAVSLAGAAGVLAVTQGSPIWAAIFVWELARPPLWLFALFLLTATA
AHALKVLACGRGSTHAG
379764364YP_005350761.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MNQPSGLKNLLRAAAGALPVVSRGGGLPTRTVTIEELPIDRTNVAEYAAV
TGLRYGNCVPLTYPFALTFPALMSLVTGFDFPFAAMGSVHTENHITQYRP
IAVTDTVGVHVHAENLREHRKGLLVDLVTDVSVGNDTAWHQVTTFLHQQR
TSLSDEPKPPPQKQPKLPPPPTVLRISPGLIRRYAVVGGDHNPIHTNPIA
AKLFGFPTVIAHGMFSAAAVLANIEAAIPDAARYSVRFGKPLVLPATAGL
YIDENDDGWDLSLRNIAKGYPHLTGTVRPL
379764363YP_005350760.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAPKVSSDLFSQIVNSGPGSFLAKQLGVPQPETLRRYRAGDPPLAGALLI
GGQGRVVEPLRAALDADYDLVGNNLGGRWADKFGGLVFDATGITTPEGLK
GLYEFFTPLLRNLGHSARVAVVGTTPDGAANPHERIAQRALEGFTRSLGK
ELRNGSTVALVYLSPDAKPAATGLESTMRFILSAKSAYVDGQVFYVGEAD
STPPGDWERPLDGKVAIVTGAARGIGATIAEVFARDGARVVAIDVESAAE
ALAETASRVGGTALWLDVTAPDAVDKITEHLREHHGGHADVLVNNAGITR
DKLLANMDDARWDAVLAVNLLAPLRLTEGLVGNGSIGEGGRVIGLSSMAG
IAGNRGQTNYATTKAGMIGLTQALAPELYDKGITINAVAPGFIETQMTAA
IPLATREVGRRMNSLLQGGQPVDVAEAIAYFASPASNAVTGNVIRVCGQA
MLGA
379764362YP_005350759.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAPASSEASTPAAQRSSERRRVAILGGNRIPFARSDGAYAEASNQDMFTA
ALGGLVDRFGLAGERLGVVVGGAVLKHSRDFNLTRECVLGSQLASYTPAF
DLQQACGTGLQAAIAAADGIAAGRYEVAAAGGVDTTSDAPIGLGDNLRRT
LLKLRRAKSNVQRLKLVGTLPATLGVEIPVNSEPRTGLSMGEHQAITAKQ
MGISRVAQDELAAASHRNMAAAYDRGFFDDLVTPFLGLYRDDNLRADSSA
EKLAKLRPVFGVKAGDATMTAGNSTPLTDGASVALLGTDEWAEAHSLTPL
AYLVDSETAAVDYVNGRDGLLMAPTYAVPRLLARNGLSLQDFDFYEIHEA
FASVVLCHLQAWESEEYCKGRLGLDAALGSIDRSKLNVNGSSLAAGHPFA
ATGGRILAQAAKQLAQRKAEQKGAGKPVRALVSICAAGGQGVAAILEA
379764361YP_005350758.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSHYKSNVRDQAFNLFEVLGVDKALGQGEYSDLDVDTANEMLNEMSRLAE
GPIADSFVEGDRNPPVFDPKTHSVTLPESFKKSVHAVIEAGWDKVGIDEA
LGGVAMPKSLLWALHEHILGANPAVWMYAGGAGFANILYHLGTEEQKKWA
VLAAERGWGSTMVLTEPDAGSDVGAGRTKAVKQDDGSWHIDGVKRFITSA
DSGDLFENIFHLVLARPEGAGPGTKGLSLFFVPKFLFDFETGELGERNGV
FVTNVEHKMGLKVSATCELSFGQHDVPAKGWLVGEVHNGIAQMFDVIEQA
RMMVGTKAIATLSTGYLNALEYAKSRVQGADMTQMTDKTAPRVTITHHPD
VRRSLMTQKAYAEGLRALYLFTSTYQDASVAEALHGVDAELAVKVNDLML
PVVKGVGSEQAYAKLTESLQTFGGSGFLQDYPIEQYIRDAKIDSLYEGTT
AIQAQDFFFRKIVRDKGVALAHVSEQIQKFVDSESGNGRLKTEREYLAKA
LTDVQAMATSLTGYLMAAQEDVTSLYKVGLGSVRFLMSVGDLVIGWLLQR
QAAVAVAALDAGASGDDKAFYEGKVAVASFFAKNFLPMLTSTREVIETLD
NDIMELDEAAF
379764360YP_005350757.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MPVVDLRADPARLRDGLREAAHRVGFFYLTGHGVAPELVTRMLEAARRLF
ALPQHDKDSVAMVRSPHFRGYTRLGGEVTRGEVDWREQIDIGPQRPPIGG
LGKSDYRWLQGPNQWPAALPELPGLVEEWDAALSAVARTLLRHWAASLGS
PADVFDPAFAETPATLIKIIRYPGRAAGSQGVGAHRDAGVLTLLLAEPGS
RGLQVRRAFDDAWIDVPPREGAFIVNIGELLEAATRGYLRATEHRVNLQG
PATDRISVPYFFNPRLDARIPVLALPRELAAGTGTDWAASQDPADPIFSV
YGRNAWKSRLRSHPDVASAHGYSAERLENE
379764359YP_005350756.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MNSNNKLTASSLREAFGHFPSGVVAIAAEVNGTREGLAASTFVPVSLDPP
LVSFCVQNTSTTWPKLKDLPMLGISVLGEAHDEAARTLAAKTGDRFAGLE
TVSRPTGAVFIKGTGLWLESAIEQLVPAGDHTIVVLRVSEVTVDADVAPI
VFHRSNFRRLGA
379764358YP_005350755.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MEPRRETASINNIRTAIRQLSVRAQLAQKEGRHNDAAELESRIQGFREEL
SHRP
379764357YP_005350754.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTYNATMRVWRGDDANGALQDFTVEVNEGEVVLDIIHRLQQTQTPDLAVR
WNCKAGKCGSCSAEINGYPRLLCMTRMSTFAEDEVVTVTPLRTFPVIRDL
VTDVSFNYEKAREIPSFAPPKDLQPGEYRMAQEDVQRSQEFRKCIECFLC
QNVCHVVRDHEENKKAFAGPRFLMRIAELEMHPLDTRDRRKDAQEEHGLG
YCNITKCCTEVCPENIKITDNALIPMKERVADRKYDPVVWLGNKLFRR
379764356YP_005350753.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MGNTNPKDNWKTHFGDTMRGGKFLNNWRMAELHAKEAPDRVWELETYGAL
FDRLKDGKISQRNFGGHTYPRLAHVGDRTGLELIRTMQQKIVSLQQEDYA
ELGDYEARIRVFAETTITELIKDGDAIAGAFGYIRESGNFILFEAPAVVL
ATGGIGKSFKVTSNSWEYTGDGHALALRAGASLINMEFVQFHPTGMVWPP
SVKGILVTEGVRGDGGVLKNSDDKRFMFDYIPPVFKGQYAETEQEADQWL
KDNDSARRTPDLLPRDEVARAINSEVKAGRGSPHGGVFLDIASRLTPAEI
NRRLPSMYHQFKELAGVDITKEPMEVGPTCHYVMGGVEVDADTGAATVPG
LFAAGECSGGMHGSNRLGGNSLSDLLVFGRRAGLGAADYVRALSSRPTVG
DGAVEAAAKRALSPFEAPAGGGPGENPYTLQLELQQSMNDLVGIIRNADE
ISEALARLDKLRERFKNLHVEGQRRYNPGWNLAIDLRNMLLVSECVAKAA
LQRTESRGGHTRDDHPSMDSSWRKLLLVCEAVAEPGDVEGAVIPDITITK
KEQTPMRPDLLELFDIAELEKYYTDEELAGHPGRTPRTEK
379764355YP_005350752.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MCLAEQGLAHHRDPQAAFARLDDRAQSRAAGADDDYVVGMPLDINHENPR
379764354YP_005350751.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSPLRIDLGFAAFVIYATARAFQQNYFFVPKYHYLTPFYSPCVSKGCGEA
GDIWPQFLPDVWWLPYAAVSLPFLLLFRLTCYYYRGAYYRTVWQSPTACA
VAEPRVHYSGETKFPLIIQNTHRYFFYIACLISIVNSYDAIVAFHSDSGP
GGFGFGLGNLILLGNVIMLWVYTLSCHSCRHVTGGRLKHFSKNPVRYWIW
TQVSAMNTRHKQFAWITLGTLMLTDFYIALVASGAISDLRFVG
379764353YP_005350750.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTSTTGTTEFAELHDLIGGLRRCVSSLRSRYGDSPAMRRIVIDADRILSD
VDLLDTDVSELDLAGATVQQSGEKIVIPDTQYDSEFWRDVDDEGVGGHNR
A
379764352YP_005350749.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTGPNTPAERAATLLKLHRPGNPVILPTVWDAWSARLAVGAGFAALTVGS
HPMADSIGKSDNEGMSFDDVLTRVAQITAAVSETEGVPVSVDIESGYGLP
ADRLIEGLLSVGAVGLNIEDTVHSEGGRLRSAEEHAELVGALRSAADAVG
VHVVINARTDLFLRQDGEESDRVDRAVARLNQAAAAGADVLYPVGRHHPD
TLRRLTAELVLPVNAIALPDQDDPAAFGPLGVARISFGPFLQAALTGRAN
ELLARWG
379764351YP_005350748.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSNLALWSRPAWDTDRWLRDFFGPAAAADWNNPLSSGWRPAAEIVKDGDD
AVVRVELPGVDVDRDVNVEVDRGRLVIHGEHRDEHAEEKDGRTLREIRYG
SFRRSFQLPAHVTGDAITASYDAGVLTVRVSGAYAGNQAQRIAITK
379764350YP_005350747.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MVGHRFVEALRARDTEGRWRITVFAEETDAAYDRVGLTSYTESWDRKLLA
LPGNEYAGDDRVRLVLNQRVTEIDRATKSVLTADGRRHDYDTLVLATGSY
AFVPPVPGHDLPACHVYRTLDDLDAIRADAQRAAQSSHATAGVVIGGGLL
GLEAANALRQFGLRTHVIEMMPRLMAQQIDEAGGALLARMVGDLGISVHV
GTGTESIESVDHPDGSTSVRVRLTGGQVVDARLVIFAAGIRPRDELAVAA
GLTRAERGGVLTDVSCRTSDPDIYAIGEVAAIGGRCYGLVGPGYTSAEVV
ADRLLDGVAEFGEADLSTKLKLLGVDVASFGDAMGVTENCLEVAVNDAVN
RTYAKLVLSDDAKTLLGGVLVGDASSYGVLRPMVGSELPGDPLALIAPAQ
SGGGEALGIGALPDSAQICSCNNVTKGDLKCAIADGCADVPSLKSCTSAG
TSCGSCVPLLKQLLEAEGVEQSKALCEHFSQSRAELFEIISATELRTFSG
LLERFGRGKGCDICKPVVASILASTGSDHILEGEQASLQDSNDHFLANIQ
KNGSYSVVPRVPGGDIKPEHLILIGQIAQDFGLYTKITGGQRIDLFGARV
DQLPEIWKRLVDGGMESGHAYGKALRTVKSCVGTDWCRYGQQDSVQLAID
LELRYRGLRAPHKIKMGVSGCARECAEARSKDVGVIATEKGWNLYVGGNG
GMTPKHAQLLVSDLDTETLVRYVDRFVMYYIRTADRLQRTAPWVESLDGG
LDHVREVVCEDSLGLAAEFEAAMERHVRNYKCEWKGVLDDPDKLSRFVSF
VNAPDAVDSTVTFTEHAGRKIPVSIGMPTVREHNSEGTRKVS
379764349YP_005350746.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTLLNDIAVWTSACAYDHLIPGRGVGVLLDDGSQAALFRLDDGSVHAVGN
VDPFSGAAVLSRGIVGDRGGRVTVQSPILKQAFSLEDGSCLDDPSVSVPV
YPVRITADGFVQIARDAEARAA
379764348YP_005350745.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MPRREEPSRGILDPVAKALRLPFGTPEFIDRLVTGGVNQIGRRTLTMLIT
TWDAAGGGPFAASAVASTGMAKTAEIVQSNFVGPVFGPLLKILGADKAAT
RASLCASQLVGLGIMRYGIRSEPLHSMSVDALVDAIGPTMQRYLVGDITR
379764347YP_005350744.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MALILVAHGTRRPGGVAMVEDLAAQVSTLVRSPVDVAFVDVVGPTPSEVL
ATAMAAGRPAIVVPAFLSRGYHVRADLPAHIAISGHPNVTVTPALGPSGQ
VARIVGDQLLKCGWRPGDSVILAAAGTSDDKARADLHTTATLLSALTGSR
VSLAFAATGDPQLHESVDRARRRGGRVVVASYLLADGLFQQRLHDCGADL
VSQPLGTHPGLARLIANRFRRALPPALAATARHASRRSAPQQVTHTRALR
PIP
379764346YP_005350743.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAPQLAPPDSAPLTGYRIAVTSANRAEELCALLRRNGAEVSSAAAIDLIA
LPEDEELQRHTEAVIAEPPDILVAHTGIGFRGWVAAADGWGLATQLLASL
SRARIVARGPKATGALRAAGLHEEWSPRSESSSEVLRYLLESDVAGKRVA
VQLHGAADTWDPFPEFLNGLRSAGAQVVPIHVYRWKPTPAGGEFDQLVTS
VARRQFDAVTFTSAPAGAALLERSRELGVEEQLLQALRSDVHAMCVGPVT
AQPLLRAGVPTSSPERMRLGALARHIAQELPTLRSTTIRAAGHEMEIRGT
CVLVDGSPRSLSGSGMATLRALAERPGDVVARNDLLRVLPGNSNDPHAVD
TAVLRLRTALGDKNIIATVVKRGYRLAIDHPDESPWH
379764345YP_005350742.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MISPRRSHRIADWNPEDAAAWEAGNKKIARRNLLGTIAGDHVAFSIWTLW
PVMALFMPGAVYGFSAGDKLLLGAVATLVGGCARIPYTLGIAAFGGRNWT
TFSAFVLVIPTAGTIALLANPGLPLWLFVLCAALTGLGGGNYAASLANVN
AFYPQRLKGAAMAVNAGVANLGVAVIQLIGLLVLATAGHQAPYWVCAIYL
VLLVAVGIAAALVMDNVHHGTQLRTMRSILFERDTHVISLLYIATFGSWI
GFSFAFGQVLQVHFLESGETAKHAALHAAQVAFVGPLLGSVARIYGGRLA
DRIGGSRVTLGVLAGMTLAAALLVTISALEDQHAVTRSVSMIGCVAGFMV
LFVLSGMGNGSVFKLIPTVYEARSRGLAMSEDDRRRWARAQSGSLIGICS
AVGAFGGVAINLALRQSYLSTGTETAAYWAFLASYVGAAIMTWMVYVRRP
VSAPGRSGARAEAEAARV
379764344YP_005350741.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAAARRNHLGALAYGRCACVHTDPSLWKQFGVWPATRVGVPHEGACPAVG
FRCSHLGRERVNRNRPIWAVS
379764343YP_005350740.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAVLEILRTGPFAVVEDLGRPGLAHLGVSRSGAADRRAHKLANRLVANPD
DRATVEVTFGGFATRVRGSDVDIAVTGADTDPTVDGIEFGTNSIQHVRDG
QVISLGAPRAGLRSYLAVRGGICVEPVLGSRSYDVMSAIGPSPLRAGDRL
PIGEHTADYPELDQAPVAAITGGVVELSVVPGPRDDWFLDPDALVRTAWV
ASDRSDRVGMRLVGRPLQCLHPDRQLPSEGATRGAIQVPPNGLPVILGPD
HPVTGGYPVVGVVIDEDVDKVAQVRPGQSVRLHWARPRTPIGAVAGAGVA
SWPFG
379764342YP_005350739.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSVTDLSGDLAHELPTELAGNTVLDYGDRALMVQCGSAAEVLAWTAALRS
EPIAGVVDVVPAARTVLVKLDGPRRQGVVRRRLHAMRVTATPPAPSERGA
DVVIDVVYDGPDLAEVAGHTGLTIPQVIDAHTATLWRVGFSGFAPGFAYL
VDGDPRLRVPRRPEPRTAVPAGSVALAGEFSAIYPRQSPGGWQLIGHTDA
VLWDLQRPDPALLMQGMWVQFRAV
379764341YP_005350738.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTLTHLFGQTVIKEPPKRVVSAGFTEQDDLLAVGVVPIAVTNWFGDQPFA
VWPWAAPKLGGARPVVLNLDNGIPVDQIAGLKPDLIVAVNAGLDADTYQK
LSAIAPTVAQSGGDAFFEPWKEQAAAVGQAVFQADQMKSLVDGVDQKFTD
VGKRNPQWTGKKALLMHGALWQGTVVATMAGWRTDFLNQMGLVIADTIKP
FGTDQRAVIPRDHIKSVLDSADVVIWTTRNPDDQKALLADPEVAGSLTTA
QNRHIFTTAEQAGAIAFASPLSYPLVADQLPPLLAKILG
379764340YP_005350737.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MRVTDPGVAPGADLFDEHPAESAEDPASAATPEAPASCKNPRRFHPCRIA
379764339YP_005350736.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTTTLSPASQPAPTRERPAGRHWIDDWRPEDPEFWEATGKPIARRNLIFS
IFAEHVGFSVWMLWSIVVVQMTAGAHGLPAASGWALTPSQALCLVAVPSG
VGAFLRLPYTFAVPIFGGRNWTTISAALLLIPCLLLAWAVSHPGIPFAVL
VAVAATAGFGGGNFASSMANISFFYPEKDKGWALGLNAAGGNVGVAVVQK
IIPPVVVAGGGVALARAGLFYVPLAVVAAVCAFGFMNNLSEAKADVKPVW
QSLRHPDTWVMSLLYIGTFGSFIGYSAAFPTLLKTVFGRGDIALTWAFLG
AGIGSVIRPLGGKLADRIGGARITAASFALLALGAAAALWSVRAVNLPAF
FASFMFLFVATGIGNGSTYRMISRIFKIKGELAGGDPDTMVQMRRQAAGA
LGVISAVGAFGGFIVPLAYAWSKSEFGSIEPALRFYIAFFLALLGVTWYC
YLRRHNAITRVGI
379764338YP_005350735.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MNRMTRPVLLEVAGREVTVTHPDKVVFPRADGHKTSGPYTKLDLVRYYLS
VADGALRGVAGRPMILKRFVKGITEEAVFQKRAPAKRPDWVDVAELRYAR
GTSAAEAVIRDAAGLAWAINLGCVDLNPHPVLADDLDHPDELRVDLDPMP
GVSWRRIVDVALVAREVLEDYGLTPWPKTSGSRGFHIYARIARRWEFRQV
RLAAQTVAREVERRVPEAATSRWWKEEREGVFVDFNQNAKDRTVASAYSV
RATPDARVSTPLHWDEVAGCRPEAFTIDTVPARFAEIGDPWEGMDDAVGD
LDRLLVLAEEMGPPERAPKGSGKRDKGTGGRRQSSMPLIEIARTKTKDEA
MAALDAWRGRHPAAAERLQPVDVLVDGMRGPSSIWYRIRINLQHVPEDQR
PPQEELIADYSPWANYSGKQQP
379764337YP_005350734.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MVDSMPNLLGLPGQASKAVAKLHQYVERGSAELHYVRKIFESGAFRIEPP
QNYAAMAADIYKWGEFGMLPALNARRHPDRAACIDEEGEFSYRELDEAAH
AVANALIEKGVKGGDGVAILARNTRWFLIANYGAARVGARIILLNSEFSG
PQIKEVSEREGAKLIIYDDEYTKAVSKASPELGKLRALGTNPDSDEPSGS
TDETLADLIERSSKEPAPKAARHASIIILTSGTTGTPKGANRSTPPTLAP
VGGILSHVPFKAGEVTSLPAPMFHALGYLHGTIAMFLGSTLVLRRKFKPP
LVLQDIEKYKVTAMVVVPVMLSRILEAVEKMDSKPDLSSLKIVFVSGSAL
GADLAERSLKDLGPVIYNMYGSTEIAFATIAEPKHLQYNSSTVGPVVKGV
RVKIYDDNGKELPQGEVGRIFVGNAFPFEGYTGGGKKQIIDGLLSSGDVG
YFDENGLLYISGRDDEMIVSGGENVFPAEVEDLITGHPDVVEATAIGVDD
KEWGHRLRAFVVKKDGADLDEDTVKHYVRDHLARYKVPREVIFLDELPRN
PTGKILKRELREMEIE
379764336YP_005350733.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MNFKPSPNGPSAGSFRAPTPAGGPAGDAAPTERLSLGQPRGQRIASEPSA
NQAGRTQRTRRTVDLAAATHRALDIWQREAADRLGVARVTGQEVLTALID
QLLVDPKLTAQITRAIKERR
379764335YP_005350732.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MPIAINPEHQELADSVRALVARIAPSETLHEAMETEVQNPPPYWQAAAEQ
GLQGVHLAESVGGQGFGVLELAIVLAEFGYGAVPGPFVPSAIASALISAH
DPDAKVLAGLASGAEIAAYGLNCCALTATRQGGSLVIRGELRAVPAAAQA
SLLVLPVAIDSGEAWVVLRADQLEIEPVKSLDPLRPIADVRANAVEVGDD
VVLTNLSMGTAHALMTTLLSAEAIGVARWATDTASSYAKIREQFGRPIGQ
FQAIKHKCAEMIADTERATAAVWDAARAIDEARENRWDTAGSHVEFAAAV
AATLAPAAAQRCAQDCIQVHGGIGFTWEHDTNVYYRRALMLAASFGRSSD
YPQKVVDTATTTGMRAVDIDLDPETEKLRAEIRAEVAALKEIEREQRKVA
IAEGGWVLPYLPKPWGRAAGPVEQIIIAQEFASGRVKRPQTGIATWIVPS
IVAFGTEEQKQRFLPPTFRGEMIWCQLFSEPGAGSDLAGLSTKATRTDGG
WRITGQKIWTTAAQFSQWGALLARTDPSAPKHSGITYFLLDMKSEGVDVK
PLRELTGNAMFNTVYIDDVFVPDECVLGEVNRGWEVSRNTLTAERVSIGS
SEANFLATLSQFVEFVRDGQFDQVAQHRAGQLIAEGHAAKVLNLRSTLLT
LAGGDAMPSAAISKLLSMRTGQGYAEFAVSSFGTDAAIGDTDQLPGKWGE
YLLASRATTIYGGTSEVQLNIIAERLLGLPRDP
379764334YP_005350731.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTRRTGAGVIREFVGLPSPTAGRAGAGGHPCQGLYHRGVGRKPKVAMIAA
HYQIDFSEHYLADYMATRGIGFLGWNTRFRGFESSFLLDHALVDIGVGVR
WLREVQGVDTVVLLGNSGGGSLMAAYQSQAVEPNVTPLEGMRPAAGVTEL
PAADGYVATAAHPGRPEVLTAWMDAAVVDENDPVATDADLDLFNGRNGPP
YTAEFLARYRSAQVARNHAITDWAERELKRVRAAGFSDRPFSVMRTWADP
RMVDPGIEPTNRQPNMCYAGVPAKANRSAHGIVAACTLRNWLGMWSLRVA
QTRAEPHLARIRCPALVINADADTGVFPSDAQRIFDALAGADKTRASVDT
DHYFTTPGARSEQADIVAGWIGKRWR
379764333YP_005350730.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MELPTHRGRRTQAAIDLAARTVIARKGVLATTIADIAAEAGRSAASFYNY
YESKEAMVRQWALRFRDEANQRALAVTQHGLTDRERAYGAAAAHWHTYRN
RLAEVISVSQLAMINDDFAQYWAEICSIPISFIAESVRRAQAEGRCRDDD
PQLIAEAIVAMFNQFCYIQLGSARGEPDDEACIQTLANIYYRAIYATEGD
R
379764332YP_005350729.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MIKPHNTNAEFELGGINHVALVCSDMAKTVDFYSNILGMPLIKSLDLPGG
AGQHFFFDAGNGDCVAFFWFADAPDRVPGISSPGAIPGIGDITSAVSTMN
HLAFHVPAEKFDAYRQRLKDKGVRVGPVLNHDESPMQVSATVHPGVYVRS
FYFQDPDGITLEFACWVKEFESGDATAVPKTAADRRPPVGAGR
379764331YP_005350728.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTDGILTDEQIAALTPGQRRDLISRLERPLGEVIDPDFLDRVRRVRLSLM
IGGSIAMVPWLGYLAMTLPEKYVAHNWPVTWIGFDVLLVAFMLTTAALGY
LRRQLLVLAAFTTGVLLICDAWFDLMTAGPKDVWLSVVTALLIEVPLAIF
MIFSAMRILRLTMMRLWLLRPGMRLWELPLFP
379764330YP_005350727.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MVALGNINEWHPPHGPVTMWMAAPDAREAARAARRSDLAPSYQQNQHLWA
SYQGKAMNRQLPRLMIVAWDIPGTCDIAAMTATINAHVRRQDTYHNWFEY
DNGTFVRRVIDDPEAIEFVPVALGHKTADQVRAHALTTTPDTLEWGCFTY
GIVQHADYFTFYASVDHLHIDGLSAALIFLDVHLTYQELAQTGHQPAGLP
EIRSYRDYVARQREKAATLTLSSPEIKDWIEFARDTDGDWPSFPLPLGDT
WSSTRGDLLTVELMNAEDTESFDAACVAAGARFIGGVLACTGLAEHELTG
KKTYHGFTAKDTRTPGVDSMTVGWFASLIPITVPTAGETFAQAARTAQKS
FDDAQRLADVPVERVLELATPDELGIKLPTQLPMMLSFLDFRKIPLNGLW
AETKFGTYGDSLSHGGVNMWINRQAANTTVTMSFPDNAIARESVLRYIAT
LIQVFARVARPTGDEPIVVVPQVNPDDTFAPAPDTDDHEAA
379764329YP_005350726.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSNVLDLADQTLFLGERATGATSLLQCVWVYDRAVDVGGLREFHSHLGRG
RLSRRVERSALPFGRHRWVAAAECSPLEIVAPPREREDIDAWLDEQTHKR
PDAERGPGWHLAMLPLSDGGAVVSLVTTHCLTDGVGLCEALADAARGRGD
RTRWPAAGGRRRCQALREDARQTAHDALDVGRAVGAAARMLRQGRDGTAA
VAPPRGKRPAPPAAPDDPIVLPMETIFVSADDWDARATALGGTSNALLAG
LAAHLAQRVGRVAPDGSVNIGMPVNERAPGDTRANAVTNVDVTLGSAAIT
TDLREIRAAIKRALVRHHDEPDERWALLPLVPLIPKPVFRRLLSVVTGGA
ATVVSSNLGALDPAANRPDGTDADYFAMKSVYPGVTAATMHRTNGALALL
SGRVHGRVFISVLAYELGRRNSNEGLRQALSKTLSDFSLTATTGWHTVCP
V
379764328YP_005350725.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MVRMSDTSSARPYRGVEAAERLATRRNRLLAAGLDLLGDQRPDISAVTVR
GVCRRAGLAARYFYESFTDKDEFVSCVFDWVVAELAATTQAAVATVPADE
QTRAGIANIVRTITDDARVGRLLFSTQLADPVVVRKRAESSALFAMLSGQ
HVGNALQVPANDRIKAAAHFVVGGVGQTISAWLAGDVRLEPGELVDHLAA
LLDELAEPNLYRLTETRAEA
379764327YP_005350724.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MATHQSVQAPIGHVERGATDPPRPQRRRRGRTLGIDEGLMGVALLAGPAN
VIMQLAQPGVGYGVMESRVESGRVDLHPFKRARTTFTYLAVATNGSEAQK
AAFRRAVNKAHAQVYSTPESPVSYNAFDPALQLWVGACLYKGGLDIYRMF
IGELDGEDAERHYREGMALATTLQVPPKMWPADRAAFDRYWEESLAKVHI
DDAVREYLYPIAANRIRGVKLPGPIQRLSEGFALMITTGFLPQRFRDEMR
LPWDATKQRRFDRLIAVLATVNRYLPRFIRQFPFNVLLHDLDRRIKKGRP
LV
379764326YP_005350723.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTAPIFMASPPEVHSALLSSGPGPGPLLAAAGAWSELSAEYASAAEQLST
LLAGVQAGAWEGPSAESYVAAHAPYLAWLTKSSADSAAAATQHETAAAAY
TAALTAMPTLPELATNHVVHGALVATNFFGVNTVPIAVNEADYARMWTQA
ATTMSTYQAVSTAAVAATPQTDPAPPIVKSDASSDDSGDEDHDPKIDNPF
NDFIANILKNLGINWDPSEGTVNGLPYDAYTNAGQPIFWVVRALELLEDF
EQFGYYLVHNPALAFQYLVQLILFDWPTHILEIFISQPELLAPALLLAAA
PLGAVGGFAGLAGLAAIPQPAALPVVAAPPPPTPSIPPAIAMAPTAPVAP
VAAPASAPAPAPAPTATTVTAAPAAPAAAPAAAGFFPPYVVGPPGMGTGS
GMGASASSSAKRKAPEPDSAAAAAAAAARTRKAARARRRRGATDRGYGDE
FMDMNVDVDPDWAASLASDRGAGTLGFAGTAEREAVAAAAGLTRLAGDEF
NGGPTAPMMPGTWGDDGADEAGRDG
379764325YP_005350722.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MMALVQPCTNDRVASGPARWIGPIADSDSAAALRDWLVLGQWENIPVPRQ
LDRHQRWTRDSHRRN
379764324YP_005350721.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MRAAPDGGAQFVDDRQSIVDGACGTDDYGERAIGAAAWGRQGAVCRPG
379764323YP_005350720.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MARKVARRRATAPAARSPKRNLLDSLGLRTVDYKDTATLRVFISERGKIR
SRQVTGLSVQQQRQVAAAIKNAREMALLPYPGRHTAP
379764322YP_005350719.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAKKSKIVKNERRRAIVARYAERRAELKKIIRSPASTPERRAAAQDELAR
QPRDASAVRVRNRDAVDGRPRGHLRKFGLSRVRVRELAHAGQLPGVRKAS
W
379764321YP_005350718.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MARNEIRLLVKLRSTAGTGYTYITRKNRRNDPDRLVLRKYDPVIRRHVDF
REER
379764320YP_005350717.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MEVQVSAHCQVTGRRPGFGNAVSHSHRRTRRRWSPNIQLKTYYLPSEDRR
IRLRVSAKGIKVIDRDGIEAVVARLRREGQRI
379764319YP_005350716.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MRTPVILVAGQRDTDAVVGAMLQTPGTLVVEHRFDGHVVRRTTASLSDGV
LTSTENGLELAHGCVSCTIRNDLLVLLRRLHRRDDVDRIVVHLAPWLEPE
PICLAIKHVRVRVAPGYIDGPAALDVAIAAVVTCVDSAAWLDQALGEEEL
DDGRTHAQVVIGQAEFADVVVLDRANPFVAAVLRRLSPRARVRVGAGGIE
DALNNLYRDARRGRSDDPHGPLLAGQPPLESRGPISLVEFNARRPFHPQR
LHAALDLLLDGVIRTRGRLWLASNPDRAMWLESAGPGLRVSSAGKWLAAM
SGPERDGVDAERRALAALGWDDRHGDRHTAMAILVCGARTDEVLDALRGA
LLTEEEMRNPRTWIAYDDPFGDWHEDPCAELTEAADNVAGHTQQGKDPS
379764318YP_005350715.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MKPGVHPDYHPVVFQDATTGAMFLTRSTRTSPRTVEWQTARGTRTYPLVV
VDVTADSHPFWTGSRRIVDSAGQVEKFHRRYGRR
379764317YP_005350714.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MGGVRSEGDTWDITTSVGSTALFVATARALEAQKPDPLAVDPYAEIFCRA
VGGAAADVLDGKDPDHQLKTADFGENFVNFQGARTKYFDDYFRRAADAGV
RQVVVLAAGLDSRAYRLDWPAATTIFELDQPQVLDFKREVLAGVGAEPRA
ERREIAIDLREDWPQALRDSGFDPAKPSAWIAEGLLIYLPASAQEQLFTG
IDGLAGHGSHVAVEDGAPMNPEDFETAVAEERAATAQGDQRVFFQLVYNE
QCAPATEWFGNRGWTAVGTPLADYLREVGRPVPGPETEAGPMIARNTLVS
AVRT
379764316YP_005350713.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MEHGDTGMLTVQPANSRVDTRVDGDVVSRFATCCRALGIVVYQRQRPADL
AAARSGFAALTRIAHDQCDAWTGLAAAGDTSLRVLEAVSRTAASAGVLQR
QVDLAPNSLGFRYDTGLYLQFRATTPDDFHLAYAAALATAGRFADADAIV
AGLTTERPNWREARWVSVVINYRAERWSDVVKLLTPIVNDTDLDEAFSHA
AKIALGTALARLGMFAPALSYLEEPEGPVAVAAVDGALAKALVLRAHVDE
DAASEVLQDLYAAHPENEQVEQALTDTSFGIVTTTAARIEARTDPWDPET
EPSAEDFVDPAAHERKAVLLHEAERQLAEFIGLEEVKNQVSRLKSSVAME
LVRKQRGLAVAQRAHHLVFAGPPGTGKTTIARVVAKIYCGLGLLKRENIR
EVHRADLIGQHIGETEAKTNAIIDSALDGVLFLDEAYALVATGAKNDFGL
VAIDTLLARMENDRDRLVVIIAGYRADLDKFLDTNEGLRSRFTRNIDFPS
YAPSELVEIANKMAEQRDSIFEKAALDHMEELFTKLATESTPDANGISRR
NLDIAGNGRFVRNIVERSEEEREFRLDHSEHAGTGEFSDEELMTITDDDV
ARSVEPLLRGLGLSVPA
379764315YP_005350712.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTSNQQPDERRSFSSRTPVNDNPDQVEYRRGFVTRHQVSGWRFVMRRIAS
GIALHDTRMLVDPLRTQSRAVAMGAVLLVTGLAGCFVFSLIRPNGTAGTN
AVLADRSTAALYVRVGEDLHPVLNLTSARLITGRPVDPTMVKSSELDRFP
RGNLIGIPGAPERMVQNPSTDANWTVCDAVSEPGGHAAHSTGVTVIAGRP
DSSGARAATLPPRQAMLADRDGTTWLLWDGKRSQINLTDQAITNALGLGQ
GNSEIPAPRPIALGLFNAIPEAPPLTAPGIPNAGAPAPFTVPAPIGGVVV
SYTLDQSSSGAPRYYAVLPDGLQQISPVLAAILRNTNSYGLDQPPRLGAD
AVAKLPVSRMLDTARYPDQQVGVVDAAKSPVMCAYWSKPAKAASSSVNLL
TGSALPVAESIRTVDLVGGGSPATAARVALAPGTGYFTQTVGGGPNSPGA
GSLFWVSDTGVRYGIDNEAEHSAAGQNKTVEALGLTGSPVPIPWSVLSLF
ASGPTLSRADALLAHDGLTPDQKPGRVTAAAREAEGAPR
379764314YP_005350711.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSRLIFEARRRLAPPVTRKGTIAIEAPPELPRVIPPSFLRRAMPYVLVIL
IVGMIVALFATGMRLISPQTLFFPFVLLLAATAMYRGNDNKTRTEEVDAE
RADYLRYLSVVRDNIRTQAAAQRAAAQWSHPEPAALAAVPGSRRQWERDP
HDPDFLVLRAGRHHVPLATALRVNDTADEIDLEPVSHSALRSLLDTHRTV
RDVPTGIDLAKVSRITVLGSEDEARSAMRAWVAQAVTWHDPTVLGVALVT
PDLESPDWSWLKWLPHIDIPGELDGVGPARLMATNVDELVAKLGSALVDR
PAFTGEPADALRHLLIIVDDPDYDLNASTLAMGRAGVTVVHRGATAPHRE
QYSDPEKPILRITAADGAGARTHSIERWQTGGWQPYIDDADQLGADEAAH
LARQLSRWDSNPTHTGLRSAATRGATFTTMLGIPDASQLDVPTLWAPRRR
EDELRVPIGVTATGEPLMFDLKDEAEGGMGPHGLMIGMTGSGKSQTLMSI
LLSLLTTHSADRLIVIYADFKGEAGADSFRHFPQVVAVISNMAEKKSLAD
RFADTLRGEVARRETLLREAGRRVQGSAFNSVVEYENAIAAGHDLAPIPT
LFVVADEFTLMLADHPEYAELFDYVARKGRSFRIHILFASQTLDVGKIKD
IDKNTSYRIGLKVASPSVSRQIIGVEDAYHIESGKEHKGVGFLVPAPGAT
PIKFRSTYVDGIYDPPQKAKSLVVPSIPEPKVFTAGRVEPDQDTVITSPD
EVELTGPPRKLIATIGDQLAGYGPRAPQLWLPPLDEPIPVSAMLARAGVP
PRQWQWPLGEIDKPFEMRRDPLIFDAASSAGNMVIHGGPKSGKSTALQTF
MLSAASLHSPREVTFYCLDYGGGKLRAMEGLAHVGSVASALEPERIRRTF
GELEQLLLSRQRREAFRDSRGGVPDDGFGEVFLLIDNLYAFGRDNTDQFN
TRNPLLAKVTELVNIGLAYGIHVVVTTPSWLEVPLSMRDGLGLRLELKLH
DPRDSNVRVVGALRRPAEAVPHDQPGRGLTMAAEHFLFATPELDQIAAIN
DRYPGMAAPPVRLLPTNLAPDAVGSLYRGPEQVVIGQREEDLAPVVVDFA
DNPLLMVFGDSKSGKTTLLRHLIRTVREHSTPDQVAFTVLDRRLHLVDEP
LFADNEYTANIDRIIPAMLGLANLIESRRPPAGLSPAELSRWTFAGQTHY
LIIDDVDQIPDSPAMSGPYVGQRPWSPLIGLLSQAADLGIRVIVTARATG
SGHALMTNPLLRRFNDLQATTLMLAGNPQDSGKIRGQRFGRLPAGRAILL
GDSDGPTYVQLINPLIGESVMASEAQREE
379764313YP_005350710.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTLRVVPEGLAATSAAVEALTARLAAAHAAAAPAITAVVPPAVDPVSLQT
AMGFSAQGQEHSAMAAQGVEELGRAGLGVGEAGASYLAGDTAAAATFGIA
GA
379764312YP_005350709.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MHSALLSAGPGPGPLLAAAGAWTSLSAQYATAAGELSALLGEAQAGAWEG
PSAEQYVAAHLPYLAWLQQASADSAGAAAQQEVAATAYTAALAAMPTLGE
LATNHAVHAVLVGTNFFGINTIPIAVNEADYARMWVQAATTMGTYQAVSG
SALAAAPRTMAAPTIVNPGSETNNLTSNAAQNTGDWWQNFIQQLSKFLQD
FFQNIQQMLQDFFSNLPAFLAANGPLLFFIAYQVFFNAVGWPTWGAILTA
PFLIPLLLGIGLSSLLTTPAEAAPEAAAPAAVAPVLASNKPSMLPAVAMA
PTVATPAAAPATTVAAGTGAPAAPAPAAAAGNLAYVVAYGADPDTGVGPT
LTGRGGAKAPAATIPAAGAAAPARAEARARRRRRAALHDHADEFADMESD
FGVPPDYGDEEELAAAVASAQGAGPLGFAGTKQRQKAFQAAGLTKLADDD
FGGGPRMPMVPGTWEQDAVNGRGPAEPGKGG
379764311YP_005350708.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MLDAHIPQLVASQSAFSAKAALLRSTISQAEQEAMSAQAFHQGESSAAFQ
AAHARFVEVAARVNTLLDIAQANLGDAAGTYVAADAAAASGYTAF
379764310YP_005350707.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSQIMYNYPAMLSHAADMSGYAGTMQGLGADISAEQATLSNAWQGDTGMT
YQVWQAQWNQAMESLVRAYQSMASTHEANTMSMLARDQAEAAKWGG
379764309YP_005350706.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MEPAPNAVELTVDHAWFIAETIGAGSFPWVLAITCPYRDAAERNAFLDRQ
KAELTQMGLVSEGGLINPAVAEWIKVVCFPERWLDLRYVGPAKDAGAAGG
AGELLRGIVAQRAGAGGRPSRTVVALRSAQLITFTAMDIDDPRALVPVLC
VGLAQRQPARFDEFSMPTRVGARADERLRSGAPLAEVLDYLGIPQSARPV
VESVFNGSRSYVEIVAGCHRDGRHSTTEVGMSIVDASEGRVLVSPSRAFD
GEWVSTFAPGTPFAIAVAIEQLTAQLPDAGWFAEHRLARDFSNSTLSVQH
379764308YP_005350705.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTSGTVMPIVRVAILADSRLTEMALPAELPLREILPAVQRLVVPATANGD
GEDASGSRGAAEVGGATQLSLAPIGGAPFSLDASLDTVGVVDGDLLALQP
VPAGPAAPGIVEDIADAAMIFSTSRLKPWGTTHIQRGALAAAIAVAFLAT
GLSVTYRVATGALSGLVAVSAVAALTAIVGLLVTARSARTGTALSIAALV
PIAAALVLAVPGRFGPAQVMLAAAGVTAWSLIALMVPSAERERIAGFFTA
TAVLGAAVLLAAGAELLWHVKLVAIGCGLIVAALLVTIEAAQMSALWARF
PLPVIPAPGDPTPSAPSLQVLEDLPRRVRISDAHQSGFIAAAVLLSVLGS
VTIALRPETLSGAGWYVVGATAAASVLRARVWDSAACKAWLLAQPFLAAG
VLLVIYTATGRYGAALGAAVVLLALVAVWIVLALNPGIAEPESYSLPVRR
LVGFAAAGLDASLIPVMAFVVGLFSLVLNR
379764307YP_005350704.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MIRSASACFAAVLALLPATATWTSPPAFAISPPTVDPGVPPPSGAPGPVQ
PMEQRGPCVTSGVIPGSDPGAPTPSQSALNLPAAWQFSRGDGQLVAVLDT
GVRPGPRLPNVEPGGDFVEATDGLTDCDGHGTLVAGIIAGQPSPDDGFSG
VAPAARVVSIRTSSARFSPRTPGGDPLMARVSTEVTTLARAIVHAADLGA
RVIDVGSATCLPVDRPVDQAALGAAVRYAAVDKDAVIVAAAGNSGPTGSF
AGGTSCESNPLTDLSRPNDPRNWAGVTSVSIPSLWQPYVLSVASLTPEGQ
PSKFTVAGPWVGVAAPGERIVSVGNGDGAGLANGLPDDHQQLVALKGTSY
AAGYVAGVAALVRSKYPDLSATAVTHRITATAHNGARDPSNVVGAGSVDP
VAALTWQLPAGDQPSGAAAKQVALPPAPAPENTTPRTVAVVGTAVLAVLV
AVAGAVTTIAARRRKDPTP
379764306YP_005350703.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAYPWRSPRDYWLLGIAAAVVIVLFGWWGGLYFTTLVRRRLAIIGRANAF
TPQPPATATTALVRVGAPEDDSDVLPLPLIAGYLDRYGIRADKIRITSRD
NASDASRRETWIGLTVSAPENLAALRARSPRIPLQETAQVAARRLADHLR
EIGWEATAVAPDDVPRLLTSNPRERWRGVQRGASDYIAAYQIRVDEALPE
TLDAIRSHAARETCTALEIAGDKAHPTVAVACAFQTDTPPERTAPLDGLT
PQRGNHLPALTALDLLSTARLDGHTTAPAGLLAQLHWPTLVGGAHRASSA
GGPETNSATTETTDTLEAART
379764305YP_005350702.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAPDMDPIDPPVPVPDVPGADVPAGAGGLPPHSALSPRQRMVVEASALGD
LALRTWVASLLTTTVTPFVVAGALRQSDASTERSNLDFYAELGAAGDPAR
SFPAPTELPRVTSRRASPLAEWVARGTVDNIAFPSSFTAINPAMRARWSA
WGSNNMVRAQHWRHDDGPRPTLCVIHGFMGSWYLANGRFFSLPWYYRAGY
DVLMYTLPFHGKRAEKFSPFSGFGYFAGGLSGFAEAMAQAVHDFRSIIDY
LRHTGVDRIALTGISLGGYTSALVASADDRLEAAIPNCPVVTPATLFDEW
FPANKLVRMGLRLSDISHEALSAGMAYHCPLSYPPLVGRDRRMIITGLGD
RMAPPDHAVKLWRHWDHCALHWFPGSHVLHVSQLDYLRRMTAFLQEVMF
379764304YP_005350701.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MWDPDVYLAFADHRGRPFYDLLSRVGAERARRVVDLGCGPGHLTTYLGRR
WPDAVIEAMDSSPEMVAAAKERGIDAVTGDLRDWKPQPDTDVVVSNAALH
WVPEHADLLLRWAGELAPGSWIGVQMPGNFESPSYAAVRALARREPYAKL
LRDIPFRVGAVVQPPAHYANLLLDAGCRVDVWETTYLHQLTGEHPVLEWI
TGTALVPVRERLDDDTWQQFREELIPLLSDAYPARSDGSTIFPFRRVFVV
AVVGGAGRA
379764303YP_005350700.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTQLTPGKDNVLIVHWHDLGRYLGVYGHPDVSSPRMDRLAAEGILFTRAH
ATAPLCSPSRGSLFTGRYPQSNGLIGLAHHGWEYRSGIRTLPQILSESGW
YSALFGMQHETSYPKRLGFDEFDVSNSYCDYVADKADEWLRQSADGLVGQ
PFLLTAGFFETHRPYPEDRYTPAEGADVELPDYLPDTPEVRGDLAAFYGA
ISAADAAVGRLLDTLADTGLDATTWVVFFTDHGPAFPRAKSTLYDAGTGI
GMIIRPPTDRGVTPRVYDELFSAVDLVPTLLGLLGIDAPADVDGVSHAGV
LLEADPPATPVRDEVYTMKTYHDSFDPIRAIRTKDYSYIENYASRPLLDL
PWDIEESPSGVAVAPLVTAPRSERELYDLRADPTETTNLLADDGADVEDV
AADLAVLLHDWRQRTGDVIPSEFAGTRIAARYTETYLQIHHGAKPTPRSA
IAADRGIEEGKPAQR
379764302YP_005350699.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MADVTDQAFSPQERRAVYRVISERRDMRRFVPGAVVDEELLARLLQAAHA
APSVGLMQPWRFIRITDDALRRRIHALVDEERPRTAAALGERGDEFLALK
VEGILDCAELLVVALGDDRDKHVFGRRTLPQMDLASVSCAIQNLWLAARS
EGLGMGWVSLFDPQRLASLLDMPDGAEPVAILCLGPVPEFPDRPALELDG
WAVARPLSEFVCENRWGRLPSA
379764301YP_005350698.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MKPSDVLEQLAADPAAGRGYGEPYQTPDGTTVIVVAKPLGVFAIRDGRAT
WTPAVDANRIALIGVVTGLLAGVIGSLAVLRQPPWPRITIRDYR
379764300YP_005350697.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAVFVRRLFGIGKLPDELHAQVESEGLIYLADYVAVTRRFSGTIPGVRLP
HGVASYTGSLALTSERVLATLSMLPRLAGPTVSVRWDAPQTGAANVEISS
TGLQVDVDVSAVDQKFSGELSLHYKVAIPAEVLDTLPRRSLAFDMPPEYV
FRAVGVTYSP
379764299YP_005350696.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MMTRPRTPLAAGIAALAAAVYALMWVGYRQHWAWLYRVDWSLLDGARALA
IKHPSWLRFAESVSFVLGPGALAVLGISVTVLALVMRQLRAALVLVLACA
PCNEFATAAVKALADRPRPPTMLVPAAATSFPSGHALEATAGLLAMLSFA
LPMMNVAVQRIAVAAVAVALPAVGLSRVALNVHYPSDVLAGWSLGYLYFL
VCLWVFRPPAPTVRAKALRRWAFGHGAVT
379764298YP_005350695.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MIFASVVLAPIGAAAGAPWFANAVGNATQVVSVVSTGGSNATMEVFQRTG
TGWQSLRSGIPTHVGSAGMAPQAKSGVPATPMGVYTLDSAFGTAPNPGTG
LPYTQITGGNYWWSGDDHSATFNSMQVCQKAQCPFNTAESENLQIPQYKH
AVVMGVNKNKTPGGGAAFFFHTTDGKPTEGCVAVDDAQLVSIMKWLRPGA
VIAITK
379764297YP_005350694.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MCCNDLMTLDDLADIEAIKQVKYRYLRALDTKHWDDFADTLAEDIKADYG
PSIGNELHFTNRAELVEYMRTSLPANVITEHRVTHPDITVTGDTATGSWY
LQDRVMVSDLNFMLIGAAFYRDTYRRTEAGWKISGTGYDRTYDATMSLEG
MNFTLKPGRAIATD
379764296YP_005350693.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSIVAGQPPGRPVGPTRRTTAPRKRGDDTRAKIIDETVRCIVEEGFSAAT
AKHVAERAGVTWGVIQYHFGDRNGLLMAVVDDGVARLVDSLSSADVSELP
LRERIEVVVDSAWGCYSSPTSMAAFEILRETRGGPDPSSRRHLLDMNAAI
GQLGRLITTEPAHAGVAEVIWATLRGVVLAQMVTGTAIDWSLERRALIDM
VTSYLAHHDT
379764295YP_005350692.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSSPSRYAQLSRDELVVLVPELLLIGQLIDRSGMAWCISSFGRDEMVQIA
IEEWAGASPIYTRRMQKALNYEGDDVPTIFKGLQLDIGAPPQFMDFRYTV
HDRWHGEFQLDHCGALLDVEPMGEQYVFGMCHTIEDPTFDATAIATNPRA
QVRPIHRPPRTPADRHPHCAWTVIIDESYPEAQAIPALEVVSQTRAATWE
LDPIDRSDEGQADYSGPLLSDFDFAAFSHSALVRMADEVCLQMHLLYLSF
AIAVAARAAGDDESLGVCTRGLIGIAGVAAERIHRALKLPGGAEGVLRVL
ELHPLLNPAGYVVAETESNRLHVRPSPAHDDRAWISLCSPESVQPLQAIA
TAVDPRIEVRLSGTATDWTAELVETDSPTEELPEVSVVRVSGGSTFQFEP
RRSLPLTVL
379764294YP_005350691.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MYDPLGLSIGTTNLVAARNGSPPVNRRCVLTLYPHCAPKIGVPEENPPLA
EPGVPMRNFVERIGDSVALVSPDGSAHDPELLTVEALDAMVLAAGADAAA
SEISIAVPAHWKPSTVQALRDALRTHVGFVRSGMAPRLVSDAIASLTAVK
SELGLPDDGIVGLLDFGGSGTSATLVNIAGDFELVSATMRYTALSGDEID
QELQLRAFEELGHGSGLDPGSTAGVGQLGELREQCRAAKERLSVDMATDI
VAELGGRSCSLTVTQDDLEELIQDRLTGFIYAFDDMLVRYRKSWSDLAAV
VTVGGGARIPLVTERLSMHGRTPILTPSQPAFAAACGALILASRGGELDL
RTRTSIGLLATADAAGDVVDLGAGDVLVIDDEALTDRELAWSQTDDPGDL
RMRFGGETYDEDGPAGWSMRLNVIDPPRERRPWRRLRISQLIIGMSAVVA
MTAVGGVAYTLTGIENRQAPPAPSVAPPPAPSVKPAAPAPAAPPPPTAVP
PPPPPSAQPVPSPAPPPPEPPPSPAPPPPPVLVTTAPPAPVYTPRHTAPP
TTTAPPQPTVTTTAPPSPTATTTSPPPPTSEEPVTTSTTTTVPMTTEWIH
VPLLPVPIPIQVPQKQAPATPQYPQYSPQYPSNEYPQYQPYPGNEYPQYP
GSSQNPYWGPGY
379764293YP_005350690.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAFDRYQADRPGSYRHPKHDVHVTPPRSFERPPSEGMTGKPHPNLVTQTL
PARAWPRRWTA
379764292YP_005350689.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSIAPGTVRLVAIEGQDADGVTVEQEEFEVGAAGNAVDRVIDAIGGTREG
VVEGGHRLSSTGVTWTNPADVAALRAAINASDLGDVMMVAPLLAAAALAQ
TVGDALAYERIAMLFVETASATLAVVEVGDGSIVDLHRRRITGTAAPAEL
ATMVAGLDAGGSAADGVFIVGCGADIVALKPAIEAATSLRVTGPEEPDMA
LARGAALASANAPLFASSTAALAYALDPGTGEFGPLAVGPSHLDLWGDAG
TGTGFRAYSALADDAEEDEDQRPPRRSRAMLLAGSALGGIAAVIAGVVLV
TLTADQPTGEGHNAGVSVATPGIQLPAAPPSTPPQAQPPAPSTSPPAPAP
TAEVAAPAPAPAPIAQQPAPQTTATSAPPAPVRRAPTRQTPQYVPQPVEQ
AAPPPAAPAPAPPPVAPPPPPPAAPPPPRPAPVTMYLHFPFVTVPIPITP
PAPPPAP
379764291YP_005350688.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MGEHGGFGFDPDEFDRMIREGSEGLRDVFERVSRFVAAPGGRSGWSTIFE
DMSRRPRPAPETAGEAGEGVWAIYTVDDGGGARVEQVYATELDALRANKD
NLDPKRKVRFLPYGIAVSVLDDDSEETA
379764290YP_005350687.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAANDDPEERIRELERPLAESAWASEQGSSASAGQAHPPPTPGAPPPPPA
WTYGGPVTGPPPPSPSGNRVWWILGTVIVIGVIALAGGIAAFAAHQISGV
KSFITSPPSVSTSPAPSASRRAAPSTSPAPPRGARLSVAGINESRTIACN
DNIVSVSGVSNTVTITGHCASLSVSGVQNAVTIEAADAITASGFNNKVTY
HSGTPKISNSGDSNVVTQG
379764289YP_005350686.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MPFASAFSARSVVLGIVPDLPNRQVLLRRRPSGLVRPDDTEMVTAPAPEP
AEGEALLRTTYVGIDAAARTWLDDQPSYLPPVQLGEVIRAAGIGEVVASR
CDAFAVGDVVTTLTGFQEYVIIRDDLFSTPIPGEDDQLAIMSVYGPTGAT
AYFGMTDIGRPQPGETVVVSAAAGATGSVAGQIAKIAGARVVGIAGGPQK
CRAVVEDFGFDACIDYKNDDIVAALKKHCPQRVDVYFDNVGGPILNAVLG
RLAPRARVVLCGVISSYLTGDHPGPANYVNLLSKTALMQGFNALDQWGRF
DEAFAALRGWEAEGRLHHRQTIFEGIESCVDALNGLFTGVNVGKTLVKIS
EPGAR
379764288YP_005350685.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MDRRSMMLISGLGMLGAAMRLPGAWATPPAPQAPPAAGGGPYIFADEFDG
PAGSPPDPGKWTIQTWQDDVFPPVEGIYRDDRQNVFQDGNSNLVLCATHD
LMSNTYYSGKLRGNFRSMINQTWEARIKLDCLFPGLWPSFWGVNEDPLPD
GEVDIFEWYGNGDWAPGTTVHAASNGKTWEGRSIPGLVDGNWHTWRMHWG
EEGFEFFRDGAQYYKVPNKPIHVAGGAPDDFRWPFNNPGYWMTPMFTLAV
GGVGAGDPAAGVFPASMLVDYLRIW
379764287YP_005350684.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MRAVPLIDHTFESGARSADPPGPFWHHSDVFSPGVLGSRRPAVAAALDPL
LVAALAVAVSMAGAARPSFWYDEAATISASYSRSLAQMWHMLGNVDAVHG
LYYLLMHGWFQVFPATEFWSRAPSGLAAGGAAAGVVVLGKQFSSRTVAIA
SGTFCAILPRTTWAGIEARPYALSMMAAVWLTVLLVHAARRDTRRLWLGY
GVALALSIVLDAYIALLLGAYVVFVVVFHRGRTVLARFATASAVAVGAVL
PFLLTVAGQAHQISWVAPIGHRTIEDVVMQQYFERSPPFAILAALLMCAA
IVLWLSGSARLAPSERQLLVLAAGWLAIPTAAILTYSVLVHSIYTPRYLS
FTAPAMALILGVCGGAVAARPWVTAALVGLFAVAAAPNYVRAQRNPYAKY
GMDYSQVADLITARAAPGDCLLVNDTVTFMPAPMRPLLAARPDAYRKLVD
LTLWQRATDRNDVFDTNLIPEVVAKPLSHCGVVWIITQADPSQPAHERGA
ALPPGPRYGPTPAFAVPHDLGFRLVERWQFNLVQVLKATK
379764286YP_005350683.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MGRLASIGYNGQPVRDPFRAVRPPIAVLVDLTVLFPREPHRSGRYQPNGL
QLHKVVEGRLSCWALCEQGDWWGLVTYPVAYGSRRKTVTHWVPAWTLRRK
A
379764285YP_005350682.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MDASWASVLSKLVALAAVIALSPITVIPAVLVLHAPRARPASLAFLGGWL
VGLVAFTAAFVAGSEALSGFHATPPKWASWVRLVFGVALLALAAFHWFTR
HRHRSMPRWMRSFSTLSPARAGVVGAVLVPLRPEVLILCAAAGLAVGNSS
LSAGGELVAAAIFVVVAASTVAIPILAYAGSGDRFEGTLERLKAWMEANH
DAMLAVILFLIGLIVLYNGIRALA
379764284YP_005350681.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAGSWGTVLTGLVPLGLVISLSPLTVIPAVLVLQAPRPRPSSLAFLGGWL
LSLAALTALAVAASGLLGGLDKAPPRWSSWLRVVLGAALIAFGVYRWLRR
NDQSESPAWMRSFANITPARAGITGAVLALVRPDVALICVPAGLGIGTSG
LGVAGDWAAAAFFVAIAASSVAIPILAYVAAGSRLDDTLARLKDWMDRNN
AALLAAVLVVIGAMVLYHGIHAL
379764283YP_005350680.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MDAQGYCTRWRENAERRGVPPHALAEISRRHDITRASFVVLARMQEIKDP
AGQSFFLLPPSAGGGDARAAALMTYILNAGSDYGAAGKRPTDFPATPHCA
AEVTRIRLRQQANGWSYTRDVPFVHRNGGRLVTTPNGMLMGLGGNWIQRL
FSQRGGTTWGDIFMVNLGRLDDPAEQLCRVVASGHTWCLDGHGAPRCTRL
DLDRVLHHEERHAQQWAARGYLGMLTGYGRELFRELAFGATNRLEADAGL
ADGGYRA
379764282YP_005350679.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MNRRPWRRARGVKQITRGLGTLDRELFDAIAETDTPLLDTVMPRLTRAAD
HSKLWLAIGAALLATGRHSAQRGATRGLVTLAATSLVTNQFAKRIRRRPR
PGYDLVPLVRQVRRRPTSNSLPSGHSASAAAFAVGVGLENPPLGFGLALL
AGLVGLSRVATGAHYPGDVVAGFGIGSGLAVLGGRLVPPIVETALPRTEP
LRVETPPRPDGAGVVLVINPESGSGTGARVLDEVRAELPKVDIRELGPDD
DPVEVLRGAAAGAEVLAVGGGDGTVAAAAGVAIDAGLPLAVFPAGTFNHF
AKDIGCDTVAKTVDAIRRGSVACVDLVCLNDSQMVLNTASIGAYPAFVRR
REKLEKRIGKPLAGLYAMLRTLRKEEPVRICYDNKTLLTSLFFLGNSLYL
PTGFAPARRTRMDDGLIDVRILEAGRPWARTRILTALALGRLERSPLYHE
LQVPEFSFSAVDGPTTVARDGEVGDKYDQARFTAKYRILPVFRPLPDARP
PR
379764281YP_005350678.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MKLNARNLTGLDIPVPTYDRSQIGIGIAHFGVGGFHRAHQAMYIDRLLNA
GLARDWGICGVGVLPGDQQMRDALRDQDHLYTLTLEHPDGTREPRVIGSI
VDFRYAPEDPDAVIELLAAPATRIISLTITEGGYQPPLSAVFGLVTEACD
RRRARGLPSPTVVSCDNIVGNGDTARRAFTSYAQRTNPELAQWMNQKTRF
PNSMVDRITPVTTPDVAERLEAEYGVRDARPVVAEPFAMWAIEDDFADGR
PPLDQAGVQLVDDVAPYEAMKLRLLNAGHQGLCYFGYLAGYRLVHEAAQD
PVIAEFLARYLDSEAMPTLTRIPGLTEFRNQLLPRFANAYARDTVARLCT
DSSDRIPKWLLPVVHDNLRTGGPVRLSAAIVASWARYAEGVDEQGQPIEV
IDRLSDTLVPLARSQRDDQDAFLANRPVFGDLIDAPRFRDAYRWTLDCLH
RRGARATLRALVGDDAS
379764280YP_005350677.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAARRLHGRFIGAALTLGPLLISGIAWAGPARADQAAFLNDLHNAGIHAV
DGGDDALLQMGADLCQQLSWGASPQQLELLALQRSDADQGSGGINGRQAA
DVVIFALRDLCPNA
379764279YP_005350676.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSPRRLAGGFIASALFGAPLLAGLVWASPAQADAASFLNDMHKDGIHAVT
GGDAALLEAGLNICQQISWGAPPAQLEGLALQRSDERQGAGGLSPQQAGD
IVVFAMRDLCPS
379764278YP_005350675.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MNEGELALMAIVDRFNMKVVAGAGLCGAAIALSPDAAAAPLITGGHACIQ
GQAGDAAPAAGGPVAAGAPADMCAAPLTDMSGVPMAVPGPVPLGAPVPIV
PPLPLAPPVPVVPPVPVVPAGAPLIALGGPVAGAPLEAAAPIIDMAGVKD
APTGPAPTGGPTSGQPIRPGPAS
379764277YP_005350674.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MVVAPAGVGLASANLSHGPAIASVSPARGEVVGVAHPVVVTFRGPVTDRS
AAERAVEVKSTPAMTGKFEWLDNKVVQWVPDRYWPAHSTIALTVGQATSE
IKTGPAVIGVASISQHTFTVSIDGAEAGPPTQLPAPHHRPHFGEQGVMPA
SLGRPEYATPVGSYTVLSKEPAVTMDSSSVGIPVDDPNGYLLTVNYAVRI
TNRGLFVHSAPWAVQSLGLENVSHGCISLSPDDAEWYYNHVNVGDPVIVQ
D
379764276YP_005350673.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MESPDLARPFAPHRQRAYVGLLTVVGVVFVFMTIAEATRLLPPTLTVDVA
ANLIFGIPVLLLPLILFWKGRGEQRSRLQLAAELTLIYIPLTAGSQLTYE
LPFLLGHPFNLWTATTDPGWRWLWWQYGLADTRYRSDDPWIFGLEFGAVL
VGIMLTIVWLRLLRKDLPDESRIKCLWLTFFGVAVLLTGTLVYYVSEIRT
GFNDIGQGAYGLCFKLVGENVPYMILPVFVLYAIYLQVDYLTRRAGATTQ
APAPVNAGV
379764275YP_005350672.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MKFGVVEAPLHSRFGPTAAAEMGYRVAMLTGADSYWLPDHLNAFLPRAVM
TPKYSGIARLAPHADAFLEPWTTLGHLAGRHRFNRMRLGTCVTDTGRRNP
AVTAQTAATLHLMTRGRAVLGIGTGEREGNEPYGVDWSKPVARFEEGLAT
IRALWNSNGQLVNRDSEWFPLRNAIFTLPAVKGNRPQIWVASHGPRMLRA
TGRYADGWFPVAIVSPERYATGLEQVRAAADDANRDPYSIVAAITQFVVT
GRSTAEVDDALESVPARTYALLLPDVEWAEHGARHPMGEGCTGYQDLLPQ
LLDEATTLAHIDAVPRALMRRCLLSGTPDEVLDQLATYRDHGVRYPTLLN
MSTIQPQLSRGLSSALPFMKILRGIARL
379764274YP_005350671.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MVLAAVLAPAAVFFAVSADVHPFAPHNQAKPVISEPAPCCVQIVTAASKR
PAKALVDGEPAAASRYHTRSRFLPAGVAPEQGLQVRTILVERSISAEFPQ
IHEIGGVRPDSLPWHPRGLALDVLIPNPGSAEGIALGNSIVAYVMQNATR
FGIQDAIWRGVYYTPGGAQASRLGHYDHVHVTTTGGGYPTGDEVYLR
379764273YP_005350670.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MLLSDRDLRAEISASRLGIDPFDDALVQPSSIDVRLDCMFRVFNNTRYTH
IDPAKQQDELTTLVEPVEGEPFVLHPGEFVLGSTLELITLPEDLAGRLEG
KSSLGRLGLLTHSTAGFIDPGFSGHITLELSNVANLPITLWPGMKIGQLC
ILRLTSPAEHPYGSSRVGSKYQGQRGPTPSRSYQNFISST
379764272YP_005350669.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MVFTSAWPWFTAMPLEGFVLDIVLGVSMAPSSIQMVVLQGEYADGATVEE
DAIDVTGADDAATVSASDRVISAILGTREGAADAGLELSSIGVTWTDQFE
AAALRDALTAHRLDNVMLVSAFLAAAALAQNVGGAMGYERTAVLLVEPDT
ATLAVVETSDGSIPDVYKQQIHAESYGAAAEQLSGMVAGLEKLEYRPDGL
FVVGSGVDVAPLKPALQTTTALDVSVAEEPETALARGAALASANAPLFAS
STAALAYAQDPGTGAVDQHSLPEYLYVPFGPDAGDDELAYSAVADEDADS
PTVVIERLFLPEESQPQRRPALLIGSGLAVAGISAVLALEIALAIGIRTT
GTVALQPTPNQHLIVPTEQAPAPVQASAPEAKISLPAPVAAPKPLNPPVA
APLPAPPPPEAPPVPAAPPVVPVPVVVPPLPVPVPVRIPVPNPVVRPPLF
EAPPRVSIPQPARPQPPVQIPQPPTPPKVGGTVPQSPPHQTPPGEGTPPK
PGAPGNSGGGHVPTPGSGGSGGGHVPTPGSGGSGGGHVPTPGSGGSGGGH
VPTPGSGGSGGGHVPTPGSGGSGGGHVPTPGSGGSGGGHVPTPGSGGSGG
GHVPTPGSGGSGGGPCPDAGFGWFRWWPMSRPRVRVAAMSRRPVRVAAYR
SLVGAARADSAAATLLRPAADLAAVTLLRPAADLAAGTLLRPAADLAVAT
LRRRLKAAVASAAGIAAVAWAASAAATAAAAWAVSAAVTVAAVASAAVTV
AVAAATNSLGLPSLLPPSGAWGTASAVTATDNSAG
379764271YP_005350668.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MEVVLGVSMAPETVRMVLVEGAAAGGVTVDQDGFDVVGDPTPAAAADHVV
AAILGTRDSAALGGYQLKSSGVSWTDPAEAAALRDVLAARRIENVMLVSA
VMAAAALAQAMGSATNWARTALLLVEPTSATLAVVDTSNGTVTDVHRHPL
PGRDDVALAKLTAMVSGAESMRARPDGLFLVGSDVDIPLIKPTLEAATSL
SVTTPEEPEMALARGASLAAANARLGAPRTITMPSARISSTEATGSAHNP
DARAARSRERHSRKPAATVALVMTIFVTGFVALALALVFGRDPDTGQPPE
VSTNVVAPQAPSPPNTGPPPPPPPAPAPPEAPTPEAPQAPAPSPPQSGDH
PHWDDWLHRHLGPDFPVP
379764270YP_005350667.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSMAPTAVRMVLVEGENGDGATVDEDNFDVTTSTDAATVTASDQVVSAIL
GTRQGAAEGGYQLASTGVTFTDPVEAAALRDKLAAHKVENVMLVSAFLAA
AALAQAVGHRTNYAQTALLYIEPDTATLAIVDSADGSIADVRRQVLPEDD
EAAVAELTRLVSGAENMESRPDAVFVVGSGIDIPLIKPALEAATTLPLTA
AEEPETALARGAALASAHAPLFASSTAALAYAQDPGTGAINPLAVAPGYF
DAPGDAGVDALAYSAVPDDPDDFFTGSQTAATELVGADYRGRNFRLVGSA
VAAVFVIGVVALVVSLAIAIRPTANVRPSPNENVVVAPTRPAPAPAAPAP
APAQAPAAPAPAPEAPAPVPEAPAPAPAAPAPAPVAPAPIPVPAAPPPAP
PPVAPVPVPIPLPIPGIGGPPGGGWGPGHGGGHGDHDDGFPGGPRGGFGG
GPRGGFGGGHGHGGFGGGGPRINIPGIPGI
379764269YP_005350666.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MFGTGYLGATHAVGMAALGHDVLGIDIDPGKVAKLAGGDIPFYEPGLRKL
LNENLAAGRLRFTTDYDAAADFADLHFLGVGTPQKKGEYGADLRHVYAVI
DELVPRLTSSAVLVGKSTVPVGTAAELNQRAAALAPRGVDVEIAWNPEFL
REGYAVQDTLRPDRIVLGVHQDSVRAEAAVRELYGPLLDAGVPFLVTDLQ
TAELVKVSANAFLATKISFINAISEVCEAAGADVSLLADALGYDPRIGRQ
FLNAGLGFGGGCLPKDIRAFMARAGELGADQALTFLREVDSINMRRRTRM
VELASAACGGSLLGANVAVLGAAFKPESDDVRDSPALNVAGQLQLNGAAV
NVYDPKALDNAQRLFPTLNYAVSVEEACERADAVLVLTEWRQFVELDPDD
LADGVRARVIVDGRNCLDTARWQRAGWRVYRLGAPRP
379764268YP_005350665.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MRGFIDGLPGEHRFGATLAFERSAEKIGELVRGKPLAAIHPVVRVHPETN
ERVVYVHQFFTKEIVDLSPRESRHVLDLLFEQISRPEYSVRFKWEPGSVA
FWDNRATLHLAPRDFEHLDHERVLHRITLVGDIPVGPDGRPSEPLEGQFF
GAA
379764267YP_005350664.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTIAEQESTRAVTPPAEAAPVPGMRRVALASLAGSVLEWYDFFLYGFAAT
LVFGPLFFPRASATAGVLAALGTFAVGFVARPLGGVVFGHLGDRLGRKKM
LVATLLIMGIPSFLMGLLPSYSAIGWSAPALLVLLRFLQGVGLGGEWAGA
VLVVTETSPPHRSGFWGSLVQTGATLGQGLATGSLFILASLLSEHSFVTW
GWRVPFLFGIALSVVGLFIRLRVMESPEFTALHRSGELSRFPLREAVRQH
GRTMLVCFGVYLGGVTVPFFVETVFLTGYGTKSRARPASSVLLGISAVHV
TVFWVLTLLGGWLADRVGAPRVVRAGLLGLLVLPTAGLLAVLSASSTVAA
LLITETLIGAPMWVVWGALPKYLAESFPARVRYTGMSLSGQSSTIIGGLI
PLLLTSVVAHVGGALWPVALTTTAVAAFGVLGLLWSHRSR
379764266YP_005350663.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MLADSAGLPDAHAAIRAFWEREGSEYDQRAAHGISSEPERRLWTAALSAI
PERSRVLDIATGTGFVALLLSELGHRVTGVDASEAMLARARAKAAATAAT
VEFVEGVTEKLPFPDASFDALTARHFIWTLLEPEKAFAEWRRVLAPDATL
IADVSLNPHVAGHHYADDVAAALPFRALSDAAPVADALRAAGFEHVRIDL
SQDGGEYPRAMLHARAGQ
379764265YP_005350662.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MDYAGAFLDENRAFAELFDGADESTPVPTCPEWTLRQLFRHVGRGDRWAA
QIVRDRLESYLDPRTVEGGKPPPDPADAISWLHGGAQRLVDAVELTGVET
PVWTFLGPRPANWWIRRRLHEVVVHRADAAIALGTDFALEPDIAADGITE
WLERVAIQAGGQGAPLPLEDGTTLHLHATDAGLGEAGEWTAAVDQGRVTW
SHEHGKGSVALRGGATELLLAILRRRPLADTGVQLFGDEAVWERWLDRTP
L
379764264YP_005350661.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTTSEIATVLAWHDALNAADIETLASLSSDDIEMGDAHGAAQGHEALRSW
AASHRPATELGRMYVHDGVVAVELKPGSTGDPGAATDAALTFRVVRDHVT
SVFRHDSLASALAATELTESDAVD
379764263YP_005350660.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MRGIILAGGSGTRLHPITTGISKQLLPVYDKPMVYYPLSTLMMAGIRDIL
VITTPHDAPGFQRLLGDGSQFGVNITYVTQDRPDGLAQAFVLGADHIGNE
SVALVLGDNIFYGPGLGTSLRRFQTISGGAVFAYWVANPSAYGVVEFSDD
GLALSLEEKPKTPKSNYAVPGLYFYDNDVIEIAKGLKKSARGEYEITEVN
QIYLNRGRLSVEVMARGTAWLDTGTFDSLLDASDFVRTLERRQGLKVSVP
EEVAWQQGWITDEQLAQRAHSLLKSGYGSYLLNLLERSRFH
379764262YP_005350659.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTHSHSHSLPPGPSGIDPLPARIVVGLLVAIGVAVAVGAILLWPSRQRVD
IPMPLQNASGGAVSTQAGHVLSSGLGDCGSPSVSQVLTGPPQPAAPGAGR
CVLTQVAVDSGPNAGATTLLESSPGPGQPKFAVGDRIRVVRQVDDQGATS
YAFYDFERGWALVGLAIAFAVVIVAVARWRGLLALVGILVAFVVLVMFLL
PALRDGAPAVPVALVASAAILYAVIYLAHGVSLRTSAALLGTLSALLLAA
GLSWAAIQLAHLTGLSDEQNTTVSAYLGNVSIGGLLLAGFIIGSLGVLND
VTVTQSSTVFELARLGGSRRAIFVGAIRVGRDHIASTVYTLVLAYAGSSL
PLLLLFSVANRSLTDVLTGESVAIEIARSAVGGMALALSVPLTTGIAAVL
AKPSGGRKRGEAARSGPPLPA
379764261YP_005350658.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTTHQLPHQLPPHPSAHHRQQRTFAQSSKLQDVLYEIRGPVHQQAARLEA
EGHRILKLNIGNPAPFGFEAPDVIMRDMIQALPYAQGYSDSQGILPARRA
VVTRYELVDGFPRFDVDDVYLGNGVSELITMTLQALLDNGDEVLIPSPDY
PLWTASTSLAGGTPVHYLCDETQGWQPDIADMESKITDRTKALVVINPNN
PTGAVYTSEVLTQIVELARKHELLLLADEIYDKILYGDAKHINLASLAPD
MLCLTFNGLSKAYRVAGYRAGWLAITGPKDHAGSFIEGINLLANMRLCPN
VPAQHAIQVALGGYQSIDDLVLPGGRLLEQRDVAWTKLNEIPGVSCVKPD
GALYAFPRLDPEVYDIDDDEQLVLDLLLQEKILVTQGTGFNWPAPDHLRI
VTLPWARDLAAAIERLGNFLVAYRQ
379764260YP_005350657.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTTQMLIRLVVGMGMTLVVAALAARRVLWLFKLITSGKPAPGHTDEPGKR
IWAELSEVFGQRKLLKWSIPGLAHFFTMWGFFILLTVYIEAYGLLFQDNF
HIPFIGRWDALGFLQDFFATAVFLGIATFAVIRLMRSPKEIGRSSRFYGS
HTGGAWLVLFMIFNVVWTYVLVRGSAVNNGTLPYGNGAFLSQLFGAILRP
LGQPANEIIETVALLLHIAVMLAFLIIVLHSKHMHIFTAPINVIFKRLPD
GLGPLLPLEHDGKPIDFENPPDDATFGRGKVEDFSWKAMLDFATCTECGR
CQSQCPAWNTGKPLSPKLVIMDLRDHWMAKAPYILGDKESPLESTPAGGL
GEELSGEEHAEAHHVPESGFGRVMGSGPEQATRPLVGTEEQGGVIDPDVL
WSCVSCGACVEQCPVDIEHVDHIIDMRRYQVMMESEFPSELSVLFKNLET
KGNPWGQNASDRTNWIDEVDFDVPVYGEDVDSFDGYEYLFWVGCAGAYDD
KAKKTTKAVAELLAIAGVKYLVLGTGESCNGDSARRSGNEFLFQQLAAQA
VETLDGLFEGTETVDRKIVVTCPHCFNTLGREYRQLGANYSVLHHTQLLN
RLVRDNRLVPVTPVSQDITYHDPCYLGRHNKVYEAPRELIGTSGANLTEM
PRHAERSFCCGAGGARMWMEEHIGKRINHERVDEALATGATTIATACPFC
RVMVTDGVNDRQEEAGRSGVEVLDVAQILLASLEYDKATLPEKGTAAKEA
EKRAAAAPKAATATATAPAEEAEEAPAEAAPKAAAAPAAPVKGLGIAGAA
KKPGAKKAAPAAEGKAEAAAPVKGLGIAGGAKKPGAKKAAPAKAEAPAEA
AAPEAETEAKAPAAPVKGLGLAAGAKRPGAKKAAPKAEAPKAEAPEAEVA
PEAEPEAKAPAATPVKGLGLAAGAKRPGAKKAAPKAEAPKAEAEPAEQAP
AEPAPKAEPAKQADGDDAPSQPPVKGLGIARGARPPGKR
379764259YP_005350656.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSQSLGLSIGVANLVAARAGTAPVTRSSVVTLFEHRPTEVGLPEENPNLT
APGLVLRGFVERVGDRAPLVAADGTKYLGAALTVEAIEAMARTVGYGTPI
SIAVPAYWSDEQFAALRDEFFAQSDLARGGVAPMLVSDATAAVAALRGTP
GFPADGVVALCDFGAGGTTVTVLDANAGFAPVAPAVRHTDFSGDAIDQLI
VDHLLASDVSTAVLGGGARMGSQTRLLAACRRAKEQLSTAAVSTVAGASG
ESTQLTRTEFEQLISPPLDRFVTSLQDTLRRNGIPNTNLRAVAIVGGGAS
IPLITARLSQRFGVPVRSAAQPASLAALGAAALGAQYAAGGAETTAAAAV
ETPTEMVGTAGIGATQAAWAAQATDVDDALAWSQDADSDEPVPYTGRDAT
GEYASEAREFEYAEQGGLPWYKRTALVLTVVGAGVAVLVAAALAIGLLMT
KSTPAPPTSSPNPPPPPQTVTITGPNDSTTVTVVPAPPPPSSEAPATTTT
TTPPPEPSTTTTTPPPSTTTTTTAPPTTTSQATTTSAAPTTTTRVRPLPP
IFQPPFGR
379764258YP_005350655.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MASNGPRDDFHNRPTQHADFGMSEPPTGEVPPPNFPPQPPHGFEQPQGFD
PFDQEPEPTPWYRRPAMLIAWLISVVILIGLIVFGIIELIHDDQSVNHVP
KSTTSTTTTTTTTTPSTTTTTTTTESSSSAEEQPPAQQPTQQQPTGQQTQ
QPTHRHHLPQLPPVITIPQVPTVITVPPGLR
379764257YP_005350654.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAADPTDREWWSEAGDDAPTAASQHRRAAESPDGTDPAKCAAAAHEETSH
GAVGAVAEAGNQLTSAVVVIALVSAISGLLYGYNTGVISWALLQLTEEFN
LTAAWKQVVAASILLGAIVGALACSWLSDRFGRRGTLLMLSVLFIVGALW
CADAPDVVVLSLGRLVLGFAVGGATQTAPMYVAELSPSAYRGRLVLCFQI
AIGVGILAANLIGVFDSVSWRGPTGIACVPAAIMLWLLLRLPESPRWLVK
QGDRNAARAVLERVRPDGYDVGAELDEATELARMERKASTRGWSGLRDSW
VRPALVLGCGIAVFTQLSGIEMIIYYAPTILTDDGVYRSVALLVSVMLGA
TYVIAQLVGLAIIDRVGRRRLTLIMVPGAAISLFALGLIFVTADSGHDVI
AYIMISLIAFMVFNAGGLQLMGWLTGSETYPLAVRPEGTAVHSATLWGTN
LLITLTLLSLINAIGVGPSMWLYALFNVAAWIFVFFRMPDLTGKSLEEIE
KNLAEGKFRPSDFAR
379764256YP_005350653.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAGGEAKGRWWRVLRYSFGGALCLLAGINVLVGSAWYLPVGAAAVGVGII
YGSGRRIFGAGVRRTGQEIVCRYLPWYESNPYMATLLFPLIAFAMIGAGC
APGNPAWLWYGGVILLAISALLVGVSLWIWRRSLLRITPAALTVRIAERG
SELTDIRREHVRSIEPKLVPSVAAGTERLQVEVAYQPADVSGEATATVML
GMYLSVQPSNLLDALAAWNNGAHDNPSELLDRIERILRGRSMAGV
379764255YP_005350652.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MLTVRLTAPKEELTEISRECVVSIEPKIVPNGVSGQSLQVAISYRATGLS
SESKTVLLGLQLTIQPINLLNALIAWKDGAHENPCELLDRVEGILRGNRQ
379764254YP_005350651.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MLTMHRVEAALDPAEVFAMLVEQQLQSTPGCHEVRRELGPAAESIGIQGL
LAMKIIHELGAIDSVSRSRIISAEQETLIAQLTVTALDDSPVRRENVWLS
VQLGAAPAGPAPVTATRDRH
379764253YP_005350650.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MQLRYISVAALIAEAGGDPWAINQSLQAGSPFQIAQLAEAFLKAGRCTAE
ATNAFDQARSRFDAAWNHQNGDHPINGSAEVQRVTKSLGAQSLQLPKIGA
DLENIAANLAEAQKTAAGQIAALESQLQQLDGFIGQAVELEKDPTLTAED
RHALDAFISGREDDAIRDTKAALGQLQSTRNGYANSFQNAMGTLHADGYD
LTAPQAGPAQGAAEQPSGGAAEQPGGGPALAPTKGEVLTGAAGAIAGGTA
DGVRGATTRLIAESPGTGPGKADPGLLRWFEDPKIGGIELKGFSRVGGVV
AAASAVPAVMSDIHDGNSVSEAVTRESVGTVLGLGLGTLAGDAAAGAAIG
SVIPGAGTALGLVVGAGVGAIAAWGGSKVVGEVWHPVADAVGSAVHGVES
VFGFG
379764252YP_005350649.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MRFSDNARRSLAGGSLLLVALFAGSGLVSGCSSVIGGRPVASPGAGAGEP
SFPTPRSTPSPPSATAAPAPTAPAAPTGPTNPAGAIPLPPDQNGYVFIET
KSGVTRCQINKDTVGCEAPFTNSPLQDGEHANGVSVTTGGKVQWVLGNLG
AIPTVKIDYQTYAAQGWTIIANVDGTRFTNDQTKHGMFVSIDKVNTF
379764251YP_005350648.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MARAVGIDLGTTNSVVAVLEGGDPVVVANSEGSRTTPSIVAFARNGEVLV
GQPAKNQAVTNVDRTIRSVKRHMGTDWSIEIDDKKYTAQEISARVLMKLK
RDAEAYLGEDVTDAVVTVPAYFNDAQRQATKEAGQIAGLNVLRIVNEPTA
AALAYGLDKGEKEQTILVFDLGGGTFDVSLLEIGEGVVEVRATSGDNHLG
GDDWDDRVVDWLVDKFKGTSGIDLTKDKMAMQRLREAAEKAKIELSSSQS
TSINLPYITVDADKNPLFLDEQLTRAEFQRITQDLLDRTRQPFQSVIKDA
GISVSEIDHVVLVGGSTRMPAVTELVKELTGGKEPNKGVNPDEVVAVGAA
LQAGVLKGEVKDVLLLDVTPLSLGIETKGGVMTKLIERNTTIPTKRSETF
TTADDNQPSVQIQVYQGEREIASHNKLLGSFELTGIPPAPRGVPQIEVTF
DIDANGIVHVTAKDKGTGKENTIKIQEGSGLSKEEIDRMIKDAEAHAEED
RQRREEADVRNQAESLVYQTEKFVKDQREAEGGSKVPEDTLSKVDAAIAE
AKTALGGTDITAIKSAMEKLGQESQALGQAIYEATQAAGEQADATGGGQA
GSADDVVDAEVVDDDRESK
379764250YP_005350647.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTVTDKRRIDPETGEVRQAPPGDTPGGPAPADEPAVQGEGKLAELTADLQ
RVQADFANYRKRALRDQQAAADRAKAAVVNQLLGVLDDLDRARKHGDLES
GPLKAVADKLEGALTGLGLTAFGEEGEDFDPVLHEAVQHEGDGSRPVIGT
VMRQGYKLGDQILRHAMVGVVDTVDDEGDESASAGEAEETAPVESDDNAG
TSGD
379764249YP_005350646.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAQREWVEKDFYKELGVSSDASPEEIKRAYRKLARDLHPDANPDNPAAGE
RFKAVSEAHNVLSDPAKRKEYDETRRLFAGGGFGGRRFDTGGFGGFNVGG
DGAEFNLNDLFDAAGRSGGTNIGDLFGGLFGRGAGGRPSRPRRGNDLETE
TQLEFVEAAKGVAMPLRLTSPAPCTNCHGSGARPGTSPKVCPTCNGSGVI
NRNQGAFGFSEPCTDCRGSGSIIEHPCEECKGTGVTTRTRTINVRIPPGV
EDGQRIRLPGQGEAGLRGAPSGDLYVTVHVRPDKVFGRDGDDLTVTVPVS
FTELALGSTISVPTLDGKVGVRVPKGTSDGRILRVRGRGVPKRSGGNGDL
LVTVKVAVPPNLEGAAQEALEAYAAAERSSGFDPRAGWAGNR
379764248YP_005350645.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAKGSSNSRNEDARTFLISVAAELAGMHAQTLRTYDRLGLVSPRRTSGGG
RRYSEHDVDLLREVQRLSQDEGVNLAGIKRIIELTNQVEALQARIKELNE
ELAQLRASQRRDVAVVPKSTALVVWQPRRGR
379764247YP_005350644.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MHVVTLRDPSSPLVAQFVPDAGMIGTSLRDAGAELLGQRRGLDAYVSDGK
TMGIPILYPWANRLGANTYTAQGATVDLTPGENGVRADPNGLPIHGVLAA
YPGWRVTDESPNELTALVDFGADPRLLASFPYPHVLTVTARLADRTLTVR
STVAATGDSAVPLCFGFHPYLQLLGVARGDWVVETPALRHLGLDDKGLPT
GESELQPAGEEALRNKAFDDAYDDVTEGAVFAVSGGGRRIEVHFERGYSA
AQIFAPPVDDPSKAIICFEPMAAPTDALRRGGYRCAAPGEPVVTQFSIRV
RSQ
379764246YP_005350643.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSLEDVQALAVLRDAFEPDGAGRSGSQGDSGELVHRFYTHWFALDASVRD
LFPPEMSAQRAAFGHAMHWVYGELVARRAREPVAFLAQLGRDHRKYGVLP
HHYDTLGRALLATLRSHLGAAWTGAVDDAARQSLNLIIGVMSGAADAEEG
PAWWDGTVIEHLRVSRDLAVVRLQLDQPMHYHPGQYVNAHVPQCPRRWRY
LSPAIPADPGGGIEFHVRLVPGGLVSTAIVNETRIGDRWRLSSPHGGLGV
DRDGGDVLMVAGSTGLAPLRALIMDLSRYAVNPRIHLFFGARYRCELYDL
PTLWQVASHNPWLSVSPVSEYSADPAWAADYPDVTPPRGLHVHQIGRLPD
VVTKYGGWGDRQILICGGPAMVSATKSALLAKGAPPERIQHDPLWR
379764245YP_005350642.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MPDAGTLQVSGAGTTKTLPCHAGYLSVSGKNNTITLTGHCTSVTVSGNDN
RVAVDSTDALSASGAGNVVVYHWGSPKIVSAGTANVVRQG
379764244YP_005350641.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MLVCLFNVVNVESVPLNSTEFWALRRTGYPRSDDADDATPRPGRRPRPNP
APGQELMAGRPRRSGGRGPCLGRPAYRPRPRQPVQ
379764243YP_005350640.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MDSFNPTTKTQAALTSALQAASAAGNPEIRPAHLLMALLTQADGIAAPLL
EAVGVAPATIRAEAERLLERLPQASGASSQPQLSRESLAAITTAQQLATE
MDDEYVSTEHLMVGLATGDSDVAKLLTGHGASPQALREAFVKVRGSARVT
SADPEATYQALEKYSTDLTARAREGKLDPVIGRDNEIRRVVQVLSRRTKN
NPVLIGEPGVGKTAIVEGLAQRIVAGDVPESLRDKTVISLDLGSMVAGAK
YRGEFEERLKAVLDDIKNSAGQIITFIDELHTIVGAGATGEGAMDAGNMI
KPMLARGELRLVGATTLDEYRKYIEKDAALERRFQQVLVGEPSVEDTVGI
LRGLKDRYEVHHGVRITDSALVAAATLSDRYITARFLPDKAIDLVDEAAS
RLKMEIDSRPVEIDEVERLVRRLEIEEMALAKEEDEASKERLEKLRSELA
DQKEKLAELTTRWQNEKNAIDVVRELKEQLEALRGESERAERDGDLAKAA
ELRYGRIPEVEKKLDAALPQAEARENVMLKEEVGPDDIADVVSAWTGIPA
GRMLEGETAKLLRMEDELGKRVIGQRKAVTAVSDAVRRARAGVADPNRPT
GSFMFLGPTGVGKTELAKALAEFLFDDERAMVRIDMSEYGEKHSVARLVG
APPGYIGYDQGGQLTEAVRRRPYTVILFDEIEKAHPDVFDVLLQVLDEGR
LTDGQGRTVDFRNTILILTSNLGSGGTEEQVMAAVRSAFKPEFINRLDDV
IVFAGLEPGELVAIVDIQLAQLQKRLAQRRLTLEVSLPAKQWLAHRGFDP
VYGARPLRRLVQQAIGDQLAKLLLAGDVHDGDTVPVNVSPDGDSLILG
379764242YP_005350639.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAWDFSTEPDFQAKLDWVEDFCREEIEPLDFVFPYAVRSPDPRVKAYVRG
LQQQIKDQGLWAIFLDEELGGPGFGQLKLALLNEVIGRYSQAPQMFGAAA
PDTGNMEMLAAFGTEEQKKRWLEPLLNQDMFSAYSMTEPQGGSDPSLFKT
HAVRDGDEWVINGEKWFTSAGRVADILFVMCTNGMFVVPRRTPGVEIQPE
PRNHNHIIYNDVRVPLDHLLGPEDGAKTLAQRRLGGGRIHHAMRTIAQCR
LAFDMMCERALSRESHGKVIAEHQMVQEKIADSYAAIRMLRLLVLETAWK
IDNSSTKEARTDIATVKFTMAKVLRDVSYNALHILGSLGTTDLTPLQAMY
ASAPTMGLADGADEVHKATVARRLLRDYSPQQHPYWPTEYFPAKREAAWA
KFEPKFQAEPELRAAAEDSKKYFARRR
379764241YP_005350638.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MVPLWFTLSALCFVGAGVLLYVDVDRRRGRSRRRKSWARSHGFDYERESA
DILKRWKRGVMSTVGDVTAQNVVLGQIRGEAVYIFDLEEVATVIALHRKV
GTNVVVDLRLKGLKEPRESDIWLLGAIGPRMVYSTNLDAARRACDRRMVT
FAHTAPDSAEIMWNEQNWTLVAMPITSTRTEWDEGLRTVRQFNDLLRVLP
PLPEETPQESGAPAGPRNASPSRPLAPAGRAELPPRRAQQDVAGLLGPDA
APGRRAAEPVRRDQPRPEPRPDTLRRPPPTGRNGHQATNYQR
379764240YP_005350637.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MALMPRPVALITGPTSGIGAGYARRFARDGYDLVLVARDADRLNRLADEL
KSTAGDVEVLPADLGDAADRQRVSDRLAAGVRVLVNNAGFATSGDFWSTD
PAVLQSQLDVNVTAVMHLTRAALPGMLDAGAGTVINIASVAGLVPGRGST
YSASKAWVISFSEGLSVGLQGTGVSVHAVCPGYVRTEFHARAGIDMSKSP
SFMWLEVDDVVSQSLADIARGKVISIPGLQYKAIIAAERMIPRTLMRAVT
KRVGGGRGRT
379764239YP_005350636.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAEPEREELAELVRRLAVVHGRVTLSSGKEADYYVDLRRATLHHRASALI
GKLMRELTSDWDYAVVGGLTLGADPVATAIMHAPGRPIDAFVVRKSAKAH
GLQRLIEGSEVSGQRVLVVEDTSTTGNSALTAVRAVQDAGGEVLGVATVV
DRATGAAEAIEAEGLPYRSVLGLAELGLG
379764238YP_005350635.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MRTILAIAACLALCLAGCSSTNPAAAPYGAQGARLGESLVLLGWNMSVSN
LRWDGDYVLVDVDASPASTKDPHAKPEDIRFGLYGALAHPMEADGLGSCE
NAKTGVHDIRATLSAPPDRLTGTVCLGPLKDRSQVRGIYGYSPRDRIPNS
SSAYPVAFPVGLLPTNPNDSGGLAVKTASLTAWRADGKPVTKAQLGDPGA
FTGNGYMLLGLEATAIAARYRDESAKRGGPMMLLASPTLPAPGLNPACAT
YGSSVLILPDASLDAVHVNASLCTQGEINDALLYATLAIDGTHAGVWTQR
379764237YP_005350634.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSGPGPTEWSATPPAGVGPWPGEPPDDPRYDPILLREGDTRNVVDAYRYW
TREAIVADIDRRRHPLHVAIENFGHDANIGSVVRTANAFAVHTVHIVGRR
RWNRRGAMVTDRYQRLCHHDSTAELLDFAADAGLTVVAVDNVPGAARLEE
TALPRECLLVFGQEGPGITDDTRSGATLTVSIAQFGSTRSINAGVAAGIA
MHTWVEQHADLSRAW
379764236YP_005350633.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MDQLWANRAASCEAAVTQRHLKRLWGLPATQLGVVAWPAQRKDRLFGTWH
YWWQAHLLDCLIDAQQRDPQPHRHTEINRQVRSHRLRNNFSWINNYYDDM
AWLALALERAARIAGVERRKALPKLANQFLTAWSPEDGGGIPWRKQDKFF
NAPANGPAGIFLARYGDHLKRAEQMANWIEATLIDPETHLVFDGIKAGSL
VRAQYTYCQGVVLGLETELAARAGVEVRARHAARVHRLVAAVREHMAPAG
VLVGTGGGDGGLFAGVTARYLALVATTLPGDSPEDAMARDTARQIVLASG
KSAWDYRQTVDGLPVFGPFWDRDAQVPTADGKEAEFVEGAVMASEVAERD
LSVQLSGWMLMEAACNVSAESSHEDRSAL
379764235YP_005350632.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MKKVHPDAESALHGLLKDGITIAAGGFGLCGIPEKLIRALVDSGIKDLTI
VGNNAGVDDFGMGLLLKGRQVKKVIASYVGENKEFERQVLAGELDLALTP
QGTLAEKLRAGGAGIPGFYTRTAYGTNLAEGKDTRVFDGTEYVLEEGIRA
DVALVKAWKGDTAGNLVYRKTARNFNPMIATCAAVTVAEVEELVEVGELD
PDLIHTPGIYVDRIIEGTGYEKRIEFRTTSGGAALKNDSPIRELMAQRAA
RELRDGYYVNLGIGIPTLVANFIPDDINVTLQSENGLLGIGAYPSEDSVD
PDLINAGKQTITSLPGSSFFSSADSFAMIRGGHIDLSILGALEVAENGDL
ANWMVPGKMVKGPGGAMDLVSGVKRVIVVMDHTAKDGSPKILKQCTLPLT
GKGVVDMIITNLCVFDVEPGQGLVLTELHPGVTVEDVRAKTGCDFTVAV
379764234YP_005350631.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSTAVTALPAILDPMYWLGADGVFGSAVLPGILVIVFIETGLLFPLLPGE
SLLFTGGLLAAHPHPPVSIWVLAPCVATVAVLGDQTGYFIGRRIGPALFK
KEDSRFFKKHYVTESHAFFEKYGPWAIILARFAPFVRTFVPVIAGVSYMR
YPLFLGFDIVGGIAWGGGATLAGYFLGNVPFVHHNLEKIILAILFVSMIP
AFIAAWRGYRGRRRVTETADREPEKLPASE
379764233YP_005350630.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MPIATPEVYAEMLRRAKEHSYAFPAINCTSSETVNAALKGFADAGSDGII
QFSTGGAEFASGLGIKDMVAGAVALAEFTRSIAARYPINVALHTDHCPQD
KLDTYVRPLLSISAERVSRGGEPLFGSHMWDGSAVPIDENLAIARELLTE
ASAAKIILEIEIGVVGGEEDGVANEINDKLYTTPEDFEKTIDALGHGEHG
KYLLAATFGNVHGVYKPGNVKLRPDILAHGQKVAAAKLGLPDDTKPFDFV
FHGGSGSEKSEIEEALRYGVVKMNVDTDTQYAFTRPIAGHMFTNYDGVLK
VDGDVGAKKAYDPRSYLKKAEASMSERVVQACTDLHCAGTSIA
379764232YP_005350629.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MPNPSEPDRGGPPNRPGFDPRESRNDPSDEWGAESGPEAGFETGDDATES
VPMVPNDAETETVVINKPDPRSGPQEVPEAPQRERRFTAPGFDAKETTII
STTPEPATEVFATPGQDGTAQFGAPPKAAVPQSIPPRLGGKLRTSRQFNW
GWILAIVVIVLALAAIAILGTVLLTRGKHTGVSQEDQVRHTIGNFDVAIQ
RGDLTTLRTITCGTTRDGYADYDERSWDETYRRVSAAKQYPVIASIDQVV
VNGQHAEANVTTFMAYDPQVRSTRSLDLQYRDDQWKICQSASG
379764231YP_005350628.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAEVRPAGKTGELQNRAMTPMKDLLGPDPILLPGDPDTEAELLAGEKPGI
VAAAHPTASLAWAALAEQALADDQAITAYAYARTGYHRGLDQLRRNGWKG
FGPVPYSHEPNRGFLRCVAALARAADTIGETDEYARCLDLLDDCDPEARK
ALGL
379764230YP_005350627.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MGAGHNHTPAETDDARLIPRMVTAAAILAAFFVVELATSLLINSIALLAD
AGHMLTDVVAVFMGLAAVTLARRGSSSPARTYGWHRAEVFTAVANAGLLI
GVAAFILYEAVRRLSEAPAVPGVPMIVVALAGLAANFAVALLLRSHSSGS
LAVKGAYMEVVADTVGSLGVLIAGMVTVTTHWPYADVVVAVLVALWVLPR
AIALARDALRILSESSPTHIDVEELRSALGAVDGVTGVHDLHVWTLSPGK
DMCTAHLTSTGDPARVLHDARAVLSARGLEHATVQIDCPDDTDCSESF
379764229YP_005350626.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSFPSPQRESVRPSPIFLALLGLTAVGGGLAWQAGYSARPLAYVGVFIFV
IAGWLVSLCLHEFGHAVTAWRFGDHDAAVRGYLTLDPRRYAHPALSLVLP
LVIVALGGIGLPGAAVYVRTWFMTPARRTLVSLAGPAANLVLAALLLALI
RLFFDPTHVVLWAAVAFLGFLQLTAVVLNLLPIPGLDGYDALEPHLNPET
QRALAPAKQWGFVILLFLLLAPVLNHWFFGIVLSLFDLSGVPDVLVSWGN
GLTRFWSRWF
379764228YP_005350625.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTQDDPAAAVLVFTHGRTYGPLRGLRAHRIAGEPDLDAAIGPFPRLVVVG
ADADLAAVLTRLLRAERLDVEVAYVPRRRTRATRIYRLPAARRAARRAVR
GSAQRVTLIRDETGSVVVGRAAWVPPDGERVIHGEAVVDDTTLFDGDAAG
VLVEPTLAMPGLRASLQGRWRRWVTGRAAQLGSTGVVVLRDGVPAPRPGR
RSAFYRNIEGWLLVR
379764227YP_005350624.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MLTTHLGRLGAVLLSAVLLCLASARASADESIVIDLVRHGQSVANAARVI
DTAVPGAALTALGQQQAQDVANVLAAKGPVAAIFASQLIRTQQTAAPLAA
ALGMNVQVLPGLNEIDAGIFNGMPQFSLAGLAYLLAPVAWLLGLRVVPML
APGSADPNGYEFHRRFSGALQTMSGNAATTASGFNDMLARMYGSALANPV
RASDGRIREVAFSSEFDIGIGTMTTVTNPEQLLLLFDPLPNTGIVEIQGN
PHDGWTLVSWNGKPAWPGWAAKRYDRDANGLCLMLDAPSRNGVCAAKPPV
AASP
379764226YP_005350623.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MPAIVLIGAQWGDEGKGKATDLLGGRVQWVVRYQGGNNAGHTVVLPTGEN
FALHLIPSGVLTPGVTNVIGNGVVIDPGVLLDELKGLEDRGVDTSRLLIS
ADAHLLLPYHVAIDKVTERYMGNKKIGTTGRGIGPCYQDKIARIGIRVAD
VLDREVLTHKVEAALELKNQILVKIYNRKALDPHQVVEALLEQAEGFAHR
IADTRLLLNTALESGETVLLEGSQGTLLDVDHGTYPYVTSSNPTAGGAAV
GSGIGPTRITAVLGILKAYTTRVGSGPFPTELFDENGEYLSKTGGEFGVT
TGRRRRCGWFDAVIARYATRVNGITDYFLTKLDVLSSLETVPVCVGYQID
GARIHEMPMTQSDLHRAEPIYEELPGWWEDISHAREFDDLPAKARDYVLR
LEELAGAHVSCIGVGPGREQTIVRRDVLAARA
379764225YP_005350622.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTDPEPNPIDLDPEYEHHGGFPEYGPASPGPGFARFVASMRRLQDLAVSA
DPGDDVWDDAADRVAALTELLGPFQAEAEGQAPAGRTPDLPGMGSLLLPP
WVLTRYDPEGVEMTGHFSRFHVGGNHAVHGGVLPLLFDHMFGMISHAANR
PISRTAFLHVDYRKVTPIDVPLLVRGRVTGTEGRKAFVSAELVDEEQTVL
AEGNGLMVRLLPGQP
379764224YP_005350621.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTDGRDDETTALVVPPPAPADARPTVLLLGSGEISRELAIALGRLGARVI
AADRYPHAPAHGVADQALVLDMTDADELAQAIGRLQPTLVVTTTDAVATG
ALDALDGELVPSARAVRLTADREGLRRLAADELGLPTAPFWFVGSLGELE
AVGAHAGYPLLVKPVAGPTGQRQSVVARREDIEPAWRRAVGDQSSARVLA
ETVVEVEFYVTLLAVRSEGPSGPAIEFCSPIGHRGSDGQVLESWQPQKMS
AAATDAARSIAARIVKALGGRGVFGVELMVNGDEVYFADVTSRPADSAWV
TLRSQRLSAFELQARTILGLPVDTMMVSPAAARVAGPADPHDPAALIGAL
SVPESDLRVSGSGFRALATAPEVTAARERAGQAAERLAAPAPRG
379764223YP_005350620.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSTERGHSYAGDISPLEAWKLLSDNPNAVLVDVRTDAEWRFVGVPDLSSL
GREVLFLEWNSSDGRPNANFADQLREQVAPAETDADRPVLFLCRSGNRSI
GAAEVATQLGITPAYNILDGFEGQLDANGHRGESGWRAIGLPWKQG
379764222YP_005350619.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTPADHDSVRTPAPLPEGVSQATIGVRGGLLRSGFDETAEALYLTSGYVY
ETAAVAEQSFTGEVDRFVYSRYGNPTVTMFEERLRLLEGAPAAFATASGM
AAVFTSLGALLGAGDRLVASRSLFGSCFVVCNEILPRWGVETVFVDGDDL
SQWEQALSVPTTAVFFETPSNPMQSLVDIAAVTELAHAAGAKVVLDNVFA
TPLLQQGVPLGVDVVVYSGTKHIDGQGRVLGGAILGDKEYIDGPVQKLMR
HTGPAMSAFNAWVLLKGLETMAIRVEHSNSSAYRIAEFLETHPAVSWVRY
PYLSSHPQYDLAKRQMSGGGTVITFALDCPDSRAKQRAFEVLDKLTLIDI
SNNLGDAKSLVTHPATTTHRAMGPEGRAAIGLGDGVVRISVGLEGTDDLI
ADIDRALS
379764221YP_005350618.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MVIIGSGFGGLTAAKALKRAPKGTEVEVTVISKTTTHLFQPLLYQVATGI
LSEGDIAPTTRLILRRQRNVRVLWGEVSAIDLTAKTVTSHLMGMETVTPY
DSLIVAAGAQQSYFGHDEYAAFAPGMKSIDDALELRGRILGAFEAAEVAT
DPAERKRRLTFVVVGAGPTGVELAGEIVQLAERTLAGAFRTITPSECRVI
LLDAAPAVLPPMGTKLGLKAQRRLEKMDVEVQLNAMVTAVDYMGITIKEK
DGGERRIECACKVWAAGVQASSLGAMLAEQSDGTETDRAGRVIVEPDLTV
KGHPYVFVVGDLMSVPGVPGMAQGAIQGAKYAATVIKHALKGEDNPADRK
PFRYVNKGSMALISRYSAVAQVGKVEFAGFFAWLAWLVLHLYYLIGHRNR
LAAMFAWGISFLGRTRGQMAITSQMIYARPLVNWVEQQAAEGTLAAAERA
ETAEQKAAG
379764220YP_005350617.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MARHASTVRRRTHERRGRRARGCAARRSHRASRRSRRGRKCVRPSRSRRL
WGRHNPKWRVW
379764219YP_005350616.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MGVTARRVRGTIALLALGAAAGLPVAGADPAAALPPMASSGSGPIIGGGS
AAAQGIAQQLFSFGNPNVVQEVDGSDAAQFITSAAGAANPQLAGPFSLLR
RALACQTDNSGFGARAYRRSDGQWGGAMLVAAKSATPSLDGLVGCVKTNW
RRTAAGGETAMCNNGWTTPTSYDSRRGETYYILLAGTAADFCSDLNAKYK
SDASAWPF
379764218YP_005350615.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MATDVADYSALPAEEAVRAARVSSRRRQVLDAAVKVMGRTGFHQMSMQDL
ATEAEVSVGLLYKYFGGKEDLLLATIVRILDAFRDQLAPVIAAAGDDVVD
QLTAGVRRYIQIVDENLDGVVLTYRESRTLGAPGRTQIKDLEIATAAPLR
AVIEAGVAQGVFRGVDVDLTVFDIMLLAHGWALKHWHFGPTYTLDEYIAL
QIGHVLGGLIADDRRVDYAHVLE
379764217YP_005350614.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSRLTYTHEHHQFRELVRDFVRQTVAPNHESWERDGQWDRSLFIEAGKLG
LLGFSVPEHLGGPGVDDFRYNAIVIDELQRAGAAAEAIAFTLQNDVVLPY
LTDLTTPEQQQRWLPGVVTGETVLGIGMTEPGTGSDLAGIRTTAVRDGDD
YVVNGAKTFISNGQVGDLFVIAARTSPDRHQGLSLLVVDADTPGFSRGRN
LEKIGLHAQDTSELTFTDMRVPKDNLLESEGRGFYQLMKNLPQERLALGV
GAVAAAETILAATLDYVRDRTAFGSPIASFQHSQFVLAELATEIDVARTY
LDDCLAEHLEGELTAARAARLKWWTTDLQVRTADRCLQLHGGYGYMREYS
VARAFVDARIQTIYGGTNEIMKTIIAKDLGL
379764216YP_005350613.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSTKTPPAFDRYDPLGLDASLSDDERAVRETVREFCAEHVLPHVAEWFEI
GDLPVRELAKGFGQLGLLGMHLDGYGCGGASAVHYGLACVELEAADSGIR
SMVSVQGSLAMFAIWNFGSEEQKQEWLPGMATGELLGCFGLTEPDVGSDP
AAMKTRARRDGSDWVLNGRKLWITNGSVADVAVVWANTDDGVRGFIVPTK
TAGFSANTIHHKLSLRASITSELVLDDVRLPAEAMLPEAQGLRGPLSCLS
EARYGIIWGSMGAARSAWQAALDYATQRTQFGRPIAGFQLTQAKLVDMAV
ELHKGQLLSLHLGRLKDSVGLRPEQVSFGKLNNTREAIEICRTARTILGG
NGISLEYPVIRHMVNLESVLTYEGTPEMHQLVLGQAFTGSDAFR
379764215YP_005350612.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MVTGAGSGIGRAIALGLAARGDHVVAADLDEAAASATAGEHPDKITALPV
DVADPDQVNALRDRINADLGVPNIVVNAAGWDRTDQFLNATAEFAQKVVA
INYLGPVHVCSAFLPGMIETHGGGRVVNLASDAGRVGSAGESIYAGAKGG
VIALTKSLAREMARHQITVNCVCPGPTDTPLFHAQPEKLKEALVKAIPFR
RLARPDEVAAPVLFFASEAASFITGQVISVSGGLTMAG
379764214YP_005350611.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MDVVGVLVFCALGRRSHDEGLNLTGIATTAWPFLSGTAVGWLAARGWRRP
TAVAPTGVVVWLSTVVVGMVLRKATSAGVAASFVVVATAVTALLLLGWRV
AVGLTLRRRSDV
379764213YP_005350610.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MEVTATFGAAARAVATDKGLLNDPFAEPLLCAVGIDYLTRAIKDHAFAAD
DGDDAAMTALMDALAAHTRFVDEFLADAGRAGIRQVVILASGLDSRAYRL
WWPRGTTVYEIDRPQVLDFKSDVLRGLDATLATNRCAVGIDLRDDWPAAL
RRVGFDAAQPTVWVAEQLLVGYLPPQEQSRLLRGVTAASALGSRLAADHM
PTWNPLQLGAERAFVDGWRRRGLDVDLASLTYPGEYHYVPEYLAAHGWET
RGRDIADLLRTMGLGKRRRTGRGDAEFIPEYVTATRV
379764212YP_005350609.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSPRHAFEFSMMPESIPPDGRLRFVSATHDDPLAQPLLAELAVEYAERYG
GTPSTHLSWLPVPEAELAPPDGGLLIGVVGGVPVTGGAFRRYDAHTAELK
RIWTDAAHRRRGYARALLAALEAETLARGYRRLYLITGNRQPEAEALYDA
TGYTRVAPDPLPSWGPFIPIAFEKWLA
379764211YP_005350608.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MHLARGDAVNWTIVADDTGVMLIDAGYPGDRPDVLASLRELGFDAGDVRA
ILLTHAHIDHLGSAIWFANEYGTDVYCHADEVGHAKREYLEQASVFDVAV
RIWRPRWAAWGLHVVRSGGLIRDGIPSTRPLTADVAAGLPGHPMAVFTPG
HTSGHCSYVVDGVLVSGDALITGHPLLKHDGPQLLPEVFSHSQQNSLRSL
DALALLDTEVLLPGHGDVWRGPIREATARAISLAGG
379764210YP_005350607.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTFGGDGKLDELARCKLFGGRFVSEFQFSHEFFLLLC
379764209YP_005350606.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MDSATVSDHFQPWRHEGGHAPFSLAWMTAVGERTKRITLGTSVLTPTFRY
NPAVIAQAFATMACLYPDRIFLGVGTGEALNEIATGYEGDWPEFKERFAR
LRESVRLMRELWRGDRVDFDGEYYRLKGASIYDVPEGGVPIYVAAGGPAV
AKYAGRAGDGFICTSGKGEELYKDKLIPAVKEGAAINDRNVDDIDKMIEI
KISYDPDPKLALENTRFWAPLSLTAEQKHSIDDPIEMEKAADALPIEQVA
KRWIVASDPDEAVEKVGQYVKWGLNHLVFHAPGHDQRRFLDLFEKDLAPR
LRRLA
379764208YP_005350605.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MVSGAATAIYIAAPEPETGKSTIALGLLHRLTATVAKVGVFRPITRSDGG
DRQRGEAGRSGSPQDLENRDYILELLLSRTTAGLSYEQCVGVTYQQLHAD
GDAAIAAIVDAYHAVAEKCDVVVIVGSDYSELGQAIRPAELSTNARIAVN
LGAPLLLTVSGKGRTAGEVADVVKVCLAELDAQHAHTAAVVANRCEPAEL
DAIRKKLDEALRPSSLRSYVLPDEPLLSAPTVAELQSAVRGTPVSGEESL
REREVTGVMVAGMTADHVLERLRDGMAVITPGDRSDVVLAVASAHAAEGF
PSLSCIVLNGGFELHPSIAALVAGLRLRLPIVATALGTYDTASAAATARG
RVTAASQRKIDTAVELMDGHVDITDLLAQLAIPIPTVTTPQMFIHQLTLQ
ARSDRRHIVLPEGDDDRILRSAGRVLQRRVADLTILGDEAQIRQRAGELG
VDLADVTVIDPRASRLRDEFADQYAQLRKAKGVTVEQAREIMRDTTYFGT
MMVHNGMVDGMVSGAAHTTAHTVRPAFEIIKTVPDVSTVSSIFLMCLPDR
VLAYGDCAIIPNPTPEQLADIAISSARTAAQFGIEPRVAMLSYSTGDSGS
GADVDKVRTATQLVRERNPDLPVEGPIQYDAAIEPSVAATKLRDSPVAGR
ATVLIFPDLNTGNNTYKAVQRSAGALAIGPVLQGLRKPVNDLSRGALVED
IVNTVAITAIQAQGGPDGK
379764207YP_005350604.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MLVINSGSSSVKFQLVDPDSGTALSTGLVERIGEEGSPVPDHDAALRRAF
DTLADDGIDLKTCGVVAVGHRVVHGGNAFYEPTPLDDAVIARLGELSDLA
PLHNPPSLKGIEVARRLLPDIPHIAVFDTGFFHDLPPAAATYAIDRDLAQ
RHQIRRYGFHGTSHRYVSEQAAAFLDRPPGDLKQIVLHLGNGCSASAIAG
TRPIDTSMGLTPLEGLVMGTRSGDIDPSVVSYLSHTAGMGVDDVETMLNK
RSGVLGLSGERDFRRLRRMIESGDESAQLAYSVFTHRLRKYVGAYLAVLG
HTDVISFTAGIGENDAAVRRDAVAGMEELGIVLDERRNLGGGKGARQISA
DDSPIAVLVIPTNEELAIARDCVNVLAGS
379764206YP_005350603.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MPFIGSEELASGSLSRHQLRMSYRAVFPNVYVPTHAEVPLELRIRAAWLW
SGRRAVIGGAAAAALHGAQWIPDNVPVELIHTNTHPPRGVLTRRETLCAG
ETQIRDGLAVTTPERTAFDIGRRGAVRSAVVRLDALARATGFKVDDVLDV
AAAHPRAPGVRRLEVALDLVDPGAQSPRESYLRLLLIDAGLARPQTQIPV
LGADGLPFAYLDLGWEESLVAVEYDGDHHRTDRRQFVKDLRRMEMLEEMG
WTIVRVVAEDRPASILRRVREALAKSSVNLGLSV
379764205YP_005350602.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAEPDKQSEKPESGPEAVEDVNPGTQPAEVQTGASTGRLQATQALFRPDF
DDDDDDFPHIALGALDTDTGDRMTVATRALPAVRQLGGGLVEIPRGRDID
PREALMTNPVVPESKRFCWNCGKPVGRSSKKSKGTSEGWCPACGSPYSFL
PQLNPGDIVAGQYEVKGCIAHGGLGWVYLAVDKNVNDRPVVLKGLVHSGD
AEAQAIAMAERQFLAEVVHPQIVQIFNFVEHKDQHGNPVGYIVMEYVGGQ
SLKHGKGEKLPVAEAIAYLLEILPALSYLHSIGLVYNDLKPENIMLTEEQ
LKLIDLGAVSRINSFGYLYGTPGFQAPEIVRTGPTVATDIYTVGRTLAAL
TLNLRTRNGRYVDGLPEHDPVLSTYDSFHRLLRRATDPDPRRRFASTEEM
SAQLIGVLREVVAHDTGVPRPGLSTIFSPSRSTFGVDLLVAHTDVYLDGQ
VHSEKLTAREIVTALQVPLVNPADVAASVLQATVLSQPVQTLDSLRAARH
GTLDADGAELSESVELPLMEVRALLDLGDVAKATRKLEDLAERVGWQWRL
VWYKAVADLLTGDYDSATTHFTEVLDTFPGELAPKLALAATAELAGDVDE
HKHYETVWKTNDGVISAAFGLARSLSAEGDRAAAVRTLDEVPATSRHFTT
ARLTSAVTLLSGRSKSEITEEDIRDAARRVEALPPTEPRVLQIRALVLGC
AMDWLEDNKASTNHILGFPFTEHGLRLGVEAALRNLARVAPTQRHRYELV
DMANRVRPTSTF
379764204YP_005350601.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MIRLPLLRRACTVAATVCVLAGCGHTESLHVASVPTLPPPTPVGMEQLPP
QPPLPPDGPNQDCDLTASLRPFPTKAEADAAVADIRARGRLIVGLDIGSN
LFSFRDPITGEITGFDVDLAGEIARDIFGAPSHVEYRILSSDERVTALQR
GEVDIVVKTMTITCDRRKLVNFSTVYLDANQRILAPRDSSIVKVSDLSGK
RVCVAKGTTSLHRIRQIDPPPVIVSVVNWADCLVAMQQREIDAVSTDDSI
LAGLVEEDPYLHIVGPNMATQPYGIGINLNNTPLVRFVNGTLERIRRDGT
WNTLYRKWLTVLGPAPAPPTPRYLD
379764203YP_005350600.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTVELAHPSTEPQGSRSPAEPAHPRWWFISTTPGRILTIGIVLAALGGIS
AFATSTTINHRQQVLTTVLNHTEPLSFAAGRLYTTLSVADAAAATAFIAE
AEPPPVRQRYEQAITDAAVAVTRASSGLTDEPQVQLLGRINAQLAVYTGL
IEIARTNNRAGNPVGSSYLSEASGLMQSTILPDAARLYRATSERVDVETT
ASTQIPAPVIMVVGTTVVFGAFSHRWLARRTRRRINPGLVVGALAILVMV
VWVGTALTISTTASRSAKDTAAESLKTVTNVAITAQQARADETLSLIRRG
DEEKRKQSFYQRIDSMHRQLDQYMSRSDAVDKPDLEGADQLLLRWRQAND
RISSYISVGNYRAATQVALGSSEEDSTPAFDKLEDELVKAMDQGRIHLRN
DVINARSGLSGAQVGGVVLSLGAAIAVALGLWPRLKEYR
379764202YP_005350599.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MQGDGDGWVISERGAHYWGRYGAAGLLLRAPQADGTPAVLLQHRAVWSHQ
GGTWGLPGGARDSHETPEQTAVREANEEAGLLVDRLAVRATLVTAEVAGI
GGTRWSYTTVVADADELLHTVPNRESAEMRWVAEDEVADLPLHPGFAASW
QRLRTAPALLPLGHGDERRQYLPRTIEVEAGVFVWCMPGDADEVPSQLSR
RISSLLPAPN
379764201YP_005350598.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MDRRLSVLATARLYLCTDARRERGDLAEFADAALAGGVDIIQLRDKGSAG
EQRFGPLEAREELAACEILADAARRHGALFAVNDRADIARAAGADVLHLG
QGDLPLDVARDIVGPDVLLGLSSHSADQAGAAAVSEADYFCVGPCWPTPT
KPDRAAPGLGLVRAAAGLGTDKPWFAIGGIDAQRLPEVLDSGARRVVVVR
AITAASDPRAAARRLSSALAAAS
379764200YP_005350597.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTGMPSGPPLGSLAVIGGGVIGLAVARRAAQAGWSVRVHRSGERGASWVA
GGMLAPHSEGWPGEERLLRLGLESLRLWRDGGFLDGLPAGVVTARESLVV
AVDRADAADLRTVADWLSAQGHPVVWESAARDVEPLLAQGIRHGFRAPTE
LAVDNRAVLDALEAECERLGVRWAPPVHDLSAVEADAVVIANGIDAPALW
PGLPVRPVKGEVLRLRWRKGCMPLPRRVIRARVHGRQVYLVPRADGVVVG
ATQYEHGRDTAPVVSGVRDLLDDACAVLPALGEYELAECGAGLRPMTPDN
LPLVHRLDARTLVAAGHGRSGFLLAPWTAEQIVSELAPVGAH
379764199YP_005350596.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MIILVNEKEVDVDAHTTVSALLDSLGFPDRGVAVAMDDAVLPRSRWATEL
SELPGAPVRLEVVTAVQGG
379764198YP_005350595.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MADSKLTIADRSFASRLIMGTGGASNLAVLEEALVASGTELTTVAIRRVD
AEGGTGLLDLLNRLGITPLPNTAGCRGAAEAVLTAQLAREALNTNWIKLE
VIADERTLLPDAVELVRAAEQLVDDGFVVLPYTNDDPVLARRLEDAGCAA
VMPLGSPIGTGLGITNPHNIEMIVAGAHVPVVLDAGIGTASDAALAMELG
CDAVLLASAVTRAADPPAMAAAMSAAVTAGYLARRAGRIPKRFWAQASSP
QR
379764197YP_005350594.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MKRYVALGSSMAAGPGIRPRAAGAPRWSGRSARNYAHLIARRYGYDLVDV
TFSGATTANVLAERQRGAPAQVDALDGSEGLVTITIGGNDVGYVPLLMAA
ALPRPLRRVPLLGDRIRELLDPDARDQALDAVFESLCAVGRAVRQRSAGA
RIFFVDYLTMLPPAGTPAPPLSPADADLGRHVAATLERMTADAAAAAGCG
IVHAAAASREHHAWSAEPWTTLPARYGVPLPGRPAPLHPNPAGMCAVADL
IAAQL
379764196YP_005350593.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSHLITALRVASAAAFTGGLVLAGSATAVAEPNTGSATDMNTLAASLSKG
YGLNNCKPQELTETGELAELLCGQSPDSGGPGSGVYALFSNSTNLGSAFS
STIKDVSLAACGDAGQSPGTWKQNGQTGGQIACGTYKNYATLTWTTDAKN
VLGHLTAANADVNALYQWWRTNG
379764195YP_005350592.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSDFSNALKTAMAMALTAGFALAGGVTAAADPAGTGNSSDINTLAATLSK
GYGLNNCTAQNIDRGRQLAVLTCGQSPDPKGPAQAKYVLFTTAENLATEF
RATIKEDVLTPCGDANQSPSSWHKDGSAANAGQAACGTYQNAAEIIWTTD
AKNTLSYLRASNTDVNALYQWWRANG
379764194YP_005350591.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MKKSDPRNDGRGASAASAHRPEDPIVARPQRHSIFDASNCPCGPLPWGFA
GDAPN
379764193YP_005350590.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTQPPPPPPPPGYPPQQPAAQAPNNYLVWSILVTLFCCLPFGIVAIVKSS
QVNGLWAQGRYAEAQASAESAKKWAIWSAAIGVVVGIIYVILMSVGALNT
NTNAALAAMF
379764192YP_005350589.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MVAASTTLMCAAIWAGDPTTPNGPLPVCPTKALLGIDCPGCGSLRMLYSL
MHGNVLAAARFNALGLAAVVLLVWAYLAWTYGHVVGRRVRSWQHRRWAAA
VTLSLVLAWFVVRNIPFAPFTALYV
379764191YP_005350588.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MVNKLATLPAALAVIALTAFSTGCSHRSGSEQTTGAAEFASALKGKVTTD
AMMAHLSKLQDIANANNGTRAVGTPGYEASVDYVVNTLRDSGFDVQTPEF
SARVFHAEKPELTVGGRPVEARALDFSLGTPPGGVSGPLVAAPANSLGCA
AADYGDLPVRGAVVLVDRGTCPFAQKEDAAAQRGAVAMIIADNVDEEQMG
GTLGPTTEVKIPVLSVTKSTGVQLRGQPGPTTIKLDASAQSFKARNVIAQ
TKTGSDANVVMAGAHLDSVPEGPGINDNGSGVAAVLETAVRLGSSPPVHN
KLRFGFWGAEELGLIGSRNYVESLDLAALKNIALYLNFDMLASPNPGYFT
YDGDQSLPMDARGKPVVPEGSAGIERTLVAYLKSAGKTAQDTSFDGRSDY
DGFTLAGIPAGGLFSGAEGKMSADQAKLWGGTADQPFDPNYHQKGDTLDH
IDRTALGINGGGVAYALGFYAQDLSGHNGVPAMEDRVRHVLAKS
379764190YP_005350587.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MNPRWGATLLLIAALVAGCSSTRPAPHAATPDLGHGLAKKITVEGMVTHL
RALQDIANANGGNRADGTPGFNASVDYVAKALRDKGFDVQTPQFDRLYTV
SMGKPSLTVAGRTYPVDQASLLVQTPPGGLTGQPIRPAQPSGCAAHDYPA
AMPKGAIAVVDDTRCSVVDKQNAALAKGASGLIVLSAPTGRGAPPTLFSP
GYFKQLTVPVAVVNPYGASALTGVTAPIRLVLDAVNTKITSRNVVAQTKT
GSPHDVVVVGAQLDGSRAGPGINDDGSGVAAVLETARQLGPLAPVNNAVR
FVFWGAEAEGLNGVMDYVFGMDRDQLNDIALYLNFTMLGSPNAGFFTDDG
DQSGPPGPGVFAADVPEGSAGIERTLAGYLNLAGKRPADMPLNSRADYHP
FMVAGVPIGGLTTGSSQTKTTVQARLWGGQAGVPFDPNFQSPRDTVDNIN
REALGIMGSGVGFAVGSYAESIGGVNGVPSHDKRHRTRMP
379764189YP_005350586.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTDGETVHRAVREHHVVFHLAANINVDQSLGDPESFLETNVMGTYRVLEA
VRRYKNRLIYVSTCEVYGDGHNLRDGELLDETAELKPNSPYGASKAAADR
LCYSYYRSYGLDVTIVRPFNIFGVRQKTGRFGALIPRLVRQAINGENLTI
FGDGSATRDYLYVSDIVRAYNLVLENSALRGRAINFASGINTRVKDIVEY
VAGKFDAKIERREARAGEVARFPANIDFAKSLGFKPEVGIWEGIDRYIQW
AKDQPQYSYQQDGVSGVLSPL
379764188YP_005350585.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSMRGGEFDGEFLTSLRQEVDAWSAHDALAQLVAMFGGVFPRHANLAARL
AALDEFSEVWDYRGRARARRGGEQVRCQDADGGARWMIPRLDLPDRQLDT
ITTLAQQLGLTDESRRTDATFDYMLVIGTGRYSNMLRARWARNLAAENRV
GHIVLAAASRQLLPSEHDAAASCAPGARTEFELLAAAATDAFGVDTREAV
RHGRQRVGDPHRGQMVWRFSEDSNDVGLPITLLEAPSPDPNNRRATSADT
FTFTARSLDMQRSSCLLVTGQPFVPYQNFDALRTLTLPFGIGIETVGFGI
DRYEGLHDMDLQHPAKLLQEVRSTIRAGRSLLERVEAAQLTATRRR
379764187YP_005350584.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MRILAVTRAHNAGETLADTLDSLAAFSDEIYAIDDRSTDDTAAILANHPA
VTNVVRARADLPSTPWLIPESTGLDLLYRMADFCRPDWMVMVDADWVFQI
DVDIREVLARTPQDVAALMCPMVSRWDDPDYPDMVPVMGTAEALRGPFWR
WYPGLYAGSKLMHNSHWPANITDHGRIGRLDGIRLTHNGWSTLEERIARV
RHYMRLDPDFRHNFGVAYDRSLLFGYALDEVDLLKADYRRRVRGDFDRTE
PGARLPIEAEPRAIGRGYGPRADGFHPGVDFAADPGSPIYAVISGTVCRT
GEVDHLCSVTISDGDSEIRYVFRPGDATHIAVGDRINAGTQIGSIGAEGQ
SADGYLHFETRVRGAHVNPLRLLGNMGLRPWPPPGRLRAVSGNYPPATPC
TITADG
379764186YP_005350583.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MYAILWPEWCGTAEEKVRIGRRIPGGGGASEKGGLAVRRDDDSWDLTSHV
GATATLVAAGRARATNSAEPLIEDPFAEPLVRAVGIEFLIRWATGELRAS
DVDDPEAAWGLQRMTTELVARTRYFDQFLADATATGIRQAVILASGLDTR
GYRLSWPPGMTVYEIDQPDVLAFKAETLAQLGAEPTAHLRMVQADLRHDW
PAALLRSGFDPAQPTAWIAEGLFGYLPPEAQDRLLDNVTHLSASESQMAM
ETFVGSSDLDSQRVEEIIRGATRSWRDHGFHLDIWSLNYSGARSDVSDYL
DNHGWRSVGTTAAQLLADHGLPAMPGNHRPPSDKPSYYISVLA
379764185YP_005350582.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MWDPGYRESAIAPTRTGANKRRSTTTTLARTQTVDADEVHDELGGRVM
379764184YP_005350581.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MVMSSIASAEAVVVTASDRLEVLFEELAELSGQRNAIDGRIVEIVAEIDR
DQLCGVTGARSVPALVAWKLGCSSANAHTLAAIAARLEEFPRCTAGMREG
RLSADQVGVIAAHAGEGSDEHYAQLAAVATVNQLRTAVKLEPRPQPEPRP
DPGPERSITTTTDEAGSCYRIRLPHHDAAKFHAALASHRDALIAEWKRDH
DNGEHAGAQVPPLPTTADAFMRLVEAGWDAEATRRPHGQHTTVVAHLDIE
QRVAALHLGPLLPDAERRYLTCDATCEVWFERHGEVIGAGRTTRVINRRL
RRALEHRDTMCAVPGCGATRGLHAHHIRHWEDGGPTELANLVLVCPYHHR
LHHRGLITITGPADALVITGEAGRILSPGSLAHPPTGPPPAVPPCPGPTG
ERAHWWWYDPFQPQPPPTNN
379764183YP_005350580.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MPRTDDDSWDLASSVGVTATIVAAGRAMATKDPRGLINDPFAEPLVRAVG
LDLFTKMMDGELDMSAIADVSPAVARAMVDGNAVRTKYFDDYALNATGRG
IRQVVILASGLDTRAYRLPWPTGTVVYEIDQPQVMEFKATTLARLGARSL
TTLRAVSVDLRADWPTAVRAAGLDSAAPTAWLAEGLLMYLRPEDQDRLFD
NITALSASGSRVATEFVTSIVDFDAERARTISNPFRDHGVDIDLASLVYT
GQRNHALDYLGAKGWQLEGVPLAELFRRSGLDAPAPDDDDTLFISGALA
379764182YP_005350579.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MVETAQRADLGVAFDELDAKINAGMDAYAIPGVAVAIWVDGQEFVKGYGV
TNVDHPLPVNGDTVFRIGSTTKTFTGTAMMRLVEQGKVDLDSPVRRYIHD
FAVTDESVGATVTVRQLLNHTGGWDGRNGQDFGRGDDAVARYVDAMTHLP
QLTAPGTAFAYNNSGLVVAGRIIELVTGTTYESAVQKLVLDPLQLAHTHY
FSDQIIGLNVAAPHAVVGGRPIVESEFWAFPRSCNPTGGLMSTARDQLRY
ARFHLGDGSAPNGEQILSRRSLEAMRSNPGAGGTLWVELTGMGVTWMLRP
SAENVTIVEHGGTWKGQRSGFFMVPDRDFAMTVLTNSDGGFHLINDLFAR
DWALRRFAGISNLPAAPQRLGPADLAPYEGRYVAGQVSQNGSLEHTVIEF
RARDGQLAGTLTDANPDGPDTAELGLAFYRPDYGIDIGPDGKPTGSRSNF
VRGADGNIAWFCTLHGRLFRRQ
379764181YP_005350578.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSPVGMRLVMNSHALRSALVWAAAVLVVAGCTTFVDGRALSMLNDPFLVG
GLPATNGPSGIRSNAPSPTGKVLNTDNGPIDRLALLSVNDIEDYWQSAYS
RSLKGTFAPVSKMVSYDSNDPSSPIVCHNDTYKLVNAFYTSRCNLIAWDR
GVFMPVAQKYFGDMSVTGVLAHEFGHALQQMAKLVTRRDPTIVHEQQADC
FAGVYLFWVADGKSPRFTLSTADGLDHVLAGIITTRDPVMDSETENDDAH
GSALDRISAFQMGFLTGASACAAIDRREIEQRRGDLPNALRVDFSTGTPE
TGEVPINQDTLSTLMELLGKIFAPANPPVLSYQPANCPDAKPTPPASYCP
GTNTIAVDLPKLAVMGRVADESEQSLPQGDDTALSLVMSRYALAVQHERG
LPMQSPWTALRTACLTGVAHRKMAEPIELPSHNQLQLTAGDLDEAVAGLL
TNHLVASDADGTSVPAGFTRIAAFRGGVTGNADACYSRYPG
379764180YP_005350577.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MELGLHFIDFLPGDPARLGPTLADAAKAAEQGGATLFTLADHFFQMEELG
PAQDPFLEGYTSLGFLAAQTATIDLTLLVTGVTYRHPGVLAKTVTTLDVL
SQGRSMLGLGAAWYEREHTALGIPYPPLSARFEMLEETLQICRQMWSDDD
GPYEGAHYRLAETICVPQPIRRPPILIGGDGEKKTLRLVAQYADIWNSMS
NDVEELEHKIDVLHRHCDAVGRNPADIRKTSGGLATTDPFENIDEYLKTA
ERYARLGVDMINVGPLPGNPDPVGFVRRLGDEVIPRLAEIG
379764179YP_005350576.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MDGISDSAAAAARDIRVVFSRLRRRLKDIAVDGLTPSQTAVLTRLWKEGP
SSASALAGAEQVRPQSMATILAGLGQRGLIERSPDPNDGRRQVVSLTPAG
RKRAESDRRAREEWLARTIQERYTEAERRVIVDALSLLERLTEH
379764178YP_005350575.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MRYNLPYRRRRPTGPPSGSAATDRAGIVEAITVCRDLAPGPLIAGGHSYG
GRQTSMVVAAGEAPVDVLTLFSYPLHPPGKPERLRTEHLPDITVPTVFTH
GTSDPFGTPDELRTAAALIGGTTAVVEIASARHDLRSKTLNVPALAVDAA
LQLLGRE
379764177YP_005350574.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSFLPLPAPGTTPLRVLSIAGSDSGGGAGIQADMRTMALLGVHGCVAVTA
VTVQNTVGVKSFHEIPDDVVAGQIEAVVGDIGIQAAKTGMLASPRIIDTV
ATTWRRLGLTVPLVVDPVAASMHGDALMAPAALDSLRNQLFPLATLVTPN
LDEVRLLVDIDVVDPASQRAAAKALHALGPRWVLVKGGHLRSSDRSCDLL
YDGTSYHEFDAERIATGNDHGGGDTLASAAACALAHGFTVPEAVGFGKRW
VTESLRASYPLGHGHGPVSPLFRLS
379764176YP_005350573.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTTGPIAGSHKIYRDVAGGRVPFRRVDLSNGDHFDLYDTSGPYTDPDATI
DLAAGLPARPGVVRDRGTQLQRARAGEITAEMAFIAAREGMPAELVRDEV
ARGRAVIPANHNHPEIEPMIIGKAFATKVNANIGNSAVTSSIAEEVDKMV
WATRWGADTIMDLSTGKNIHETREWIMRNSPVPVGTVPIYQALEKVKGDP
TELTWEIYRDTVIEQCEQGVDYMTVHAGVLLRYVPLTAKRVTGIVSRGGS
IMAAWCLAHHRESFLYTNFEELCEIFARYDVTFSLGDGLRPGSIADANDA
AQFAELRTLGELTKIAKSHGVQVMIEGPGHVPMHKIVENVRLEEEWCEEA
PFYTLGPLATDIAPAYDHITSAIGAAIIAQAGTAMLCYVTPKEHLGLPDR
KDVKDGVIAYKIAAHAGDLAKGHPHAQERDNALSQARFEFRWNDQFALSL
DPDTAREYHDETLPAEPAKTAHFCSMCGPKFCSMRITADVRAYAAEHGLD
SEEAIEAVMSEGMAEKSREFAEHGNRVYLPLAQQ
379764175YP_005350572.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MQAGDPSTNGDGARSRGPSEYLNIGTFRFWFGGQRWEWSDEVARMHGYEP
NDVEPTTQLLLSHKHPDDRAHVQELLDYALQSEGSFSSRHRFLDTAGTVH
DAIVVADRMLDESGAVLGTEGYYIDLTDTLDETRQEVLDEALPDLVESRA
AIEQAKGVLMSVYRVSAQQAFRVLQWRSQETNVKLRALAKQLLDEMANLP
APSTAVQSQFDHLLLTVHERISSEPAD
379764174YP_005350571.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MMAEKKSRRQTSQRDAVEKIREGETFVVNLPAIGQVQIPRPEQLAYFGGL
AALAAFELIDWPVAVVIAAGHLLASNHHNKLLEELGEAMEEV
379764173YP_005350570.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSITTSLRRSLPSRLISAGLQATTELARAGIETGIDVATIPLREGAKALS
GELSRATLRRHCWRGNGRAWIEVRGLADAADGPLSSTVLEAILAHPGVAS
AKLNRPLSRVVVDLDDPATSLSDLCRVVEEAENRCPPTQDAGQPVSASLP
GDGLVLATRAVTVAANAAGLGVALFGRATRLPRLPVTIAAGITFFDYQPW
LRRRLEDRIGGPATDTVMTLVQATSQTLSQSPTSLSLGLTMQSLKVAECR
AEARAWEQHEPELARHADQPLTHRSPRPQPSRGMERAPGRFALLQALSAG
AIGAGTRNLNMAATAVQVTTPKANRTTPEAFAATLGRGLAERHSVLPLRP
ESLRRLNKVDTIVIDPRVLCTDTLRVSRIRGADDSELPAAWNRAQLMLEN
SGLRAGWRKVSGISSGRSGAQVEALFLPAHDPLASAVVGEANRAGAQLVT
VDHESLDELRPAFDEVRPLKSGTDKSIDDALAAAVDDLQEAGRTVAVLSS
TAAQAISSAHLALGVLPQDGVGAPLWNADLLLPDLQAAWRVLHALPAAAA
ATQRGIGISAGATAMGSLFMIPGVRGNLGAETVNVGAAAGLLSGYLLARG
VLGADTPRPAAMHEWHAMSVEQVRKALPEQDSAAPVPTERGTPAALRLAE
TPAQAVWQLAKAVRAELSDPLTPVMALGSAASAVLGSPVDAMLVGTVLTG
NSILAAAQRLRAEKRLSYLLAQQTPPARKVIVGPDGARTYTLVDAAQLRP
GDVIEVRTHEVVPADARVIEEVDVEVDESALTGESLSVEKQVEATPGAPL
AERRCMVFAGTTVVAGTALALVTAVGPDTQQRRAADLISGELSSDIGLQH
QLGQLTTKALPVSITGGALVGALGLLRRLPLQHAVGSAIAIAVAAVPEGM
PLVATLAQASSARRLTKFGALVRVPRSVEALGRIEVVCFDKTGTLSENRL
RVSQVHPAPGYSREEVLRCAVHAAPVTNGGTQVHATDVAIVEAGSAVDGS
ASAPPTAHLPFRSGRSFSASVTGTELTVKGAPEVVLAASGDTGAMEGTVA
ELAAGGLRVIAVARRELTAQQARAIAENPDDIAEYCTGGLTLTGFLGLSD
TPRAEAAKLLADLGGLGVGVKLITGDHPITAKAIAAELGLNVTADQVISG
AEWEALSRKDQERVAAERVIFARMTPENKVQVVQALENADVRTAMVGDGA
NDAAAIRSATVGIGVVAHGSDPAHLVADVVLVDGRIDALMEAIREGHQLW
RRVQSAVSVLLGGNAGEVIFAIIGSAITGTSPLNTRQLLLVNTMTDALPA
AALAVSKPSGPIDPRLRGADQAALWQAVTIRGVTTAAATTAAWAMAGLSG
PLSSPQRASTVALVALVGTELGQTLVESQAPLVVLTALGSLGLVGVLIST
PGVSQLLGCTPLGPFGWAQGLGAAAAATVATGVLSRALTGRDKSNPEPPP
DPAEPPAPSSESRPPRRATTAHRVPVTAP
379764172YP_005350569.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MGVVDGAVRSVGRTLNRAASVTTSTAGAVGGAAVNGVVGGIKGAADGIQQ
GISKGSKSTTAAAVGLGALGAIGLIEWPVLLAVGGGALVLQRIARQQKES
APPSRAKLTTVPTKPEPEPQTRKSPPQKAPTKRAAASKPAKKATGRRAGS
AALRSTN
379764171YP_005350568.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MRIATWNVNSIRSRLPRVLDWLARTDVDVLAMQETKCSDSQFPTLPFFEL
GYEVAHVGFNQWNGVAIASRVGLDDVQIGFDGQPTWSGKPEVAAVAEARA
LAATCGGVRLWSLYVPNGRALGDPHYAYKLDWLAALRDSAEGWLRDDPGA
AIALAGDWNIAPQDDDVWSMEFFAGATHVSAPERRAFNAIVEAQFTDLVR
PFAPGPGVYTYWDYTRLRFPKRQGMRIDFILGSPALASRVTDARIDREER
KGKAASDHAPVLVDLRVD
379764170YP_005350567.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MISWPALGTRVMIRYRLAEGSIPPLTDAVGHLLSVDPVVRLQTKTGAVVE
CSPADVVMLRVLTFAPVRTSDIRALEHAAAMAWPGVEHAWLEGWLLRAGS
PNNRDTELPANSAVPLDLSARLGTVPAIVDWYERRGLTTRLAIPDRLLSV
PTGSTGEQPESVLVRDVSEMAAREPDPSAGLSARPDDAWLSIFGPEVDVD
VLTAVGNGELMFGTLGGAAVARAAVTDAPDGARWIGLSAIRGDDRAATAL
CEALLAWGAGRGATRGYVAVPDAEADTGWLGFRLHHHRRYFPVRQGA
379764169YP_005350566.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAVVPIRIVGDPVLHTPTKPVPVAADGSLPAELPALIADLYDTMDAAHGV
GLAANQIGVGLRVFVYDCADERGRTERRRGVVVNPVLETSEVPETMPDPD
NDDEGCLSVPGESFPTGRAKWARVTGLDADGNPVALEGNDLFARMLQHET
GHLDGFLYLDRLVGRHARSAKRAVKSHNWGVPGLSWMPGEGPDPFGH
379764168YP_005350565.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MDSAMARANRSGDDSEVADGLTRREHDILAFERQWWKFAGVKEDAIKELF
SMSATRYYQVLNALVDRPEALAADPMLVKRLRRLRASRQKARAARRLGFE
VT
379764167YP_005350564.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MVMVLLFLGVIFLLLGWQALGTSGSSDDDSASPVPSATATASATSTSNKP
AATQAEVQVYNISTKEGVAARTGDQLTSAGFKVIKVDNMTVPDVSSTTVY
YTDADDEHATADAIGKKLGAPVEPRIPALSGEPPGVIVLVAG
379764166YP_005350563.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAKLPPSLVLAGCAALLGACSTPQYASSVPGTTPAIWTGSPSPSGAKAAE
AGPAEVPTVTTHLKAPDGTQVAIAKFEFNNGYATVTIETTANGVLAPGFH
GVHIHKVGKCEPNSVAPNGGAPGDFLSAGGHFQVPGHATEPASGDLTSLQ
VRKDGSGTLVTTTDAFAMEDLLTGQKTAIIIHADADNFANIPAERYNQTN
GTPGPDETTKSTGDAGKRVACGVIGAG
379764165YP_005350562.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MPAKRRDARIDFARSSRPTIGVEWEFALVDAQTRDLSNEATAVIAEIGEN
PRVHKELLRNTVEVVTGICQTAGEAMEDLRQTLGPARRIVRDRGMELFCA
GAHPFAQWTTQKLTAGARYAELIKRTQWWGRQMLIWGVHVHVGISSPNKV
MPIMTSLLNYYPHLLALSASSPWWTGVDTGYASNRAMMFQQLPTAGLPFQ
FQTWSEFEGFVYDQKKTGIIDHVDEVRWDIRPSPHLGTLEMRICDGVSNL
RELGALVALTHCLVVDLDRRLEADESLPSMPPWHNQENKWRAARYGLDAV
IILDADSNERLVTEDLDDVLNRLEPVAKKLNCVDELAAVAEIPRQGASYQ
RQRRVAEEHDGDLRAVVDALVSELEI
379764164YP_005350561.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MMESLELAMFPLESALLPDQDLPLRIFEPRYGALVRHCVDTGDPFGVVLI
SRGREVGGGEERCDVGVLSRITECVDQGAGRYALRCRTGERIRVREWLPD
DPYPRARITLWPDEPGPEVSPAQLLDVEDRAVALFERIAQARGITLPGRE
VLLGHDPQAPAGERLFALASRIPIGTADRYTVLAAPTAAERLAALSEAVN
AVAEVVEFQLSE
379764163YP_005350560.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MKVHLQVDGSPAGAAASAADIAATGADGLFTFEGQHDVFFPLLLAAGTTG
LDLMTNVAIAPPRSPLHLAHSAYDLQCYSGGRFRLGLGSQIKVHIEKRYG
SKWDKPAARMAEAIAAIKAIFAAWENQGRLDFRGEFYTHTVMAPNFNPGP
NPFGPPPVLLGALGPVMTRTAAEVADGLLVMPFNSARHFAERTVPAIAEG
LRRSGRAFGEFTVIAQAMVAVGRDEADLAAAVNGVASLIAFYGSTPAYLP
VLQVEGWDDVQPELNALSKQGRFAEMRRLVSDEMVARIGIVGTPEECARQ
IAGRFGEHAGEVCCYFPGYTPRDADIADLIGALHRAPALP
379764162YP_005350559.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSDDLTVEIDSGVAVLTLNRPEQLNAYTAEMGALLSRAYRECDEDDDVRA
IVVTGAGRAFCAGADFSGGASPFDAPAADGTFSASPITPAAFELRKPVIA
AVNGHAIGIGLTIALQADIRILAEDAKYGVVQVRRGVIPDCMAHWTLTQL
TTLGVAADILLTGRTFGGAEAVTLGIANRALPGERVLDDALTAARDIAVN
VAPMSVALCKRLLWDSAIHHYTPRQVAALETRLHERVMGGADAAEGVAAF
LDRRPPNFTARLSQDWTPLPEP
379764161YP_005350558.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MDRMTEHPTALQIVEGIDLSGKTCVITGASSGLGRESARALAAGGAHVIL
AARNPEALAETARWIASEVPAARTSTVSLDLTDLSSVRAAASAVAGITPV
VDVLMNNAGVMFTPFGRTRDGFELQIGTNHFGHFELTRLLIPQLTAAGAA
RVVILSSGGHVMGDVDVDDPNWERREYDKFAAYGASKTANVLHAIEADRR
LRDAGIRAYAVHPGTVATALARYMSRSDFSALRSLVAENSREPSDGFLDF
VMPEHGAATQVWAAVSPDLAGRGGLYLQDCGIGEAAPHARDERRAAQLWE
LSERLCAAH
379764160YP_005350557.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MHMSDGPDQPADAADPVARADTEWRSALATFGPHHESTLTALLALASARW
TAGDSLGAVHDAGQVLAVRRETLGDEHPSTLGVAGLVAIWRYHRGDEGSV
DELRELVPVMTRVLGAEQADTLWVTHTLAAAEDAGGDPAARLLRWVQLCG
AETRVFGPRNELTLAAAFGVAQARHDLGDPFGASTDALIVVGYRRRLLGE
HHPHTLAAQLSRLTWLGEAEGINDHTLNEFDELIVALQNTLGHDHEHTLI
ARYNRAVWTPETADEVERVSEWEVLAEDLARVLGEQHPVTVEAAQRLGAA
RAEWEDSVNETRNIAFDLFVDAESEDREIDVMPGRDWMDPGNLDDDAVAK
VAEDADEQRSERVDLMEHAVEVKRALARCARTLGNDHIETLQWRYYLAWW
LWNGHEFDPAAARTRKLIDDGGRVLGEDHPLIDATRTLDHHITNRVWGGL
SPFWDGSALV
379764159YP_005350556.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MERLPYIDEHAITLDANRADTWSALLRVMCRDPHDATTVPVGFVLDEARA
PARFALKGRHWFAIYRWVFELDELDGTARTRLRAATWAAFPGIHGKAYRA
LVIGTGAHRVAVRWTLKRVAARVHSRSTPVP
379764158YP_005350555.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MILDAARALVLDGGPRAASVAAIAKTSGAPAGTLYHRFGNRDGVLTAAWL
RALERFQARALAADGDTPADTAVAMAVAAVGFARALPEDARLLLTIRPGD
LLDEEPDAAFRQTLTAMNAPLTERIAVLARQLYGNARPRSVDAVARAVAD
LPYAVVRRHAHDDPMPSWLEKDVAASALAVLNSFGERP
379764157YP_005350554.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTARLNTSAVDSRRGVIRLHPSAVAALGIREWDAVSLIGSRTTAAVAGLA
GPGTPVGTVLLDDVTLSNAGLREGSAVVVGAVTVYGARSVTLSGSTLATQ
SITPDTLRQALLGKVLMVGDAVSLLPRDLGPGTSTSAATRALATAVGISW
TSELLTVTGVDPVGPVSVQPNSLVTWGTGDVASGAATPSRISVEVARPEM
VVEELKGTQPQAAKLVEWLKLALDEPHLLKTLGAGTNLGVLVSGPAGVGK
VTLVRAVCGDRRLVTLDGPEVGALAAEDRLKAVASAVQTVRDGGGVLLIT
DVDALLPAAADPVASLILGELRTAVASDGVALIATSARPDQLDARLRAPD
LCDRELGLPLPDAATRKALLESLLKNVPAGGLDLDEIASRTPGFVVADLA
ALVREAALRAASRASADGRPPELNQEDLVGALSVIRPLSRSASEEVSVGD
ITLEDVGDMAEARQALTEAVLWPLQHPDTFARLGVDPPRGVLLYGPPGCG
KTFVVRALASTGQLSVHAVKGSELMDKWVGSSEKAVRELFRRARDSAPSL
VFLDEVDALAPRRGQSFDSGVTDRVVAALLTELDGVDPLRDVVVLGATNR
PDLIDPALLRPGRLERLVFVEPPDAAARRDILRTAGKSVPLSADVDLDEV
AAGLDGYSAADCVALLREAALTAMRRSLDATDVTAADLAAARETVRPSLD
PAQVESLRAFAKAV
379764156YP_005350553.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MISKPRGRAVNLQILPSAMTVLSVCAGLTSIRFALEHQPKAAMALIAAAA
ILDGLDGRVARILDAQSRMGEEIDSLADAVNFGVTPAIVLYVTLLTNSPA
GWVVILLYAVCVVLRLARFNALQDDGSQPAYTHEFFVGMPAPAGAISMIG
LIGLKLQFGDGWWTSPLFLCIWITGTSILMVSKIPMRKMHAVAVPPSWAA
PLLAILAICAAAAVLAPYVLIWVIIIAYLCHVPFAIRNQRWLAAHPEAWD
DEPKQRRATRRAIRRAQPNRRSVARLGLRKPGRRVP
379764155YP_005350552.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MRSAVPPVHPAGRPFIGAGLALALAGRRHRWVRRAGLLAAGACAGFFRHP
PRVPPTRPGAVVAPADGEICVIDFATPPAELSMGDAALPRVSIFLSLLDA
HVQRAPVSGEVIAVQHRPGRFGSADLAAASTENERTSLVISTPGGADVVA
VQVAGLLARRIICDAHVGDKLSIGDTYGLIRFGSRLDTYLPAGCEPLVKV
GQRAIAGETVLAELP
379764154YP_005350551.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MRRAKRGVTAAFIAHGLVFSSWAAHIPRVKDELGLSDAALGTALFGAPLG
SVVATLASHWALRRWGSHRLIPVMVAGYAVAGTTVGLAKSGAALFGALAL
WGTFQGALDVAMNTQAATVERAARAPIMARFHGMWSVGTLVGAVIGAACV
GAGIGLTAQLTVLGAVVLIVVGTLTRRLIPDAADDSDASSGPTPQGRRAW
MTPTVAILAAVSFASFLCEGAATDWSANYLRNVVGAGPSVSALSYAAYTL
TMVITRFGAPRLHARVPSRRLLPALAVVAVAGMSVTLATANAAVGVLGFA
ALGVGVALLVPTAFSAAYGASEAGSAIAIVAATGWLGYLLGPPLIGHLSG
WVGLSAALATIPVMMSIVGIAIRYNPAFDKADEFHRDVATPAG
379764153YP_005350550.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MRSVAEHQRVVTDLIRPRPPVSVALTDAQGLVLAEDVIAQLALPVFDNSA
MDGYAVRAEDTASATPENPVVLPVAEDIPAGRTDELTLQPGTAHRIMTGA
PLPAGATAIVPVEATDGGVDVVSIREPREAGKHIRRAGEDVAPGTTVLRR
GQVVTPAVLGLAAALGIAELPVIPRQRVLVISTGSELVTPGVPLRPGQIY
ESNSIMLAGAVRDAGADLVAVATAEDDVAQFSSIIDRYAADSDLIITSGG
VSAGAYEVVKDAFGREGDQGVEFVKVAMQPGMPQGVGRVAGATIVTLPGN
PVSALVSFEVFIRPALRTAMGLPDPERPHRSAVLAESLTSPRGKRQFRRA
VLSDDASSVTSYGPPASHHLRWLASANGLLDIPEDVVEVPEGTRLQVWDL
R
379764152YP_005350549.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MASNDKETRAWSESDVPDQSGRVVVITGANTGIGYEAAAVLAHRGAHVVL
AVRNLEKGNAALSRIVAAGGQGSREVDVTLQQLDLTSLDAVRSAADALRA
AYPRIDLLINNAGVMWTPKQVTADGFELQFGTNHLGHFALTGLLLDHLLR
VRDSRVVTISSLGHRLRAAIHFDDLQWEHRYDRIAAYGQSKLANLLFTYE
LQRRLAATPDAKTIAVAAHPGGSNTELTRNLPAIFRPAAAALGPVLFQSA
AMGALPTLRAATDPDVQGGQYFGPDGFLEQRGHPKLVKSSAQSHDAELQR
RLWAVSEELTGVRFPV
379764151YP_005350548.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MYTYDIDAAAMFDDRTDQFAKFGVPLEDIERVRSAVDDMWDDAPGGWVYE
WSRVARDYAERGDHRMASLVYGCAKFPCLTDAARVKALQHQLEQFQLAAN
GFPVHFERRIVAVGYRGGSVEVPVHLYSADGRYVDRAVLIASGGVDTWKM
DIHPWWVAFTQGAGVTTLAFDHPGTGETDIPLDEHADEVIRGLIGYARTL
GDGRVAHFGASFGGNFAAMSGLTGIVDAAIELGGPVVDAFAVENIAKLPY
GMRDIVGNAMHWDHSPTLEELSVGLSRLNRRDLLARQGNSEMLVINGADD
YFVPQSDTLVFQGRPDTEVHLIEGTGHVAMSKAPEVVPRVIAWLRAQMTT
ER
379764150YP_005350547.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MKLVAKTATTPGPRDKRGVLAARIAAAARDEFAVHGWAGTTIRAVARRAD
VDPALVYHYFGSKEGLLDAATNPPQQWLDRVAEVWATPVERLGAALLQLL
LASWADDEIGPTLRAILQTAAHDPVTRDKLRRVVEGSLMGVSGLGSDDRD
RLIRSGLISSQMMGFALMRYVWKIEPVASMTDDEAIAAIAPNLQRYVDGD
LGGQTQ
379764149YP_005350546.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSLVVPPYPPARYTAEEPEINAWLKRADQPPDYETSGVKYHYLANQQDTA
GDYGLYRVDIAPAGGGPPAHFHRAMSEAFFVLSGTMKLYDGTEWADGHQG
DFLYVPPGGVHGFRNEADEPASILMLFAPGAPREAYFEGFAALADMTDEE
RREWFVRHDNYWV
379764148YP_005350545.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MEAAEELRVERLLDAERKAAQLFDEIERRAMIRPGVGEKELSDEIHDLAG
EMFGVTRHWHRRIVRAGENTLQPFHERPPDRLIVDDDIVFLDLGPIFEEW
EADFGRTFLLGDDPHKRAVRDALPRVWQAGRDYFAGNPDVTGAELFDFVV
GAAHAEGFAWASRIAGHLVGEFPHKKIAGPGIEWYIMPGSDKPMRRTDPR
GRICHWILEIHLVDRPRGFGGFYEQLLDLP
379764147YP_005350544.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAKTIAYDEEARRGLERGLNALADAVKVTLGPKGRNVVLEKKWGAPTITN
DGVSIAKEIELEDPYEKIGAELVKEVAKKTDDVAGDGTTTATVLAQALVR
EGLRNVAAGANPLGLKRGIEKAVEKVTETLLKSAKEVETKDQIAATAAIS
AGDQSIGDLIAEAMDKVGNEGVITVEESNTFGLQLELTEGMRFDKGYISG
YFVTDAERQEAVLEDPFILLVSSKVSTVKDLLPLLEKVIQAGKPLLIIAE
DVEGEALSTLVVNKIRGTFKSVAVKAPGFGDRRKAMLQDMAILTGGQVIS
EEVGLSLESADVALLGKARKVVVTKDETTIVEGAGDSDAIAGRVAQIRSE
IENSDSDYDREKLQERLAKLAGGVAVIKAGAATEVELKERKHRIEDAVRN
AKAAVEEGIVAGGGVALLHATPSLDELKLTGDEATGANIVRVALEAPLKQ
IAFNGGLEPGVVAEKVRNSPAGTGLNAATGEYEDLLKAGVADPVKVTRSA
LQNAASIAGLFLTTEAVVADKPEKAAAPVGDPTGGMGGMDF
379764146YP_005350543.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MALPAPSPTSTAVVTGASSGIGADIARELADRGHGVTLVARREDRLRDLA
DELAGRVRVEVIACDVADSAARAGLFDEVERRGLTADILVNNAGIGTMGS
VTKIPVADEIAQVRVNVEAVIDLSTRAVQRMVPRGRGAILNVGSTAGYQP
FPGQVGYAATKAFVNNYTQGLRGELAGTGVTVVLLCPGPVRTEFVKSAGM
DERDFADAFPKFMWKPSREVARAGVDALESDRPTVIPGLPSQISTRLFQF
MPRRVLLPLLKSQHPSLRRDRSAG
379764145YP_005350542.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSRIAPLAPPWSEEDAAGINSWGHPDRTYEPLLLVRCLQRHPVLASRLRK
LGESLYTAALLPPRTRTIAILRICALLRCAYEWGGQAAFWGPIAGVSDDE
CDALVLAGADDPRWGPAERTLIAAVDECERIGSWSEATWEALGDFLDDEQ
RIELLTAVGWYRTICTLCNALALPVEGWMRPWPGSAG
379764144YP_005350541.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MRSKKKVDFAALADALVDYPYAYLITVDDEYRSHTVTVEPELRGQTLEVG
LIGGRTQQNLARRRDVTLLWPPAEPGGYSLIVDGAAEVSPEGGAGDAVRL
TVTPTRALLHRDADSPDAARGCLHDCVVFSLPA
379764143YP_005350540.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTNPHFAWLPPEVNSALIFSGPGPGPLLAAAAAWDGLAGELASSASSFSS
VTSDLASGSWQGASSAAMMTVASQYVSWLSAAAAQAEEVSHQASAIATAF
EVALAATVQPAVVAANRALVRALAANNHLGQNTPAIADIEAAYDQMWASD
VAAMFGYHADASAAVAKLPPWNEVLQNLGFSNTTTAVTRPASSGAVARGY
TSRIAGFLTPPAPQ
379764142YP_005350539.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTYDLIIRNGTIVDGLGGEPYVGDVAVADNVIKAVGDVNGAAANREIDAT
GLLVTPGFVDLHTHYDGQSIWSERLTPSSAHGVTTVVMGNCGVGFAPCRQ
SDHDVLVDVMAGVEDIPGVVMTDGLPWTWETFPEYMDALDAGKRDIDVAA
YLPHSPLRVYVMGQRGADREPATEDDLAKMRALAKEAIEAGALGFASSRL
TIHKTESGSPIPSYDAAREEIEQIARGVVDGGGGLLQFVPDIPAGGYQPV
LQTVFDVAEDVGLPLTFTLVVANSGDPSWPDAITMIEKANAAGGDITAQL
LPRPIGLIIGLQLSANPFVLYPSYREIAHLPLAERVAEMRKPEVRARILA
DKPGQGHPILYVAQMWDWIYPLGEDPDYEPDPSTSIGARARAKGVEPMEE
AYDRLLDDDGKAMLLVATSNLQGNSLDTVGELLHRDDVVLGLGDGGAHYG
MICDASYSTYFLTHWARDRKAGRFTVPEAVRELTSVPARIAGLSDRGRIA
VGYKADLNVIDHAALRLHKPVITYDLPAGGRRLDQTADGYVATIVSGEII
AEYGVPTAARPGKLVRGRQPAPAPLQ
379764141YP_005350538.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MIDHVGINCADYAKSQRFYDAVLETLGFSRQLDVGPAIGYGRGGKPTFWI
SGALAGPNREVHLAFEAPDEDAVRAFYRVAVELGAEPLHEPRLWPEYHPG
YFGAFVRDPDGNNVEAVFHGALP
379764140YP_005350537.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MARTDDAAVIQDLLRDAFTRLIEHVDEITEGLTEEVSSYRPTPDANSIAW
LLWHSARVQDLQLADVAGVEQVWLRDGWVDRFGLDLPQGDMGYGHSPDDV
AKVKAPADLLSGYYHAVHELTLEYLSGITAEELARVVDTNWDPPVTASAR
LVSIIDDCAQHLGQAAYVRGIA
379764139YP_005350536.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MRFAASVLLWLITTLALAVAIPAAWTQLHVVDADGYAALARGAAADPDLQ
SAMAAELTTRAMALIAEHGGGRYPVDSSDVHDAASAFTAGPTFPPLFAQA
NRAAHGWLFGDPGGGENGDQWAVDVAPMLGDDSIRPLLSRYNVTVPAKLA
VPLTVSMPQAMRQGRLSRLSTWGPWVSVGAAALCGVCALLTLAAARRRGK
ALSSLGVSALLVGAAGWAGLEVAGRYVDKALNRTTGDIRRVAEAMVGHAE
AGLHQWLNVTLLAGAALVGLGVVVAMVGSLWKKS
379764138YP_005350535.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MQTIALIGFLGGLITGISPCILPVLPVILLSGAGGTRADSRRVSSVSRPY
LVIAGLVCSFSLATLLGSALLTALHLPQDAIRWAALVVLTLIGLGLIFPP
VQHLIERPFAYLPQRQIGANADGFGLGLTLGALYVPCAGPVLAAIVVAGG
TSSIGPGALVLTATFALGNAVPLLAFALAGRRVAERVAAFRRRQRAIQIA
GGIAMIVLAVALVFNLPAMLQRAVPDYTTAMQNKLGANDIGHSLNPTPAQ
QPNRGTGLALSPPSVTVEGALSDCSSGSDELQQCGPAPALTGVTGWLNTP
DGKPLDPAEVRGKVVLIDFWAYSCINCQRAIPHVIDWYNRYHDAGFVVIG
VHTPEYAFERVPENVASGAADLHIPYPIALDNDYATWNNFHNLYWPAEYL
IDANGQVRHTKFGEGDYDGTEKLIRQLLADAHPGAPLPAPTSSADTTPQT
RLTPETYLGVERSGNYGGTGDYTSGTVTLSFPPTLADDKFALRGRWTLDD
QGATAEGDDATVRLNYTAKDVYAVIGGTGTLTVTRDGTTTTTPIGGAPTL
HRIVADDSAHRDQLDMRVSKGLQVFSFTFG
379764137YP_005350534.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAQLTFQRARTEEKKRQRAEALVEAARSLAMETGVASVTLTAVASRAGIH
YSAVRRYFTSHKEVLLRLSAEGWVRWSNTVSDKLAEPGAKSPSRIAGTLA
EALADDPLFCDLLANLHLHLEHEVDAERVIEVRRISTAATRSLADAIERA
LPELGRSGSLDILLAAYSLAATLWQVANPPADLTDVYAEEPEVAPPEWNL
DFATALTRLLTATCIGLIAEAA
379764136YP_005350533.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTTTEPRTEPLQQQGSAGGEGEKAAPQRAKKKGVLGRFWLVLTIAAVVAL
SGFVVYRLHGVFGVHRGSFGGGTSGEVLDEFNAKTITLQVWGPPGSTATI
NYLDENSHPQQALNVPLPWSKVLSSTKPGIPANLVAQGDGSWIACQFVVN
KHDGSGDVIKTPNRSDPNQTVNAFVYCLDKSA
379764135YP_005350532.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSEPGEVPPRVDQPLIPPFLPRMIHKLALPIVLVWLGIVFVTNTVAPQLE
VVAKTHSVSMSPTDAASFQSMMKVGSTFKEFNSDNSAMILLEGDKPLGAE
AHRYYDEIVRRVEQDKKHVQHVQDFWSDPLTAAGSQSHDQKAAYVQVYLA
GNMGGGLANESAAAVRKIVDSVPAPPGIKAYVTGAGPLFADQSHAGEKGV
AKVTLVTFLVIILMLLFVYRSAITMLIMLVMVFIELAAARGVVAVLGNYG
IIGLSTFANNMLVLMAIAAGTDYAIFVVGRYHEARGLGESREKAFYTMFH
STAHVVLGSGLTIAGAMYCLSFCRLPYFQTLGVPCAVGMLVAVLAALTLG
PAVLTVASFFKLMDPKRKLQTRGWRRMGTAVVRWPAPVLAVTIAVALVGL
LALPGYKTDYDNRHFLPADTPANVGYAAADRHFDQARLNPELLMIETDHD
LRNPADFLVLDKVAKAVFHIPGIGRVQTITRPLGTPLDHSTLGFQMGAQA
AGRIQTQHYQEEQANNLLKQADELHKTMATLHEQMQVTQDLSNTTHETTR
LTKETVQITERLRDDIANFDDFLRPIRSYFYWEKHCYDIPACWALRSVFN
ALDGIDQVAENIVNLSANLDKLDRIQPKLVALIPPQIESQQRNLDTIMSN
YAITQGLNEQAKAQADNATAQGDAFDKAKNDDTFYLPPEAFKSPDFARGL
KQFISPNGHAVRLIISHEGDPATPEGINHIEPIKQAVHEAIKGTPWEGAK
VYLGGTAATYKDMHDGSDIDLIIAGIAAATLIFVIMLVITRSVVAAVVIV
GTVLLSLGASFGLSVLLWQYILGLKLHWMVLAMAVILLLAVGSDYNLLLI
SRFKEEIHAGLKTGTIRAMAGSGSVVTSAGLVFAATMATFMFSPLLVMAQ
VGTTIALGLLFDTLIVRSFMTPSLATLLGRWFWWPQHVRPRPASTMLRPY
GPRPAVRELILNDVEEHPPGGLVQPR
379764134YP_005350531.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSIRSVDRMRAVNWNRLPDPKDAQVWDRLTGNFWLPEKVPLSNDSASWQT
LTAQEQQTTVRVFTGLTLLDTTQATVGAVSMIADAVTPHEEAVLTNIAFM
ESVHAKSYSSIFSTLCSTRQIDDAFDWSERNPHLQRKAQIVVDYYRGDDA
LKRKAASVMLESFLFYSGFYLPMYWSSRGKLTNTADIIRLIIRDEAVHGF
YIGYKCQCGLAELSESERSGHREYTYELLNALYTNEIDYAHDLYDGLGWT
DDVLPYMRFNANRALANLGYEPMFGPSDCRVNPAVLSALDPGAGENHDFF
SGSGSSYVIGSHQATEDADWDF
379764133YP_005350530.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MPHYVLPDLTYDYGALEPAISGEIMQLHHDAHHAAYVKGANSTVDQLAEA
RAERNLAHLPGLERTLAFHLAGHALHSIFWTNLSPEAAERPEGELAAAID
EFFGGFEAFRAEMTGATSSVQGSGWGALAWDPIGRRLVVHQIHDHHVSVA
ITSTPLLVFDAWEHAFYLQYRNVKADYVDRLWSIVNWADVAVRFEAARRG
DLSGLHSSDEIGGAR
379764132YP_005350529.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MFLALGVTAAIFPSTAVADSTEDFPIPRRMINTTCDAEQILAATRDTSPV
YYQRYMIDFNNHPNVNQAAIDKAHWFYALSPADRRNYSENFYAPQADPLW
LAWPNHMKIFWNNKGVVAKATDICNTYPPGDMSVWNWS
379764131YP_005350528.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MPSSDFQTLLYRTAGPVATITLNRPEQLNTIVPPMPDEIEAAVGLAERDP
AVKVIVLRGAGRAFSGGYDFGGGFQHWGESMMSDGKWDPGKDFAMVSARE
TGPTQKFMAIWRASKPVIAQVHGWCVGGASDYALCADLVIASEDAVIGTP
YSRMWGAYLTGMWLYRLSLAKVKWHSLTGRPLTGVQAAEIELINEAVPFE
RLEARVAEIAAELAQIPLSQLQAQKLIVNQAYENMGLASTQTLGGILDGL
MRNTPDALGFIKIAEDEGVRAAVERRDGPFGDYSQAPPELRPDPSHVIVP
DRD
379764130YP_005350527.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSAAQRIELTLLATGLIFILASAAQARYRFINDRRAGRRFYWATAIIGIA
CFAVGTGQLWPNGVVVAAIFSAIVAFSAYLTTPYLKIAGRIYASSPENRQ
PDP
379764129YP_005350526.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MATMASMASNASTTPHARTDPQDSEDPYLWLEDVTGDEALDWVRARNEPT
LARFRDTDFERMRTEALEVLDTDARIPYVVRRGEYLYNFWRDAANPRGLW
RRTTLDSYRTDTPEWDVLIDVDELGRADGEKWVWAGAAVIYPEYTRALVS
LSRGGSDASIVREFDMLTREFVTDGFELPEAKSQVSWEDPDTVLVGTDFG
PDTLTDSGYPRVVKRWRRGTPLAEAETVFEGARSDVNVAASASRIPGYER
TLIGRALDFWNEELYELRGPELIRIDTPTDASVSLHREWLLVELRSDWFF
GGTTYGAGSLLAADYEEFLGGTAQLQVVFEPDEHTALNHYAWTRDRLVIV
SLVDVASRVEIVTPSRPSGDDPLRPAPPRLRSSRASGDDPLRPAPPRLRS
SRASWRREPVAGIPAATNTVVVSADDTGDEFFLDSSGFDTPSRLMRGTDD
GALEQLKSAPAFFDAENISVTQNFVKSKDGTPIPYFVVRPAGPASDGPAP
TLLYGYGGFESSNTPGYSGVLGRLWLARGGTYVLANIRGGGEYGPEWHTQ
AIREGRHKVAEDFAAVATDLVDRGITRVEQLGAQGGSNGGLLMGIMLTQY
PEKFGALVCSVPLLDMKRYHLLLAGASWVAEYGDPDNPDDWKFIAEYSPY
QNISATRRYPPVLMTTSTRDDRVHPGHARKMTAALEAAGHPVFYYENIEG
GHAGAADNEQVAFKSALTYSFLWQMLGGRTQS
379764128YP_005350525.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSYESRYENFIGGQWVPPARGRYFENPTPVTGQTFCEVARSDEADVDKAL
DAAHAAAPAWGKTAPAERAAILNKIADRIDEHTAALAVAEVWDNGKPIRE
ALAADIPLAADHFRYFAAALRAQEGSLSQIDDDTVAYHFHEPLGVVGQII
PWNFPILMGAWKLAPALAAGNAVVLKPAEQTPVSVLYLMSLIGDLLPPGV
INVVSGFGAEAGKPLASSNRIAKIAFTGETTTGRLIMQYASQNLIPVTLE
LGGKSPNIFFSDVMAKADDYQDKALEGFTMFALNQGEVCTCPSRSLVQAD
IYDEFLELAAIRTKAVRQGDPLDSETMLGSQASNDQLEKVLSYIEIGKDE
GAKVITGGERAELGGDLSGGFYMQPTILGGDNSMRVFQEEIFGPVVAVTS
FSDYDDAMSIANDTLYGLGAGVWSRDGNTAYRAGRDIQAGRVWVNCYHVY
PAHAAFGGYKQSGIGRENHKMMLDHYQQTKNMLVSYSEKAQGFF
379764127YP_005350524.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAITAPAAEVLTRLQAAHGPVMFHQSGGCCDGSSPMCYPLGDFLVGDRDV
LLGVLDVGPDGVPVWISGPQYAAHYRDKHTQLVIDVVPGRGGGFSLEAPD
GVRFLSRGRVFTAEEQASLAGAPVITGAGYERGERPATRGPVVAGAGAQT
CPAPR
379764126YP_005350523.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MLIGSAVGALACVAYTVVVHASVRPDIAIASVVGIPSVVGLTMILFSGRR
WVTALGAFILAAAPGWFGVLVALRVTAGA
379764125YP_005350522.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MPDFSDDERETEDTGTQSWVPDFDDDSDSEIADTGERPAATEPEPGEPEP
EAATGSAVPVQSVTVPGRYFYVKWWKLALMLLGVWAAAAVVGLGLFSWWY
GSIDKTPALFAVLVYVAVCVVGGVMLAMVHGRPLVSALSVALMSGPFAAV
AGAAPLYGYYYCERVGHCLVGVIPY
379764124YP_005350521.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTSHYDVVVLGAGPGGYVAAIRAAQLGLSTAVVEPKYWGGVCLNVGCIPS
KALLRNAELAHIFTKEAKTFGISGEATFDYGVAFDRSRKVAEGRVAGVHF
LMKKNKITEIHGYGRFTDANTISVELNDGGTETVTFDNAIIATGSSTRLV
PGTSLSANVVTYEELILSRELPESIIIAGCGAIGMEFGYVLRNYGVDVTV
VEFLARALPNEDAEVSKEVERQFKKLGVKILTGTKVESISDNGAEVTVAV
SKDGNTQELKAAKVLQAIGFAPNVEGYGLEAAGVALTDRKAIGITDYMRT
NIEHIYAIGDVTGKLQLAHVAEAQGVVAAETIAGAETLALGDYRMMPRAT
FCQPQVASFGLTEEQAREEGHDVVVAKFPFTANGKAHGVGDPSGFVKLIA
DSKYGELLGGHLVGHDVSELLPELTLAQKWDLTATELARNVHTHPTMSEA
LQECFHGLTGHMINF
379764123YP_005350520.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MIRTVTPQTIAGAVAGLATGYVVWLLGISTGDNATAGQWGPLVLLASVVL
GIGAAIWGAWQRRRGKLGWAAFAFGLPVLPVVLTLAILADVYL
379764122YP_005350519.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSPDGRIPPGRFRQLGPINWVIAKLGARTVRAPEMHLFTILGQRQLLFWT
WLAYGGRLLRGKLPTIDTELVILRVGHLRACEYELQHHRRMARKAGLDAD
AQAAIFAWPERLDPVEGRLTVRQQALLAATDEFVNDRTVTDATWRELATH
LDRRQLIEFCLLASQYDGLAATMATLEIPLDNPQQL
379764121YP_005350518.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSKTFVGSRVRQLRNERGFSQAALAQMLEISPSYLNQIEHDVRPLTVAVL
LRITEVFGVDATFFSSQDDTRLVAELREVTLDRDLDIDVDPTEVAEMVSA
HPGLARAVVNLHRRYRITTAQLAAATEERFSDGSGSGSITMPHEEVRDYF
YQRQNYLHELDTAAEELTIKMRLHHGDLARELTRRLTEVHGVHINRRIDL
GDTVLHRYDPATKTLEISNHLSLGQQVFKMAAELAYLEFGDLIDDLVAQG
KFTSDESHTLARLGLANYFAAAAVLPYRQFHDVAENFRYDVERLSSFYSI
SYETIAHRLSTMQRPSMRGVPFSFVRVDRAGNMSKRQSATGFHFSSSGGT
CPLWNVYETFANPGKILVQIAQMPDGRNYMWVARTVERRAARYGQPGKTF
AIGLGCELRHAHRLVYSEGLDLSGEISTPIGAGCRVCERDNCPQRAFPAL
GRALDLDEHRSTVSPYLVTQP
379764120YP_005350517.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSLDKQLMPVPDGHPDVFDRQWPLRVGDIDRTGRLRLDAACRHIQDIGQD
QLREMGFEETHPLWIVRRTMIDLIRPVEFSDMLRMRRWCSGTSNRWCEMR
VRIDGKRKGGLIESEAFWININRETQMPSRIADDFLAGLHKTTSVDRLRW
KSYLKPGSRDDAVEIHEFPVRVTDIDLFDHMNNSVYWSVVEDYLASHTEL
MQAPLRITIEHEAPVALGDKLEIISHIHPAGSTEQFGPDLADRTVTTLTY
AVGDETKAVASIFAR
379764119YP_005350516.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MPMSVVGTPKSAEQIQKDWDTNPRWKDVTRTYSAKDVVALQGTVVEEATL
ARRGAEVLWEQLHDLEYINALGALTGNMAVQQVRAGLKAIYLSGWQVAGD
ANLSGHTYPDQSLYPANSVPQVVRRINNALLRADEIAKVEGDTSVKNWLA
PIVADGEAGFGGALNVYELQKAMIAAGVAGSHWEDQLASEKKCGHLGGKV
LIPTQQHIRTLTSARLAADVCDVPTVVIARTDAEAATLITSDVDERDQPF
ITGERTKEGFYRVRNGLEPCIARAKAYAPYSDLIWMETGTPDLELAAKFA
EGVKSEFPDQMLAYNCSPSFNWKKHLDDSTIAKFQKELGAMGFKFQFITL
AGFHALNYSMFDLAYGYARNQMSAYVELQEREFAAEERGYTATKHQREVG
AGYFDRIATTVDPSSSTTALTGSTEEGQFH
379764118YP_005350515.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTVSSCTAIGPAQGWPGRGLRYFISFSVRRACTQGESSAEFSPPMHARRA
CGMRRSRQAPLGLSDSSRRLHFVLAACAARAQ
379764117YP_005350514.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MVGAGQMGSGIAEVSVRADVDVTVFETTEALIAAGRNRIVKSLERGVSAG
KVTERERDRALSKLTFTTDLNDLADRQLVIEAIIEDDAVKAQVFAELDRV
ITDPDAVLASNTSSIPIMKIAAATKNPQRVLGLHFFNPVPVLPLVELVST
LVTDEAAAARTEEFASAVLGKQVVRCSDRSGFVVNALLVPYLLSAIRMVE
AGFATVEDVDKAVVAGLSHPMGPLRLSDLVGLDTLKLIADKMFEEFKEPQ
YGPPPLLLRMVEAGRLGKKTGQGFYKY
379764116YP_005350513.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTRLEPYYEESQSIYDVSDEFFALFLDPTMAYTCAYFERDDMTLEEAQYA
KFDLALGKLNLEPGMTLLDIGCGWGGALKRAVERYDVNVIGITLSRNQFE
YSKKMLAGLPTDRNIEVRLQGWEEFEDKVDRIVTIGAFEAFKMERYPAFF
DLAYDILPDDGRMLLHTILMYQWQEYPALGVTLTMSDIRFARFIGQEIFP
GGQLPAQEDIFKFGEAAGFSVERVQLLQEHYARTLNIWAANLEANKEKAI
AVQSQEVYDKYMHYLTGCENFFRKGISNVGQFTLVK
379764115YP_005350512.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MQLTPHFGNVQAHYDLSDDFFRLFLDPTQTYSCAYFERDDMTLEQAQLAK
IDLALGKLKLEPGMTLLDIGCGWGATMRRAIERYDVNVVGLTLSENQAEH
VQKSFDQMDTTRTRRVLLEGWEKFHEPVDRIVSIGAFEHFGRQRYGRFFK
MAYNALPPGGIMLLHTIVRPSFKDARAKGLSLTHEIVEFSKFILAEIFPG
GWLPTPQTVGEYGVTVGFELTRVQSLRLHYARTLDLWAEALEANREEALA
IQSQEVYDRYMKYLTGCAELFRDGYTDVNQFTMEKK
379764114YP_005350511.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MRVKMDGRKRRWHQHKVERRNELVDGTIDAIRRLGGALSMDEIAAEIGVS
KTVLYRYFVDKNDLTTAVMMRFTQTTLIPNMAAALTSNLDGFDLTREVIR
VYVETVANEPEPYRFVMANSSASKSKVIADSERIIARMLAVLMRRRMQQA
GMDTGGAEPWAYLIVGGVQLATHSWMSYPRMTRDELIDYLTMLSWNALKG
IVEVGGSLEKFREEPHPSPIVPPRDDDDAAAG
379764113YP_005350510.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MCHHFIIYVPGDWCDDTGCRAPQTPLHARPAPQTDLSTP
379764112YP_005350509.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAESFAGADREADAQRRVALRRMKMVALSFLIGATGVFLACRWAQAHAGA
GVWVGYVGAAAEAGMVGALADWFAVTALFRHPLGIPIPHTAIIKRKKDQL
GEGLGAFVRENFLSPEVVETKLRDAEVSGRLGKWLSEAAHAERVASETAT
VLRVLVELLRDEDVQQVIDRMIVRRIAEPQWGPPVGRVLATLLAENRQEA
LIQLLADRAFQWSLNAGEVIQRVVERDSPTWSPRFVDHLVGDRIHRELMD
FTDKVRRNPDHELRRSATRFLFEFADDLQHDPDTIARADAIKEQLMARDE
IANAAATAWTTLKRLVLEGVDDPSSTLRTRIADTVVRIGESLRDDVDLRD
KVDNWLVRAAQHLVSQYGVEITAIITDTIERWDAEEASRRIELHVGRDLQ
FIRINGTVVGSLAGLVIYAVAQLLF
379764111YP_005350508.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAPEEKLSAKVSNAASDMASDIGSFIRSQRELAQVSVRQLAEKSGVSNPY
LSQVERGLRKPSADVLNQIAKALRVSAEVLYVRAGILEPTDKSQVRDAIV
TDTAITERQKQILLDIYASFTQQNESTDEECSTQSDTE
379764110YP_005350507.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MVWHLVFSVVRCLVGKLGANVSFATGAARTRGSSPST
379764109YP_005350506.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAENSNIEDLRAPLLAALGAADLALATVNDLIASLRERAEETRVETRTRV
EERRARLTKLQEDLPEQFTELRDRFTADELRKAAEGYLEAATSRYNELVE
RGEAALQRLRSQTAFEDASARAEGYVDQAVELTQEALGTVASQTRAVGER
AAKLVGIELPGKTEATAKKAQKAVGKAPAKKAPAKKAPAKKAPAKKAAAK
KVTQK
379764108YP_005350505.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MNHLVGTVMLVLQIAVLVTTIYAFVHAALQRPDAYTAADKLTKPVWLLIL
AGAVALTSILGFVFGVLGMAIAACAAGVYLVDVRPKLLEIQGKSR
379764107YP_005350504.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MRLLLTAPAAALVALCCPPPHAIAAPEPLVDHTEWAQWQGRSSLRVFPTP
AGRTASRTPTSMAWGDEAWSEVLALAPDADTPGMRAQFLCHWQFAELARP
GKTSWNLEPWRPVVDDAEMVASDCNPGGGEESFG
379764106YP_005350503.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTGHPTRAELAAFVDHTLLKPEASAADVTALVAEAAELGVYAVCVSPSMV
PVAVHAGAGVRVASVAGFPSGKHVSAVKAHEAALAVASGACEVDMVIDVG
AALAGDVDAVRSDIQAVRDAVGGAVLKVIVESSALLALADERTLARVCRA
AEDAGADFVKTSTGFHPTGGASARAVALMAETVGGRLGVKASGGIRTAAD
ALAMLDAGATRLGLSGTRGVLDGLG
379764105YP_005350502.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MPPPAPPPPPAQGPPPGQTERFGTPQPNMQQRGYPPPTTPPAGPTERLAT
APGDDATPGKKKRRFGRDPVSVLLIFIIVFALIIAGLIGAELYVRHVADT
KVAEAVACEVKDQATASFGVTPLMLWQQATKHYTNISVQTAGNNIRDAKG
MKLSLNINDVRIKDTANSKGTIGSLDATISWTSDGIKESVQNAIPVLGPF
VTNTVTTHPADGTIELKGMLDNITAKPVVEGTGLKLQIVSFNALGFTMPK
ESVQSTLDDFTSNLTKNYPLGIHADSVQVTDKGVTSHFSTRNASIPAGDN
NNPCFANL
379764104YP_005350501.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MRIALAQILSGTDPAANLQLVREYSRRAADAGAKLVVFPEATMCRFGVPL
GPVAQPLDGPWADGVRSVAAESKITVVAGMFTPAGDGRVKNTLLAAAPDQ
SGAHYDKIHLYDAFGFTESRTVAPGHEPVVITVDGVGVGLTVCYDIRFPE
LYTELARRGAQVIAVCASWGAGPGKLDQWTLLARARALDSMSYVAAAGQA
DPGAAQAESGSGAPTGVGGSLVVSPLGEVVASAGAEPQLVVADVDVDRVA
EARKAIAVLSNRSAFAQVDRAESVR
379764103YP_005350500.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MPRSFDLSADYDGSVDEVHRAFTDANYWRARLAESGADVATLESMRVGGQ
SGDDDTVEVVTLQVISSDKLPGMVTQLHSGDLRIRREETWGPVTDGAAAG
SVVGSIVGAPVSLEGTAVLEPIGRAEGSRLTFRATVHVRVPIIGGKLENI
IGARLAELIAAEQRFTTEWIAKTA
379764102YP_005350499.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MKSSGAGSVFAGASVADSAPLAPLTTLRIGPIARRLVTCTNRDQVVAALG
HLDAESRAGQGGPVLVFAGGSNLVISDTCADLTAVKLANDGITVDGNLIR
AQAGAVWDDVVLAAIEHGLGGLECLSGIPGSAGATPVQNVGAYGAEVSDT
ITRVKVLDRGTGEVRWVPGGELGFGYRTSVFKRGGAGGFEIPSVVLEVEF
ALDASGRSAPLRYAELAAALNVDVGERAEPRAVREAVLALRARKGMVLDP
ADHDTWSVGSFFTNPVVAPEVYERLAATVDGPVPNYPAPDGVKLAAGWLV
ERAGFAKGYPEPGPGGREAPCRLSTKHALALTNRGGARADDVIALARAVR
DGVADVFGVTLIPEPVLLGCRL
379764101YP_005350498.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MATLGLGVLAPNALAACGGTSAKQAEKKEQPALQLKYQPADATQNVVPIA
PVSVQVSDGWFQHVTLSNSSGKAVAGTFNQDRTVYTTSEPLGYDMTYTWS
GSAVGHDGKAVPVAGKFTTVSPSKKIGGAFQLADGQTVGVAAPIILQFDA
PITDKAAVEKALTVTTNPPVEGSWAWLPDEAQGARAHWRTREYYPAGTTV
SVEAKLYGLPFGDSAYGAEDISLNIQIGRRQVVKAEVSSHRIQVVRDEGV
VMDFPCSYGEADKARNVTRNGIHVVSEKYADFYMSNPAAGYNHIHERWAV
RISNNGEFIHANPASAGAQGNTNVTNGCINLSTGDAEQYYQSAMYGDPVE
VTGSSIQLSYSDGDIWDWAVDWDTWVAMSALPPPTAHPPSTQIPVTAPVT
PSNAPTLSGTPTTTTPATTGPATPGG
379764100YP_005350497.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MVETGRNERVAVITGASSGIGAATARTLAAQGFHIVAVARRADRIRDLAE
EIGGTAIVADVTDDASVDALASKLSRVDVLVNNAGGARGLEPVADAELDH
WRWMWETNVIGTLRVTRALLPKLIESGDGLIVTVTSVAALEVYDGGAGYT
AAKHGQGALHRTLRGELLGKPVRLTEIAPGAVETEFSLVRFDGDQQRADA
VYTGITPLVAADVAEVIGFVASRPAHVDLDLIVMKPRDQASASRFNRRG
379764099YP_005350496.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MGMGEGIGGHERPFVRILLAILATPGMGSGAAKCAATTRTRRAQTRGGGD
VGQGAVKHTENLARSLRLFRWLKLAGMNASR
379764098YP_005350495.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MPTNTLTHTHLSAGRVVGYSGQKGHRSVRRQIVPPALHIPDSAAASVFRA
VRLRGPVGRDVIAGVTSLSIATVNRQVIALLEAGLLRERADLAVSGAIGR
PRVPVEVNHEPFVTLGIHIGARTTSIVATDLFGRTLDTVETPTPRNPAGP
ALASLADSARRYLRRWHRRRPLWVGVAIGGTVDGATGQVDHPRLGWRQAP
VGQVLADALGLPVSVASHVDAMAGAELLLGMRRFLPSSPTSLYVYARETV
GYALVIGGRVHCPSSGPGTIASLPAQSELLGGTGQLESTVSDEAVVAVAR
QQRILPFAPANRANGPATGIADLLRVARAGNQQAKDLLAERGRVLGEAVA
LLRDMLNPDELVVGGQAFTEYPEAMEQVEAAFAARSVLGPRDIRLTAFGN
RVQEAGAGTVSLSGLYADPLGAMRRAGALDARLHEVTRDESSA
379764097YP_005350494.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MRHDDVFRLNEPRRVAVLAVHTSPLAQPGTGDAGGMNVYVLQTALHLARR
GIEVEIFTRATASADPPVARVAPGVLVRNVVAGPFEGLDKYDLPTQLCAF
AAGVLRAEASHEPGYYDIVHSHYWLSGQVGWLARDRWAVPLVHTAHTLAA
VKNAALAEGDSPEPPLRTVGEQQVVDEADRLIVNTDDEARQLITIHHADP
ARIDVVHPGVDLDVFRPGDRRAARAALGLPPDEPIVAFVGRIQPLKAPDI
VLRAAAKLPGVRIVVAGGPSGSGLASPDGLARLADELGITARVTFLPPQS
RSNLATLFQAANVVAVPSYSESFGLVALEAQACGTPVAAAAVGGLPVAVR
DGVTGTLVAGHDVDRWAAALDGLLRRPAPAAGEMGRAAAAHAATFSWDHT
TDALLASYSRAIREYTAERREVGA
379764096YP_005350493.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSSSTDVSRVIEDALRASGLNYSKHAGAHGGPSGLVVELPGERKLKTNTI
LSVGEHSVRVEAFVCRKPDENHEGVYRFLLKRNRRLYGVAYTLDNVGDIY
LVGRMSLPSVDADEIDRVLGQVLEAVDSDFNTLLELGFRSSIQKEWEWRV
SRGESLKNLQAFAHLIDEDDDAEREAR
379764095YP_005350492.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MGDSATLILLRHGESEWNSLNLFTGWVDVGLTDKGRTEAVRSGELLAEHN
LLPDVLYTSLLRRAISTAHLALDAADRLWIPVRRTWRLNERHYGALQGLD
KAETKARYGDDQFMAWRRSYDTPPPPIEKGSTYSQDTDPRYADIGGGPLT
ECLADVVVRFLPYFTDVIVPDLRSGKTVLIVAHGNSLRALVKHLDRMSDD
DIVGLNIPTGIPLRYDLDADLRPVVPGGTYLDPEAAAAGAAAVAGQGRR
379764094YP_005350491.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MFSALLLAGVLSVLALAAGVAVGVRLSPRAMQRRQRVSTEWTGITVGQML
ECIVALMPVGAAVVDVHRDVVYLNDRAKELGLVRDRQLDDQAWEAAQQAL
TGVDVEFDLQPSKRTGARSGLSVHGQARLLSEEDRRFAVVFAHDQSDYAR
MEATRRDFVANVSHELKTPVGAMALLAEALLASADDSETVRRFAEKVLVE
ANRLGDMVAELIELSRLQGAEPLPNVVDVDVDKVVSEAISRHKVAAENTK
IAVRTDAPSGLRVLGDETLLTTALANLVSNAIAYSPPGSPVSISRRRRGE
NVEIAVTDRGIGIALEDQERVFERFFRGDKARSRATGGSGLGLAIVKHVA
ANHNGTIGVWSKPGTGSTFTLSIPAAKPSPRDEGESEQAQGRDVRPDRSQ
REEELSR
379764093YP_005350490.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTSVLIVEDEESLADPLAFLLRKEGFEATVVTDGSAALAEFDRAGADIVL
LDLMLPGMSGTDVCKQLRARSSVPVIMVTARDSEIDKVVGLELGADDYVT
KPYSARELIARIRAVLRRGGEDDSEISDGVLESGPVRMDVERHVVSVNGD
TITLPLKEFDLLEYLMRNSGRVLTRGQLIDRVWGADYVGDTKTLDVHVKR
LRSKIEADPANPVHLVTVRGLGYKLEG
379764092YP_005350489.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MDSVANSHPEPGQPGHEVELDFAREWVEFYDPDNPEHLIAADLTWLLSRW
TCVFGTPACQGTVEGRPDDGCCSHGAFLSDDDDRARLDDAVKKLTAADWQ
YREKGLGRKGYLELDEHEGQPQYRTRKHKDACIFLNRPGFAGGVGCALHS
KALKLGVPPLTMKPDVCWQLPIRRSQEWVTRPDGTEILKTWVTEYDRRGW
GSGGADLHWYCTGDPAAHVGAKQVWESLADELTELLGGKAYAELAAMCKR
RSKLGLIAVHPATRIAE
379764091YP_005350488.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MRLGVLDVGSNTVHLLVVDAHRGGHPTPMSSTKATLRLAEATDSAGKITK
RGAEKLISTIDEFAKIADSSGCEELMAFATSAVRDAGNSDDVLSRVRKET
GVELRVLTGVDESRLTFLAVRRWYGWSAGRIINLDIGGGSLEMSSGLDEE
PEVAMSLPLGAGRLTREWLPDDPPGRRRVAMLRDWLDAELAEASAKILDA
GSPDLAVASSKTFRSLARLTGAAPSGAGPRVKRTLTANGLRQLISFISRM
TTADRAELEGVSAERAPQIVAGALVAEASMRALSIEVVDICPWALREGLI
LRKLDSEADGTALMGPSVRNAGGQVVDRNQHRSRGDKP
379764090YP_005350487.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTGPHSETESPGTRPISVAELLARNGTIGAPAVTRRRRRRRGDSDAVTVA
ELTGEIPVVRDDDDAEHGATDTIEAVKPADSPAEDVAAEPVTEDKPKTAY
WSEPEPRWPKSPPQPKRVPGLLRSAYPRPLANGTARPEEPSGAEDMSPDP
MDHYADIPVDVMDSDVREAEPALEDSAYVRSYLRSSGSLDEDLDEDGDAA
RAGSLDTGLLGLEDEDAHAEGADAHPAEGRLDALWRGAVVVLQSILAVAF
GGGLFVAFDQLWRWNSIVALVLSVLVILGLVVGVRVVRKTEDIASTLIAV
AVGALITLGPLALSLQSG
379764089YP_005350486.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MYPLRAEAAFEYAARLGYDGVELMVWAESASQDVAAVKKLSRRYRVPVLS
VHAPCLLISQRVWGPNPIPKLDRSVRVAEQLGAQTVVVHPPFRWQRRYAE
GFSEQVAKLESSSDVMVAVENMFPFRADRLFGAGQSLERMRRRGGGPGPA
ISAFAPSYDPLDGNHAHYTLDLSHTATAGTDSLDMAQRMGAGLVHLHLCD
GNGLPADEHLVPGRGTQPTAEVCQMLAGGQFAGHVILEVSTSSARSANER
EAMLAESLQFARTHLLR
379764088YP_005350485.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MNALFTTAMSLREAGSGVYEGELDKRWTIGPKVHGGAMLALCANAARTAC
GGQPAGPDLQPVAVSASFLWAPDPGPVQLVTSIRKRGRRISVVDVELTQG
DRTAVHAVVNLGEPEHYPVDDAGREAARGGAGSSSRPVDGAVKPLLSANP
VADLMTPEPPDDIEPIGPGHPLAGLVHLGEGCDVRPVLSTMQVRDDGRPP
VIQMWARPRGVAPDALFALMCGDLSAPVTFAVDRTGWAPTIQLTAFLRGL
PADGWLRIIATCTEIGHNWFDEDHTVVDSLGRLVVQARQLALVPAAR
379764087YP_005350484.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MLSGMARIAIIGGGSIGEALLSGLLRAGRQVKDLVVVERVPERAKYLADT
YSVLITSVAEAVENASFVVVAVKPADVESVMSEVARAAAAAESDTAEQVF
VTVAAGVTIAYFEAKLPAGTPVVRAMPNTAALVGAGVTALAKGRFVTPPQ
LEGVSALFDSVGGVLSVPEGQMDAVTALSGSGPAYFFLMVEALIDAGVAA
GLSREVAGDLTAQTMAGAAAMLLERMDADRRLSEAEAPGMRVDATATQLR
ATVTSPGGTTAAALRELERGGLRAAVDAAVQAAKMRSEQLRITSE
379764086YP_005350483.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAALMRVSKMTVYRLVHNGELPAVRVGRSFRVHAKAVHDMLETSYFDAG
379764085YP_005350482.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MDGSNGENTGPDDTAGNAAHYPKIVLVTGACRFLGGYLTARLAQNPMIKG
VIAVDAIAPSKDMLRRMGRAEFVRADIRNPFIAKVIRNGDVDTVVHAAAA
SYAPRSGGTAALKEINVMGAMQLFAACQKAPSVRRVVLKSTSEVYGSSAH
DPVMFTEDSTSRRLFRDGFAKDSLDIEAYARGLGRRRPDIAVTILRLANM
IGPAMDTTLSRYLAGPLVPTMFGRDARLQLLHEQDALGALERAAMAGKAG
TFNIGADGIIMLSQAIRRAGRIPLPVPGFGVWALDSLRRANRYNEISRDQ
FDYLSYGRVMDTSRMRSELNYQPKWTTAEAFDDYVRGRGLTPIIDPYRVR
SLESRAISLAQRWGSRNPIPWGGVR
379764084YP_005350481.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MVREIDEHRRATGASPGEAPLNELAQRVASVAAFLRQRLTGDYSVDEFGF
DPHFNSAIVRPLLRVFFRSWFRVEVSGIENLPADGAALVVANHAGVLPFD
GLMLSVAVHDEHPAHRELRLLAADMVFDLPVVGEAARKAGHTMACTTDAH
RLLAAGELTAVFPEGYKGLGKRFEDRYRLQRFGRGGFVTAALRTKAPIIP
CSIIGSEEIYPMLTDVKLLARLFGLPYFPITPLFPLAGPMGLVPLPSKWH
IAFGEPIYTDDYAASDADDPMVTFELTDQVRETIQQTLYRLLAGRRNIFF
G
379764083YP_005350480.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSLQGETGTQLHPPVEAVRSHYDKSNEFFKLWLDPSMTYSCGYFDENPDP
QNLTKTLEEAQYAKRKLALDKLNLEPGMTLLDIGSGWGSTMRHAVAEYDV
NVIGLTLSENQYAHCVAEFDKMDSPRRKEVRIQGWEEFPGDVPIDRIVSL
GAFEHFADGAGDAGYERYATFFKKYYDLLPDDGRMLLHSIVVPTREEGNA
MGLKVNMTLLRFISFILKEIYPGGKLPQVDLVDKYATDAGFKIERHHFIG
KNYVPTLTAWGDALEAHKEEAIALKGQETYDIYLKYLRGCSDLFRDGYTN
VCQFTMVK
379764082YP_005350479.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTVPKEAEGLIGSHYRAPDYFEVGREKIREFALAIKDDHPAHFDENESRR
AGYTDMVAPLTFLAIAGRRVQLEIFTKFSIPINIARVIHRDQKFKFHRPI
LAHDRLFFDTYLDSVIESHGTVLAEIRSEVTDADGKPIVTSVVTMLGEAA
SQAETEATAAAVASISAGKLGAL
379764081YP_005350478.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTSSDPVNADHTGYVDLESLGADASAARAIEGMQEEAAAAPDRPQPPVDL
TAAAFFDVDNTLVQGSSAVHFGRGLATRNYFTYRDVIGFIYAQAKFQVLG
KENSNDVAAGRRKALAFIEGRSVEQLVALGEEIYDEIIADKIWPGTRELT
QMHLDAGQQVWLITATPYELAATIARRLGLTGALGTVAESVDGVFTGRLV
GDILHGTGKAHAVRSLAIREGLNLKRCTAYSDSYNDVPMLSLVGTAVAIN
PDARLRALARERGWEIRDFRTARKAARIGVPSALALGAAGGALAAVASRR
QSR
379764080YP_005350477.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAPLACDPTALDRAGATVLSTGESLGSVISALTTSLAGSAGMAGDDPVGA
ALGRTYNGAAAKVIVAMTSTRNGLCSIGDGVRMSAHNYAHAEAMSDVTGR
AEGLPTPPVTAPLTAPSHPPSAVGAGSGAPAGWSWVAPYIGMIWPTGDSA
KLRAAAAAWTTAGVNFMTTEIAAGGGSMAAIAAQQIPEAAAINKALADAS
GATASVAQQCQTIAAQLNSYAAQIDKVHAAILDLLSRICDPMTGIKEVWD
LLTDEDEDEIKRIADDIKTVVDSFSREAETLGGQIEATMSAAATAAEDMA
HWAGKEWDHFVALNKATLHRVGKILGGVGKEGWGVLKGLYSISQVRAVLD
PIGYGKELAGMAQGAAPLVGLGPDGGPGWQESWMALGKEVTHWDEWSKDP
LDALGRTAFDVLTLPIPGGPLSKLGKVSRAAADALKDVKKPGLPKTPAVK
PPAESPPAAPKPPGSGQPAPGPADGPLPHSPTESKPPIGGTPHSGEPKPI
AIPPESGGKPPVSAPAEGTPPPHPPPHEPAPTRVPPAEPAAVAPAASAPA
ASMPAASAPSMPSMPEPPSLPSVPAGGLPAEAPPGLGEVPHSGEPPAHPP
GPPHPSDGGPHPPGDGGGPHPPGDGGGPHPPGDGGGPRPPGDGNEPPGSH
QPHDHTPLSDDGSDADLPGHTDPSDLPPWRQAQLALAQSPEQLMQDLIDH
GCPPDIAKSALHSPYSGMTAQDILDRFWDPKEGTWDWPKVNGFADGKWET
ARSISPNVWLDRIGEVSAKSGDFMGNVGDPYSHRGLAPGTSGDYHAFQGT
GKQLPQGWEVRFGKVGEAFGWPGGGTQWVVFDTVEKKTVLIETLLRRGYL
RRS
379764079YP_005350476.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MPEAFRVDPQALADAVQRMAAFQRYAEDMIAEIDSRVTRLHGTWTGEAAA
AHAEAHQHWVRGEAMMREALGQLEKVATTAHGNYTGAMSTNLGMWS
379764078YP_005350475.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MADNTVRVDPVVMQGAAVSLSGAAEHLSAQLSQLDDQVGQMLGGWQGAAG
GAYASAWELWHKGAREVELGLSILAHLVGEAGGAYHSNEAASAQAERAVR
DA
379764077YP_005350474.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MELLTRDGCTICERIHARLVVLAGELGFDLSTTDVDAAAADGNPALRAEF
GDRLPVVLLDGREHSYWELDEPRLRADLAR
379764076YP_005350473.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSVLLFGVSHRSAPVSVLEQLSIDESDQGKIVDRVLQSPLVTEAMVLSTC
NRVEVYAVVDAFHGGLAVIGQVLSEHSGMSMTDLTKYAYVRYSEAAVEHL
FAVASGLDSAVIGEQQVLGQVRRAYATAETNRTVGRVLHELAQRALSVGK
RVHSETAIDAAGASVVSVALNMAERRLGGLSGRTAVLVGAGAMGALAAAH
LSRAGIAQVHVLNRSLSRAQRLVRKIRETGVRADALPLEQLTDVLAGADV
VVSCTGAVSPVVSLADVHHALAAANRSIVDETTDPLVICDLGMPRDVDPA
VAGLPGVWVVDVDRVQHEPSAHAAAADVDAARTIVATEVAAYLAGQRMAE
VTPTVTALRQRAADVVEAELLRLDNRLPGLASAQREEVARTVRRVVDKLL
HAPTVRIKQLASAPGGDSYAEALRELFELDQTAVDAVAAGELPVIANGFD
AGTPQQPAE
379764075YP_005350472.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MANVIRIGTRGSLLATTQAGVVRDALIALGHPAELVTITTAGDRSSGPIE
SLGVGVFTTALREAMEEGRVDAAVHSHKDLPTADDPRFAVAAIPVRNDPR
DAVVARDGLVLGELPPGSLVGTSSPRRAAQLRALGLGLEIRPLRGNLDTR
LNRVSSGDLDAIVVARAGLARLGRLDDVTETLEPVQMLPAPAQGALAVEC
RAGDTRLAAVLAELDDADTRASVTAERTLLAELEAGCSAPVGAIAEVVES
IDEEGRIFEELSLRGCVAALDGSDVIRASGIGTPGRARELGLSVAAELFE
LGARELMRGARQDPTRGN
379764074YP_005350471.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MGSGPGDPGLLTTRAATVLTNAALVFTDPDVPEPVLALIGKDLPPVSGPA
PADPAASSGDGADQGQTQPAVISGGPDIRPALGDPAEVAKTLTHEARTGV
DVVRLVAGDPLTVDAVITEVNAIARSHLHIEIVPGLAPTNAVPTYAGLPL
GSSHTVADVRGDVDWEALAAAPGPLILQATSSHLADAARTLIEHELAENT
PCVVTAQGTTCQQRSIETTLHGLTDSAVLGGTDPAGPLTGPLVVTIGKTV
SSRAKLNWWESRALYGWTVLVPRTKDQAGEMSERLTSYGALPIEVPTIAV
EPPRSPAQMERAVKGLVDGRFQWVVFTSTNAVRAVWEKFGEFGLDARAFS
GVKIACVGESTADRVRAFGISPELVPAGEQSSLGLLDDFPPYDSVFDPVN
RVLLPRADIATETLAEGLRERGWEIEDVTAYRTVRAAPPPAETREMIKTG
GFDAVCFTSSSTVRNLVGIAGKPHARTIIACIGPKTAETAAEFGLRVDVQ
PETAAVGPLVDALAEHAARLRAEGALPPPRKKSRRR
379764073YP_005350470.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MVAQTSLEPRHLVLPMFVADGIDEPRPIASMPGVVQHTRDSLRAAAASAV
AAGVGGLMLFGVPRDEDKDAVGSAGTDPDGILNVALRDLAKDLGEATVLM
ADTCLDEFTDHGHCGVLDDRGRVDNDATVARYVKLAVAQAESGAHVVGPS
GMMDGQVGAIRDGLDTAGHTDVAILAYAAKFASAFYGPFREAVSSSLSGD
RRTYQQEAGNSREALREIQLDLDEGADIVMVKPAMGYLDVVSAAASISPV
PVAAYQVSGEYAMICAAAANNWIDKRAAALESLTSIRRAGADIVLTYWAA
DAAGWLS
379764072YP_005350469.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MFYEPGATWWWVACGPASAAAMVLIEIWSGAKVSFVVPAIFFVLVSAFVG
LQVKAARIHVSVELTEDALRQGTETILVREIVRVYPEPENHEASGKELAR
WQSARALGELVGVPRGRIGIGLKLTNGRTAQAWARRHRQLRAALTPLVQE
RVEPTGTDVIDGDPDDPTGDQAGPAQ
379764071YP_005350468.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MIASYRALVELAVAVAALAGSGYSWTRSHHTVAVAPIAEGQPFTTSVVYD
PQLLLLTLVLLTSAGVLVVVGAARLRRARSGATTSS
379764070YP_005350467.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MRAHYRHLATVVHIRGEIDGANVDRVSRHIRRFTLGENPVVLDVADVGQF
AEAGISLLYAFDADCRAAGVDWTLVASSAVIAVLEDTGHDTNFPLMRSVQ
EALRDRADAIRVRRTMALPLVRKTS
379764069YP_005350466.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MVLFHFRPMLGDASPDFRDALAPVLNCGAQGVDLFFILSGFVLTYNYLDR
MGRSWSTRATLHFLWLRLARVWPVYLVTLHLAALWVIFTLHVGHVPSPDA
ASLTAVSYVRQILLVQLWFVPFFDDSSWDGPAWSISAEWLAYVLFALLVL
VLLRMKQATRARSLMVLAFAASLPPVVMLLASGHFYTPWSWLPRIVTQFT
AGALACAAVRRLRLTDRGRRVAGYISLLLLAAMVGVLYWFGAHPISGVVE
NDSGGVVDVLFVPLVISLAVGLGSLPRMLSTRVMVYGGQISFCLYMVHEL
VHTSWGWAVEQFELATQDNPWKWNVIGLLAIAVVLSIALYHAVEEPARRW
MRKMVDVRAVNARSDPGESTNGKPHPIDRPLEAISVRAV
379764068YP_005350465.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MGIAYPPQVRTYATLTLDFRLNHLAVIGDSYTTGTDEGGLGARSWPSRAW
QALGARGSRVSADVAAEGRAGYAAPGDHGSTFEDLTARAVHPDDALVVFF
GSRNDQGIDPLLLTEKTHAALDLARRFAPAARLLVIGPPWPTADVPPSMF
LIRDVLGGAAGAAGATFIDPIAEHWFVGRPDLIGPDGVHPNDAGHQYMAD
KIAPLIRTQLST
379764067YP_005350464.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSPLLLVCIAVAAPFAGVGLLHLQDRLERWDYERHAED
379764066YP_005350463.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MERRITRRGFRPDIEGLRAVAVIAVVLYHAGIPGVSGGYIGVDVFFVISG
FLITGLLFREAAATNTVALGRFYGARARRLLPAAAIVGTVTAIAAAAVLP
PLQARSVFLDGIASALYVGNYRFALRGTDYLTTDAPSPFQHYWSLGVEEQ
FYLVWPVLIIAIAWLVQRVPLLRGAAKRAAPYAAVLAVVAVASLTAGALW
TRTSPSWAFFSLPSRAWELAAGGLVALSLQQWRRLSLLTASIAGWGGLVL
ILLTCTQLGAHTPYPGVEALLPVLGTALIVGGGAVTGGLGPGRLLCRPAM
RAIGRISYSWYLWHWPVLLLMPALLGEPAGLPARLSATAVSAGLAVITLH
LVENPGRFAAALRRSAKVSLAVAGGASAATACACMLLLNVIPAPVGHGVA
APRANIVAAPPAGVAAVSPQEAAVRQAFDQARVVLAGAAGLRAVPSNLDP
PLDKAPADKAAVFVNGCVRSWRDVGQSECATGDTASPTTVALIGDSHAAM
WNPAFEQLAEQRHWRLETLAKVTCPLQDLHIVSPYLGREYTECEQWRADI
MGRMNAEHPRLVVLDMSRRYGGDFGFTSYDPAWIDTLGRTVAQLRATGAT
VLVLGPAADPHSPAPTCLSAHLDDATACAPTRSAAVNDDGIAAERAATVG
NGGHYADLTDLFCAPDRCPLIVGNTLVFRDDNHVTTQYARLLAPVMGVLV
DRAVADG
379764065YP_005350462.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTERSRQITQCFQYGVARRVIPAAGGIIAIMPDLTRRAVLRMGAGASLGA
AGVYAFSSLLAAETSQAATLPQAPAPFEPPTAGSALPNRLTGSFVSAARG
GIKTNYVIAMPPGQSKMLRPVIALHGVDGDANQMIDMGVPDGLARLAKEG
KPPFAVVGVDGGNTYWHKRTSGEDSGAMVLDELLPMLSTMGFDTSRVGFM
GWSMGGYGALRLGAKLGPSRTAGICAISPALYTSYATSAPGAFDSNEDFV
QNSVMGVPALNSIPLRVDCGNFDRFYFATKQFVYQLKTPPAGSFSLGGHD
VAYWRSQLPGELAWMAT
379764064YP_005350461.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MKRETHVTILFRPCAQKAPSFAIRGRRARVETFEIAFPARGSAAAPEGNT
IAMFPVVARLVATATM
379764063YP_005350460.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSLAFHWFLPTYGDSRNLVAGGHGTPMSGDRPATLRYLHQICTAAEDNGF
EAVLTPTGLWCEDAWLTTAMLVESTAILKFLVAFRPGLLSPTLAAQMAGT
FQRHSAGRLLLNVVTGGEPHEQRAYGDFLDKEARYARTAEFLHVVRQLWT
SRGPVTFSGEHVRVEGAQLNDPPDPIPAVFFGGSSAAAGPVAAKHSDVYL
TWGEPLPAVAKKLDWVRGLAVDAGRILRYGLRIHVISRDTSAQAWAEADR
LLAAIDPADIARVQDSLARSESEGQRRMRELHGGDSSKLLIAPNLWAGVG
LVRGGAGTALVGSHAEVAERLAEYANLGITHFILSGYPHLEEAYWFGEGV
LPILERMGLWRHPNRQSHPAGATPFAVASAH
379764062YP_005350459.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAATLPASAPAAGLADAYPVAERSDQRRRRLRIVVAASLLGTTVEWYDFF
LYATAAGLVFNKVFFPNESSLVGTLLAFATFAVGFVMRPIGGVVFGHIGD
RIGRKRSLALTMLIMGGATALIGLLPTATQIGAWAPVLLLVLRVLQGFAL
GGEWGGAVLLAVEHSPDDRRGRYGAVPQVGLALGLAMGTGIFAFLQIVLG
PNRFLAYGWRIGFLLSLLLVVIGIVVRLRVDETPAFRELQDLQAASTVPL
RDIVREPRSRRNTLLGLLSRWAEGSAFNTWGVFAISYATGALGLNRVSVL
VAVTIAALLMAVLLPISGRLTERFGARRVYLVGIACYGLTAFPAFALFGT
KKLLWFGLAMIIVFGVVHALFYGAQGTLYSALYPTSTRYTGLSFVYQVSG
IYASGVTPMILTALIAALGGAPWLACGYLVATAVISVVATALIRERDLYL
379764061YP_005350458.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAGTSQLRQGLSQRQLSMIALGGVIGAGLFVGSGVVIKDTGPAAFLTYAL
CGLLVVLVMRMLGEMAAANPSTGSFADYAARALGRWAGFSVAWLYWYFWV
IVVGFEAVAGGKVLTYWLHAPLWALSLGLMVLMTATNLFSVTSFGEFEFW
FAGIKVAAIAIFLAVGAVYVLGLVPGHPGGLANLHAHGGFFPHGVGAVFA
AIVVVIFSMVGAEIVTVAAAESRDPELAVQRATRSVVVRIGIFFVGSVFL
LVAILPWDSGQLGGSPYVAALKHMGLPGADQVMNAVVLTAVLSCLNSGLY
TASRMLFVLADRGEAPMRLVQLSGRGVPYLAILCSSAVGFGCVIMARVAP
HTVFLFLLNSSGAVILFVYWLIALSQIVLRRRTPADKLTVKMWFFPVLSI
LTLAGITAVLVQMAFDQRARSQLWLGLLSWAVVIGLYVVARRRGRGGVAS
RD
379764060YP_005350457.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTDTVTDSGREQRLTERVEQLYANDPQFRAAAPSQEVTEAAHRAGLRLAE
VVDIYLSGYADRPALGQRACEVARDPATGRAATSLLSGFETITYRELGDR
VAALAAAWRSGLPGGLRPGDFVGVLGFTSIDYVVHYLACIRLGAVFVPLQ
TSSTAAQLAPIVAETSPRILAVSVESLGTAVDVVLEAPSVQRLVVFDYTS
DDDEQRGRYDDARARLRDAGHGAEMVALAAELASGRERPAPEAHVPGQGE
NPLATLIYTSGSTGTPKGAMYTADMMTRIWQRPHSPSVDIGRVIPAIHLQ
YMPLSHVYGLEWLIATLSSGGIGYFAAKSDMSTLFDDIGLVRPTALNLVP
RVCDMFFRRYRKELDQRAGDGLTAEQRDEAVKAELRQDFIGGRVISAMCG
SAPLSKQMHAFMESLLDVTVADGYGATETGGGIMRSGRIRRPPVTDYKLV
DVPELGYLTTDKPYPRGELHLKASNVIPGYFKHPELSAQIFDDEGFYKTG
DIMAELGPDHLMYLDRSNNVIKLSQGEFVAVSQLEATFSTSPYIRQIFLY
GSSEQPFLLAVIVPNVDAVGGGDARALIAESLQQIAADSHLHPYEVPRDF
LLEPQRFTRDNGLLSGVGKLLRPALKARYGERLDAMYDEIEASHGNQLDE
LRSASRELPTIDTVRRAAAATLGLPADAALRGDAKFIELGGDSLSAFSFA
TLLSEIFHIDVPVQTIVSPTATLSTIANYVDGERTSESTRPTFASVHGRG
ATVARAADLTLAKFIDDDTLAAAPHLPAPTGAVNTVLLTGANGYLGRFLC
LDWLERLAPTGGTVICLARGADPTAGRQRIEAAIDSGDAELSRRFRQLAD
KHLQVLVGDVGAANLGLDTPTYQRLARSVDLVVHSAALVNHVLPYSQLFG
PNVVGTAEIVKLAISERLKPINYISTVAVTTLPDGSFIGEDADVRSASPS
RSLDESYASGYATSKWAGEVLLREAHDLCGVPVAVFRSDMILAHSDFAGQ
LNVPDMFTRLILSLVATGIAPRSFYQLDASGNRQRAHYDGLPADFTAEAI
TTLGARTRQGYHTYNVLNTHDDGVSLDTFVDWLIADGHEIERVDDYDEWL
ARFTAAMKSLPDNQRKSSLLPLMSAYAKPGQPTHGTGMPAEKFRAAVQSA
GIGATRDVPHVTQALIDKYVADLQRLGLLRTRAGAHAG
379764059YP_005350456.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MKIAVIGCGAMGSIYAARLATAGNDVLAIDRHEPSVERISRDGLRVTGPG
YDRVVPLRASTTAPDEPMDLIVLAIKAADVTVGARQALPMLGPATPVLTI
QNGLGSAETVAGIVGAERVAVGIASGFGASRVAPGHVHHNAMRAMRFGAH
SSLPHATVETIARAWTDAGFDAAAVTDIAAMQWEKLICNAAYSAPCALTG
MTVGQVMDDPEMAPVSRAAATEAWTVARASGIAVAVTDPVAHARDFGAQM
PDAKPSALLDHEARRVSEIDVINGAVPRQGARVGVAAPVNATLTALIKAI
ERQWG
379764058YP_005350455.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MMRIAAIVERAVGLEGGRRGGPANAVVNFSGHTVSLVAVIADVIRGGRPV
AGVAFNSIGRFAQSGILRDRMIPRVLAASPDALLDASGFLDPAAVVACAL
ADEKPGGHGDRAAAAGALELACWDLNAKLRDEPACVTIARHAGRDPAPTV
PVYAAGGYYYAEGGVVQLRREMRGYLDLGYDAVKMKIGGAALGEDLTRIE
AVVDAVGDAGRVAVDANGRFVRAQATRWADALAPYGLRWYEEPGDPLDYA
LHRAVTDRYDGAVATGENLFSVPDVTNLVRYGGMRPNRDVFQMDPGLSYG
LGEYMRMLDVLEAHGFDRRFAFPHGGHLINLHVAAGLGLGGCEAYPGVFA
PFGGYSDACVVSGGRIAPTDAAGFGLEEKAGLAELIAELTGGCG
379764057YP_005350454.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MQLPQGLARFNRHVTNPIQRMWAGWLPSFGILEHVGRRSGKPYRTPVNVF
RTEVDGKPGVAILLTYGPDRDWLKNLTAAGGGRLRTRGKTVGVADPRVVS
KAEAAAHVSRGVRRVFARLPFEQAVLLTLTS
379764056YP_005350453.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MGQAAGNEAARRAEELVRRGEELAAGKAVTVDDARRAAERAEASHERDEE
AHRRGVQRHYDAAVAHERAAEVHERAVAQRLGDVAAHQRAAEKERDAARH
DYQKAQEAERQGA
379764055YP_005350452.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MGSSDRATAHATGAPRATAASARLFEDACAVIPGGVNSPVRAFTAVGGTP
PFITQARGCWLTDADGNRYVDLVCSWGPMILGHAHPAVVDAVAKAAASGL
SFGAPTPAESELAAEMIGRVAPVDRVRLVNSGTEATMSAVRLARGFTGRA
KVIKFSGCYHGHVDALLADAGSGVATLGLPSSPGVTGATAADTIVLPYND
IEAVRETFARFGDQIAAVITEASPGNMGVVPPAPGYNAALRTITAEHGAL
LIIDEVMTGFRVSRSGWYGIDPVDADLFTFGKVMSGGLPAAAFGGRAEVM
ERLAPLGPVYQAGTLSGNPVAMAAGLATLRNADAAAYTRLDTNADRLAGL
FSDALTNAGVAHQIPRAGNMLSVFFSDTPITDFGSARASQTWRYPPFFHA
LLDAGVYPPCSAFEAWFVSTALDDGAFDRIAEALPGAARAAAEAEEGKS
379764054YP_005350451.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAEQTRVHVVRHGEVYNPSGVLYGRLPGFHLSEAGRAQAAAVADALDHRD
IVAVIASPLQRAQETAAPIAAKHGLPVDTDPDLIESANFFQGRRVSPGDG
AWRDPRVWWQLRNPFRPSWGEPYTEIAARMETAVDKARARGAGHEVVCVS
HQLPVWTLRLHLTGQRLWHDPRRRQCGLASVTTLVYDGDRLAGVEYSEPA
AP
379764053YP_005350450.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTGAALATLVSGLLAGCSSGHDAVAQGGTFEFVSPGGKTDISYDPPSSRG
RPGPLAGPDLADPAHTLSLDDPIFAGRVVVINIWGQWCGPCRAEVTQLQQ
VYDATRGAGVSFLGIDVRDNNRQAALDFVNDRHVTFPSIYDPAMRTLIAF
GGKYPTTVIPSTLVLDRQHRVAAVFLREMLAGDLQPVVQRLAHE
379764052YP_005350449.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTGFTQIAAAGPLLVALGACLLAGLVSFASPCVVPLVPGYLSYLAAVVGV
DEQPPPGAVKAPPGARWRVAGSAALFVAGFTAVFILGTVAVLGMTTTLIT
NQLLLQRAGGVLTIVMGLVFVGLIPALQRQARFSPRQLTTVAGAPLLGAV
FALGWTPCLGPTLAGVITVASATDGASVARGIVLVIAYCLGLGIPFVLLA
FGSAGAVAGLGWLRRHTRAIQVFGGVLLITVGALLVTGVWNDFVSWLRDA
FVSDVRLPI
379764051YP_005350448.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MGTALVLLFLLALGAIPGALLPQRNLNAGKVDDYLKAHPVIGPWLDRLQA
FNVFSSFWFTAIYVLLFVSLVGCLTPRMIEHVRSLRSTPVAAPRNLARLP
KHASHQIRAGAEELNTLANAITDRLRGWRTAIRHEDGAASDVVEVSAEKG
YLREFGNIVFHFSLLGLLVAVAVGKLFGYEGNVIVIADGGPGFCSASPAA
FDSFRAGNTVDGTSLHPLCIRVDDFAAHYLPSGQATSFAANIAYQSGEDL
TANTWRHYRLEVNHPLRLGGDRVYLQGHGYAPTFSVTFPDGQVRTSTVQW
RPDNPQTLLSSGVARIDPPAGTYPTPAERRAHQIAIQGLLAPTEQLDGTL
LSSRFPALNAPAVAVDIYRGDTGLDTGRPQSLFTLDPRLIEQGRLTKEKR
VNLRAGQAVRIDQGPAAGTVIRFVGAVPFVNLQVSHDPGQTWVLVFAITM
MGGLVVSLLVRRRRVWVRLTPDAGGAPGTVNVELGGLARTDNSGWGDEFE
RLTERLLDGLGGAGRAETPPASQRSSQVDVT
379764050YP_005350447.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MNTLHVNVELARYSDWAFTSAVVALVIALLLLAFELAYAGGRRADQRARV
LAGAVSADSATPGVVEQPDQRPLDERVGRAGLSVVYLGIGLLFACLVLRG
LATVRVPWGNMYEFINLTCLCGLIAGAVVLRRPQYRPLWVFLLLPVLILL
TVSGRWLYTNAAPVMPALQSYWLPIHVSVVSLGSGVFLVAGISSILFLLR
TSRLGDPDTDSAAARLVRRFPDAETLDRIAYRTTIFAFPVFGFGVIFGAI
WAEEAWGRYWGWDPKETVSFVAWVIYAAYLHARSTAGWRDRKAAWINVAG
FVAMVFNLFFVNLVTVGLHSYAGVG
379764049YP_005350446.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSEHPTAGVGAPEQPTTQIPPQTSSAPAQQDAGEPQPESGGDAPTRAFAG
FRTERRVPTPEHQQAAPPTAPRPGAMPPWDSTPVTGIPRVDPTAYGAYYA
GPDAPPTQMQGAPQRPEHLPHTPYPELSTGMLLRPVQPPPSDGWRLLLYK
MSGGLINLGESPRASRYNNLVAQVNRPLRGSYRVAFLSLKGGVGKTTIAA
TLGATFASIRGDRVVAVDANPDRGTLSQKIPLETAATVRQLLHDAGTIER
YSDVRRYTSKGPSGLEVLASETDPAISEAFSAEDYGRILDILERFYGLVL
TDCGPGLLHSVMKSVLDRADALVVVSSASIDGARSASATLDWLDAHGHED
LVRNSIAVINGVRPRPGKVDMNKVIEHFSRRCRAVQLVPFDPHLEEGAEI
DLERLRRPTREALTELAAIVADGFPGDQRNPGVLG
379764048YP_005350445.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MVYLLLVVILGTLIYVGWRAARSQVHRPKTRVIGPDDDPDFLRRLGHGDN
NPR
379764047YP_005350444.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSHEGSDNTIGGPGNGAGGESAENHVVVPVLAYMAARLLLAVVLTAVIYG
VARLAGITQFPLVVAALFALIIAMPLGIWVFGPLRRRATAALAIAGERRR
RERELLQARLHGDAPPDETREDG
379764046YP_005350443.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MKQISATSGPTNIGLLSVGSYRPERVVTNDELCENIDSSDEWIYSRTGIK
TRRFAARDESAASMATEAGREAIAKASLEASDIDCVIVATSTHLLQTPAC
APAVAAALGATGVPAFDISAGCAGFGYALGVAADMIRGGTAARVLVLGSE
KLSPTIDMQDRSNCFIFADGAAGVVVGETPTQGIGPTVWGSDGNQASAIR
QDIDWLDYLENPTGPRPFLRLEGSAVFRWAAFEMGKVGQQAMDAAGIRPD
EIDVFVPHQANSRINEILAKSLELRPDAVIANDIEHTGNTSAASIPLAMA
EVLATGAAKAGDLALLIGYGAGLSYAAQVVRLPNG
379764045YP_005350442.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MVHDHAVIAGPGERRPASWQDDVVANLGQWVSGARPRTLPNAVAPVVAGT
GAAAWLGSAVWWKALLALAVALALTVGVNYANDYSDGIRGTDDDRAGPVR
LVGSRLAAPRAVLGAALASLTIGALAGVVLALFSAPWLIAVGAACIAGAW
LYTGGSKPYGYAGFGEVAVFLFFGLVAVLGTQYTQALRVDWVGLLLAVSV
GALSSSVLVANNLRDIPTDARSGKITLAVRLGDARTRVLYQALLGTAGVL
TLALMVATPWCAAGLVATPLALRAMAPVRSGRGGPELIPVLRDTGLAMVV
WAIAVAAALAIGT
379764044YP_005350441.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MLGVIGGSGFYTFFGSDADDVTVDTPYGAPSAPVTVGAIEGHDVAFLPRH
GAKHEFSAHTVPYRANMWALRKLGVRRVLAPCAVGSLKPELGPGSIVVPD
QLVDRTRGRADTYFDSGGIHVDFADPYCPTLRAAVTDLPGVVDGGTMVVI
QGPRFSTRAESRWFASAGFSLVNMTGYPEAVLARELEICYAAIALVTDLD
AGVSAGEGVRTVDVFAEFERNIGPFKALVRAAIGRVAADRTCTTCLPHTG
VTLPIELP
379764043YP_005350440.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MRVLLTGAAGFIGARVGAALRAAGHDVVAVDVLLPAAHGPNPVLPKGCQR
VDVRDADALAPLLDGVDAVCHQAAMVGAGVDAADAPAYGGHNDLATTVLL
AQMFAAGVRRLVLASSMVVYGQGNYHCRRHGRVDPLPRRGADLDAGAFEH
RCPVGGEELAWCLVDEDACLRPRSLYAASKTAQEHYALAWSEATGGSVVA
LRYHNVYGPGMPRDTPYSGVAAIFRSSLEKGEPPRVFEDGGQMRDFVHVD
DVAAANVAALAHDDGFLAANVCSGQPISIFEVAAALCDARGGSLSPVVTG
EYRSGDVRHIVADPSRAAEVLGFSASVLPGDGLREFAFAPLR
379764042YP_005350439.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MVSQSSDDTPTGPIGARAQQAPAPRIIRPHATGGTTPVAAGTGRRRAIVS
DATAVVLLVLAVFLPWNLYFGVGIPDSSPALFAVLLAVTVLAVAAVAVAG
SWRSGGERFNPASAARLRLALNAPYLLLVLAVIAFDAYETVRFGGTVTVP
GGVGPGAWVGVAGSLLSAQAVPAGPIPADDEYTGWHRSARMIGALSMLAA
VLSFGFNLYWRVRYALQSTNGAAEFGKQNIAVIATAVVYGVVALVAVLVA
SRWLLQRTRASRLTTVALGASALAAGILVWILPVGRDLDAFHGIAQNTST
AGVGFEGYLAWAAGAAIFAPRALFGHRNPSPAEESAWRSTTRNGLLLIAV
WAVGSIAMRLTDLVVGIALNYPFSGYDSVVLAAFDLVTAALAIWLRRRLA
GISARLVTSLCGLVAALSVARVIVGVALAPRFADSPNSPAQQPVYGNDLA
QQITSTFDVTLCGLALGILAAAVVAGQLHGRRLARRAARKRAADANAAAP
TTRVRVGQAAGPSAAATTRMPTGGPGAESDPPTAEIPPLAGSPRIFRGDD
SGTRQIPVRGPQIFRPPQT
379764041YP_005350438.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MHRSLANIFSVRLPWQWLGRAAGRRRFRGDRPVLRKAGYAALVANLVAE
379764040YP_005350437.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MDVVLGVAVTGPVARLALLGSGAQGTDVIDQSVIDLADNPLGTLTETVVG
TNRLLADENHRLVGTRLCWSDEPRADELRRALEDSGVHNVAVLSESQAVA
ALMRAAGRPGAALVMDDATATLSVVGPDAGDPDAPPTVLASQPLTGATGP
DATAAFQTMMANLGTHPDAPGEVYLLGASPDLNRVADELRDASTMRVQVA
EDPTFALARGAAIAAAAASAPDATAMAPAVGLTGDATAMAPAAGLTGDET
TVVPAPDAEEPQLAYSMADEGGVYPGEMDEYDPEFDDYDYGPEFGDDAEA
GEDAPTKLSRRSLVIGNAVIAFAVIGLASLATAIAVAVRPTAAQQPVVGV
QNGTPGKFMPILPSQQQAPLPPPPPEAPNAGFQGGTVPAPEHVAPPSGGG
PQVAPVPEAPSNPGVVPNPDPGWAPRPNPIVPVPIPIPIPIPGWQPPYNP
PYNPTTPYTPPTITTSQPPTTTYSPPTTTYSPPTTTYSPPTTTYSPPTTT
YSPPTTTYSPPTTTHAPPTTTYAPPSTKATTQPPVQTHTQQTAPPTHSQQ
PLFPQEPRTHRGF
379764039YP_005350436.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MPGADGLVTVVLPCLNEEESLPAVLAAIPAGYRALVVDNNSTDDTAGVAA
RHGARVVAEPRAGYGAAVHAGVMAATTPIVAVIDADGSIDGADLPRLVAA
LEQGADLVTGRRRPVPGLHWPWVARIGTVVMSWRLRTRHGLPVHDIAPMR
VARREALLALGVADRRSGYPLELLVRAAAAGWRVVELDVSYGPRTGGKSK
VSGSLRGSITAILDFWKVIS
379764038YP_005350435.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTALPVTLLVVAKAPEPGRAKTRLAASVGDRVAAEIAAAALLDTLDAVAD
APVAARVVALTGDLGRAASAADIRRRLASFTVIAQRGDDFAARLANAHAD
ASSDGLPVLQIGMDTPQVTAELLTGCARRLLEAPAVLGPARDGGWWVLGV
GAPAMAQCLRTVPMSAPDTGELTLKALRDTGIDVATVQTLADVDVVDDVA
AVREACGPDSRFARITRAAGL
379764037YP_005350434.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MRDAVAVSIGAALVAAAFVLPRMNLGVRPRLDVGAEKFATHAGSAPIFGE
WLIHAGWGTGPAIALAVVVVAWGPTLAQRLSWRALTLGSWAVAGGWAFAL
AMIDGWQRGFAGRLTTRDEYLSQVPGVTDIPATLRTFAGRIVDYQPHSWT
THVSGHPPGALLTFVWLDRIGLHGGAWAGLLCLLAGSSAAAAVVVGVRAL
ADESTARRVAPFVALAPTAIWVAVSADGYFAGVAAWGIALLAVAVHRPVR
FPALTAAAAGLLLGWGVFCNYGLMLMGLPAAAVLASAADWRAILRALGPA
ALAAIGVAVAFAVAGFYWFDGYHLVQQRYWQGIAKDRPFQYWSWANLACV
VCAIGLGGVAGLGRVFDGAAVRRRSGFHLLLLGVLAAVVCADLSMLSKAE
VERIWLPFTIWLTAATALLPVRSHRIWLALNAAGAIALNTIILTNW
379764036YP_005350433.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MLEGRDPALVAVGDDRESAALRAGLRVGETIDDDVALVAATSGTTGNPKG
ALLTAAALRASAAATHDRLGGPGSWLLALPPHHIAGVQVLVRSLLAGTSP
VEMDVTGGFDETELPRAIGALGPGRRYTSLVAAQLAKALADPAAAAALAE
LDAVLLGGGPAPRPVLDAAATAGITVVRTYGMSETAGGCVYDGVPLAGVR
LRVADGRIVIGGATVAKGYRDPIDPDPFAEPGWFVTDDLGAIDGAGVLTV
LGRADDAISTGGLTVLPQPVEAALCSHPAVRDCAVFGVADERLGQRVVAA
IVVHDGRVAPTVEALRAHVTRALDATAAPREVHVVDALPRRGIGKVDRAA
LVRRFAGASDQ
379764035YP_005350432.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MNGFLNSIVSWLRAGYPEGVPPTDTFPVLALLARRLSNDEAKAVACELVR
RGEFDDVDIGVLITQITDELPSPQDVERVRVRLAAQGWPFDDADQAGDPA
379764034YP_005350431.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSHIGDWFNYQASLKILVFAMLAGAALPGLFALGIRLQSAGAGDISLDGA
SNGSAPRRNPMLTALAWSIYALVIAVIALALLYIARDFIAHHTGYPLLGA
KPK
379764033YP_005350430.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MNIQLFLLIIVVITALAFDFTNGFHDTGNAMATSIASGALKPKTAVLLSA
VLNLVGAFMSTAVAATIAKGLIDSNIVTLELVFAGLVGGVVWNLLTWLLG
IPSSSSHALIGGIVGATIAAVGAHGVIWKGVISKAIIPAVVSAILAIAIG
AVATWLVYRITRGVPKARTEAGFRRGQIGSASLVSLAHGTNDAQKTMGII
FLALISYGSVSKTATMPPLWVIVSCALAMATGTYLGGWRIIRTLGKGLVE
IQSPQGMAAESSSAAVILLSAHFGYALSTTQVCTGSVLGSGLGKPGGEVR
WGVAGRMGVAWLVTLPLAGLVGAFTYGIVHLIGGYPGAITGFALLVAVSA
TIYLRSRRVKVDHHNVNAEWKGDLTSGLQAADQPPPGDDGPTLGGVSARY
DSDDPSLKANAS
379764032YP_005350429.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MEILASRMLLRPADYQRSLAFYRDEIGLAIAREYGGGTVFFAGQSLLELA
GYGSPDHSRGPFPGALWLQVRDLEATQAELRGRGVSIAREARQEPWGLHE
MHVLDPDGITLIFIQIPPDHPLRRDTRGERQGNSG
379764031YP_005350428.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSKSPLRRFTDQLVLATMRPPMAPQVLVNRPLIKPIELAGKRILLTGASS
GIGEAAAEQFAREGATVVVVARRQELLDALAERITTAGGDATAIACDVSD
MDAVDALVADVEKRLGGVDILINNAGRSIRRPLAESLERWHDVERTMVLN
YYAPLRLIRGLAPGMIERGDGHIINVSTWGVLSEASPLFSVYNASKAALS
TVSRVIETEWGERGVHSTALYYPLVATPMIAPTKAYEGVPALTPEEAGEW
MITAARTRPVRIAPRMAIAAKALDTFGPRWVNAVMQRQSIQPNRKGDR
379764030YP_005350427.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSDNPFDADQWRPVEGFGDLTDITYHRHVDDATVRVAFDRPEVRNAFRPH
TVDELYRVLDHARMSAGVGVVLLTGNGPSPKDGGWAFCSGGDQRIRGRSG
YQYASGETADTVDPARAGRLHILEVQRLIRFMPKVVICLVNGWAAGGGHS
LHVVCDLTLASREHARFKQTDADVGSFDGGYGSAYLARQVGQKFAREIFF
LGRAYTAEQMHHMGAVNAVVDHAELESEAIAWAREINAKSPQAQRMLKFA
FNLLDDGLVGQQLFAGEATRLAYMTDEAVEGRDAFLEKRDPDWSRFPRYF
379764029YP_005350426.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MARADGLKPPWWLKPANKVFIQLSRLGLSFGGESPVVLTVPGRKSGTPRS
TPVTPMTVDGKRYVVGGFPGADWIRNVRAAEHATLARGRHRERVRMVELP
ADVARPFLRAFPTEVPTGVGFMKRSGLVTDGRPEEFEALAGVCPVFRLDP
A
379764028YP_005350425.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTDLNPGGIGTIGSHPVARMGYGAMQLFETSPQDAAAVLRRAIDLGVNHI
DTASFYGPGEVNRRIRAALAPYPDDLVIVSKVGARYTGEQPIPLAPAQRP
SELRAAVEDDLRQLGLDRVPVVNLRRLDSGIGMAAEGDQIVDLDDQLAEM
IALRDEGKIGAIGLSSVSLDVLRRALPAGIACVQNAYSLLDRSQEAALEL
CVDEGIAWVPYFPLGSALPGFPKVADDPVVAGIAGELGVSGARVGLAWIL
AHAPNTLLIPGTRSIAHLEENMAAADVTLSAEAIARLDAVATPGVDPWAQ
GAEPFREASRS
379764027YP_005350424.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MGRSDARRNRERLLLAATAAFTEHGAAASLESIARDAGVGIGTLYRHFPN
REALVEAIYRAELAEVAAAAEQLLGRHPPTTALRRWMDRYAGFVAAKRGM
AESLQAIFDSGAMEPSQTRDSIVGAVELLLRAGADDGSLRADVRADDVVS
SLIGIFLVSGSSEQTGRMLDLLVAGVSAT
379764026YP_005350423.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSDELLRNPTHNGHLLVGALKRHKNKPVLFLGDTTLTGGQMAERISQYIQ
AFEALGAGTGVAVGLLSLNRPEVLLIIGAGQTRGYRRTALHPLGSLDDHA
YVLNDAGISSLIIDPNPMFVERALALLEKVPGLKQILTIGPVPEALNGVA
VDLAAEAAQYDPQPLVAADLPPDQVIGLTYTGGTTGKPKGVMGTAQSISS
MTQIQLSEWEWPEDPRFLMITPLSHAGAAYFLPTLIKGGEMHVLPKFDPA
DVLKTIEEKRITATFLVPSMLYALMDHPDSHTRDLSSLQTVYYGASAINP
VRLAEAIRRFGKIFAQNYGQSEAPMAITYLAKNEHDEKRLTSCGRPTLFA
RVALLGEDGKPVPQGEPGEICVSGPLLAGGYWNLPDETAKTFKDGWLHTG
DMAREDEDGFYFIVDRVKDMIVTGGFNVFPREVEDVVAEHPAIAQVCVVG
APDEKWGEAVTAVVVLRSDAPRDDAAIEKMTAEIQAAVKDRKGSVQSPKR
VVIAESLPLTGLGKPDKKAVRAQFWEGAERSVG
379764025YP_005350422.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MGQADLVVTGTILTVDEARPTAEALAVADGRIVAVGTRAEVADAIGPDTQ
TVDVGDGCVMPGFVEAHGHPLMEAVALSDRLVDIRPVTMRSADDVVAAVR
SEVARRGSDGAYLNGWDPLLQNGLPEPTLGWLDGIAPDTPLVIMHNSGHK
AYFNSRAAQLHGLNRDTPDPKGAKYGRDADGELDGTAEETGAVFPLLGGV
IDFADYPRMLLAECARLNRAGLTTCSEMAFDPGFRPLVEGLRSQLTVRLR
TYEISNPQMSTDATPGQGDDILRQVGIKIWVDGSPWIGNIDLSFPYLDTE
ATRIIGVAPGSCGCANYTKEQLHEIVGAYFPLGWPMACHVQGDAGVDTIL
DVYEDVLRRHPRDDHRLRLEHVGAIRPEQLRRAHDLGVTCSIFVDQIHYW
GDVIVDGLFGEERGTRWMPAGSAVATGMRISLHNDPPVTPEEPLRNISVA
VTRTAPSGRVLGPEERLTVEQAIRAQTIDAAWQLFSDDVIGSLEVGKYAD
LVVLSADPRTVSPERIADLDVRATYLAGRQVYSA
379764024YP_005350421.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTPPLEDLLDRLHVVALPMRVRFRGITTREVALIEGPAGWGEFGAFVEYE
PPEAAHWLACGIEAAYRQPPPVRRDRIPINATVPAVPAAQVGEVLARFPG
AGTAKVKVAEPGQTLADDVARVNAVRDLVPTVRVDANGGWSVEQAVEAAA
ALTADGPLEYLEQPCATVGELAELRHRVDVPIAADESIRKAEDPLAVVRA
GAADIAVLKVAPLGGISAMLAIADQIDIPVVVSSALDSAVGIGTGLTAAA
ALPRLRHACGLGTGGLFVDDVAETAPPVDGHLAVGPVTPDPARLAALAAP
PERRQWWIDRVKACHRLLVPSSG
379764023YP_005350420.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MINLAYDDRGSGEPVVFIAGHGGAGRTWHPYQVPAFLAAGYRVITFDNRG
IGATENADGFSTQTMVADTVALIEGLNAAPARIVGMSMGAFITQELMLAR
PDLVSAAVLMGTRGRMDRARQFFRDAEAELADAGVTLPAAYEAKIRLLEN
FSRKTLNDDTAVADWIAMFSTWPVKPTPGMRAQLDVAPYTSRLSAYRSIA
TPVLVIGFSDDVLTPPYLGREVADALPNGRYMQIPDTGHLGFFERPDAVN
AAMLKFFAEPR
379764022YP_005350419.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MVVDELIRGGVRDVVLCPGSRNAPLAFALQDADRSGRIRLHVRIDERTAG
YLAIGLAIAAGAPVCVAMTSGTAVANLGPAVVEANYARVPLIVLSANRPY
ELLGTGANQTMEQLGYFGTQVRATISLGLAEDAPERLDAHNATWRSATCR
VLAAATGSRTANAGPVQFDIPLREPLVPDPEPRGAVLPPGRPGGRPWTYT
PPVTFDQPLEIDLTPDTVVIAGHGAGTHPALAQLPTVAEPTAPAPENPLH
PLALPLLRPKQVIMLGRPTLHRPVSALLADPKVPVFALTTGPRWPDVSGN
SQATGTRAVTTGAPNPAWLHRCAETNRHANDAVRGQLAAHPLTTGLHVAA
AVADALRPGDQLVLGASNPVRDAALVGLDTHGIRVRSNRGVAGIDGTVST
AIGAALAHERVGDPDNPARTVALIGDLTFVHDSSGLLIGPTEPTPRRLTI
VVSNDNGGGIFELLEQGDPRFSDVSSRIFGTPHDVDVGALCRAYHVESRQ
IEVDELHAALDDPGPGMRVLEVKADRSSLRQLHAAIKAAL
379764021YP_005350418.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MRWARIAVLIVAGLVTLQSVLLVAGAWRNDLAITHNMGVAQAEVLSAGPR
RSTIEFVTPERVTYRPELGVLYPSHLATGMRIYVEYNKNDPNLVRVQHRN
AGLAIIPAGSIAVVAWLGAAALLVALALLDKWLDRRAETAEPANFA
379764020YP_005350417.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MRVAIVAESFLPEVNGVSNSVIRVLEHLRRTGHEALVIAPDTPPGEPPAE
RIHDGIRVHRVPARMFPKVTTLPLGVPTPRLVSVLRGFDPHVVHLASPAL
LGYGGVRAARWLGVPTVAVYQTDVPGFAASYGIPMTARAAWAWFRHLHGL
ADRTLAPSTVTMEALVAHRFPRVHRWARGVDVLRFAPSARDEALRRRWSP
HGKPIVGFVGRLAPEKHVERLAGLAAGGAVQLVIVGDGVDRDKLQSAMPT
AVFTGALYGDELAAAYASMDVFVHPGEHETFCQVVQEALASGLPVIAPDA
GGPRDLVTPWRTGLLLGVNEFEARLPEAVAHLLAERARYAPAARRSVVGR
SWSVICDELLGHYEAVLSPFERRRLSARRYAQGE
379764019YP_005350416.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MWFITGTSRGFGRAWAIAALERGDRVAATARDTASLDDLVRKHGDALLPI
QLDVTDRAADFAAVKRAHDHFDRLDIVVNNAGYGQFGFVEELSERDARDQ
IETNVFGALWITQAALPYLREQGSGHIIQVSSIGGITAFPLVGIYHASKW
ALEGFSQALAQEVAQFGVHVTLIEPGGFDTDWAGASARHAERLPAYDDLR
AAVEAERSRRWASPGDPSASAAALLKVVDAEKPPLRVFFGSSPLETAKAD
YESRLRTWEEWQPVAELAQG
379764018YP_005350415.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MVSRAELDKDPRDVASMFDGVARRYDLTNTVLSMGQDRHWRKATRAALEI
GPGQRVLDLAAGTAVSTVELKKSGAWCVAADFSVGMLAAGAARHVPKVAG
DATRLPFADDVFDAVTISFGLRNVVDTQAALREMARVTRPGGRLVVCEFS
TPTNGLFATVYKEYLMRALPRVARAVSSNPEAYVYLAESIRAWPDQEGLA
QQLTQAGWVGVRWRNLTGGIVALHAGHLPPR
379764017YP_005350414.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MKGTMLATIGAAAAAVAAFALAAPAPLSAPAQADPPPTAPYPTPRTPSPP
SDYDAPFKNTVNGFGIYQPQDQLAWLGKITCDRIDHGVDHDAHQSATFIQ
RNLPRGTTEGQSLQFLGAAVDHYCPEHIDVVQAAGNH
379764016YP_005350413.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MVVVGAGPAGSAAAAWAARAGREVLVIDSASFPRDKACGDGLTPRAVAEC
ERLGLGDWLDARIRHRGLRMSGFGGEVEVDWPGPSFPSTGSAVARVELDD
RIRKVAEDSGARMLLGTKAVGVQHDSSGRVTSLTLADGTEVGCRQLIVAD
GARSSLGRKLGRRWHQETVYGVAARGYLSTPRADDPWLTSHLELRGPDGS
KDTVLPGYGWIFPLGNGEVNIGVGALSTSKRPAELALRPLIDHYTDLRRD
EWGFVGPPRAVSSALLPMGGAVSGVAGPNWMLIGDAAACVNPLNGEGIDY
GLETGRLAAELLDGRDLSQAWPSLLREHYGRGFSVARRLALLLTFQRFLP
ATGPIAMRSTTLMTIAVRVMANLVTDEDADWVARAWRGGGRLSRLIDRRT
PFS
379764015YP_005350412.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MNTPATVVAGVDLGDAAFAATVRDGVGRIEQLMDTELRSADEIMTESLTH
LFKAGGKRFRPLFTVLSAQLGPNPDAADVTIAGAVIELVHLATLYHDDVM
DEAEVRRGTPTANVRWGNNVAILAGDYLFATASRLVSRLGPEAVRLIAET
FAQLVTGQMRETRGLTGAAEGADPIEHYLKVVYEKTACLIAAAGRFGAMF
SGADADQVERLSRLGGIVGTAFQISDDIIDIDSDSRESGKLPGTDVREGV
HTLPMVYALREPGPDAARLRELLVGPIDDDETVAEALALLRASEGMAKAK
RSLQDYAAQAHQELALLPDVPGRHALQTLVDYTISRHG
379764014YP_005350411.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTWHPHANRFKTFALLVGMSALIVFVGSLFGKTAMFLAVLFAIGMNVYTY
YNSDKLALRAMHAQPVSELQAPAMYRIVRELATAAHQPMPRLYISDTNAP
NAFATGRNPRNAAVCCTTGILGILTERELRAVLGHELSHVYNRDILISCI
AGAMASVITALANMAMFAGMFGGNSRDGENPFALLLVSLLGPIAATVVRL
AVSRSREYQADESGAVLTGDPLALASALRKISGGVQAAPLPPEPQLASQA
HLMIASPFRAGERIGSLFSTHPPIEDRIRRLEQMAGR
379764013YP_005350410.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MEAVMAMSHSDSIDIHEAGLALNLPDLVFETRAGAGMNQEQLAHALGTTR
EAVAAWESGDEVPRVDVLQRLAQVCGKRLHIRIDVD
379764012YP_005350409.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MQDIERAGDRLPTASRADRLRGIIRHDLPSSLVVFLVALPLSLGIAIASG
APVLAGLIAAIVGGIVVGSVGGSPLQVSGPAAGLTVIVAGLVSEFGWGIT
CLITVAAGTLQVLLGLSRVARAALAISPVVVHAMLAGIGITIALQQAHVL
LGGKSKSTAWHNLIGLPGQVVGAHRPGVILGVLVIVIMVAWRWVPAKARR
VPGPLVAIVAVTALSVVFGFHVRRIDLEGSPLDALRLPDLPHGNWGAFTV
GVITVALIASVESLLSAVSVDRMHNGPRTDFNRELVGQGAANIISGTVGG
LPITGVIVRSSTNVNAGAKSRASAIMHGVWILLFTIPFAGLVEQIPTAAL
AGLLIVIGVQLLKPAHIETAMKHGDLAVYVVTAVSVIFLNLLHGVLIGLA
LAIALTGWRVIRAKIEAEPVGDEWRVTIEGAACTFLALPRLTRMLTSVPR
GATVTVAISVHYLDHAAHQTITDWQRQHEATGGTVEIRGVMETGHRAADE
PLVEAQAPGAAA
379764011YP_005350408.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MNYSQISDVGNTLIAMASEKREPKVVVLGGGSWGTTVASICARRGPTLQW
VRSEETARDINDNHRNSRYLGNDVELSDTLRATTDFAEAANSADVVVMGV
PSHGFRGVLTELARELRPWVPVVSLVKGLEQGTNMRMSQIVEEVLPGHPA
GILAGPNIAREVAEGYAAAAVLAMPDQHLATRLSGLFRTRRFRVYTTDDV
IGAEMAGALKNVFAIAVGMGYSLGIGENTRALVIARALREMTKLGVAVGG
DPDTFPGLAGLGDLIVTCTSQRSRNRHVGEQLGAGKPIDEIIASMNQVAE
GVKAASVIMEFANEFGLTMPIAREVDAVINHGSSVEEAYRGLIAEVPGHE
VHGAGF
379764010YP_005350407.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTVTPQEAAGHGATEADYFDVIIVGAGISGIDAAYRITERNPQLTYTVLE
RRAQIGGTWDLFRYPGVRSDSSIFTLSFPFEPWTREEGVADGVHIREYLA
ATARKYGIDRHIRFDSYVRSADWDSATDTWTVTVEQGGERRLYRGRFLFF
GSGYYNYDEGYTPDFPGIEEFQGTVVHPQHWPEDLDYAGKKVVVIGSGAT
AVTLLPSLSDRAAKVTMLQRSPTYLISASKYGTVAAVARKLLPRKPAHLV
VRMYSALTEAVFFALSRKAPGFVRWLLRRKAINSLPAGYDVDTHFKPRYN
PWDQRMCLIPDADLYEAISAGRADVVTDHIDHFDATGIALKSGGHLDADV
IVTATGLQLQALGGATISLDGNEIKTSDRFVYKAHMLEDVPNLFWCVGYT
NASWTLRADITARATAKLMEHMASHGYTRAAPHRGNEPMTEKPSWDINAG
YVLRSVHALPKSGTKRPWNVRQNYLADAIDYRFDRIEEAMVFGRTADRTA
LAG
379764009YP_005350406.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MADSSFDIVSKVDRQEVDNALNQAAKELATRFDFRGTDTTIAWKGDEAIE
LTSSTEERVKAAVDVFKEKLIRRDISMKAFDAGEPQASGKTYKVSGSLKQ
GISSENAKKITKLIRDDGPKSVKTQIQGDEIRVTSKKRDDLQAVQALLKQ
ADLDVALQFVNYR
379764008YP_005350405.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSISPATLSILRECRTALATARESALAAQAGLAGVRKARAAELAEKIADA
IAFADRLCFVVQCDLRAGQ
379764007YP_005350404.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MQTVRSFCRVCTSVCGILVDVEGDEVLRVRGDQEHPFSRGYTCPKGRALP
QLHHHPDRLERPRMRADGRLRDTTWDACLDDLGTRLKDIIDRHGPQSVAF
YFSTMESAGFRMAEALHAAIGTPAKFSPLTIDGTAKPLVSDLVGGFMGLS
GRTDLDNADFLMLVGVNPVVSHGHAISMPNPTGTVREIARRGQVWVIDPR
RTETARLATAHLAPRPSTDHAVLAYLVREILRDGMKSDVPVQGIDELARA
VEPFTLEHTAKLADVAEADLARLFAGVRAAKCVAVETGTGVTMTAERANV
TQWLAWVLMILTGAMNRPGGTWFHPGFAYQLETFGEFLPVTPIEGSFGPG
PRSRPEAQAFINEWPCAALPDEIAAGNIRALINVGGSLVTSFPETGKLIP
ALQSLEVFATTEIINNETTELATHVLPTKDPLERPDITIHDILSSHVSVQ
YSPAVVEPVGERRSMWWVFAELGRRLGYELGNLGDPDTSTDDDVLAVLLA
GARTGFDEVAAVGWAEAPRELPAAWVDEHVARMGGWRLAPPLLVDQLAGL
KPPAPLVLVPRRQRRKLNGQLDFLGEAPEVLIHPEDGAAAGVADGQKVTV
RSANGELTGIAKVDDSIRRGAVSIPHGHHAANVNRLTNKDDIDVVTGMVR
YSGVPVSLHPA
379764006YP_005350403.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTDTTTPPVADESEDRPQIPLRTRGRWLRWGLLSVWGPGLVVMLADTDAG
SLITASQSGAQWGYRMVLPQLILMPVLYVVQEMTVRLGIVTGRGHGSLIR
ERFGRGWAWLSAFTLFASAIGALLTEFAGVAGVGELFGVSRWVSIPVATV
ALLALALTGSYRRVERIGLVVGAAELAFLVAMVMARPDPRALVDGLSSMP
LGNSSYLLLVAANVGAVIMPWMIFYQQGAVVDKRLSENTIRQARYDTAFG
AVLTQLIMIAVVVTMASTIGTSGAHGGGAELETVGQIAQSLTPYLGRVGG
TVLFGLGMLGAALVAAIVASLAGAWGLAEVFGWKHTLNERPNRATARFYI
TYSLAHIVGAVLVLASVDLVNLAVDVEVMNALLLPIVLGLLLALEARALP
EQWRMRGLHKYVTRALCFVTIGFGLYMVPQALGWI
379764005YP_005350402.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MRATWGPAAAAVACLALSSCSETVSAPPLTPTAPTSASKTTTRAGPAPIT
GPLEKDWKSYGGTAYFGCPQTFSAGKSALDDIRPKIFDPKTGQYVAPAIP
TIAAGENLTGAMCALTGAAADLKVVYVVTTVKPAQAPAPEISRTTAYSYD
WSSGHQVATKELQPPTPGLRLAAPKEWGLAPTASGVAWVNAFTDGHAPAS
PPRTVVLSGADLSIMWDDPQPARVWQDVIAFPRNADPGKASGAELRRPNG
EAIYQDDDAQSVDAELAEGPDKLVKITHRESRNPPAVSTMFYDLNAKSLI
KIGDSDRISGGGLSAALSDGKLFVDGHNSENSSFGFGVWNLRSQQWDLLK
SRDDAKKMSISKLAFFEDHLYLTGSGGTFSVIALPATDPVASGWSTRPFE
RISGWTLVCRGETAPSSNGECKEIVMVQDQDGHYPGPWF
379764004YP_005350401.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MLMTGQPQLLSVQRRYWELIASGVSSEDAGVAVGVSATCGGKWFRRFGGV
NPRWLAPQGQKRPRLSADEREQIMIGTAQGESIRSMAARLGRAPSTVMRE
IANNGVMRGYVGRYRSRYRFGARRAGVDAKSGYSARIAQLRSEQRARRPK
IGKLGRCPALRDQVQAWLVKKYSPEQIAGMLATTYSDRPEMQVSHETIYK
ALYVQGRGELRRELTKCLRTGRALRKPRARVGARSGCGRIPGMVNISERP
AEAADRAVPGHWEGDLILGKNQHSQIGTLVERSTGFVQLLHLPARRDPET
VADAMIATIKTLPQALRRSLTWDQGHEMLRHARISIDAGIDIYFCDPHSP
WQRGSNENTNGLLRQYFPKGTDLSVHSADYLAEVAAELNERPRKRFGWDS
PAQVLNRLLSNPPQTTVATKP
379764003YP_005350400.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAIHCLGVVRSWWGIDEETVMTVGAAPPSVFDADLPTLSYRDDETPAEVY
PRLREAQRHAPVALGPHGPEVLGYHMVRSVLRDTRFQIPPGLNLLVQGIT
SGPLWDKVVNSLLCLEGDAHHRLRSLTSKAFTPKATLRLHDTMVGVLNEL
VDRVAGAGRCDVVTDIARPYPVPIICALLGAPREDWQRFSLWADDVFKAF
SFTADLTEVEPVVMRAWRQLDAYVDEMVAGRRRSLTDDLLSDLIRAEDEG
DRLDAAELRMLAGGLLLAGTDTTRNQVAASVHLLCEHPEQWELLRRRPEL
AMRAVEETMRHSPIVCGTLRLVAEDAEVDGYVFPAGTMVLLNTGAANRDP
TVYDDPDRVDITREGAPPILTFGGGAHYCLGANLARREIAEALTVLTARL
RNPRIAGPAPWKPMGTLSGPLSLPLEFDR
379764002YP_005350399.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MIKGMTEPVAARVAVYLDFDNIVISRYDQIHGRNSFQKDKAKGLEQHSER
LGQATVDVGAILDYASSFGTLVLTRAYADWSADINAGYRGQLVARAVDLV
QLFPAAAYGKNGADIRLAVDAVEDMFRLPDLTHVVIVAGDSDYIPLAQRC
KRLGRYVVGIGVAGASSRALAAACEEFVVYDALPGVPALDREPGPADTAP
PKRRGGRTKAAQAEEPEPPDAQAAATALLTRALQIGLEKDDVDWLHNSAV
KAQMRRMDPSFSERSLGFRSFSDFLRSRSDIVELDETSTTRMVRLRAQD
379764001YP_005350398.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSDMKFLELHGDRIAYRDEGDGEALLLIHGMAGSSETWRSVIPQLSKKFR
IVAPDLLGHGQSAKPRTDYSLGAFAVWLRDFLDELGVSQATVVGHSLGGG
VAMQFVYQHPDYAKRLILISSGGLGPDVGWVLRLLSAPGAELVLPIIAPT
PVLSVGNKLRSWLTSAGIQSPRGAELWSAYSSLSDGETRQSFLRTLRSVV
DYRGQAVSALNRLSLREDLPVMAIWGERDGIIPVDHAYAAHKARTDARLE
ILPDVGHFAQVEAPNQVVELIEDFIATGERRDTQSPQPSL
379764000YP_005350397.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MRIAISGAGVAGAALAHWLHRTGHTPTLIEQAPHLRTGGYMIDFWGVGYQ
VAKRMGIEGPIRAAGYEMERLRSVGPRGEIKADVDVDVFRRLLGADFTSL
PRGDLAAAIYATIEDEVETVFGDSISFVDERDDGVRLGFERGGARDFDLL
IGADGLHSNVRRLVFGPEREFERYLGCKVAACVVDRYRPRDELAYVTYAE
PGRQLARFALRGDRTTFLFIFRADHDGTDTPPKDQLRNTFADCGWEAHDM
LAALDDVDDLYFDVVSQIHMNRWSRGRVLLIGDAAGCISLLGGEGTGLAI
AEAYVLAGELGRAGGDHRRAFDAYEMRLRPFIEGKQAGAARFIGFFATRT
RFGLWFRDLALRTMNFAPMTRLLARDVRDDFELPDYGI
379763999YP_005350396.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MATPNLPPGFDFTDPDIYAHRLPVREFAELRATEPVWWNEQAPDKGGFGD
GGYWAVTKHRDIRDVSLRSDVFSSAAKSIVPRYREDLAAGQIEAGRASMI
MMDDPEHSRLRRIVSRAFTPRAVERLRAELSERARCIVTEAAAAGSGDFV
RQVACELPLQAISALLGVPHEDYDKLFDWTNNMIGSDDPEFAGNDALTSA
GELMWYAMQLAARKAEEPGDDIVTTLIQADADGQRLSEAEFGMFVVTLAV
AGNETTRNSITQGMMAFTDYPVQWELFKARRPKTAADEIIRWATPITAFQ
RTAREDTELGGVAIREGQRVVLFYRSANFDEEVFDDPFTFDILRSPNPHL
GFGGTGAHYCIGANLARMTIDVMFNALADRLPDLAPLGNPERLRSSFING
IKHWPVDYRGGHPVAS
379763998YP_005350395.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MIGSDPGLLRLRMATRTTAALGLSLLVLFVLTRATGQPLTVALLGVVITM
VASRSVNEPDPRQQRITMALLPVPAALAITAAALLAPHVVASDAVFVLIV
FTAAYIRRFGARGRALGMVAFMSYFFTLYLRARVSELPWMIGAVAVGTVC
TYVMTAYVLPDRPERVLRATIRALRARMAIVIDTTAEAVRTGRLDERRRR
RMRARTTRLNETALLVQSQIEDKADPGALWPGVTAEQLAPWLLDAELAIE
WVATAGRRAAAVAGEAPESIPIGTRVPLVDALSQLARAIRLPEPEGLRRA
AARAQRLLDELPEAGAAAEDDPGATAVRRLALAIINAAGATSDVRAIVDR
MAAGAPLDETGGERPAADERAAPEGAADEARPGGLLPTTRQAIQVCIAAS
LAIVTGELVSPDRWYWAVIAAFVIFAGTNSWGETLTKGWQRLLGTLLGVP
AGVLVATLLTGHEIGALAGIFVCLFCAFYFMTVTYSLMTFWITTMLALLY
GLLGQFSFGVLMLRIEETAIGAVIGATVAVVVLPTNTRTAIRADTRTFLT
SLSALIEVCAATMCGEGGASPSEQARQVDRDLQQFRVTAKPLLAGVAGLA
GRRSIRRALGIFTACDQYGRSLARSSEQYRDPVGSPPPAPKLAQAFSAAA
AQTRRNIEALQEAIEGGHAPTLVSAADDLDAAETLARQQDGDGHGAEPRP
ETRRYLTAVHALRQIERAVITAATNLGGRERVRTAEPASR
379763997YP_005350394.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MPATKLVFDIVTEPTRAKLADGRDLLFFSLPGHRPAPVEDRRPLPPRTAE
QSQLRFDRTTGQWVIVAALRQDRTYKPPPDACPLCPGPTGLTSEVPAPDY
DVVVFENRFPSLSGAATPLPDPGDADGFVSTPAPGRCEVICFSADHTGSF
AALTPAHARLVVDAWRHRTADLMAAPGVEQVFCFENRGEEIGVTLTHPHG
QIYGYPYLTPRTVAMLEQARAHRNKHGGNLFGDLLAREVTDGGRIVARNE
VFTAFVPFAARWPVEMHIYPNRFVPNVIGLDEDELDGFVAIYLDVLRRFD
RMYSTPLPYISALHQYSGAGVQADGYFHVELMSIRRSATKLKYLAASESA
MDAFIGDVTPESVAQRLRELQ
379763996YP_005350393.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTVRYGAPGRINLIGEHTDYNLGFSLPIALPQRTVATFKPGPGDAITVTS
ERADAPVRIALGTAPGEVTGWAAYVAGVIWALRQADYPVPGGTMSITSDV
EMGSGLSSSAALECAALGAIASAAGVRIDRKHQARLAQRAENEYVGAPTG
LLDQLASLFGRPATAVLIDFADLAVSPVAFDPDAAGVALLLIDSRERHSH
AGGDYAARRQSCERAAADLGASSLREVGDRGPADLGAVRDPVDARRARHV
LSENQRVIDCVAALGDGNYAEAGRIFTASHASMREDFDITTERIDLIAAA
AVRAGALGARMTGGGFGGCVIALVPIARAGAVAEAVRRAVVDAGFEQPVV
TRTRAAAGAGSCQ
379763995YP_005350392.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAWELDRQAAAIERGLAGAVPQRAGWFRFYFEGHRWVWSDQVQRMHGYEP
GTVTPTTELVLSHKHPADRPQVIDGINDMIRRRQAFSVRHRIVDTRGLIH
HVIVVGDRFCDDNDEVVGTHGFYIEVTPPPARNREDSISAKVAEIVGRRG
VIDRTKGMLMLIYGIDEDAAFTMLKTLSQSKNTKLGVLAQRIADDFTALG
KEVITARSRFDRCLRAAHLRAPGGPPADG
379763994YP_005350391.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAEQSYAVDAGHPPSALLRLVNPVMGLLLRSPLAGAARKQFMVLSFTGRK
TGRPYSIPLSAHLIDGQLYALTGAPWKQNFRDGGPVDVVYDGTTTAMRGE
LIRDRAAVSDLLLRAAESYGVARAQRMIGLRFRDHRIPTRDEFAEAVDRL
HLGAVRLSPVG
379763993YP_005350390.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MALSFALVGCGHDHKSADKTTTSTSASTSTSSGTSSQTSAAPAAKAHYTI
ADYVKDNNISQTPVHHGDPGPNVDLPVPPGWQLTQDSGTSYGGIVQSQPA
NPSDPPTIATLFSKLTGNVDPAKVLQYAPGEVQNLPGYQGQGGAGSASTL
GGFQAWQLGGTYQKAGNTRVRAQKTVVIPAQGAVYVLLLKADGLQSDQAS
LIDAAMVIDEKTTITG
379763992YP_005350389.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MRSRRALIAVIAASAVFMTFIAAAPPKGYDGPPVFVANPVDHVATLIGTG
TGGETVGEINNFPGATVPFGMVQYSPDTVGNYAGYNYDNPRSTGFSMTHA
SVGCAAFGDISMLPATGGVGPQPWNAWETIAHDDTEQGVPGYYAVRFPDT
GVRAELTATAHTGVGRFSYPRNGRPALLQVRSGSSLAGNSRATIQIGEDN
TTITGWATSGGFCDKPNAYTVYFAMKFSRPFTSFGSWDGATVYAGARSAN
APYSGGYVEFPAGTTLEVRTAISYVGIEGARANLAAEDAAGFDDVRAAAS
REWNAALSRISVAGRNVDDLTTFYTSLYRSLLHPNMFNDADGRYVGFDGA
IHTVAAGHTQYANFSDWDTYRCLAALQAMLFPDRASDMAQSLVNDAQQSG
SLPRWAFANAATGEMTGDSVVPFIVSLNTFGAKDFDVRAALRYMVDGATK
GGAGLAGYVERPGIETYLRFGYAPFTLVFGRNGWIADASITLEWSVDDFA
ISRFADSLGDAATAAEFQNRSQYWQNLFNPTTRSVVPRSWSGFFRPGPAV
VVSPENFGQVGYDEGNAEQYVWSVPHNVAGLVTALGGRAAVADRLDRFTE
KLNVGPNQPYLWAGNEPSFGVPWLYNYIGQPWKTQRTVDRVRGLFAPTAD
GEPGNDDLGALAAWYVWAALGVYPATPGTPILTVGAPLFDRIEIALPAGK
FLRISAPGASGPHHLKYISGLKVDGRPTEHTSLPETIITTGGTLTFSLAA
YPDKRWGTSEADAPPSFGAGSSALTVNVAQPVVTIAPGRTGTVTLDAQRM
IDGRDVPDGYTVSGTSTDAGITVAPTPGRFGNGGSAAVSVPITVAQSVPE
DYHLVYLTTTAGESARRSTVLVVTQAESGNS
379763991YP_005350388.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MRVDGRDIPVSGSLLQPLTRRTNDILRLVLASLFLALVITGSVVTRPQWI
ALEKSVSQIVGVLSPTQSDVVYLAYGLAIVALPFMILIGLIVAGQWKLLG
AYATAGLSAIVLLSISGTGLAAPRWHFDVHDRLSTLPAQLLDDPRWIGML
AAVLTVSGPWLPARWRHWWWALLWAFVPIHLVISAVVPARSLVGLAVGWV
VGALVVLVVGTPALEVPLDAAVRAMAKAGFVVSRLTVVRPAGRGPLILSA
DGDDDSGRTALVELYGPHQRSGGALRQLWGKLKLRDTETAPLVTSMRRAV
EHRALMTIAIGDAGLANTATVALAPLDRGWMLHSHKPARGTPIDRCAATT
PVVRLWEALRILNDRQIAHGDLRSQHITVDDGAVLFGSFGSAEYGATDAQ
LQSDIAQLLVTASALYDPKSAVRAAIEVFGADTILSASRRLTKVAVPRFI
RRSVPDAGTVISAARAEVKRQTGADQIKPQTITRFTRSQMIQLVLFGALV
YVAYPFISTAPTFFSELKTANWSWALVGLLVSALTYVGAAAALWACADGM
VNFWTLSIAQVANTFAATTTPAGVGGLALSTRFLQKSGLSAMRATAAVAL
QQSVQVIAHIALLVVFSAAAGASMNLSHFVPSATLLYLIAGVALGIIGTF
LFVPTLRRWLSTEVRPKLNEVVGDLVKLAREPRRLALILLGCAGTTLGAA
LALWASIEAFGGGTTFVAVTVVTMVGGTLASAAPTPGGVGAVEAALIGGL
AAFGVPAAIGVPSVLLYRMLTCWLPVFVGWPVMRWLTTNEMI
379763990YP_005350387.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MARTDNDSWEITESVGATALGVAAARAAETRGENPLISDPFAQVFLDAAG
DGVWNWHSAGRLPDAVVEAEPTLPLQMQSMVGYMASRTAFFDQFFLDATA
AGIRQAVILAAGLDARSWRLAWPAGTTVYELDQPRVLDFKASTLAEHGAQ
PACHRVPVAVDLRQDWPEALRQAGFDVSAPSVWSAEGLMPYLPAAAQELL
FERIQGLTVPGSRVAVEALGPKFLDPQLRARRRERMDRIAALMAEVDPDR
QVPRTDELWYFEEREDVGEWFGRHGWDVTVTPSDELMAGYGRAAAKEVRD
YVPGNLFVAAQRAAG
379763989YP_005350386.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSSTGLPDVDAVFDALDAEVDRACALVLDALTVQQQLAVLERCERLRRRI
PVIEHPLLNSLARQVPSQDLGGGLSHALTECTLISRHEASRRIKEAADLG
QRHGLTGEPLPPVLAATAAAQRAGDLGAGQVAVIRKFYYQLPGWVSAAAR
EFAEAQLAGFGTQFGPEHLKELARGLTDALNPDGTFTDEDRARSRGVTLG
NQQADGMSELRGLITPELRATLEAVEAKLGAPGMCNPLDDIPCVEGTPSQ
AAIDRDTRSAAQRGHDALLAGLRGLLASGELGQHNGLPASIIVTTTLAEL
EAAAGRALTGGGTILPMSEVIRLARHAHHYLAIFDKGKALALYHTKRLAS
PGQRIVLYAKDRGCTAPGCTVSGYYCEVHHVTDYSKCHSTDINQLTFACG
PHHRMLDPGGWTTRKNTRGETEWKPPPHLERGQPPTNTYHHPEKLLHHES
NDDEADNPGAA
379763988YP_005350385.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MRLAVFAAFLAVAFYLVAVAHVIDIEEIRRVVSATGPAAPLTYVVVSAVA
GALFVPGSILAAGSGLLFGPLLGVFVTLGATVGTAIVASFVGRRAGRDSA
RALLGAQRADRFDALIGRRGLWAVVGQRFVPGISDALASYAFGAFGVPLW
QMAAGAFIGSVPRAFVYTALGASIGNRSSPLAYAAIAVWCVSAIVGAFAA
HRGYRRWRTHAGRDADTGSPEPGSEAR
379763987YP_005350384.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTADVMFATGLLRTFSDAGVFEAADVHVAQRLTALTGESDERVALAVALV
VRALRGGSVCVDLRAASGLLGDADLPWPGADDWLAVVRASALLGPPPVLR
FFGDLLYFDRYWLEEEQVCTDLLALSASPVGIESSSYERLFEPGYEEQRA
AAEIAVSQAVTVLTGGPGTGKTTTIARLLALLLEHAERAGMPPPRIALAA
PTGKAAARLAEAVAAGAQRLGAADRARLAGLSGTTLHRLLGPRPDTSVRF
KHNRANRLPHDVIVVDETSMVSLTMMARLAEAVRPDSRLILVGDPDQLAS
VEAGAVLADLVDGLSARGDVRVAALRTPHRYGTSIGALAEAIRVGDADRV
VELLAAGGEHVEWVDAQRPADRLREVLVAHALRLRSAALLGAADEALATL
DEHRLLCAHREGPYGATHWNTLVQKWIAEATGQPAWSQWYAGRPLLVTAN
DYGLRLYNGDTGVAVTGAEGLRAVIAGASGPLDFATSRLGEVETMHAMTI
HKSQGSQADEVTVLIPPEDSRLLTRELFYTAVTRAQTRVRVVGPEASVRA
AIERRAMRATGLRQRLRADAAAT
379763986YP_005350383.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MQRFDLLGPLPAERSTTVLEASAGTGKTFALAGLVTRYLADGAASLDQML
LITFGRAASQELRERVRCQIVDAVRAFADPSTVGDNQLVAYLLDGTDDQR
AARRQRLRDALAGFDAATIATTHQFCQLVLRSLGVAGDTAASVTLLDSLD
DLVTEIVDDLYLAHFGQERDDPALHYSEALRLAREVVNNPSTQLRPRDPD
PDSRAAVCLRFANDVLAELDTRKRRLGVLGYDDLLTRLADALATDGSPAR
LRMHQRWPIVMVDEFQDTDPVQWQVIDRAFSGRSTVILIGDPKQAIYAFR
GGDIVTYLRAAQTAGERKTLDINWRSDSALVARLQVVLRGAQLGDPAIVV
NDVGAHHRGHRLAGAPRNDPFRLRVVSRKTLGRRGIQNLPIDELREHIGA
DLAADIRALLAAGATFDGEPLQARDIAVIVERHRDAHACFKALCAAGVPA
VYTGNTDVFTSEAAEDWLCLLEAFDQPHRPGMVRAAAATMFFGETAQTLA
AGGDALTDRIAKTLREWAGHARERGVAAIFEAAQLLGMRDRVLGWRGGER
HMTDLAHVTQLLQEVAHREHYGLPALRDWLRRQRDERGGAPERNRRLDSD
AAAVQIMTVFVSKGLQYPIVYLPFAFNRNTQDSDVVLFHDEDGTRCLHVG
GKDSPDFKTVERLGRKEDASDDSRLTYVALTRAQAQVVAWWSPAYFEPNG
GLSRLLRGRRPGDPVVPDRCEPAKVSDDDALARLREWEAAGGPVIEDSVV
APAPSLPPAPVPRHLDSRHFHRAIDTTWRRTSYSGLIRVAQASGVSGEPD
VVGLDDEVGDIPLSSPAAGPDVPSPMADLPAGATFGSLVHAVLETADPFA
ADLAAELEEHIREHSAWWPVAATPEELAAAMVPMHDTPLGPLAGGLTLRR
IGLSDRLRELDFELPLAGGDRPSVGPEARLADLAPLLREHLPPDDPLVSY
ADRLTDRALGDQSLRGYLTGSIDAVLRIPDGAGHRFVVVDYKTNLLGDPE
RPLTAADYDRPRMAEAMLHSDYPLQALLYCAVLHRFLRWRIRDYDPDRHL
GGVLYLFVRGMCGADTPVRDGHPCGVFSWRPPPSLTSALSDLLDARKVPA
379763985YP_005350382.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MPLHLHRAERTDLLADGLGALLADPPADPFAPELVVVPARGVERWLSQRL
SHVLGRARGGGVSGGVCAGVSFRSPGSLIAEIAGTADDDPWSPEAMAWPL
LEAIDHSLDEPWCRPLATHVGHFHTGAEAELRRGRRYEVARRLAGLFASY
ARQRPQLLIDWLGGDPGDLDEDLRWQPELWRALVSRVAADPPHIRHAKTL
ARLSEAPSDLPARLSLFGHTRLSRTDSELLAALAIHHELHLWLPHPSDRL
WRALAGTRGAIPRREDTSHRAVGHPLLATLGRDLRELQRGLPADAQTDEY
LPGEARPDTLLGWVQSDIAANAVRPQGRALADDDRSVQIHNCHGPARQVD
VLREVLLGLLADDPTLEPRDILVMCPDIETYAPLIVADFGLGDVVHGAHP
AHQLRVLLADRSLVQTNSLLAVASQLLGLAGGRVTATEVLNLAQAAPVRA
RFGFTDDDLEAITRWVRQANIRWGLDQEHRRPYHVDFVHNTWRFGIDRIL
AGVAMSDDSNAWIDATLPLDDVSSNRVPLAGQFAEFVARLHHVVDSLTGT
RTLTEWLATLAGAIASLTRVHESEEWQTGQVQREFAAVLAQAGSRGGTML
RLPDIRALLTRHLAGRPTRANFRTGTLTVCTMVPMRSVPHRVVCLVGLDD
GLFPRLGVVDGDDALARRPMTGERDIRSEDRQLLLDAIGAATEKLVITYT
GANEYSGQPRPPAVPLAELLDALDVTTPTKVRHRIVIEHPLQPFDVRNVI
PGELVPKVPFSFDPTVLRAARAATGEHTEQPKFVAAPLPPPPADDVNLAD
LVGFFKDPVKGFFRALEFTLPYDVDGVQDAMPVDINGLEEWTVGDRMLGD
ILRGMSPDDARQAEWRRGTLPPGQLGWRKVTEIRDQAAALALEALRHRQD
HRSAAAYDVDVDLGAGRRLTGTVSPVYDDALVSVTYSRLDGKHLLESWIP
LLALAAHDPGRDWSAVCIGRMRRGRSIRVEGLGPPDGDPVEVLRELVTIY
DAGRREPIPLPIKTSYAWAAARHGGDDPAAEARRRWKTSDRFPGEDQAPA
HVRAWGRGAPLDDLMQPVRPGEECDGEDNRLGAYAARLWLPMLRAERKLI
379763984YP_005350381.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAAVAEHLTPHFEEVQAHYDLSDDFFRLFLDPTMTYSCAYWDRGRDITLE
EAQLRKIDLSLGKLGLRPGMTLLDVGCGWGATARRAIEKYDVNVIGLTLS
AHQAAHVQKLFDSMDTERSRRVLLHGWEEFDEPVDRIVSIGAFEHFGYDR
YDDFFAMAHRLLPDDGVMLLHTITMLTPQQIVERGLPMTEEQTSFNEFIA
TEIFPGGQLPAIEIVEFHASKMGFNLKRRQSLQLHYARTLDHWAEALEAH
HSEAVAIQSEEVYQRYMRYLTGCADAFRAGYIDVNQFTLAK
379763983YP_005350380.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MDAWDAICARRNVREYQPRAISDEDLDRIAEAGWRAPSAKNRQPWDFVIV
TDRAQLQELSTVWRGAGHIAAAPAAIAIVAPVPPDERRVVTDNYDIGQAT
MAMMIAATDLGIGTGHSSVGDQEKARAILGVPDDHLVAFLLGVGYPADRP
LRPIRTPNRRPFSEVVHHGRW
379763982YP_005350379.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MHDHQGDYGVDGSFHKFSARTQALGVGAQVVALAVWAAISWARGKRLRAG
LAAVSSAGIAGNALLYMYATRSGKFVVWDRVLRDLRLAGDETVLDLGCGR
GAVLLAAAKRLPRGRAIGVDLWQADQTDNSRQATLANAVAEGVADRVEVR
TADMTALPLADESVDVIVSNLAIHNIDGHAGRRRALDEAARVLRPGGRLA
IADLWETRQHAERLRELGWRNVRRRNLGWRMWYGGPWFSTRLVTATKPG
379763981YP_005350378.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MLGPMTRTELTEQIVVARLAKGLTWQQLADAIDRPVVWTTSALLGQHPIP
VEQAKTLAELLGLDESVVPVLAAAPMRGGLPTAVPTDPTVYRFYEALQVY
GGALKELIAEQFGDGIMSAINFSVDIQKKPHPSGDRVVVTFDGKFLPYQW
VSSER
379763980YP_005350377.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MESTAHQPKPVDLVLSGGGVKFIGLVGAIVALMDAGYSIKRVSGVSAGSV
VAAILAAGSTDGQLTGAQVKELAFSVPLRKWRDAGPVPYLGAAWGLVTDS
SMYRGDVAYDWIRSELKNFGVTRFGDLHLDDDRLLEGRRDKLVVTVADLT
AAQLVRFPWDFRRLYGLDPDEQPVADAVRASMAIPFFYRPVKLTGADGST
STLVDGGVLSNFPIDTFDRPDGRAPRWPTFGITVLPRLTEGIGAVMPALK
PLRFFEQTALLESLVTTMLAGHDQTHLSRPWVAARAIAVESTDVGVLDFD
IPKGRLEELYESGYAAAQAFLSTWDWPAYLDRFR
379763979YP_005350376.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MKLKMALRELHRSERKLAHELNVVAARHHSDQDVSHLAQDLAGWSRHHLA
ELARHGRHYGLHLSTDPRTGAVTGFLQSRLSGLLRHRPEPGLMLLADLRR
IHRLSAGVSLDWELLAQGAQAAKDSELLSLASRCHPETLRQMRWANAMLK
ELSPQVLMN
379763978YP_005350375.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MATDRIADPWGARTPYEPGTPWPDRVDTYLADGITAESVDRWVQSAAVLH
SNGDGLDIAVKDGRIVGVRGRAVDRVNHGRLDPKDLFGWQANASADRLTT
PMIRERGELKPCDWDTAMQRIVDRSKQLLDGYGPSSIGFYTSGQLFLEAY
YTQGAIAHGAIGTNHVDGNTRLCTATAAEALKESFGCDGQPGSYTDVDHA
DVIALFGHNVAETQTVLWARMLDRLAGASPPAIVCVDPRLTPVARHATVH
LAPVPGTNVPLMNGLLHEIIGNGWIDRDYIDSHTVGFDELRGRVEEFGPE
RVADICGVPAEDIRRAARLLGTAKRLLSTVLQGFYQSHQATAAAVQVNNI
HLVRGMLGKPGCGVLQMNGQPTAENTRECGADGDLAGFRNWSNDSHVAEL
AALWNLEPLQIPHYAPPTHAMQMFRFAEEGTLRMLWVTATNPLVSLPELA
RIRDIFSQERLFLVVQDIFLTETAALADVVLPAAAWAEKTGTFTNADRTV
HLSEKAVDPPGSARPDLDIFLDYARRMDFRDKDGQPFPPWTDAESAFEAW
KKCSAGRPCDYTGLSYAKLRGGSGIQWPCNTEHPDGTERLYADAKFWAEP
DYCEAYGKDMITGAPLQPDEYRSMNPYGRAIIKAAQYVPPHERTSPDFPF
ALITGRTVYHFHTRTKTARAQQLQRAAPEVWVEVSAGDARRLGIADGDLV
EVSTPRGCIRCAARVCGIRDGVLFVPFHYGYWDAGTNGHHRAGNELTLTD
WDPVSKQPIFKTAAARLRKSRMRRAGGNGAAAPPATVAEALGGQA
379763977YP_005350374.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTAPVHYSTKDSLAVIRMDDGKVNALGPTMQRALGDAIDQAERDNAGALV
ITGNERVFSGGFDLKILTSGEVQPAIDMLRGGFELAYRLLSFPKPVVMAC
TGHAIAMGAFLLSSGDHRVAAHAYNIQANEVAIGMVIPYAALEIMKLRLT
PSGYQQAAGLAKTFFGETALAAGFIDEIVLPEMVLDRAQEAAAEFAGLNQ
RAHAATKLRARADALAAIRAGIDGIEAEFGL
379763976YP_005350373.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MDSMGWIQDSWHGVTHVGSSTWIAWAAWAAIALAVVTLVFTNSQITRNRR
AAAEQTRPHVGVFMEPHSADWHVIELVVRNFGQTAAYDIQFSFDNPPTVA
EYESATDGYADVVELRLPRELPVLAPGQEWRLVWDSALDRAEIGSGIESR
FTGTVSYYDRPDQPRGWRFWQRERSPLRTDVVLDWDALPPVQRIELMTTH
DLAKREKEKLELLRGLLTYFHYASKETRPEVFRSEIERINAAVRETQDRW
RTRQLDEPTDVSLRWSNAEDDLGKHHNQSA
379763975YP_005350372.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSDDRLYFRQLLAGRDFAAGDMFATQMRNFAYLIGDRQTGDCVVVDPAYA
AGDLLDTLEADGMHLSGVLVTHHHPDHVGGSMMGFSLAGLAELLERAPVP
VHVNTHEALWVSRVTGIGVGDLTAHENHDKVSIGDIEIELLHTPGHTPGS
QCFLLDGRLVAGDTLFLEGCGRTDFPGGDSDEMYRSLQRLATLPGDPTVF
PGHWYSTQPSASLSDVKRSNYVYRAADLDQWRMLMGG
379763974YP_005350371.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MRKKVEIEVDLDLVDEAIQRFRVADAREAVNLALRTLLREGASDEEEDEY
DEFSDLNAWRPRRSRETG
379763973YP_005350370.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MASSTDVRPKITLACEVCKHRNYITKKNRRNDPDRLELKKFCPNCGKHQA
HRETR
379763972YP_005350369.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MPLTESIVGMHYRYPDHYEVEREKIREYAVAVKHDDPAYFEEKAAADLGY
SGLPAPLTFVCVFGYTAQTAFFKHANVAVQDAQIVQVDQVLKFFAPLVAG
DKLYCDVYVDSVRVSHGTQIIVTKNVITNEAGDVVQETYTTLAGRAGEDG
EEGFSDATA
379763971YP_005350368.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MKVGDQLPEKTYPLTRQDLVNYAGVSGDLNPIHWDDEMAKVVGLETAIAH
GMLTMGIGGGYVTAWIGDPGAVTEYNVRFTAVVPVPNDGKGAELVFNGRV
KSADPETKSVTIALTATTGGKKIFGRAIASATLA
379763970YP_005350367.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MALKTDIRGMIWRYPDYFVVGREQLRQFALSIKNRHPAHFEEDAAAELGH
DAIIAPLTFGTIFAKLVQLDFFRHVDIGMETLVIVQVDQRFVFSKPIKAG
DKLWARMDIVSVDERFGADIVVTKNICTDENDEVVLEAYTTLMGQYADNS
ANLRWDSESGQVVRTA
379763969YP_005350366.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSDEGDVANDAASDGTDTTEGRASGVRTAVVTRPQRPTGKRSRQKAADAG
EDADAASPDEIEASGKDKAKKGAKAKKAAKPKKSADSRANPFLFVYNYLK
QVVAEMRKVIWPNRKQMLTYTSVVLAFLAFMVALVGLADFGLTKLVLLVF
G
379763968YP_005350365.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTSFDGDPSAGDAVDLKETTEAAEVSDDTATSEVSEATTDEATTDEAADA
AGAPDEPAEEVDPAVALKAELRSKPGDWYVIHSYAGYENKVKANLETRVQ
NLDVGDYIFQVEVPTEEVTEIKNGQRKQVNRKVLPGYILVRMDLTDDSWA
AVRNTPGVTGFVGATSRPSALTLDDVVKFLLPRGATKKAAKGAATTATAA
EAGGLERPAIEVDYEVGESVTVMDGPFATLPATISEVNGEQQKLKVLVSI
FGRETPVELTFSQVSKL
379763967YP_005350364.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAPKKKVVGLIKLQIQAGQANPAPPVGPALGQHGVNIMEFCKAYNAATEN
QRGQVIPVEITVYEDRSFTFALKTPPAAKLLLKAAGVGKGSAEPHKTKVA
KVSWDQVKEIAETKKADLNANDIDAAAKIIAGTARSMGITVE
379763966YP_005350363.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSKNSKAYRAAAEKVDRNSLYSPLEAAKLAKETSSSKQDATVEVAIRLGV
DPRKADQMVRGTVNLPHGTGKTARVAVFAVGDKAEQAQAAGADIVGSDDL
IEKIQGGWLEFDAAIATPDQMAKVGRIARVLGPRGLMPNPKTGTVTPDVA
KAVADIKGGKINFRIDKQANLHFVIGKASFDEKSLAENYGAALDEVLRLK
PSASKGRYLKKITVSTTTGPGIPVDPSVTRNFSEA
379763965YP_005350362.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MADLDGVFRREWGPAVAALARWSGDLTVAEDAVQEACAEALRTWPRDGLP
ANPGGWLVTVGRNRARDRLRRESVRPGKELAAVLDDIRARTEHTDPHPVR
DDELRMMFTCAHPALDRQSQLALTLRLVSGLTVGEIARALLQTEAAIGQR
ITRAKNKVRHANIPLRVPPAELLPERTPHVLGCVYSVFTEGYWSTAGPSA
IRDDLCDEGIRLGGELCALLPAEPEAHALSALMLLHDSRRATRVDESGML
VPLEDQDRRRWDRARIARGLERLRHARGSTGAYLPQAVIAALHATAPSWE
RTDWVAICSAYDRLWQLTGSPVVAANRALAIGFRDGPDAGLAALDDVAGD
PRLARSNLVATVRADLLRRAGRPADALTWYRAALESNGSEPGRAFLRRRI
AECGG
379763964YP_005350361.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTTMQYFALLISKEQDRAPDDAAAAMAAWENFHAKAGPAIKAGDALAPAA
SAVAISGGPDAPTVTDGPFAESAEVACGYYVFEAENLDEALALARDVPVA
EFGAVELWPVVHAVEPSRALTGNDWLALLLEPAESAHTPGTPEWEAVAAK
HVELHAAAGDHVIGGAALHDRSTATTVRVRDGEVLITDGPYVEGAEIATG
IYLLSAADRDEAVKIASMIPASSVQLRQLAGVSGL
379763963YP_005350360.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAEQPTGPTKTRTRSEDIQAHYDVSDDFFGLFQDPSRIYSCAYFERDDMT
LEEAQYAKIDLNLDKLDLKPGMTLLDIGCGWGTTMKRAVERFDVNVIGLT
LSKNQHARAEALLGSIDSNRSREVRLQNWEDFSEPVDRIVSIEAFEHFGH
ENYDDFFKRTYDIMPDDGRMTVQSSVSYHPYDLAARGKKLSFETARFIKF
IVTEIFPGGRLPSTQMMVDHGEKAGFVVPEPLSLRPHYIKTLHIWGDTLE
SNRDKAIEVTSEEVYNRYIKYLRGCEHYFTEEMLDVSLVTYLKPGAAA
379763962YP_005350359.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MGVAMVKLEPYYEESQATYDISDDFFALFLDPNMVYTCAYFKDDDMTLEQ
AQLAKLDLGLDKLNLEPGMTVLDVGCGWGGAVVRALEKYDVNVIGITLSR
NHYTRTKARLAAIPTTRRAEARLQGWEEFDEHVDRIISFEAFDAFKKERW
PAFWDWAYETLPNDSRMLMHSIFTYPQSHWKEVGIKITMSDLRFLHFLGK
EIFPGGQMCGEADIVDLSRASGFGLEQTQYLQSHYARTLDTWAANLEANR
DRAIAIQSEEVYDRFMRYLTGCANLFRKGISNVAQYTLTK
379763961YP_005350358.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MQVRTGYAISGDLKLYYEDMGDVDDPPVLLIMGLGAQLLLWRTAFCQKLI
DQGLRVIRYDNRDVGLSSKTQYGSSGQPLATRLVRSWLGLPSRAVYKLED
MADDAAAVLDHLGIERAHIVGASMGGMIAQIFAARFRERTQSLAIIFSSN
NAALLPPPAPRALLALLKGPPPNSPREVIVDNAVRVGKIIGSPRYRVPDE
QARAEAAEGYDRNYYPQGVARHFAAVLGSGSLRRYNHGTVAPTVVIHGRA
DKLMRPFGGRAVARAIDGARLVLFDGMGHDLPQQLWDQVIGVLTNNFARA
C
379763960YP_005350357.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAKLDRVPLPVEAARVAVTGWQVTRSAARIVTKLPGRGPWQQKVIRQLPQ
TFADLGPTYVKFGQIIASSPGAFGESLSREFRGLLDRVPPADPGEVHKLF
IEELGADPSELFASWDEEPFASASIAQVHYATLHSGEQVVVKIQRPGIRR
RVAADLQILKRFAQAVEVAKLGRRLSAQDVVADFSDNLAEELNFRLEAQS
MEAWVSHLHASPLGRNIRVPQVYWDFTSDRVLTMERVSGIRIDDVAAIRK
AGFDGVELVKALLFSLFEGGLRHGLFHGDLHAGNLYVDDQGRIVFFDFGI
MGRIDPRTRWLLRELVYALLVKKDHAAAGKIVVLMGAVGTMKPEAQAAKD
LEKFATPLTMQTLGDMSYADIGRQLSALADAYDVKLPRELVLIGKQFLYV
ERYMKLLAPKWQMMSDPQLTGYFANFMVEVSREHSSDVEV
379763959YP_005350356.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSDERSALREFLAFHQSAYFAVSYGLTDEQARSTPSASALSIGGLVKHAT
GMQHSWMTRVAAAPDAPPKDTRPFEQISKEFADQHVMGPDETLDGLLRAF
EAQNATSLRLVETADLDAAVPVPRDIPWFPKDQRAWSVRWVILHVINELA
RHAGHADIVRETIDGATMYELIAGHEGWAIEGWVQPWRGGHRHQ
379763958YP_005350355.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MADLSAQLADQLDWHWRNQLRPRLGGLTDDEYFWQPVPHCWTVHPDGSID
FAFPAPSPAPFTTIAWRMAHVIVGVFAMRAHHHFGGPSADYQSWNYATTA
ATALRQLDETYAVWINGVRSLSAADLTRRCGAAEGPYADYPLSALVLHIN
REAIHHGAEIACLRDLYVHNRMD
379763957YP_005350354.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MQLVSAESTELFVGPPEAPLQLARVTVAGVGEPRRVRIDGDGLTGEAVAD
IGDELVEVPVTLDRPVVGERRSARVRAGRADLPFEFTVAEPGWTMFMVSH
FHYDPVWWNTQGAYTSEWTEDPPGRARQTNGFELVHAHLEMARREPEYKF
VLAEVDYLKPYWDTRPEDRADLRRFIAQGRVEVLGGTYNEPNTNLTSPET
TIRNLVHGMGFQRHVLGADPATAWQLDVFGHDPQFPGLAADAGLTSSSWA
RGPHHQWGPMHSDGGLGGMQFCSEFEWISPSGRGLLTHYMPAHYSAGWWM
DSATTLREASDATYELFDQLKTVALTRNVLLPVGTDYTPPNTWVTAIHRD
WAARYTWPRFVCALPREFFAAVRAELAQRGCEPSPQTRDMNPIYTGKDVS
YIDTKQANRAAENAVLAAERFAVFAALATGADYPHAALAKAWVQLAYGAH
HDAITGSESDQVYLDLLTGWRDACELGRTARDASLALLSGAIEGDVVVWN
PLAHPRTDLVTARIDPPLPAGVRVLDADGAELPALVEHDGSSVTWLARDV
GSLGWRAYRLAPADQAAGWAAVPGSVIANEHYRLEVDKARGGAVASLIDL
SAQGGRELIAEGRVGNELAVYEEYPSHPTQGEGPWHLLPKGPVVCSSESP
ARVRAFRGPLGERVVVRGRIGTLLRYTQTLTLWRGVARVDCRTTIDDFTG
ADQLVRLRWPCPVPGAMPVSEVGDAVVGRGFALLHDGPRAVDTARHLWAL
DNPAYGWFGLSSAARVRVSGAGVRAISVAEVVSPAEAVSGPLARALMVAL
VRAGVTATCSAADKPRYGHLEVDSNLPDVRIALGGPDRNAFTEAVLAHAD
AVYARELDRQLAATGRARVWVPAETPLAAVWVPGADLRGLRALPVLVVDG
RADEDLRAEIAALADDLGDAEIVAQRPASGTEAFEDRTVALLNRGVPSFA
VDTEGTLHTALMRSCTGWPSGIWIDDPRRTAPDGSNFQLQHWTHDFDYAL
VSGDGDWRRADIPTRSAQFAQPLLAVAGGRRPGALPPVGALLRVELADSV
HLAALKAAGDPLTAGRAAPVDPHSVALRLVETTGAGARVTLSSDVAAISD
LRAADLLEAPEGRLDSVDLHGYQVATVLARFDLPATLADAAALAPNAEAA
QPLYARYWLHNRGPAPLGGLPAVAHLHPSQISAQPGRDVTVRLTAASDCS
DATLRGGVVLACPDGWSATPAELPFTLCSGGHLEADVVVSIPPTAEPGLY
PVRARLRLTGEHIPAPWRQAVEDVCVVAVGGAAVDPGGLVYLADGPREVT
LRPGEAGEVTVTVGTHARADLALEAHLISPWGTWEWMGPAALGAVLPAGG
TVGLGFRVTPPAWLGPGQWWALVRIGCAGRLVYSPAVRVTVT
379763956YP_005350353.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSGHPVATVAGIPVSCAEVDAAETRLRAGRGAGALPAAGTSEGRQLRRWL
TQLIVTRRVVAAEADARGLDPREAPTETELLPDVTARLEIGSIAAAVLAD
PRARALFADVTADVHVTDDEVAAYHARNPLRFAAARPGENGWRTTALAAP
PLAEVRSAIAEQLRGAARRRAFRLWLHARRAELVRLAPGYEHPGDPRQPD
NTHRH
379763955YP_005350352.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MPTLCLDIGGTKIAAALVDSAGALVHSAIRPTPVTTAAGDVWAVVEAMIA
DAVRAADAPITAVGIASAGPIDLHTGSVSPINIAGWDRFPLRDRVAAAVP
GVPVVLGGDGLCMALGEHWIGAGRSAGPDARFLLGMVVSTGVGGGLVLDG
VPYAGRTGNAGHVGHIVVELDGPPCTCGGRGCVETVASGPWMVRWARDNG
WAAPPGAGARDLAVAAAAGDPVARRAFHRSANALAAMIASVGAVCDLDLV
VIGGGVSKSGPLLFDPLRAKLADYAGLDFLSGLRVVPGELGGAAGLIGAA
RLAALG
379763954YP_005350351.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MNHSIDALAVVITGLLVGVELAVAVFFHPLIARLPDDAFRAARVGAARSL
GTTMPFWYALSLLLLVALAIKERGATGPTGPPAP
379763953YP_005350350.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MVLVVLLTVTLLVPINNRIAKWPAAGELSRDLAARWDRLHRLRVALLLAV
FVLLTLGVTRAVI
379763952YP_005350349.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MARADKATAVADIAEQFKESTAALVTEYRGLTVANLAELRRSLGASATYS
VAKNTLVKRAASEAGVDGLDELFAGPTAIAFITGEPVDAAKAIKTFAKEH
KALVIKGGYMDGRALTVAEVERIADLESREVLLAKLAGAMKGNLAKAAGL
FNAPASQVARLAAALQEKKAAEGPAGPAASEAAAEPAAEAAPEPASEAPA
EPAETPAEAE
379763951YP_005350348.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAKMSTDDLLDAFKEMTLLELSDFVKKFEETFEVTAAAPVAVAAAGPAAG
GAPAEAAEEQSEFDVILESAGDKKIGVIKVVREIVSGLGLKEAKDLVDGA
PKPLLEKVAKEAADEAKTKLEAAGATVTVK
379763950YP_005350347.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MATMTSDVQRSVREEMLRAAVGLLDEHGPDALQTRKVAGAAGTSTMAVYT
HFGGMRGLIAEVAEEGLRQFDAALTVPHTADPVADLFMIGAAYRRYAIKR
PHVYRLMFGSTSAHGINAPAHNVLTLTVAEIERDYPSFAHVVRGVHRCAV
AGRIKPAGAVKDGVDDASVVATAAQFWALIHGFVMLELAGYYGDDSSAVV
PVLGSMTSNLLVALGDSPERVAQSLQTAMGAR
379763949YP_005350346.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MATTTTAKPGNPYLEDFLAPVSAEVTATDLKVTGRIPEHLDGRYLRNGPN
PVAEVDPAVYHWFSGDGMVHGVALQGGQARWYRNRWVRTAHVCTALGEPA
PSGLNPRAGMLSVGPNTNVLSHAGHTLALVEGGGANYRLTDELDTEGPCD
FDGTLFGGYTAHPHADPRTGELHAVSYSFTRGRTVQYSVIDTQGRARRTV
DIEVGGSPMMHDFSLTDKYVVIYDLPVTFDPVQVMPANVPRWLSLPARLV
MQSLIGRVRLPSPMATAINRNQRPTSRMPYRWDDNYPARIGVMPREGGNR
DVRWFDIEPCYVYHPLNAYSEMRDGTEVLVLDVVRYARMFDRDLRGPGDS
RPTLDRWTVNLATGTVTSERRDDRPQEFPRINETLLGGPHRYGYTIGTEG
GYLSGGRSEMSTAVYKHDYATGSATAADLDACLLLGEMSFVPNPAPGAED
DGILMGFGYHRDRDEGQLVLLDAQTLEHVATVHLPQRVPMGFHGNWAPAG
379763948YP_005350345.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MGVAIEVNGLTKSFGSSRIWEDVTLEIPAGEVSVLLGPSGTGKSVFLKSL
IGLLRPERGSVVIDGTDILQCSAKELYEIRTLFGVMFQDGALFGSMNLFD
NAAFPLREHTKKKEGEIRDIVMEKLTLVGLGGDEKKFPGEISGGMRKRAS
LARALVMDPQIILCDEPDSGLDPVRTAYLSQLILDINAQIDATVLIVTHN
INIARTVPDNMGMLFRRKLVMFGPREVLLTSDEPVVRQFLNGRRIGPIGM
SEEKDEATMAEEQAALDAGQHAGGVEEIEGVPPQIVASPGMPERKAVARR
QARVREILHTLPKTAQTAILDDLEGTHRYRAHEIGE
379763947YP_005350344.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MWAIRLALAEISQDASFQHLVRLTKAGTTGQLAANCVGSAGERTVRISRA
QLKN
379763946YP_005350343.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MQIDSFEWLIGAPRWREAAAARGDGKPGVTPVGGLEEVLLELSPIEDFSG
SMSLSFSDPRFDEVKAPVDECKDKDMTYAAPLFVTAEFINNNTGEIKSQT
VFMGDFPMMTEKGTFIINGTERVVVSQLVRSPGVYFDETIDKSTEKLLHS
VKVIPSRGAWLEFDVDKRDTVGVRIDRKRRQPVTVLLKALGWTNEQITER
FGFSEIMMSTLEKDNTAGTDEALLDIYRKLRPGEPPTKESAQTLLENLFF
KEKRYDLARVGRYKVNKKLGLHAGEPITSSTLTEEDVVATIEYLVRLHEG
QPTMTVPGGIEVPVETDDIDHFGNRRLRTVGELIQNQIRVGMSRMERVVR
ERMTTQDVEAITPQTLINIRPVVAAIKEFFGTSQLSQFMDQNNPLSGLTH
KRRLSALGPGGLSRERAGLEVRDVHPSHYGRMCPIETPEGPNIGLIGSLS
VYARVNPFGFIETPYRKVVDGVVTDEIHYLTADEEDRHVVAQANSPIDAK
GRFEESRVLVRRKAGEVEYVPSSEVDYMDVSPRQMVSVATAMIPFLEHDD
ANRALMGANMQRQAVPLVRSEAPLVGTGMELRAAIDAGDVVVADKAGVIE
EVSADYITVMADDGTRHTYRMRKFERSNHGTCANQSPIVDAGDRVEAGQV
IADGPCTENGEMALGKNLLVAIMPWEGHNYEDAIILSNRLVEEDVLTSIH
IEEHEIDARDTKLGAEEITRDIPNVSDEVLADLDERGIVRIGAEVRDGDI
LVGKVTPKGETELTPEERLLRAIFGEKAREVRDTSLKVPHGESGKVIGIR
VFSREDDDELPAGVNELVRVYVAQKRKISDGDKLAGRHGNKGVIGKILPQ
EDMPFLPDGTPVDIILNTHGVPRRMNIGQILETHLGWVAKSGWNIEGSPD
WAVNLPEELRHAQPDQIVSTPVFDGAKEEELAGMLSCTLPNRDGEVMVDG
DGKSVLFDGRSGEPFPYPVTVGYMYIMKLHHLVDDKIHARSTGPYSMITQ
QPLGGKAQFGGQRFGEMECWAMQAYGAAYTLQELLTIKSDDTVGRVKVYE
AIVKGENIPEPGIPESFKVLLKELQSLCLNVEVLSSDGAAIELREGEDED
LERAAANLGINLSRNESASVEDLA
379763945YP_005350342.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MLDVNFFDELRIGLATAEDIRQWSYGEVKKPETINYRTLKPEKDGLFCEK
IFGPTRDWECYCGKYKRVRFKGIICERCGVEVTRAKVRRERMGHIELAAP
VTHIWYFKGVPSRLGYLLDLAPKDLEKIIYFAAYVITSVDEEMRHNELST
LEAEMMVERKAIEDQRDADLEARAQKLEADLAELEAEGAKADARRKVRDG
GEREMRQLRDRAQRELDRLEEIWTTFTKLAPKQLIVDENLYRELIDRFGE
YFTGAMGAESIQKLIENFDIDAEAEILRDVIRNGKGQKKLRALKRLKVVA
AFQQSGNSPMGMVLDAVPVIPPELRPMVQLDGGRFATSDLNDLYRRVINR
NNRLKRLIDLGAPEIIVNNEKRMLQESVDALFDNGRRGRPVTGPGNRPLK
SLSDLLKGKQGRFRQNLLGKRVDYSGRSVIVVGPQLKLHQCGLPKLMALE
LFKPFVMKRLVDLNHAQNIKSAKRMVERQRPQVWDVLEEVIAEHPVLLNR
APTLHRLGIQAFEPMLVEGKAIQLHPLVCEAFNADFDGDQMAVHLPLSAE
AQAEARILMLSSNNILSPASGRPLAMPRLDMVTGLYYLTTEVDAALGEFK
PAAKDEPEVGVYSSPAEAIMASDRGVLSVRAKIKVRLTQLRPPAEIEAEL
FGANGWQPGDAWMAETTLGRVLFNELLPVGYPFVNKQMHKKVQAAIINDL
AERYPMIVVAQTVDKLKDAGFYWATRSGVTVSMADVLVPPRKKEILDQYE
ERAEKVEKQFQRGALNHDERNEALVEIWKEATDEVGQALREHYPADNPII
TIVDSGATGNFTQTRTLAGMKGLVTNPKGEFIPRPVKSSFREGLTVLEYF
INTHGARKGLADTALRTADSGYLTRRLVDVSQDVIVREHDCETERGIVVE
LAERQPDGTLIRDPYIETSAYARTLGTDAVDEAGKVVVARGEDLGDPEIE
ALLAAGITQVKVRSVLTCTTGTGVCATCYGRSMATGKLVDIGEAVGIVAA
QSIGEPGTQLTMRTFHQGGVGEDITGGLPRVQELFEARIPRGKAPIADVT
GRVRLEEGERFYKITIVPDDGSEEVVYDKLSKRQRLRVFKHEDGSERVLS
DNDHVEVGQQLMEGSADPHEVLRVQGPREVQIHLVREVQEVYRAQGVSIH
DKHIEVIVRQMLRRVTIIDSGSTEFLPGSLIDRAEFEAENRRVVAEGGEP
AAGRPVLMGITKASLATDSWLSAASFQETTRVLTDAAINCRSDKLNGLKE
NVIIGKLIPAGTGINRYRNIQVQPTEEARAAAYTIPSYEDQYYSPDFGQA
TGAAVPLDDYGYSDYR
379763944YP_005350341.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MLIGSHVHQDDPLAAAQADGADVVQFFLGNPQSWKKPKPRDDAEALKAST
IPLYIHAPYLINVASANNRVRIPSRKILQDTCDAAAAISATAVIVHGGHA
DDNDMDAGFERWVKALDYLETDVPVYLENTAGGDHAMARHFDTIGRLWDH
IGDKGIGFCLDTCHAWAAGEQLIDAVDRIKALTGRIDLVHCNDSRDAAGS
GADRHANFGTGQIDPELLAAVVKAADAPVICETADEGRKDDIAFLREKTG
G
379763943YP_005350340.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MLRRLATISGVVLVLAGCFPGVANAPTGFVTGTSVHHLKVGDLDRSYRLY
KPAGVAASAPLVVMMHGVSGSAREAEKDYHWDGLADSGKFVVAYPDGLDH
AWNVDGQTCCGRSGREGVDDVGFISAAVADIAKNVGIDTAKVYATGMSNG
GIMSYTLACTTEIFAAIGPVAGTQLNSCRTPHPMSVMHIHGTADELVPYG
GGPGYSVINGPPVPNVNAFWRNVDQCGAPSATTDGPITTSTAGCAEGRGV
VLITVDHGDHEWPDFATRELWDFFAAHPR
379763942YP_005350339.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSDTHVVTNQVPPLEDHNPATSAVLIEALIREGGQWGLDEVNEVGALSAS
REAQRWGELADRNRPILHTHDRNGHRIDEVEYDPAYHELMRAAIEHGMHA
APWADERPGAHVVRAAKTSVWTVEPGHVCPISMTYAVVPALRYNPELAQV
YEPLLTSREYDPELRPATAKPGITAGMSMTEKQGGSDVRAGTTQATPNAD
GTYSLTGHKWFTSAPMCDIFLVLAQAPGGLSCFMLPRVLPDGTRNRMFLQ
RLKDKLGNHANASSEVEYDGAIAWLVGEEGRGVPTIIEMVNLTRLDCTLG
SATSMRTGLTRAIYHAQHRKAFGAYLIDQPLMRNVLADLAVEAEAATMVA
MRMAGATDKAVRGDETEALLRRIGLAASKYWVCKRSTPHAAEALECLGGN
GYVEDSGMPRLYREAPLMGIWEGSGNVSALDTLRAMATRPECVEVLFDEI
AESAGQDPRLGNHVARLRADLANLESIAYRGRKVAEDICLALQGSLLVRH
GHPAVAEAFLTTRLDRRWGGAFGTMPDGLDLAPILERALVKG
379763941YP_005350338.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTHAIRPVDFDNLKTMTYEVTDRVARITFNRPEKGNAIVADTPLELSALV
ERADLDPNVHVILVSGRGEGFCAGFDLSAYADRTGSAGGTGAYAGTVLDG
KTQAVNHLADQPWDPMIDYQMMSRFVRGFSSLMHADKPTVVKIHGYCVAG
GTDIALHADQVIAAADAKIGYPPTRVWGVPAAGLWAHRLGDARAKRLLFT
GDCITGAQAAEWGWAVEAPDPADLDERTERLVERIAAVPVNQLIMVKLAL
NSALLQQGVATSRMVSTVFDGVARHTPEGHAFVADAVEHGFREAVRHRDE
PFGDHGRRASGV
379763940YP_005350337.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MPDMTARSVVLSVLLGAHPARARASELVRLTSDFGIKESTLRVALTRMVG
AGDLVRNADGYQLSDRLLARQRRQDDAIDPRVRPWRGEWVTLVVTSVGDD
ARTRAALRTAMHDKRFGELREGVWMRPDNIDAELGPDVTARVRVLRARDG
DPAELAAQLWDLPAWARAGHRLLDDMAAAPDIPGRFVVAAATVRHLLTDP
VLPDELLPADWPGARLRAAYHDFAAELLRRREPLCAEAR
379763939YP_005350336.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSDPVRVERNGRVTTVIIDRPGARNAVNGPTAAALYAAFEEFDRDDTASV
AVLWGDGGTFCAGADLKAFGTPDANAVHRSGPGPMGPTRMVLSKPVIAAV
SGYAVAGGLELAIWCDLRVVEEDAVFGVFCRRWGVPLIDGGTVRLPRLIG
HSRAMDMILTGRAVAADEAQAIGLANRVVPKGQSRRAAEELAAQLSALPQ
QCLRSDRLSALHQWGATESEALDFEFASISRVAAEANEGAGRFAAGAGRH
GAAAD
379763938YP_005350335.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MNYGSMGTTTNLDCATGKSLNVAGSDNTLTVTGSCSTVNIGGTNNKITLD
KVEKRITVLGMNNTITYKDGDPKVDNLGSDNTINKGS
379763937YP_005350334.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MLPISRDAVVLAPLDPVVGAAPALVVGLLFVVVVEEEPAGGLAVELQPAS
TRIAAAGARAKVCTRIVV
379763936YP_005350333.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MKWTTVAGSLATCAVAVVAGFAAVPGLAQAKNGDTHVIGEDMEQTVDCND
ATLLVNGSFLTVTALGNCYAVTVMGSSNVVIADSVSHDITVYGHDQTVLY
KGGQPFLWDRGRELGMTNRLQQVPG
379763935YP_005350332.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAAQPESPSAAGRQRAGRPGSRPTKLSREGIIDGALTFLDREGWDALTIN
ALATQLGTKGPSLYNHVDSLEDLRRAVRIRVIDDIIMMLNRVGEGRARDD
AVLVMAGAYRSYAHHHPGRYSAFTRMPLGGEDAEYAAATRSAAAPVIAVL
SSYGLDGAEAFHAALEFWSAMHGFVLLEMTGVMDDIDTDVLFSDMVLRLA
AGLERRTAHDGARG
379763934YP_005350331.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTVRFTPRPGVSHALRTGRKSDAWWTREFARHSLPYG
379763933YP_005350330.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MPTIQQLVRKGRRDKVAKVKTAALKGSPQRRGVCTRVYTTTPKKPNSALR
KVARVKLTSQVEVTAYIPGEGHNLQEHSMVLVRGGRVKDLPGVRYKIIRG
SLDTQGVKNRKQARSRYGAKKEKS
379763932YP_005350329.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MPRKGPAPKRPLVNDPVYGSQLVTQLVNKVLLQGKKSLAERIVYGALEQA
RDKTGTDPVITLKRALDNVKPALEVRSRRVGGATYQVPVEVRPDRSTTLA
LRWLVSFSRQRREKTMVERLANEILDASNGLGAAVKRREDTHKMAEANRA
FAHYRW
379763931YP_005350328.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAQKDVLTDLTKVRNIGIMAHIDAGKTTTTERILYYTGISYKIGEVHDGA
ATMDWMEQEQERGITITSAATTCFWKDNQINIIDTPGHVDFTVEVERSLR
VLDGAVAVFDGKEGVEPQSEQVWRQADKYDVPRICFVNKMDKIGADFYFS
VRTMEERLGANVIPIQLPVGSEGDFEGIVDLVEMNAKVWRGETKLGETYD
TIDIPAELAEKAEEYRTKLLEAVAETDEALLEKYLGGEELSVDEIKGALR
KLTISSEAYLVLCGSAFKNKGVQPMLDAVIDYLPSPLDVPPAVGHAPGKE
DEEVTRKPSTDEPFSALAFKVATHPFFGKLTYVRVYSGKVDSGSQVINAT
KGKKERLGKLFQMHSNKENPVETASAGHIYAVIGLKDTTTGDTLSDPNQQ
VVLESMTFPDPVIEVAIEPKTKSDQEKLSLSIQKLAEEDPTFKVHLDHET
GQTVIGGMGELHLDILVDRMRREFKVEANVGKPQVAYKETIRRKVENVEF
THKKQTGGSGQFAKVIINLEPFTGEDGATYEFENKVTGGRIPREYIPSVD
AGAQDAMQYGVLAGYPLVNMKVTLLDGAFHEVDSSEMAFKIAGSQVLKKA
AAQAQPVILEPIMAVEVTTPEDYMGDVIGDLNSRRGQIQAMEERSGARVV
KAHVPLSEMFGYVGDLRSKTQGRANYSMVFDSYAEVPANVSKEIIAKATG
Q
379763930YP_005350327.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAKAKFERTKPHVNIGTIGHVDHGKTTLTAAITKVLHDKYPDLNESRAFD
QIDNAPEERQRGITINISHVEYQTDKRHYAHVDAPGHADYIKNMITGAAQ
MDGAILVVAATDGPMPQTREHVLLARQVGVPYILVALNKADMVDDEELLE
LVEMEVRELLAAQEFDEDAPVVRVSALKALEGDAKWVESVEQLMEAVDES
IPDPVRETEKPFLMPVEDVFTITGRGTVVTGRVERGVINVNEEVEIVGIR
PTSTKTTVTGVEMFRKLLDQGQAGDNVGLLLRGIKREDVERGQVVTKPGT
TTPHTEFEGQVYILSKDEGGRHTPFFNNYRPQFYFRTTDVTGVVTLPEGT
EMVMPGDNTNISVKLIQPVAMDDGLRFAIREGGRTVGAGRVVKIIK
379763929YP_005350326.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MPMSFVQTTPEFVAAAATDLARIGTTITSANTAAMGPTSAVLAPGADEVS
ASIAALFDAHSQVYQALSAQAAAFHSQFVQLMNGGAMQYAAAEAANATPL
QTAAAPASMAAQVPTMTAGAMSASAPTAPAGPLAAAVAPAAAVPAPAGTP
VAAAPVG
379763928YP_005350325.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MRGDTGSVVAGEACGATCAGGAADVPVGADAAGVTVLAGPAGA
379763927YP_005350324.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAPQASPATTLPVSPRTAPHSPAGTQPAAPPVRRVPIVPPESLA
379763926YP_005350323.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MGPIFLVVYFVMGLDSLLQWMFYVGLLITAADVLIALALANYGAKTSAKV
AALEQSGVLALAQITGITETGTWVNNQQVVKVHLHIAGPGLLPFDSEDRV
IASVTRLGNLNARKVVVLVNPTTNEYRIDWERSALVNGLVPAQFTVAEDN
RTYDLSGQAGPLMEILQILKANNVPLNRMVDIRSNPALRGQIQAVVRRAV
EQQSSAAQPAPGAPPSAGAAPSAVVTPPEPSIAARLQELNDLHASGALTD
QEYNSRRAAIIAEI
379763925YP_005350322.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAGSLHGRVAFITGAARGQGRSHAVRLAAEGADIIALDICAPASASVTYP
PATPEDLDETARLVEGQGRKILTRVLDVRDDAALRELVADGMEQFGRLDI
VVANAGVLSWGRVWELTDEQWDAVIGFNLTGTWRTLRATVPAMIEAGNGG
SIVVVSSSAGLKATPGNGHYSASKHGLTALTNTLAIELGEYGIRVNSIHP
YSVETPMIEPEAMMEIFGRHPSFVHSFPPMPVQPNGFMTADEVADVVAWL
AGAGSGTLTGTQIPVDKGALKY
379763924YP_005350321.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSTDASATNGIVIVGGGLAAARTAEQLRKSEYSGPITLVSDEVHLPYDRP
PLSKEVLRKEVDDTALKPREWYDENDITLRLGSAATRLDTAAQTVTLDDG
TTLRYDELVIATGLVPRRIPSIPDLEGIRVLRSFDESLALREHASAARRA
VVIGAGFIGCEVAASLRSLGVDVVLVEPQPTPLAAVLGEQIGELVARLHR
AEGVDVRLGVGVAEVRGDTRVEAVVLSDGTELAADVVVVGIGSRPATEWL
EGSGVDVDNGVICDEAGRTSAPNVWALGDVASWRDATGHQGRVEHWSNVA
DQARAVVPAMLGQDVPTAVVVPYFWSDQYDVKIQCLGEPEADDIVHVVED
DGRKFLAYYERDGALAGVVGGGMPGKVMKMRAKIAAAVPISEVLG
379763923YP_005350320.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MKTMQELFEIAWQATQIGAATLKKSQPSSVQHKGDRDLVTDIDLAIQRDI
ADYLAQTTPEIPLLAEESEQHPDIETSEWLWVLDPIDGTSNFVHGLPLCA
VSLALMRTGRTVVAVTHAPLLGKTYHAIEGKGAFLGGQRINASAADSLSG
AIVSLGDYAVGHDAGRLNEHRLALTAELVPRVERIRMIGAATLDLAFVAE
GALDACVMMSNKPWDTAAGTLIAREAGAQLTDAQGNPHTHKSASTVISAP
GIAEQLATVIRNTEKAGDRYATAVG
379763922YP_005350319.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MGFLRRKRFRDNTPGGLCQPLLVRMGPIHRSLGDNNRAGRTAPGPRRSTS
H
379763921YP_005350318.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MIPTVALNDEAKMPVLGLGVAKLSDEETESSVLAALEAGCRLIDTAASYG
NEEAVGRAIAASGIPREELFVATKLGTSRQGFQSAQESCKESLDRLGLDY
LDLYLIHWPAPKLGKYVESFEGMKVARDEGHVRSIGVCNFTEELLANVIE
ETDEVPAVNQVELHPRLNQAELRQAHAQHDVTTQSYSPLGVGKMLEDPTV
TAIAAEYGRTPAQVLVRWNLQLDNVVVSRSSKPERVAQNLDVFDFTLEPE
HMEAINGLHDGTRVLHDPMTFMGT
379763920YP_005350317.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSVEHLAHTLRAQGRFCASSGSAMYGELFELVAADVEAGGVFAAILSRHR
HAPSRDAVPLRLLGGLHRLVLDGRAAHLRRWYPSTGGSWNAGPAWPQIRD
AAAGHADALRAALDQPPQTNEVGRSAALIGGLLHLNQSGLPIRLFEIGAS
AGLNLRADHYLYRFAGSQWGAPDSPVAIDDAWRGALPPGRDVRIAERRGY
DIAPIDVGDTDGELTVLSYVWPDQAARLARLRGAIEVARRVPARLERRTA
AGAVAGLRVADGALTVLWHSITWQYLSADERDAVRAHVDALAARAGARSP
FAHLTMEPASDGPGTPIRFEVCARSWPAGQSRVLGECHPHGPPVHWR
379763919YP_005350316.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MPQPRVGRRRSTTPAHITDVAIDLFTARGFADVSVDDVAHAAGISRRTLF
RYYASKNAIPWGDFDTHLAHLRDLLDNVDSRVRLGDALRAALLAFNTFDE
SETARHRQRMRVILQTAELQAYSMTMYAGWREVIAGFVARRCDCKTTDLL
PQTAAWTMLGVALSAYEHWLSDESVPLPVALGNAFDVVGAGLNELDT
379763918YP_005350315.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSRPDERQGPVDHETETDTQLVTETLVEEVSIDGMCGVY
379763917YP_005350314.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MPAPAQAETARPAGDTVFDPDRGWRLHPQVAVRPEPFGALLYHFGTRKLS
FLKNRTILTVVQSLAEHPDVRSACRAAGIDDAGQGPYLHALGVLVDSKML
VPREDHQ
379763916YP_005350313.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTAPTQAAVPRLIEQFEHGLDAPICLTWELTYACNLACVHCLSSSGKRDP
RELSTRQCMDIIDELERMQVFYVNIGGGEPTVRPDFWELVDYATAHHVGV
KFSTNGVRITPEVAARLAASDYVDVQISLDGATAEVNDAVRGPGSFDMAV
RALENLADAGFKDAKISVVVTRHNVDQLDEFAALASRYGATLRITRLRPS
GRGADVWEELHPTADQQVQLYDWLVAKGERVLTGDSFFHLAPLGQSGALA
GLNMCGAGRVVCLIDPVGDVYACPFAIHDRFLAGNVLSDGGFDNVWKNAP
LFRELREPQSAGACGSCGHYDSCRGGCMAAKFFTGLPLDGPDPECVQGHS
ASALAHDRETPRPRADHSRGKRIRQPVPLTLSLRPPTVTPAAPPARLCNE
SPV
379763915YP_005350312.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAEKWFETVAIAQQRAKRRLPKSAYSSLISASEKGITVSDNVEAFGELGF
APHVVGAPAKRDMSTSVMGQDISMPVLISPTGVQAVHPDGEVAVARAAAA
RGTAMGLSSFASKPIEEVIAANPKLFFQLYWLGDRDAIAARVERARAAGA
AGLIVTTDWSFSHGRDWGSPSIPEKMDLKTILKMSPEVITKPRWFLQWAK
TMRPPELRVPNQGRRGEPGPPFFAAYGEWMGTPPPTWEDIAWLRELWGGP
FMLKGVIRVDDAKRAVDAGVSAISVSNHGGNNLDGTPASIRALPAIAAAV
GDQVEVLLDGGIRRGSDVVKAVALGARAVMIGRAYLWGLAAAGQPGVENV
LDILRGGIDSALMGLGHSSIHDLGPGDILVPPGFTRALGVPPAGG
379763914YP_005350311.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MNSSYHHRVPVLGELGTATSSQLSGTAASVMIPLGSTEQHGPHLPLDTDT
RIATAVARRARARLGDGWLVAPAIAYGASGEHQSFAGTISLGTEALTLLL
VEYGRSAGTWARRLVFVNGHGGNVAALGAAVARLRAEGRDAGWCPCVAPG
GDAHAGHTETSVLLHISPADVRTDRWRAGNTAPLPELLGPMRRGGVAAVS
PVGVLGDPTTATAAEGERIVAEMVDECVRRVARWGPGLDGMLT
379763913YP_005350310.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTSSAPRLPDGFAVQVDRRVRVLGDGSALLGGSPTRLLKLAPAAQDMLCD
GRLKVRDDLSAQLARTLLDATVAHPRPAGGPSHHDVTVVIPVRNNLSGVR
RLVSSLRGLRVVVVDDGSFNAVEPEDFVGAHCDIEVLRHHRSKGPAAARN
TGLAACRTDFVAFLDSDVAPRRGWLEALLGHFCDPTVGLVAPRIVGLSHN
ENVVARYEAVHSSLDLGEREAPVLPHSTVSYVPSAAIICRCSAIREVGGF
DETLQSGEDVDLCWRLIESGVRLRYEPIALVAHDHRTELRDWLARKAFYG
GSAAPLSVRHPDKTAPVVISGWALMTWTLMAFGSTLSRLASIVLAVLTGR
RIARAMRSAETSMADVAMIAGRGLWSAALQLASALCRHYWPLALMAATMS
RHFRRVVLVAAVMDGVVDWLRRRDAVGDDVEPIGLPTYLVLKRVDDLAYG
LGLWWGVLRERNVRALKPQIRS
379763912YP_005350309.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTAAVSHSDVLIVGAGSAGSVVAERLSADADRTVTVLETGPALDDPGLLA
QTANGLQLPIGVGSPLVRRYQTHLTDEPVRQHPLVRGATVGGSGAINGGY
FCRGLPRDFDRIGLPGWGWSEVLDSFRAIETDLDFDGPAHGDSGPILVRR
THEMTGTTERFITAAQRAGFGWIADLNDVAAEPISGIGAVPLNIVDGVRR
GSGTAYLIPALSRPNLRLHARTRAVRLRFAGSVAVGVDAIGPDGHTVFTA
DRIVLCGGAIETAHLLMLSGIGDPDALAAAGVPVVAALPVGASFSDHAEW
VLPTDWTVAPGRPVLEVVLSTADGLEIRPYTGGFVAMTGDGTAGHADWPH
IGVALMQPRARGRITLVSPDPDVAPRIEHRYDSEPDDVADLRRGIDLAHE
LAGSTIGSATAVWSTSQHLCGTAPMGVDGDPRAVVDPLCRVYGIDNLWVI
DGSVLPTITSRGPHATIVMIGHRASEFVSTR
379763911YP_005350308.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MVAITAGTTDPRPARSRARLLDAAVTLLRAGGPSAVTVDAVTRTANVARA
TLYRHFPSGNDLLAAAFNSLIPASPTPPAEGSLRDRLVAVVLAQAESVAH
APTLMTAMSWLALGRDLEGLPEPRHSANADSAAITTLRERIAQQYAEPFD
VIFDSPEAAELGEVDRSRAIAMLIGPLVLGRLSTLPDFDYRECALAAVDG
FLHVQTNRANAANTESAGA
379763910YP_005350307.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAGAEAKTSAMSTPTVDPETAQAVKVFADPIAYADEPRLHAALAHLRAHA
PVSLVDCPPYRPFWAITKHADVMEIERANDLFLNEPRPLLAPAEADDFAR
AQLDAGMGLRTLIHMDDPRHQVVRAIGADWFRPKAMRALKVRVDELAKSY
VDKMMAAGGECDFVQEVAVNYPLYVILSLLGLPESDFPRMLRLTQELFGG
DDEEFKRGTTPEEQMQILLDFFGYFSDLTAARRAHPTDDLASAIANARVD
GEPLSDVDTASYYVIIATAGHDTTSATIAGGLQALIENPDQRARLTADPA
LMPLATEEMIRWVTPVKEFMRTAVADTAVRGVPIAAGESVYLSYVSANRD
EDVFDDPFRFDVGRDPNKHLAFGYGVHFCLGAALARMEVNSFFTELLPRL
ESVECAGEPELVATTFVGGLKHLPIRYSLR
379763909YP_005350306.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAGQKIRIRLKAYDHEAIDASARKIVETVVRTGASVVGPVPLPTEKNVYC
VIRSPHKYKDSREHFEMRTHKRLIDILDPTPKTVDALMRIDLPASVDVNI
Q
379763908YP_005350305.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MARKGILGTKLGMTQVFDENNRIVPVTVVKAGPNVVTRIRTPEQDGYSAV
QLAYGEISPRKVNKPVTGQYAAAGVNPRRFLAELRLDNPDAAAEYQVGQE
LTAEIFTDGSYVDVTGTSKGKGFAGTMKRHGFRGQGASHGAQAVHRRPGS
IGGCATPARVFKGTRMAGRMGNDRVTVQNLLVHKVDTENGVLLIKGAVPG
RTGGLVVVRSAVKRGEK
379763907YP_005350304.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MMAAQGSKTLKIDVKTPAGKVEGSIELPAELFDAPANIALMHQVVTAQRA
AARQGTHSTKTRGDVSGGGRKPYRQKGTGRARQGSTRAPQFTGGGVVHGP
KPRDYSQRTPKKMIAAALRGALSDRARNGRIHAVTEIVAGQTPSTKSARA
FLGTLTERKQVLVVIGRSDEAGAKSVRNLPGVHILTPGQLNTYDVLRSDD
VVFSVEALNAYISANTGTPEEVSA
379763906YP_005350303.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MATVTDPRDIILAPVISEKSYSLLDDNVYTFVVHPDSNKTQIKIAIEKIF
SVKVASVNTANRQGKRKRTRTGFGKRKSTKRAIVTLAPGSKPIDLFGAPA
379763905YP_005350302.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSDFSEVTRSTPEKSLVRPLHGHGGRNAHGRITTRHKGGGHKRAYRVIDF
RRNDKDGVNAKVAHIEYDPNRTANIALLHFLDGEKRYIIAPQGLSQGDVV
ETGPNADIKPGNNLPLRNIPAGTVIHAVELRPGGGAKLARSAGASIQLLG
KEGTYASLRMPSGEIRRVDVRCRATVGEVGNAEQANINWGKAGRMRWKGK
RPSVRGVVMNPVDHPHGGGEGKTSGGRHPVSPWGKPEGRTRHPNKASNKL
IVRRRRTGKKHGR
379763904YP_005350301.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MPRSLKKGPFVDGHLLKKVDAQNEKNTKQVIKTWSRRSTIIPDFIGHTFA
VHDGRKHVPVFVTESMVGHKLGEFAPTRTFKGHIKDDRKAKRR
379763903YP_005350300.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTTTEFPSAVAKARFVRVSPRKARRVIDLVRGRSVADALDILRWAPQAAS
EPVAKVIASAAANAQNNNGLDPSTLVVATVYADEGPTAKRIRPRAQGRAF
RIRKRTSHITVVVESRPAKDQRSAKSTRARRAEASKAAAKKAPATKAPAS
KAPAKKAAAKAPAKKAAPKAEAKTSETSDAKGGSD
379763902YP_005350299.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MGQKINPHGFRLGITTDWKSRWYADKQYSDYVKEDVAIRRLLSTGLERAG
IADVEIERTRDRVRVDIHTARPGIVIGRRGTEADRIRADLEKLTGKQVQL
NILEVRNPESQAQLVAQGVAEQLSNRVAFRRAMRKAIQSAMRQPNVKGIR
VQCSGRLGGAEMSRSEFYREGRVPLHTLRADIDYGLYEAKTTFGRIGVKV
WIYKGDIVGGKRELAAAAPAGAERSRRERPSGTRPRRSGASGTTATSTEA
GRAASVEEGAAAAAPAAEPQSTES
379763901YP_005350298.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MLIPRRVKHRKQHHPRQRGIASGGTAVNFGDYGIQALEHAYVTNRQIESA
RIAINRHIKRGGKVWINVFPDRPLTKKPAETRMGSGKGSPEWWVVNVKPG
RVLFELSYPNEQIARAALTRAIHKLPIKARIVTREDQF
379763900YP_005350297.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MGISPGELRELTDEELTERLRESKEELFNLRFQMATGQLTNNRRLRTVRQ
EIARVYTVLRERELGLASGPDGKES
379763899YP_005350296.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MMAEAKKAAPKKAAAAQAASKDKGPKHTPANPKVRGRRKMRIGYVVSDKM
QKTIVVELEDRVRHPLYGKIIRTTKKVKAHDENSAAGIGDRVSLMETRPT
SATKRWRLVEILEKAK
379763898YP_005350295.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSTDSRAFNGKIELDIRDSEPDWGPYAAPTAPQDAPNVLYLVWDDTGIAT
WDCFGGLVEMPAMSRIAERGVRLSQFHTTALCSPTRASLLTGRNATTVGM
ATIEEFTEGFPNANGRIPFDTALLSEALAEAGYNTYCVGKWHLTPLEESN
LASTKRHWPLSRGFERFYGFLGGETDQWYPDLVYDNHPVSPPATPEDGYH
LSKDLADKTIEFIRDAKVIAPEKPWFSYVCPGAGHAPHHVFKQWADHYAG
RFDMGYERYREIVLERQKSMGIVPGDTELSPVNPYLDVKGPDGQEWPLQD
TVRPWDSLNDDEKRLFSRMAEVFAGFLSYTDAQIGRILDYLEESGQLDNT
IIVVISDNGASGEGGPNGSVNEGKFFNGYIDTVEESMKLFEHLGGPQTYN
HYPIGWAMAFNTPYKLYKRYASHEGGIADTAIISWPNGIAAHGEVRDNYV
NVCDITPTVYDLLGLTPPQTVKGIAQKPLDGVSFKAALDDPKATTGKSAQ
FYTMLGTRGIWHEGWFANTVHAATPAGWSHFDADRWELFHIEADRSQCHD
LAAQKPEKLEELKALWFSEAAKYNGLPLSDFNILETLGRSRPYLVGERSS
YVYYPDCADVSIGAAAEIRGRSFSVLAEVTIDTTGAEGVLFKQGGAHGGH
VLFIQDGRLHYVYNFLGERQQEVSSAQAVPLGRHLFGASYSRTGTVENSH
TPLGDLTLFIDDEVVGTLAGVSTHPGTFGLAGAGITVGRNGGSGVSSRFK
APFAFTGGTIAQVTVDLSGRPYRDVETEIALAFSRD
379763897YP_005350294.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MLSELVDLPGGSFRMGSTSFYPEEAPIHTVAVGPFAVERHPVTNAQFAEF
VDATGYLTVAEQPIDPALYSGADPDDLCPGAMVFRPTPGPVDLRDWRQWW
QWVPGASWRHPFGPDSDVADRGDHPVVQVAYPDAAAYARWAGRRLPTEAE
WEYAARAGSTTTYSWGDEVTSDGRLMANTWQGSFPYRNDGALGWVGTSPV
GTFAPNAFGLIDMIGNVWEWTATEFSPHHRLDSPPKACCTPPGPADPSVS
QTLKGGSHLCAPEYCHRYRPAARSPQSQDSATTHIGFRCVADSRSG
379763896YP_005350293.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MFDEVRRRAVIAELDELVERCHPSSTRESAALLEHLGVVARVENRAAAAQ
LVAIGELFAYRLSRCAESEEWAVDTEAAVAAEVGAQLRIGQGLAASRVRY
ARAMRERLPKVGAVFGAGDIDYRMFQTIVFRTDLIVDPEVLGAVDAVLAA
NVGRWPSLSQGRLAAQVDKVVAKADVDAVRRRQERAAGRQVWMADMGDGL
AHLEATLYAPDAHALDRRLDGLAATVCAHDPRTREQRRADALGALAADAD
RLGCRCGRADCAAGGRAAGPVTVHVIGEHAVLEGRASTPGAEVGAEGLIP
PEVLAELAASATLVPLTHPGDAAPEPGYVPSRALADFVRCRDLTCRWPGC
DRPATACDVDHTIPYAAGGPTHASNLKALCRTHHLVKTFWGWQEKQLPDG
TLIFTSPAGHTYVTTPGSALLFPSLCAATGAIAAPEADPPPNHCAQRTAM
MPQRRRTRTQDRATRIAAERKHNRDARLARRAPSATCSWPTVYGPDDDPP
PF
379763895YP_005350292.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MIQQESRLKVADNTGAKEILCIRVLGGSSRRYAGIGDVIVATVKDAIPGG
NVKRGDVVKAVVVRTVKERRRPDGSYIKFDENAAVIIKPDNDPRGTRIFG
PVGRELREKRFMKIISLAPEVL
379763894YP_005350291.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MKVKKDDTVLVIAGKDKGAKGKVLKVYPERNRVLVEGVNAIKKHTAISTN
QRGAQSGGIVTQEAPIDASNVMVVDSDGKPTRVGYRVDEETGKRVRISKR
NGKDI
379763893YP_005350290.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTTAEKVQPRLKERYRNEIRDALHKEFGYGNVMQIPTVTKVVVNMGVGDA
ARDAKLINGAVSDLALITGQRPEIRRARKSIAQFKLREGMPIGARVTLRG
DRMWEFLDRLTSIALPRIRDFRGLSPKQFDGVGNYTFGLAEQSVFHEIDV
DKIDRVRGMDINVVTSATTDEEGRALLRALGFPFKEN
379763892YP_005350289.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAKKALVNKAARKPKFAVRGYTRCNKCGRPRAVFRKFGLCRICLREMAHA
GELPGVQKSSW
379763891YP_005350288.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MALDDCDSDEAERSDEEEWRSMTMTDPIADFLTRLRNANSAYHDEVTLPH
SKLKANIAQILKSEGYISDYRTEDARVGKSLIVQLKYGPSRERSIAGLRR
VSKPGLRVYAKSTNLPRVLGGLGVAIISTSSGLLTDRQAARQGVGGEVLA
YVW
379763890YP_005350287.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSRIGKQPVPVPAGVDVTIDGQKVSVKGPKGTLDLTVAEPITVARNDDGA
IVVTRPNDERRNRSLHGLSRTLVSNLVTGVTQGYTTKMEIFGVGYRVQLK
GSNLEFALGYSHPVVIEAPDGITFAVQSPTKFTITGIDKQKVGQISANIR
RLRRPDPYKGKGVRYEGEQIRRKVGKTGK
379763889YP_005350286.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MGQSVSATRRVSRLRRHARLRKKIEGTPQRPRLVVNRSARHIHVQLVNDE
NGTTVAAASSIEDDVRSLQGDKKARSVRVGQLIAERAKAAGIDSVVFDRG
GYTYGGRIAALADAARENGLQF
379763888YP_005350285.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAEQPAGGQGAGDSRDSRGDRDSRGRRGDGGRGRDRDGDKSNYLERVVAI
NRVSKVVKGGRRFSFTALVIVGDGNGMVGVGYGKAKEVPAAIAKGVEEAR
KGFFRVPLIRGTITHPVQGEAAAGVVLLRPASPGTGVIAGGAARAVLECA
GVHDILAKSLGSDNAINVVHATVAALKLLQRPEEVAARRGLPIEDVAPAG
MLKARRESDALASAAAREAQISGTQP
379763887YP_005350284.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSSQLKITQVRSTIGARWKQRESLRTLGLRRIRHSVIREDNPQTRGLIAV
VSHLVEVEEAK
379763886YP_005350283.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTIKLHDLKPARGSKTARTRVGRGEGSKGKTAGRGTKGTKARKNVPATFE
GGQMPIHMRLPKLKGFRNRFRTEYEIVNVGDLNRLFPQGGSIGVDELVAK
GAVRKNSLIKVLGDGKLTVKVEVTAHKFSGSAREKITAAGGSATELS
379763885YP_005350282.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MRFSIAIPQFDYETFDAAGLRSFLTRAEELGFEGGWVLEQIIGPAPLLAP
MELLAYCAACTERLRLGVGVLVTSLHEPLQLASAITAVDRLSHGRLDVGV
APGGGRRKFAAFGVDKDTFISYFTEGLELMKAAWSDDPRVTFHGRFREVD
DLPVAPKPVQRPHPPIWFGGLAPKALARAVRHGDSFLGAGSSTTEAFAGA
VAVVRRELDAQHKDPAGFTIAKRVYLTVDDDAARARERVLAGLDRIYGRM
PGVQDVPVSGTPDDVARGLREVIDAGAQMLLLNPVGIDASENREQMERLA
AEVIPQLS
379763884YP_005350281.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MFAFLPSIPGLSKGADEVRALADRVDTARHHGVPNGCVLELDLRSMPPET
SGFDPLAMITGGSRPVSLRDTVSAIYRAAEDPRVAGLIARVQLTASPSAA
VQELREAIVAFTAAKPSLAWAETYPGTLSYYLASAFGEVWMQPAGSVGLI
GFASNATFLRDAFDKAGIEAEVVARGEYKSAANRFTEHGFTEAHREAVTR
MLESIREQVWEAVGTSRKLDAAALDALADRAPLLREEAVSSGLVDRIGFR
DEAYDRIAELVGVKDVSEENAPPRLYLSRYAGAARSRLIPPAPSVPGRRP
KPTVAVINVDGTIVDGRGGPQFLPFGTSTVGSDTIAPALREAAADDSVSA
IVVRVNSPGGSVTASETLWREVKKARKRGKPVVASMGSVAASGGYYIAVA
ADAVVASPATITGSIGVLTGKLVIRDLLGRLGVGSDTVRTNANADAWAID
TPFTPEQRAHREAEADLLYADFVARVADGRNLTKDAVDRVARGRVWTGAD
ALERGLVDELGGFRTALRRAKILAGLDEDADVRIVTYPGGSLLDMLRPRA
SSQPAAASLPDALGALLGRTIGGIVDNVERSVSGASALWAGPWRL
379763883YP_005350280.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MPRTHDDNWDLASSVGATATMVAAGRAMATKDPRGLINDPFAEPLVRAVG
VEFFTKMMDGELDIDAIENASSVRVQAMIDGMTVRTRYFDDYFMDAVGAG
VRQVVILASGLDARAYRLPWPDGTVVYEIDQPQVIEFKTSTLAGIGAEPT
ADRRTVGIDLRADWPTALKDAGFDTTAPTAWLAEGLLIYLPPDAQDRLFD
NITALSAPGSTIATEFVPGIVDFDAEKVREMSGSFRDHGVDIDMASLVYT
GDRNHVVDYLSSTGWHAEGVTRTELFERGGFDVRAPEDDDPLGEIVFISG
RLGG
379763882YP_005350279.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MGATATMVAASRAVASKGPDALLDDPLADPLVRAVGLDPFIRIIDGEIDF
EDDPLFNRRARAEQITVRTRFFDDFFLDATNAGIKQAVILASGLDTRAYR
LRWPAGTVVYEIDQPDVIAFKTDTLAGLGAAPTAQRRTISIDLRDDWPAA
LRDGGFDVTQPTAWSAEGLLPYLPPEAQDRLFDNITALSAPGSRVATEHV
PDPDAFSDERLRRISERWQRFGFDLNAADLFYRGERNVVVDYLNGHGWQV
SAHPARELYARNGFEFPEDEMAATFGELSYVAATLE
379763881YP_005350278.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTSTRYEGDTWDLASSVGVTATMVAAARAMATRAESPLINDPFAEPLVKA
VGVDLLSRLASGELDPAELNDVHDGAASSAGAMSRMADNMAVRTKFFDEF
FMDATNAGIKQAVILASGLDARAYRLAWPAGTVVYEVDQPQVIEFKTRSL
AELGAAPTAERRVVAVDLRDDWPTALKDAGFDPAQPTAWSAEGLLGYLPP
EAQDRLLDTITELSAPGSRLATESAPNPAPGDDEKLKERMQAISERWRAH
GFDLDMAGLVYFGDRNEAAPYLAAHGWRLNSASIRDLFAANGLDPLGDDD
MRMGEMLYTSGTYE
379763880YP_005350277.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAYERVLITGASSGLGAALARRLAGGGAVVGLVARRRDRLAEVLADCRRT
APGSAMWVADLADTSALRDLAATAWDTLGGIDVLINNAAVPKRRPVTALD
PDEVEEVMRVNFFAPMRLTLALLPRMRERGSGMIVNVSSVGGRLGIIHES
AYCASKFALCGWSEAMAVDLHGTPIAVKLIEPGPVDTEIWDHPGSEEPLY
RGPKVSADEVADGILAALGTEGFEHYVPDMKPVVDAKNADLDAFIAGAAG
LAAP
379763879YP_005350276.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MRALVYGVPPEPFEVPERANALTQNLARTPTALREVPDPQLPQEDWVLTR
PRLTGICGSDSKQILMDFGEGDADNAMSAFCSFPQVLGHEVVADVVALGP
RARGLQVGQRVVLNPWLSCGPRGIAPPCPACQAGDYSLCWSFTDGALSPG
IHTGVSADVTGGYAELMPAHDSMLFAVPDSIPDEAAVFADPFSVSLHAVT
RHPPPDTGPVLVYGAGSLGLCAVAILRALYPDVAVAVIARFGAQAELARR
FGAAKVLAHEPRSDLIEELVAWGGGRLRRPLLGLPMAHPGAVDVVYDTIG
KPETFEVGVRVLRSRGTLVKAGVHAPGRWEDSPLYFKEVSLVGSNAFGVE
EVDGRRKHAIAHYLDLAGAGRVDLRPMLTHTFGLARWRDAFWELADQGES
GAVKVAIDQR
379763878YP_005350275.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MRRFRLGRATLARVVELRFSLGAKSFPHTPPSGWHDNADLLVPDFFDPDT
DQWHIAIQSWVIQVDGLTVIVDTGVGNDRLRPHMPPLDHLNTAFLAALRS
AGVERDAVDVVVNTHMHSDHVGWNTMLDNGTWVPTFPNARYLLPAADYRH
FEPDGPAARRSPRTEAEAAQQRGDQLVFADSVLPIDAAGQLIRWSDDYAV
SDSLRLRPAPGHTPGSSVLWLDAGQPAVFVGDLTHSPLQVRRPGDACAFD
IDAAAAAVTRRRIFTEAAQATATVIPAHYPGRGGATIRALGDEFEVGEWL
DIPAL
379763877YP_005350274.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MKFVENAETAVLDAAKDMLRRGLVEGTAGNISARRADGNIVITPSSVDYR
DMQLDDLVLVDPGGSVLQAADGRSPSSEMQLHLACFAAFDDIGSVIHSHP
VWATMFAIAHQPIPACIDEFAVYCGGDVRCTDYAASGTADVGTNAVAALE
GRAAALIANHGLVAAGPRPDKVLHVTALVERTAQIVWGARALGGPVPIPE
DVNNNFAAVYGYLRANA
379763876YP_005350273.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAFVTSKPRALVTAPMRGPGFAKLRELADVIYDPWIEQTPLRIYSAEQLA
ERIASEGAEIVVVESDSVRGPVFAQGLRAIASTRGDPNNVDIAGATAAGI
PVLNTPARNADAVAEMTVALLLAATRHVLPADADVRSGNIFRDGSIPYQR
FRGGEIAGRTAGLVGLGAVGRATQWRLSGLGLRVIAHDPYNPDARHSLDE
LLAEADIVSLHAPVTDDTAGMIGAGQFAAMRDGVVFLNTARAQLHDTDAL
VDALVAGKVAAAGLDHFAGEWLPADHPLVGMANVVLTPHIGGATWNTEAR
QAQMVADDLEALLKGDAPAHLVNPEVLGP
379763875YP_005350272.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSRIDVTIGIDVGSTAVKAIAADADGNVAARVRIPHALRVPAADRLEHDA
DEAWRRGPSAALAELADRTDVAAVAVSAMVPSMTAVDATGTPITPGLLYG
DGRGRTPGGDAQPLPALGEAAEFLRWTAAQEPDAAGYWPAPAVANHALAG
DAVIDIATAATAFPLFDGTGWDPAACAERGARVEQMPRVESMGAVVGEVR
GSGAAVATGAIDALCEQIVAGADRDGDVLVMCGTTLIVWTTISEPRQMPG
LWTIPHTTPGKSQIGGASNAGGLFLGWVDRVVAQADPTAVEPGRVPVWSP
YLRGERSPFHDPDRRGLLEALDLTHDAAALRRAAYEASGFVVRQLIELSA
APVSRIVATGGGTRVGPWLQAIADATGRPVEVSAVAEGAALGAAFLARMA
AGLETTIADAARWVRTERVVEPDPVWAAAVEDRYHRFLQMAERRCGAVAP
PPF
379763874YP_005350271.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTDHDRKATRREIADALSKAVERRHEIADAIVESENRAAAVEAIVRLLDT
SHLAAEAVMGMSFDQLTIDSRRKILAELEDLNKQLSFTLGERPASSGETL
ELRPFSAATDRDIFAVRTEEIGAAGDGSGGPAGSLDDEISAALGRVDDEE
AAWFVAVDSGQKVGMVFGELVRGEVNVRIWIHPDYRKRGYGTAALRKSRS
EMAWCFPAVPMVVRAPAAKPPG
379763873YP_005350270.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTRTDQDSWDLASSVGATATMVAAARALASGGANPIINDPFAAPLVRAVG
LDFFRRLVDGEVTEPEGDGAAGGGAKELALETDSMAVRTRFFDDFFLNAA
RDGIRQSVILAAGLDARAYRLGWPPGSVVYEVDQPKVVEFKSATLASLGA
SPAADRRTVGIDLREDWPAALRGSGFDVTRPTAWSAEGLLMYLPPDAQDR
LFDNITALSAPGSKLATEYHPDNGTTMSQRAREFNDRWAKVGCDIDLSGL
FFDGERSNVVDYLTGRGWRVSTRPRRDLFGDYGLEFPDDDEAAQHPNIVA
VTATLGS
379763872YP_005350269.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MLSAFISSLRTVDLRRKILFTLGIVVLYRVGAALPSPGVNYPNVQQCIKE
ASGGAAGQIYSLINLFSGGALLKLTVFAVGVMPYITASIIVQLLTVVIPR
FEELRKEGQSGQAKMTQYTRYLAIALAILQATSIVALAANGGLLQGCSLD
IIADQSILTLIVIVLVMTGGAALVMWMGELITERGIGNGMSLLIFVGIAA
RIPAEGKTILDSRGGMIFTAVLIAALIIIVGVVFVEQGQRRIPVQYAKRM
VGRRMYGGTSTYLPLKVNQAGVIPVIFASSLIYIPHLITQLIRSGSGGVG
NSWWDKFVGSYLSDPSDPVYIGIYFGLIIFFTYFYVSITFNPDERADEMK
KFGGFIPGIRPGKPTADYLRFVLSRITLPGSIYLGAISVLPNLFLQIGNG
GAVQNLPFGGTAVLIMIGVGLDTVKQIESQLMQRNYEGFLK
379763871YP_005350268.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MRVVLLGPPGAGKGTQAQKLSEKLGIPQISTGELFRSNIENGTKLGLEAK
RYLDAGDLVPSELTNQLVDDRLSDPDAANGFILDGFPRSLQQAKALHEML
ERRGTDIDAVLEFRVSQDELLQRLKSRGRADDTDDVILNRMKVYRDETAP
LLDYYRDELKTVDAIGTLDEVFARALQALGK
379763870YP_005350267.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTPLARLRSRKVVPQRSAGELDAMAAAGAVVAAALQAVRAAAVSGVSTLS
LDEIAESVIRDAGAVPSFLGYHGYPASICASVNERVVHGIPSAAEVLGSG
DLVSIDCGAVLDGWHGDAAITFGIGTLDAADEALSQATRESLEAGIAAMV
PGNRLTDVSHAIEMGTHAAAARHSRSFGIVEGYGGHGIGRQMHMDPFLPN
EGSPGRGPQLAPGSVLAIEPMLTLGTGKTVVLDDQWTVVTTDGSRAAHWE
HTVAVTESGPRILTLGA
379763869YP_005350266.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MKALFDEHAAVLWRYALRLTGDTSQSEDVVQETLLRAWQHPEVVGDTERS
ARAWLFTVARNMIIDDRRSARYRNVVGSTDVSGAPEQSTPDEVNAALDRL
LIADAMAQLSADHRAVIERSYYRGWTTTQIAADLGIAEGTVKSRLHYAVR
ALRLTLQELGVTR
379763868YP_005350265.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MKDMDEMNTPVADIGPPEDRYAMWDAAYVLGSLSAAQRREFETHMARCTA
CREAVADLSGVPALLSQLDRDEVAAIDESGPAPEMSEEMLPSLLAAVRWR
RRRTRVVTWVASAAAAAVLAIGVFVGLQAWSSTPAQQVTASAEPMAQVGT
SLLTSSVQVTGQHWGTSIALRCVCLAPLNAHHDTLAMVVVGRDGSQTRLA
TWVAVPGHTATPVGAISTPVDQIAAVQVVAADSGKVLLQRSL
379763867YP_005350264.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MFGRPLRVLVVGAGVAGISVARGLVRDGHDVTVFERRPDVRAPGGAVTIW
SNGETVLNQLGVDMGGAGRLLATVRAVTSRGRPLATLDVTAMVRRLGAPV
RMVPRRVLLERLLDGFDAERIRCGSPVIAVNRTDVGVCVEFGHGTVADAD
VVIGADGLHSMVRNCVGAQAAKPTGWCSWQGLATVPEIADSDAALMIIGA
RGNLGLWPAGGSEVQWWFDLPWSHGFVRPQRPIEMIRSHFAGWSDSVDRV
LATLSDDDLAGSPFPHFRHPIPGPGHGPVTLLGDAAHAMPPTLAQGTNQA
LLDTMVLCKALRDFRGGTNGGADVSAALRWYERTRRRKVMAVSWVASLPV
SHGEFVLRPAALISDRLQAGALTTFLRLTSHRRMSAEISRNLGVAATVPS
SP
379763866YP_005350263.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MRGDLDAPSRWLWLVKWCVLAVPHYPILILLYLIYPFSTVAAGVAILCTG
RYPRPLFAFNVGVLRWSWRLMNYRFPMNSTDRYPPFTLASRPDYPGDLAV
DYPERLKNWAVLVKWLLAIPQVLLCWSMEAPLQVLCVIAALALLFTGTIP
PGAFDLLMGMVRWRYRVAVYVSLMRDEYPPFRMDLGAR
379763865YP_005350262.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTLRSLAFPYVYRFGQPLFDRLFYHRYRRAALSNATGRLLMLGLGPGTDL
MFLPDTVTSVAAVEPAAPFRRMAARLARRRGIAVDLVEGTGESIPFPDNS
FESVHAGLVLCSVGDVAATLGEIRRVLVPGGRLVVLEHVRGDGATGRFQD
LIAKPWSWLAGGCEPNRRTLEAIAAAGFDTAALRSIRTPVPFPCKPHLQG
FATVTRR
379763864YP_005350261.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MRPGARRGLKLTAAASRLRVFSLRELAVHRRRTFASIAVMAVSATYLVAI
FGIFGSITGSVGRLADGIAGVAALEVSGITDGGFPDSILADVAGVPGVAT
AAPMIRASASTPSGPVLLLGADASTAALGGALKDVVTRPVQALSSTPSGV
QAGPRVGYAKGQAFQLGSASVTVTDVLAGKRYEDLNGGHYVLAPLALAQN
ATGRTGQLDSILITTKRGADPGAVRAAVTAAVHGRAIVAAPSFRAARAGD
GVKLMNYMALLGAAVALVVGAFLIYTTMTMAITARRPVISMLRAIGGRRA
SIVGDMLAEAAVLGLIGGAIGSGMGIVAGHIAIGRLPPAMTQGLEARVQY
WLPGYAIPLALAATALTSVAASAMAARQVYKVSPIEALAPVGASAADTVP
RWLRIAGGVGAVAVFAVSTPVVTGQRGSYAVVAMAAVLGAEIALGFALTA
PIVHATAAMARTFGSFGALAAATIQRAPRRVWATVMTVLIGVLTTVVITG
TNADMIRSARDIFAPVTDTDVWVSADPPDSYPTDALPQGLSAKVAALPGV
ARVTEGAFGFAVVGGTRVLLDGFSAGSNDALFRALDERVRTEVLTGRGVV
LTRNLGTTLRVRAGDQLRLQTPHGPRSVTVLALVPFFSTVIGTVGIDVDQ
MRAWFDRPAATTLQIAAAPGVNRQRLLAGVREAAPAPNHVYDGPTALAGL
QAPLRQSMFIANAVWVIVVAVAAVALLNTLTLSVNERRREIGVLRAMGSS
RRFTLRMVLAEAAGIGVVGGVLGLALGLTDQWLFSRISDDIMNFEVGFHP
NPLALAFTLGAVAISLLGSVPPARRAARLSIIEAVSVE
379763863YP_005350260.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTVELCNVVREYRVGGQTVRALDGVSLRLADEQFVSVVGPSGAGKSTLLH
VLGALDSPDSGSIAFDGEEIARLSDEQQSRFRHRRVGFIFQFFNLLPTLS
AWENVAIPKLLDGVRLGSAKPDAIRLLDRVGLGNRAQHRPAELSGGQMQR
VAVARALMMNPPLILADEPTGNLDSATGASILALLAEVAHEEGGGRLVVM
VTHNADAAAATDRVITLQDGRVGSDVMAVAG
379763862YP_005350259.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAAGERFMYWIWTTMNRPGRYLVSSGMLGRHRVVDHIVGHLAAIGVDHIF
GVDGANIEDVYDAAHFCPDIDAVLAKHEFSAATMADGYSRSGAGVGVVAA
TSGGGALNLVAGLGESLASRVPVLALVGQPARTMDGRGSFQDTSGANGSL
NAEALFSAVSVFCERLLTPADIVSLLPRAIAAARIGGPAVLLLPKDIQQA
HLDAGRDDNDADGMRAAIGNPHPIVAELRRVQGRVTILAGEQVARDDARA
ELEELRALLHARVATVPDAKDVAAADGGPAALGVTGVMGHRNVAEAVATS
AVCLIVGTRLAVTARGGLDEALAAVRTVSIGSAPPYLPCTHVHTDDLRGS
LRALTHAVRHRGRPAGPRIPGAGRPAEMTPPPFTGPGVRYREAMAVLDDV
VPDGSDIVVDAGNTGAAAIHYLPVRRGGRFAVALGMGGMGYSFGAGIGMT
LGRANTGRPAGRTVVIAGDGAFFMHGMEVHTAVQYRLPMTFVLFNNNAHA
MCVTREQLFYDDLYSYNRFRPSRLGAGLAAMFPGLAAVDVSDADGFAAAM
GAALDIDGPAVVSVECAADEIPPFAPFLTAAPAKGRGVDQISLAEENLTN
VAASA
379763861YP_005350258.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSLPALEDIPDLIDGVTRIETSPREKATPIIMDMMRSVYPHDQVFGQYCT
VNDYVDCPPDELYEYMADTRSLEEWTYSLRGFTPTDEPGLWLAHDRLGSE
TEIYTRTVANAQARTVDYHCAWDQGKHLWMIYLMRVVDAQTVLDKPGSVV
LWTNCHHPFYDHNPYPETAPAQRPVWVGDFWDMFAAGHLLELRNLKAIAE
YRHRNGLPVTPVWMR
379763860YP_005350257.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAKPTVSLIDVSTYLPGDPIPAGYYARFAESDDLRDNVMFRAPKFRHHVG
ADESSVDMIERAARGLIERHGHDVVAGADVLITHTQVPDMAFYGQGGGIA
HRLGMRPSWVLDLNNGGCAAFVLALNVARTLLSAGQGRTALIAIAQNAAG
QFFDQPTIRRKAQSAVPGDGAAVGLVALSEHSPILDVECRTYGEYAGEMT
LSYDPPRKWWQAGPGEGSIGFTESKITKVLARGNRQVPEVALAVCDRIGL
AAKDIDLLVTNQPNRAFLRNWRDALELPPQRHRDTFDECGNLFGAGIPIN
LDRAIADGQLGAGEVVMMAAFAHAGDFAGAAAVRWGGRD
379763859YP_005350256.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MHAVPAPVAGQICDALPDAVDPFALSLNENPFPPLPSVRSALIRSVSAAN
RYPEFLPERLRGLVAGHIGVPTERVVLGAGATGVVLQALQALTAPGDTIA
MASPTFDGYPIVAQLARLNSSFVPLDAHGQHDLDALADAAGAARVVVVCR
PHNPTGTLEPAAAVLRFLRRVPRDTVVLLDEAYIEFTAPEHRFDVAALVT
RFPNVVVVRTFSKAYGLAGLRIGYAVASHQLAPTLWTQQLPFGIAITGLL
AVAASYAAEGELLRRIRLITAERRYLRMRLSALGIYTTDAHANFMYLPSQ
QGLSWREAFGDDAPRVRYYADGAARITVGGRASTTAVLSALGKATLGLQV
R
379763858YP_005350255.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MADSRPDKRDPIAAARANWERAGWGDVAPGMVAVTSVMRAHQILLARVET
ALRPYDLSFSRYELLRLLAFSRSGALPITKASDRLQVHVTSVTHAIRRLE
ADRLVQRVPHPTDGRTTLVQITDLGRSTVEDATITLNKQVFADLGMSDAE
SQDLASSIETLRRNAGDF
379763857YP_005350254.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTEHVTVAFLGLGHMGGPMATNLVAANHAVRGFDPVPAALSAAAAAGVAA
FDTAVDAVAGADVVMTMLPNGELVKRCYAEILPAARPGALFIDSSTISVD
DAREVHALAESRGIAQLDAPVSGGVNGAVAGTLAFMVGGDDAALQRARPV
LEPMAGKIIHCGAAGAGQAAKVCNNMVLAVQQIAIGEAFVLAEKLGLSAQ
SLFDVITGATGNCWAVHTNCPVPGPVPTSPANNDFKPGFATALMNKDLGL
AMDAVSSSGSTAPLGRHAAEIYAEFAADHGDKDFSAIIETLR
379763856YP_005350253.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MFTLDDDERVITETAAAFAAKRLAPHALEWDAAKHFPTDVLRESAELGMA
AIYCREDVGGSGLRRLDGVRIFEQLAIADPTTAAFLSIHNMCAWMIDTFG
TAEQRKDWVPRLASMDVIASYCLTEPGAGSDASALSTRAVKEGGDYVLDG
VKQFISGAGASDVYVVMARTGGEGPRGISAFIVEKDSEGLSFGALEEKMG
WHAQPTAQVILEGVRVPADAMLGGADGEGAGFGIAMNGLNGGRLNIAACS
LGGAQAAADKAGAYVRDRQAFGKSLLDEPTIRFALADMATGLETSRMMLW
RAANALDTDDPDKVELCAMAKRYVTDTCFEVADKALQLHGGYGYLREYGL
EKIVRDLRVHRILEGTNEIMRVVIGRAEAARFRASPATA
379763855YP_005350252.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTTQIPHFIDGRRTAGQSGRTADVFDPSTGSVQAQVPMAGQADIDAAVAS
ALEAQKGWAATNPQRRARVMMRFIELVNKHNDELAELLSREHGKTLADAK
GDIQRGIEVIEFAIGIPHLLKGEYSEGAGPGIDVYSLRQPLGVVAGITPF
NFPAMIPLWKAGPALACGNAFVLKPSERDPSVPVRLAELFVEAGLPPGVF
QVVHGDKEAVDAILNHPDIQAVGFVGSSDIAQYIYAGAAATGKRSQCFGG
AKNHMIVMPDADLDQAVDALIGAGYGSAGERCMAISVAVPVGEQTADRLR
ARLIERINNLRVGHSLDPKADYGPLVTEAAVARVRDYIGQGVDAGAELVI
DGRERASDDLTFGDANLEGGFFIGPTLFDHVTPDMSIYTDEIFGPVLCIV
RAHDYEEALRLPSEHEYGNGVAIFTRDGDAARDFVSRVQVGMVGVNVPIP
VPVAYHTFGGWKRSGFGDLNQHGPSSILFYTKTKTVTSRWPSGIKDGAEF
VIPTMD
379763854YP_005350251.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MHTIEADYLVVGAGAMAMAFIDALVAEASAAQARVVVVDRNHAPGGHWTM
AYPFVRLHQPSAFYGVNSLPLGGDAIDQVGWNRGLYELATAGEICAYYDH
IMRRRLLPSGRVSYFPMSEYLGEHRGEARFRTLAGADYTVRVARRVVDAT
YMRVTVPAMRPPPYRVAPGIDCVPPGDLPRRGAHERYVIVGAGKTGIDTC
LWLLGQGVDPDRLTWIMPRDSWLLDRETMQPGALFAEKIKASFTAQLRAI
NDAASVRDLFDRLEEAGLLLRIDPAIRPAMYRCATVTRLELEQLRRITDV
VRMGHLRAIEADTMVLDRGAVAVSGRELYLDCTADGAEKRLATPIFDSNR
ITLQSVRGCQQIFSAALIAHVEAAYRDDSLKNELCVPLPHPDTDIDWLRL
AWADYSNQLRWFDDPDLMSWLSTARLDLFGHLIGHLLPSASAKPRVRDRI
LGIAKSVFSATATKLDELMAAEAALAAR
379763853YP_005350250.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAARSDPVGPRPLRAVPGAGHEAGYPDWEAVYSDNVGWVYRTLFARVGNR
TDAEDLTAEVFLAALRPLRLTVSVAEVRAYLRATARTVLAAHWRQTLGRE
ITSIEDIEQPADSEEAISTAPQRVARVLDALPDRYRLILESRFLRGNSIK
ESAAELGISVPNAKVLQHRALRLAAQVNDGGKQ
379763852YP_005350249.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MNARGLRRYVDDLLRGRRPRPFAPDDFEAAQLRTAIELRAARSGDDTPRP
EFLADLHRRIGEQMSGTPPRTPPGRTGTRRQVIVGTSAAATAAVAAVSLD
RAVISGRHRRPSAPDNAAGRLTPNEGSWQRVASSSDVPDGAMRAFDLGSV
TGFVRRIDGNVHAISGVCTHQGCKLWFDASEDTLRCPCHTTSFSPSGQVL
THQLPIAPKPLPELMVREVDGVIEVFAPGRRT
379763851YP_005350248.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MGMDIALRRRLLAAVLAASVISSPGCGRPRPVATTPAPTTGVSITAPTPA
AGANQVTIDGFAFAPPNLTVPAGTTVTWTNRDEEPHTVAASDGSFHSPGM
GTGATFAHTFSAPGTFDYVCSIHPMMRGTVVVTG
379763850YP_005350247.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTGRPGDDAMTRRQLLRHTAWFGAAVGLIVAGGEVISHVAGEAAAQRAHV
RPTLRFAQISDSHLGFNGAPNRDVAATFSDAIDKVNSLGYTPDFVIHTGD
LTHLSSTEQFDQAKQMMSGLKTHHVFTVPGEHDSVDDAGQKYRNTFGAGA
VGDGWYSFDIAGVHLIALVNTLNLRKLGHLGVDQLEFVKKDVAHLPSDTP
IIVFSHIPLFAMYPQWGWGTDDAAQALSYLRRFSSVTCLNGHVHQLFSKT
EDNVTFHSGTATAYPLPRPGDGPAPKPVTLPAGKLRDALGIREVGYTTGE
SALALKERALR
379763849YP_005350246.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MHDGRWPMTLGQAFNAGNNALNAWRLVLAAEVMLWHCWPITGRMPPAATL
QLLFSIGVDGFFAISGFLITRSWLDDPHVRDYLTARALRILPGYYACLIV
TAFAFAPLSVALQGGSVGELVCSGGPLEYVLKNSAVAYVHLDVGGTPSGI
PHSGLWNGSLWSLVWEVICYLAVAGVGLAGLAHHRWVSPAILVVATGLAT
AMPPMTFPGVWTIPQIAVRSAIMFAAGAVLYQWREVIPARWPLVGVSVVI
VLASSMLPDYRTVAALPLAYAIIVSGALLKSSRLRLRTDLSYGVYIYAFP
TQQLLAVCGLARLQPVAFFLVAAAATLPVAAASWFLIEKPSMALKRRLKR
KWSDATKAEGGHPATTAAG
379763848YP_005350245.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MKLGQVFDPRRNALNALRLALAAEVMLFHSWPITGHMPPKSTLQLFFSVG
VDGFFAISGFLITRSWLTDPRLRDYLTARALRILPGFYVCLIVTAFVFAP
LSLAIQGGSAAKLLGSTAPLEYVLKNSAIAYLQPTIDGTLHDLPGGNTWN
GSMWSLVWELLCYLFVAAIGLAGLGNRRWVSPVVLAVATLGALVLPPLTF
PGVWTIPQLAVRAAIMFAAGAVMYQWRDVIPARWSLVAVCLVIVAASGLL
PDYRVVGALPLAYAVVVSGSLLKSERLRLRTDLSYGVYIYAFPAQQLLAV
CGLATRLHPVLFFLASVTATLPLAAISWFVIEKPSMSLKRRLRVKWSAPV
PSSSDEAGPVSAANAVADRPATEAPGTA
379763847YP_005350244.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MKLGQVFDPRSNALNAWRLALAGEVIFWHTYPVRGHLPSVRAVLQLLLCV
GVDGFFAISGFLITASWISNPRLRAYLAARALRILPGFYVCMIVTAFVFA
PLSVAIQGGSAARLLFSFAPFEYVLKNIAVMWLKPDVGGTPHDIPNAGIW
NASLWSLFWEVMCYLVVAIIGVAGLANRRWVSPAILVVAAIGASMMPPVT
FPEVFNRPTGNVGIVIVFLACRAAIMFAAGALLYQWRDVIPARWSLVAVS
VVIVLLAGQLPDYRVVAAVPLAYAVVVSGSLLHNKRLRLRTDVSYGMYIY
AYPMQQLLAVLGLLSLNPFVFCLTVAAATLPLAAASWFLVEKPARSLKAR
IKRKAAGAREAAMVLPPEVTGAA
379763846YP_005350243.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MGSDVEVRELKVPGAWEITPAVHGDSRGHFFEWLTDKGFRSFAGHRLDVR
QANCSVSSAGVLRGLHFAQVPPSQAKYVTCVRGAVFDVVVDIRVGSPTFG
QWDSVLLDDTEHRTIYLSEGLGHGFLALQDNSTVMYLCSAEYNPQREHTI
CATDPALGIDWPLVDGAPPTLSDRDAAAPSLDDVRASGLLPTWEETNAFV
EGLRAKPTN
379763845YP_005350242.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MRLLVTGGAGFIGANFVHSTVREHPEDSVTVLDALTYAGRRESLAGVEDA
IELVVGDITDAELVSRLVAESDAVVHFAAESHVDNALEGPEPFLHTNVVG
TFTILEAVRRYGVRLHHISTDEVYGDLELDDPQRFTEATPYNPSSPYSAT
KAAADMLVRAWVRSYGVRATISNCSNNYGPYQHVEKFIPRQITNVLTGRR
PKLYGAGANVRDWIHVDDHNSAVRRILESGEIGRTYLISSEGERDNLTVL
RTLLQMMGREPDDFDHVTDRAGHDLRYAIDPSTLYDELCWAPKHTDFEEG
LRETIDWYRANESWWRPLKDASEARYEERGQ
379763844YP_005350241.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MIEGVSLKPDLGQFGVWLPTRSIEPELAAQIESLGYGAAWIGGSPDAELS
WVEPALARTTSLQLATGIVNIWSAPAAAVAESFRRIETHHPGRFLLGVGV
GHPEHTGEYVKPYDALVSYLDELDAALVPTSRRVVAALGPRVLRLAARRS
AGAHPYLTTPEHTAKARELLGGAVYLAPEHKVVLSTDAEQAREIGRQTVE
HYLGLSNYVNNWLRLGFTEADVRTPGSDRLIDAVVAHGTPEAIAGRLREH
LDAGADHVAIQVLGGYSEETLLPALTELAGALGLTAAN
379763843YP_005350240.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTDAASKPDLGRFGSFGRGVTPQQAKDIEALGYGAVWVGGSPPAELSWVE
PLLEATTTLQVGTGIVNIWTAAAKPVAESFHRIDKAYPGRFLLGIGVGHP
EAHTEYRKPYDALVDYLKQLDDYGVPANRRVVAALGPRVLKLSAERSAGA
HPYLTTPEHTARAREIIGPSAFLAPEHKAILTTDAEKARAVGRKALDVYF
NLANYRNNWKRLGFGEDEVTRPGSDRLVDAVVAYGTVDQIAARLTEHLEA
GADHVPVQVLTKDENLVSALAELAGPLGLNPS
379763842YP_005350239.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTGAESIKVPCEPDELRSLFLFEALTDEQLAVLCAAGHIETYEPGPICVE
GEPATCFYVLIEGELMMSKLSGGQDIETNRTSQRGVYCGAWRAFTGGKQK
SYDASVHVTRPSRFFVMDAPVFAQFMRDQFPMAVHLLDGIAVGTDRTRRI
IDNREKLLALGRLSAGLTHQLNNPAAAISRAASDLRERVASMRHKLAMLA
DGTVSPEALSALVRLQERVAEQVAKSASQHLSALETADREDAVGDWLEAH
GIDGGWDIAPTFVEGGIDTDWLERISAVSEELASTSAEQAIRWINYTIES
ELLMNQILEASKRISALVADAKQYSQLDRAPFQVTNVHELLRSTLVMFAD
RLTKDGGKNSHAIAVVKDFDQSLPEIPCYPGDLNQVWTNIIDNAIAAMRD
TGGTLTIRTCREGEHMARVEICDTGPGILEDVREHIFEPFFTTKPFGEGT
GLGLDLAFNIVVKKHRGDLRVESAPGDTRFIVLLPLQPPAADVAPDLDGP
EENVTTPE
379763841YP_005350238.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTNPSSQRKPVMLTVDDDPSVSRAVARDLRRHYGEDHRIVRAESGPDALG
TLKELKLRGETVALLIADYRMPQMSGIEFLEQAMDLYPAARRVLLTAYAD
THAAIDAINVVDLDHYLLKPWDPPEEKFYPVIDGLLDAWRAAPEHPVPHT
KVIGHRWSARSWQVRDFLARNGLYYTWFMADEPAGERLLNAAGEDGLRLP
VVVTQRGDTLVEPTDAQLAETLGLTTTPSQEFYDLIVVGGGPAGLAAAVY
GASEGLRTVLIEHIATGGQAGQSSRIENYLGFPDGVSGGQLADRARRQAE
KFGAELITARKATALEVNGSKRTVRFADGGSIDAHAVILATGVAYRQLDA
EGCAELTGCGIYYGAAVSIAAECEDEEVYVIGGANSAGQAAMYLSRTAKS
VNIVVRAPSLEASMSYYLIQQIEANPKINVLTCTEVQRATGDGHLEQLSL
VNNRTGETEDVTCGRMFIFIGAAPRTDWLDGVLARDDHGFILTGPDLRNV
CGWTLDRPPHQLETSVPGVFATGDVRSTSAKRVAAAVGEGSMAVMLVHRY
LAES
379763840YP_005350237.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAKKDGAIEVEGRVVEPLPNAMFRIELENGHKVLAHISGKMRQHYIRILP
EDRVVVELSPYDLSRGRIVYRYK
379763839YP_005350236.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MEIALTYIFGVGRTRSNEILEATGIDKNLRTRDLTDDQLTHLRDYIEANL
KVEGDLRREVQADIRRKIEIGCYQGLRHRRGLPVRGQRTKTNARTRKGPK
RTIAGKKKAR
379763838YP_005350235.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MPPAKKAASAPKKGQKTRRREKKNVPHGAAHIKSTFNNTIVTITDPQGNV
IAWASSGHVGFKGSRKSTPFAAQLAAENAARKAQEHGVKKVDVFVKGPGS
GRETAIRSLQAAGLEVGAISDVTPQPHNGVRPPKRRRV
379763837YP_005350234.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MARYTGPVTRKSRRLRTDLVGGDQAFEKRPYPPGQHGRARIKESEYLLQL
QEKQKARFTYGVMEKQFRRYYEEAVRQPGKTGEELLRILESRLDNVVYRA
GLARTRRMARQLVSHGHFSVNGVHVNVPSYRVSQYDIIDVRDSSLNTVPF
QIARETAGDRPIPSWLQVVGERQRILVHQLPERAQIDVPLTEQLIVEFYS
K
379763836YP_005350233.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MLISQRPTLSEEVLTDNRSQFVIEPLEPGFGYTLGNSLRRTLLSSIPGAA
VTSIRIDGVLHEFTTVPGVKEDVTAIILNLKSLVVSSEEDEPVTMYLRKQ
GPGEVTAGDIVPPAGVTVHNPDLHIATLNDKGKLEVELVVERGRGYVPAV
QNRASGAEIGRIPVDSIYSPVLKVTYKVDATRVEQRTDFDKLILDVETKS
SINPRDALASAGKTLVELFGLARELNVEAEGIEIGPSPAEADHIASFALP
IDDLDLTVRSYNCLKREGVHTVGELVSRTESDLLDIRNFGQKSIDEVKVK
LHQLGLSLKDSPASFDPSQVAGYDVATGTWSTEAAYDDQDYAETEQL
379763835YP_005350232.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MPKPTKGPRLGGSSSHQKALLANLATSLFEHGRIKTTEPKARALRPYAEK
LITHAKKGALHNRREVLKKIRDKDVVHTLFEEIGPFFADRNGGYTRIIKV
EPRKGDNAPMAVIELVREKTVTSEADRARRVKASKKSDAPVAAAAAPQAA
VEPEEAVGPTAEEATAEAGETKPETEASDEPTKAQAEAEDKADKAVAARA
EAEAAEKANDEADES
379763834YP_005350231.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAGVLDEALTTIFRTPVRLRAAGRTDAGVHATGQVAHVDVPAAALPNAYS
RAPHVGEAEFLPLLRRLGRFLPTDVRVVDIVRAPAGFDARFSALRRHYVY
RLSTAPWGVDPQQVRYVTAWPRPLDVEAMATASPDLLGLHDFAAFCRHRE
NATTIRDLQRLEWTREGDLITARVSADAFCWSMVRSLVGALLAVGEHRRP
VSWCRELLSATARSSDYATAPAHGLTLVGVDYPPDDQLAARNLITRDVRS
R
379763833YP_005350230.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MGGAFVNSLREQTRKSVGAYGVNYPADKDFLAAADGANDASSHIQRMAVN
CPNTKLVLGGYSQGAAVIDIVTAAPVSGFGFRRPLPPAAADHVAAVALFG
NPSGRAGNLMSALSPNFEGKTIDLCNPGDPICSGGLRWASHLSYVPGLTN
KAASFAAARV
379763832YP_005350229.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MKTHRAARLVGLGASALVTAAGLLAAPAATPVASADDCPDVEVIFARGTN
EPPGLGRVGDAFVDSLRQQTGGLNILPYGVNYAASKLQLHGGDGANDTID
RVKKSVEKCPSTKIVLGGYSQGASVMDIVAGVPIGGINWGNSLPPQYADN
IAAVATFGDVADRAGGTLPSQSKLLGSKAIDLCNPNDPICHAGPGNEWSG
HTEGYVPVYTTQAAAFVASRLVGAGQSVPGYGPSFPGAGPQVPGQPGYGQ
QTPVYGQTPPGSGPSIHGGTGTAPAPAPLAPGPVTSVPQAPLV
379763831YP_005350228.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MPRQPTTWLRVSAHRYLVRRTECALLGEAIYPTGPRARMPSASLAAGCVV
TVLALAGCALLGLLSPHVALDRAQIVMSRDSGALFVRVGDVWHPVPNLAS
ARLIAGSAADPQPIREADLERAKRGPLLGIPGAPQFVGRPLPAQELAFSM
CDSDDASSTTVVVGPVADNGVTRMPPGQAVLAAVSSGSPAYLLYDGHRAI
VDLEDAAVVRALRLEGHAPRLVSQALLNAMPEAPPISAPRIRGLGGAAPG
LPGFRVGSVLRVTRADGDEYYAVLADGVQRIGQVAADLMRFGSSQGTVSP
ITVAPAAIRAAPVVAELPVAGFPDRAPTLPEAAGTLCASWAGGRAGVALL
AGGRLPVPPGQAAVTLAQADGRGPALDAAYVPTGRSAYVRAGDKAGTRYL
IVDTGVRFAIPDDDAAHDLGLSEPTPAPWPILTLLPAGPELSRRGASIAR
DAVAGSP
379763830YP_005350227.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MFAVSALTMLAAFGTPPAQAVSPPGIDDKWLPQPALPAPTRPTVQREVCA
ALTRDSRPGRNQPPGAFDLSEVWRLTRGAGQRIAVIDTGVSRHRRLPDVV
PGGDYVSTGDGTQDCDAHGTLVAGIIAAAADSKSDGFSGIAPEATLISIR
QSSAKFAPATDRSRSGVGDVDTMAKAVRTAADLGASVINISSVACVPVAA
ALDDRALGAALAYAVDVKNAVVVAAAGNTGGAAQCPPQRPDATWQTITVA
VSPAWYDDYVLTVGSVNAEGAPSGFSLAGPWVDVAAPGEAVASLAPDPVS
GTSYAVPVVSGLAALIRARFPALTARQVMQRIESTAHHPPAGWDPLVGNG
TIDPLAAVSTGTGPPATTPKPPPAAAPAAVSPPTTRSRDTRARDTAVRGA
AVCLVALTVALAAGAVRSRLRGARDRVPGD
379763829YP_005350226.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MFARIRPKGPPLAASDTGLCRVRVHWGTAVADLVLPAGVPVAVLIPSLID
ALGVRPADQEAVRYQVSIPGASALNPSTTLAQNRIGDGAVLVLSTPSVPL
PAPRYVDIAREVAATLEGPARLRGGAATRRVTRLCGATAAVVLTAVGGLT
LVRNTFSDSHPRDEGMTGAALGSAALVALGLAAVAHRAYRDPIAGLALSV
IAIVFAAVAGFVMVPGGPSVSNVLLAAAAAAVTAVLAMRLSGCGVVALTA
AACFAAAVAAAALVGAITAAPVHVIASASAVLSLGLLGAAPRMSIALAGL
SPRFATADFAVPGPSDSRVPAQAIRADRWLVSLRAGLSSSAGVGAALTVL
AGAPRLSCMAFGTVTAALFLLRCRSGAGAGLLSFAIGGTLIAATTFGVTV
LRMQMPGPLLAAATALAAAAMYLGFAATPSSPVALRCVEVLEWLAWSALV
PLACWISGLYGAVRGLHLT
379763828YP_005350225.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTEMLVPEAQQAPIVVEAPPDLPPPAGPGLLPRLLPVAISVVSIGIMAAA
FASGTAMARTPVFLAFPLMMLVSALASGLTGRAHRRGDGIDADRGRYLDY
LSRLSQSVSEVAMAQRACAIRRHPHPDTLWTLIGGARMWQRGPGDADFCV
VRLGTGPQPLARRLVAPELAAEELRDPVTDTALRRFLHAYSTVVAPVPID
LRDGSLVTIDGDARAARGLLRAMICQLAVQHAPDQVRIAAAVSEPHRAHW
EWLKWLPHNQHPGDSDAAGPVRMVYSDAAQVQGALAGVAATRVVVVAELD
EGPTALGGATTIAIGGGNDGAPLTIRRSGEAAPVSCPDRMEPVDALVCAL
RLAGHRGRAGGGDPGWPGLVGLRDVHRFDPATLWRGQARRDRLRVPIGTT
MQGAPLELDIKEPAEGGMGPHGLCIGATGSGKSELLRTIALGMMVRNSPL
TLNLLLIDFKGGATFLDYARAPHVAAVITNLADDAPLVSRMRDALAGEMN
RRQQLLRTAGCVSVEAYEGARRSGDPPEPLPALPTLFIIVDEFSELLSQQ
PDFADTFVAIGRLGRSLGMHLLLASQRLDEGRLRGLEAHLSYRLCLKTLS
AAESRTVLGNLDAYELPAAPGAGFLRIGGGEPIRFQAASVSGPLRTDASP
DKAPAAARSTQAFTTRVTGAVRRTHRANMTSPPAIYHAVLDRLRGQGPPA
HRVWLPPLGPAPQLHTLLHSAEPTPAGLTAVPIGLVDRPFEQRRTPLMID
LSGAAGNAAIVGGPQSGKSTALRTLITALAATHDASQVQFYCLDFGGGTL
SSVRSLPHVGAVPGRAESRLVGRIVAECESVVRRREAIFGEHAIGSIADY
RRRAAAGVANDDPFGDVFLVIDGWATVRQEFEALEASITALATHGLSFGV
HVVLSASRWADVRPSLRDQLGTRVELRLGDPADSELDRKAAAHVPHDSPG
RGLSRDGLHMVVARPVAEVLAGHSVAPPIPLLPDHVDRETLVRGSGAELR
AQVLLGLRERELRPAAIDFDGQPHLVILGDSACGKTATLRTLCRELVRTK
TAAQAQLLIVDFRRTLLGVVESEHLRGYAMSPAALAALLPDVLALLSARM
PPPDASQAELRSRSWWSGPQIYVVVDDYDLVATPTENPLGPIAEFLPYAQ
DLGLHLVVARRGAGAERAMFEPVLAGLRDLGCMSLMMSGSPSEGAPFGRA
RPAQLPPGRGLLTNRTGDEDLVQVAWSPP
379763827YP_005350224.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSEHRPIIEAGPGTIRRLCCGTGPIDEGETADVIRSALDAIDDRVALVGE
RPVTVDALWEAALRAATCGTADGMVVVHPSWWSSSRVGVVTAAAARVAGA
VRTRPRSWLLTRASRAEPTVAVEIAERLVAVTASEITAVPRNADPQSVAE
AVADVIAGAAPAAVVIDTPSTVAGASPLAASIIHGLRGSGPSAPSVLEIN
HIRFTRLARASFPVRPLPSGARPTARPSRVRALGTLGAAAIVVAAAAPAA
MAPDRRGVVPPTRVEATPTTFLVEGRVALSVPATWPARRVVTGPGSARVQ
VTSPADPEVALHITQSPVAGETLSGTAERLKRAIDVEPAGLFVDFNPSGT
SAGRSAVTYREVRPGHEVRWTVLLDGPLRISVGCQSRPGDEGGVRDACEQ
AVRSAHAIG
379763826YP_005350223.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAAPNPLSADVDLMRSVAGTTDARNEEIRAMLQAFIGRMSGVPPSAWGGP
AATRFKDVIDRWNAESVRLYHALHTIADTIRQNAATLQEAGQSHADRIAA
AGGNL
379763825YP_005350222.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MDSVLSYNFGEIEYSVRQEIHSTSARFNAALDELRAHIAPLQQLWTSEAA
AAYQAEQLKWHQSATALNEMLAALGNAVRDGADEVANADRRAAGVWAR
379763824YP_005350221.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MPTYTPKAGDTTRSWHVIDATDVVLGRLAVAAANLLRGKHKPTFTPNVDG
GDFVIVINADKVAFSGQKLDKKLAYRHSGYPGGLSSRTIRELMAKHPDRV
VEDAIVGMLPKNKLARQIARKLHVYAGPTHPHVAQQPVPYEIKQVAQ
379763823YP_005350220.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTETTEGLENPENPDNPETAEETVAAAEVTEAPVEASEPADVAAPAEPYV
FERPIQTVGRRKEAVVRVRLVPGTGQFNLNGRTLEGYFPNKVHQQLIKAP
LVTVDRVESFDVYAHLHGGGPSGQAGALRLGIARALIVASPDDRPALKKA
GFLTRDPRATERKKYGLKKARKAPQYSKR
379763822YP_005350219.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MGRLFGTDGVRGVANRELTAELALALGSAAARRLASASAPGRRVAVIGRD
PRASGEMLEAAVIAGLTSQGVDALRVGVLPTPAVAYLTGAYDADFGVMIS
ASHNPMPDNGIKIFGPGGRKLDDGTEDQIEALVGDPGPRPVGTGIGRVVD
AEDAADRYLRHLSKASTLRLDGLTVVVDCAHGAASAVGPRAYRAAGARVI
AINAEPNGLNINDNCGSTHLDSLRAAVVVHRADLGLAHDGDADRCLAIDA
DGNLVDGDHIMVVLALAMHEAGELSSRTLVTTVMSNLGLHLAMRSAGITV
RTTGVGDRYVVEELRAGDYSLGGEQSGHIVMPALGSTGDGIVTGLRLMNR
MAQTGSSLAHLASAMQTLPQVLINVTVADKTTAAAAPSVQSAVGQAEAEL
GDTGRILLRPSGTEPMIRVMVEAPEKEIAARIATRVAEAVSAAH
379763821YP_005350218.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MKFVGGTRPVAAARAQIDASATHRVANQFAMAAEFLDRAVSDHLARLAFG
GACAGRAHAARGDALRVELGRLTQQVTQWSRASSEIAAALRSSAQRYADA
ELYAAARIA
379763820YP_005350217.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MADRLDVDARLAEGRVAVEHTQTYVQASHALGYQHPDLTAHPAQIREWYA
SEDGLDLRALDRDCAELRAAGVVAAEALRMQRAQVAELAVAWQGAGGDAA
VQLLQRHCDSADAVVGELRAAAQRCESLRDNLWHLVDSKVATAIAVDDRA
QAQRPAWLAAAAAVTAGDRRGAEDVVRHQVIPYVDNDIRNDWLAAMRSAS
DGVQTSYAMVIDRAAAAPAARFEFPGDLGAGAVPVQLAPPVAAASAPRVD
RPRGDGGGRGAGAGRPPAGSAGAGRGLG
379763819YP_005350216.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MGDLGGLGGGGLGDGLGSGGLGGGGGGLLGLAARIVDAMGDLLGSAGDGS
DGAAALGDSADGNAFDENPFHAEDPTDAKGAEDAGDAEDAGDTAEGSGPA
EPVDGEAGQPDPTEPEQQAQPVETPPPADPAPAEPPAPAAAPAAEPAPAA
GEGSTPCEIAADQLPQAGQ
379763818YP_005350215.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MRIGIALNYSGGFHEAVDRVVELEKSGIEVAVVAEAYSFDAISQLGYLAA
KTNTVELASGVLPLYIRTPSLLAMTAAGLDFVSDGRFRLGIGTSGPQVIE
GFHGVPFDAPLGRTREIVEICRKVWRRERVQYAGKHYQLPLPADRGTGLG
KPLQLINHPVRERIPISIAALGPKNVELTAEIAEGWQPVFYLPDKAASIW
GEPLAAGAAKRDPALGPLDVMVHASLAIGDNVDERLAWVKPQLGLYIGGM
GAKGRNFYHNLATRYGYGEVADRIQELYLSGRKQEAIDAVPDELVRGMSL
IGPRGYVAERMAAFAEAGVTTLLLSPQATDRDESMRFVEEALQLQP
379763817YP_005350214.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSSAHALYARWITELWNGRPVAAELVTDDFVGHWPGREVQGPDALAQIIE
QTRNMFSDLSFGIEVGPLTEGDLVAGRWVGTGHGPDGPVSFTGNDILRLA
ADGRRFAEYWTGTSAG
379763816YP_005350213.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MARIRKLVAALHRRGPHRVLRGDLAFAGLPGVVYTPEEGLNLPGVAFGHE
WLAGAARYSNLLEHLASWGIVAGAPDTQRGVAPSVLNFAFDLGTALDIVS
GVRLGPGKISVHPAKLGVVGHGFGGSAAVFAAAGMPAKLAAVAAIFPSVT
SPPAQQPAATLKVPGVIFTAPGDRTTLNSNALALAEAWKPATLRIVSKAE
PGGLVEGRRLATVLGLPGPHRRTQRSVRALLTGYLLYTLGGDKKYRDFAD
PDVHLPGTDAIDPEAEAIPLEEKIVALLK
379763815YP_005350212.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTAVRYDEVVPAPSAPAPGHAARPRRHPSAGSGNALMDLTTHVLTATLHQ
LYAALWRAGVIEVTA
379763814YP_005350211.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MVRPPTCRKACPGTATGTASGGRPGPIRPVPSHSCHRHNRREFFHLMCAR
RFRSRHRGRA
379763813YP_005350210.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MCGIVGYVGQQPACDVVMAALRRMEYRGYDSSGIALANGDGTLTVSRRAG
RLANLEEAVAQMPRHSLTGTTGLGHTRWATHGRPTDRNAHPHRDAAGKIA
VVHNGIIENYANLRHELEAQGVEFASDTDTEVAVHLVAQAYRHGETAGDF
PASVLAVLRRLDGHFTLVFANADDPGTIVAARRSTPLVLGIGDGEMFVGS
DVAAFIPHTRNAVELGQDQAVVITADGYRITDFDGNDDVEYREFHIDWDL
AAAEKGGYEYFMLKEIAEQPAAVADTLLGHFVDGRIVLDEQRLSDQELRE
IDKVFVVACGTAYHSGLLAKYAIEHWTRLPVEVELSSEFRYRDPVLDRST
LVVAISQSGETADTLEAVRHAKEQKAKVLAICNTNGSQIPRECDAVLYTR
AGPEIGVASTKTFLAQITANYLVGLALAQARGTKYPDEVAREYHELEAMP
DVVARVLATIKPVAALAYQFAQSPTVLFLGRHVGYPVALEGALKLKELAY
MHAEGFAAGELKHGPIALIEDDLPVIVVMPSPKGSAVLHAKLLSNIREIQ
ARGAITIVIAEEGDDTVRPYADHLIEIPSVSTLLQPLLSTIPLQVFAASV
AQARGYDVDKPRNLAKSVTVE
379763812YP_005350209.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MRSGGIRYVVVGLVVLIVAAYIVSIMMYAQGDAVRRLDGITPVVSADEPS
ATINVEEIQSNYSVLAVNLAFNPGSALLDPKTHHLKEDLSLRVRSSAMPS
RHTWTKGMLPGLMSVPLTIAGQIERWPFDQYRSGLIEVEIFYGPDTDRAP
AHVPVTFVDHLSGWQLTATRPQADGPYRLQLRRSLSTAAFAIVILGVLIT
IASLAVFVAVQTARDRRPFQPPMTTWYAAMLFAVVPLRNALPGSPPFGSW
VDITVVIWVLVALVASMVLYIGCWWRHLTPPAPAAAPPAEVPAPSGS
379763811YP_005350208.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MRSMTLAVWHFVSTAPLTYGWLLVLMVTTIIQNHLTGRQLHSVLLHRSTN
IHELGKDPLHVLFSSLLWIDGKSFEPHLLLFTLFLAPAEHWLGQLRWLSV
GLSSHILATYISEGILYFAIEERDASQRLVHARDIGVSYFLVGVMAVLTY
HIARPWRWGYLGVLFVIFGFPLITMDRVDLDFTAIGHFASILIGLCFYPM
TRTRSRRSRQVSPARLKAMARRSVPPS
379763810YP_005350207.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MRHYYSVDAIRQAEAPLLASLPDGALMRRAAYGLAAEIIGELAARTGGVS
GRRVCAVVGSGDNGGDALWAATFVRRRGAAADAILLNPERTHRKGLAAFR
RAGGRIVESVSPATDLVIDGVVGISGSGSLRPAAAEVFAAVDDAGIPVVA
VDIPSGIDAATGATSGPAVRAVLTVTFGGLKPVHALGECGRVRLIDIGLD
LPDTDVLGFEATDVAARWPVPGPHDDKYTQGVTGVMAGSSTYPGAAVLCT
GAAVAATSGMVRYAGSAHREVLAHWPEVIASPTPASAGRVQSWVVGPGLG
TDDAGAAALWFALDTELPVIVDADGLTILAAHPELVAKRGAPTVLTPHAG
EFARLAGNPPGDDRVGACRKLADAFGATVLLKGNVTVVADPGGPVYLSPA
GQSWAATAGSGDVLSGMIGALLAAGLPPGEAAAAAAFVHARAAASSAADP
GPGDAPTSASRMVPHIRAALAAL
379763809YP_005350206.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MPQHPSLPAHSIAPAYTGRLFTAPVPALRMPDESMDPDAAYRFIHDELML
DGSSRLNLATFVTTWMDPEAGKLMAETFDKNMIDKDEYPATAAIEQRCVC
MVADLFHADGLNDADPYSACGVSTIGSSEAVMLGGLAMKWRWRAKIGKDW
KGRTPNLVMGSNVQVVWEKFCRYFDVEPRYLPMEEGRYVITPEQVVDAVD
ENTIGVVAILGTTYTGELEPVADICGALDKLAAGGGVDVPVHVDAASGGF
VVPFLHPELKWDFRLPRVVSINVSGHKYGLTYPGVGFVVWRSKEYLPDDL
VFRVNYLGGDMPTFTLNFSRPGNQVVGQYYNFLRLGREGYTKVMQALSGT
ARWLGEQLRVSEHCELVSDGSAIPVVAFRLSKDRGYTEFDVSHELRTYGW
QVPAYTMPDNATNVSVLRIVVREGLSADLARALHDDAVSALSSLDKLRPG
GHYADQHFAH
379763808YP_005350205.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MELLRRSRRNLANKSTLGGGWRGSGTMAPMTGRAATPISLTPGLLAEALV
DLGAIAHNVRLLCEQAGGAQVMAVVKADGYGHGAAQTARAALAAGAAELG
VATVDEALALRADGVRAPVLAWLHPPGFDFAPALLADVQIAVSSERQLDE
LLDAVRRTGRTATVTVKVDTGLNRNGVPPEHYPSMLTALRRAVAENAIVL
RGLMSHMVYADQPANPVNDLQAQRFTEMLAQARDQGVRYEAAHLSNSSAT
MSRPDLAFDMVRPGIAVYGLSPVPERGDMGLIPAMTVKCPVALVKSIRAG
ESVSYGHTWTARRDTTLALLPVGYADGVFRSLGNRLEVLINGRRRPGVGR
ICMDQFVVDLGPGPTDVAEGDEAILFGPGASGEPTAQDWADLLGTIHYEV
VTSPRGRITRTYREARTIEP
379763807YP_005350204.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSPDGTRRRYRGRAWLAGGAGLTAIATIIGASARRSITQRATVEDPYAHE
DFNRLEDDRSLVVTTPDGVPLAVRDAGPADAPLTLVFVHGFCLQMGAFHF
QRTRLPDQLGPDVRMVFYDQRGHGRSGEAEPETYTLTQLGRDLQTVLNAV
VPRGMIVLVGHSMGGMTVLSHARQFPEQYGRRIVGAALISSAAEGVARSP
LGEILKNPALEAVRVAARSAPNLMHRGRNVSRSLIGPVLRAASYSDLQVS
RSLDAFSQRMMNSTPIPTMVGFLDALEKHDETAGLWTLLRVPTLIACGDH
DLLTPDEYSRKMAASLPRSELVIVVGASHLALLDKPEAINGGLVRLVRRA
TPTKAALRLRRIRERLWRRG
379763806YP_005350203.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MGKGEGTATCERVEDTIALGTRLGEQLRAGDVVVLSGPLGAGKTVLAKGI
AAAMDVDGPVTSPSYVLARVHPPRREGAPTMIHVDMYRLLDHTDNQGADL
LGELDSLDLDSDLDDAVVVVEWGEGLVERLAERHLDIRLERLSGSDVRIA
TWQWADRPERGHRAGGEAHP
379763805YP_005350202.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSIVLALDTSTPAVTAGIVRREDLCALAQRVTVDARAHAERLTPNVLAAL
ADAGLTMVDLDAVVVGCGPGPFTGLRAGMATAAAYGHALGIPVHGVCSLD
AIGVHTTGDALVVTDARRREVYWARYRDGVRTGGPGVDAPADVDLGGAQA
VAGSPDHAAMFGLPVCGPAHPTPAGLVAAVGDWRDDPAPLVALYLRRPDA
KPLAARQ
379763804YP_005350201.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MIAEPVTVGALTRADAQRCAELEAQLFDGDDPWPAAAFNRELASAHNHYV
GARVGGTLVGYAGISRLGRTPPYEHEVHTIGVDPAYQGQGIGRRLLDELL
TFADGGVVYLEVRTDNEAAIALYRSVGFEQIGVRRSYYRVSGADAYTMRR
EAL
379763803YP_005350200.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTTILAIETSCDETGVGIARLDTDGTVTLLADEVASSVDEHVRFGGVVPE
IASRAHLEALGPAMRRALAAAGLDRPDIVAATIGPGLAGALLVGVAAAKA
YSAAWGVPFYAVNHLGGHLAADVYEHGSLPECVALLVSGGHTHLLHVRSL
GEPIVELGSTVDDAAGEAYDKVARLLGLGYPGGRVLDELARTGDRDAIAF
PRGMTGPRDDPYAFSFSGLKTAVARHLESHPDAVNADVAAGFQEAVADVL
TRKAVRAATDLGVSTLLIAGGVAANSRLRELAEQRCAAGGLTLRIPRPRL
CTDNGAMIASFAAHLVAAGAPPSPLDVPSDPGLPVVKAQVG
379763802YP_005350199.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAKVNIKPLEDKILVQANEAETTTASGLVIPDTAKEKPQEGTVVAVGPGR
WDEDGEKRIPLDVSEGDTVIYSKYGGTEIKYNGEEYLILSARDVLAVVSK
379763801YP_005350198.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSKIIEYDETARRAIEAGVNTLADAVRVTLGPRGRHVVLAKAFGGPAVTN
DGVTVAREIDLEDPFENLGAQLVKSVATKTNDVAGDGTTTATVLAQALVK
GGLRLVAAGANPIELGAGISKAADAVSEALLASATPVSGKEAIAQVATVS
SRDQLLGELVGEAMTKVGTDGVVSVEESSTLSTELEFTEGVGFDKGFLSA
YFVTDFDAQQAVLDDPVILLHQEKISSLPDLLPMLEKVAESGKPLLIIAE
DIEGEPLATLVVNSIRKTLKAVAVKAPFFGDRRKAFLEDLAIVTGGQVIN
PDAGLLLREVGTDVLGSARRVVVSKDDTVIVDGGGAKDAVANRIKQLRAE
IESTDSDWDREKLQERLAKLAGGVAVIQVGAATETALKERKESVEDAVAA
AKAAVEEGIVAGGGSALLQTRKALQQLRGSLTGDQALGVDVFSEALAAPL
YWIATNAGLDGAVAVHKVTELPNGHGLNADKLTYGDLIADGVIDPVKVTR
SAVLNAASVARMVLTTETAVVDKPAEEADDHGHGHGHHHH
379763800YP_005350197.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MNSQGRLVPRILLTLVLTLSAAGCGSGTSDSSKTTTATTASTASGAPTQR
ILSEKALTEALLGVQDLPAGYSQDPPSDRSVDKTFCDYKPAFQEKSYVKR
DFTKGGGLSAEFLKVGLRQYADADQARASFKSLTDALATCTGETYNGSNL
TYAPMSAPKVAAGSVGVKITADGASLLSFFAVDGPVLINTGGGGLVNANA
DEVIKTLESQVKKYEALAKS
379763799YP_005350196.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MVAKIVSSTTLLLRQHAPEQITTNLIAEKAGVSKGSIYQYFADKEQIINA
AIERLAAEQAPAIEDMLRGITLDRPESAMESSIDILIDYTIANRRLIRYL
AERPDHVRTFDKVSGLNATLLAMTTLHMNHYRSQYRDELSPSALAWLFFN
MAVATTMRYIESDDPIRLDELRAGLKFASAGLLAAGRTEP
379763798YP_005350195.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTASPEVDVRRHSEDQQDAEEIELVPPESLTAEHTGRWTFLILEGAAFMM
QAMHPVIAEITGRYSAAFHGDPGGRAIRSVDSVLRWTYGGTEARAEGDRV
RAMHQPITMKSAETGRQISALNPEAYQWVIATGYIVNAQAGRLLIGREFT
EAEKEELLRDNRRLARLLHVPMRGYPESQQEMADYFEAMIDTLRGTPQAL
QLMEDMKTGRVDVPPSLPKALAPLVRAAVLPALRLNYLSVVGLLDPRLRE
KLGVTWSPKEERQLIRVYTAIRTAYRVLPDRLTYFPLAYHARKHHQCLEK
MKQRQEKSFAYHLR
379763797YP_005350194.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MKPLADFFRDTVGARIAVAAVLGVAVALGVGNTVGWRFALAGWIVTAGVY
VVWTRLILGGMDADQTREYATREDPTRWASDAVIVSASVASLGGVGYVVA
AASRSGPGAVEAAVVGILTVAASWFAVHTLFTVHYARLYYSDEPGGINFH
DPEPPRFRDFAYVAFTVGMTYQVSDTEIGLTSIRATVLRQALLSYLLGAV
VLAVTINLIAGLGAKF
379763796YP_005350193.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MQTALFTLGLVLFLLGLLTGLAVPALKNGRMGLSSHLEALLNGMFLVLLG
LLWPHIHLPHAWGIAAVALIVYAAYANWLTTLLAAAWGAGRRFAPIAAGD
FEASTAKESFVSFGLVSLSLAILVGVGIVIVGVLVGR
379763795YP_005350192.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MNKGASFAVAALTATLAPLAACANQQGSQPNTSPLTSPAPGAERLTTQLK
TADGIPVANATFEFANGYATVTVEAGPNQVLSPGFHGLQIHSVGKCEGDF
DSAGSVYQAADHTGYPASGDLTALQVRSDGSAKLVTTSNSFTAADLRSSS
GSALILHQSVDNLGGGPTAESNKRIACGVIAAASATTTSSTTSVTTSTST
STVVVPPPSTSTSTSTVTVTSTPTTTSAPTTTVTTPPSLPPGTR
379763794YP_005350191.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MNAYDVLFEHHRVLRGLCERISAIPPEADERQAALAELLFELDIHMRIED
DLFYPAVAAASALVAIAHAEHRQVWDQLAVLLRTAPTAPNYQDEWSSFVR
VLDAHASEEERDLCPAPIDLSEDLLESLGNQMVERMARLRQSRLNRLRVR
GRAALLSSL
379763793YP_005350190.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MFAAAGRHRDRISNFLHGTWLGHPLHPALTSIPMGALTTTVAMDAVSVLP
RRAAQLHDASRFALGVGLAGSVGAAATGLTDWQHTHEQSRRIGLVHGALN
AIATGLYAVSWWDRRGGRHRRGMAASALGYGLTLGAGYLGGTLVFASGTG
VDRSGARLSGDRWTPVLAVASLDGQPRRVEVAGVGVVLYRNEGRVLAVGE
HCPHLGAPMNDGWIDRDRIVCPWHGSRFACESGEVLRGPATAALPRYPVR
IRDGLVEVRGVKR
379763792YP_005350189.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTTIQRIRMTPQDYTRLHDELAGLRSRRGAEVPDDLMDYNPNRRARQSVW
RARICEIEGLLSHAVVVGEGAAFDPVAEAGMVLTIRYDDTGETETLLLGR
PCPEAAGIKAYSMASPLGRAIAGARPGDQRFYAIPGGTGRSVTVLRALPY
EMHAAKSLGPQVVLR
379763791YP_005350188.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MPAEKAKSLFTQRDSAHVPDKQIHRWEGEGGAEYLPRSHRRPEY
379763790YP_005350187.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MFFHPDGERGRARMQREQRAKEMCRQCPVIQECRSHALEVGEPYGVWGGL
SESERDLLLKGDIGRGIRRSA
379763789YP_005350186.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MADAAFGDGPGDWPLPSATTPAQLWLRAVAAGGQGRYGAAQRDLAALRRA
APAGRLASLGMSTQGSFLRQLGWHTVARRWDGRALALAGADPEAGADALI
GLAADALGVGRFAAAAALLARADPLLASPDPKTPVPDRIPVRRRWVAAEL
AMARGEGDVAVRHAGEAVELAAAMSVPSARHRVKSEVVLAAALCSAGNIE
RARAVADAALQTTGRLGLLPLRWALACLLIDIESVTFSAQQLHEIRDVCA
GQVRHAGGTWRSA
379763788YP_005350185.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MVAKAVTGDHGALREVLETIRPIVVRYCRARVGTVDRGGLSADDVAQEVC
LATITALPRYRDRGRPFLAFLYGIAAHKVADAHRAAGRDLAYPTESIPER
WSPDAGPEQLAIEADSVSRMSELLEILPAKQREILILRVVVGLSAEETAA
AVGSTTGAVRVAQHRALSRLKSEMIAAGDCA
379763787YP_005350184.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MPESLDEFARTDLLLDALAQRRPVSVEDPDVDVLTTMLEDWRDNLRWPPA
SALVTPEEAVNALRKGLVERRRGRRGLTAIASVAAALIALSGFGAMVVEA
RPGTPLHGLHAMFFDQPRVHEKQEMLAAKADLAKVQESIDRGEWEQAKNQ
LTDVSSLVQSIDDPVAKRELMNQLKLLNAKVESRNPNATLPSSAATPGAP
NQ
379763786YP_005350183.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MRDHLPPGLPPDPFADDPCDPSAALEAVEPGQPLDQQERMAVEADLADLA
VYEALLAHKGIRGLVVCCDECQQDHYHDWDMLRANLLQLLIDGTVRPHEP
AYDPEPDAYVTWDYCRGYADASLNEATSDADGFHRRH
379763785YP_005350182.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MRVGGLVDDPVPTGGDNPHKIAMLGLTFDDVLLLPAASDVVPATADTSSQ
LTKKIRLKVPLVSSAMDTVTESRMAIAMARAGGMGVLHRNLPVAEQAGQV
EMVKRSEAGMVTDPVTCRPDNTLAQVDALCARFRISGLPVVDESGALVGI
ITNRDMRFEVDQTKKVAEVMTKAPLITAQEGVSADAALGLLRRHKIEKLP
IVDGHGRLTGLITVKDFVKTEQHPLATKDSDGRLLVGAAVGVGGDAWVRA
MMLVDAGVDVLIVDTAHAHNRLVLDMVGKLKAEAGDRVEVIGGNVATRSA
AAALVAAGADAVKVGVGPGSICTTRVVAGVGAPQITAILEAVAACGPAGV
PVIADGGLQYSGDIAKALAAGASTAMLGSLLAGTAEAPGELIFVNGKQFK
SYRGMGSLGAMAGRGSGTGKSYSKDRYFADDALSEDKLVPEGIEGRVPFR
GPLSSVIHQLTGGLRAAMGYTGSSTIEELQQAQFVRITAAGLRESHPHDV
AMTVEAPNYYAR
379763784YP_005350181.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MVEIGMGRTARRSYELSEVSIVASRRTRSSQDVSTAWQLDAYRFEIPVLA
HPTDALVSPEFAIELGRLGGLGVLNGEGLIGRHADVEAKIAQLVEAASKE
PEPSAAIRLLQEFHAAPLNPDLLGSAVARIREAGVTTAVRVSPQNAQALT
PVLLQAGIDLLVIQGTIVSAERVASDGEPLNLKTFISELDVPVVAGGVQD
HRTALHLMRTGAAGVIVGYGATRGVTTSDEVLGISVPMATAIADAAAARR
EYLDETGGRYVHVLADGDIHTSGELAKAIACGADAVVLGTPLAESAEALG
EGWFWPAAAAHPSLPRGALLQIAVGERPPLRQVLGGPSDDPFGSLNLVGG
LRRSMAKAGYCDLKEFQKVGLTVGS
379763783YP_005350180.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MKPDYDVLIIGSGFGGSVSALRLTEKGYRVGVLEAGRRFADEDFAETSWD
LRKFLWAPKLGCYGIQRIHPLRNVLILAGAGVGGGSLNYANTLYVPPAPF
FKDQQWSHITDWRDELMPHYDQARRMLGVVENPTFTDADRVVKEVADDMG
CGDTFVPTPVGVFFGPDGTKAPGKTVPDPYFGGAGPERTGCLECGCCMTG
CRYGAKNTLLKNYLYLAESGGAQVIPMTTVKRFEQRPDGLWEVRTVRTGS
WLRRDRRTYTAKHLILAAGTWGTQHLLFKMRDEGRLPRLSNRLGVLTRTN
SESIVGAGRLEVSPDLDLTHGVAITSSIHPTPDTHIEPVRYGKGSNAMGL
LQTLMTDGPGPEGTDVPRWKQLLDTAREDPRGMLRLLNPRQWSERTMIAL
VMQHLDNSITTFTKRGKLGIRWYTSKQGHGEPNPTWIPVGNEVTRRIAAK
IDGVAGGTWGELLNIPLTAHFLGGAVIGDNADHGVIDPYHRVYGYPTLYV
VDGAAISANLGVNPSLSITAQAERAASLWPNNGENDRRPAQGEPYRRLDP
IAPAHPRVPLSAPGALRWSPVDPVSSVG
379763782YP_005350179.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTAQITVTKLGSRIGARIDGVSLGGHLDDAAVETIRRALLTHKVVFFRHQ
HHLDDEQQLDFARLLGTPIGHPAASALAAKHMPVITPIDSEYGKATRWHT
DVTFAANYPAASILRAVTLPSYGGSTLWASTVAAYQHLPEPLKHLVENLW
ALHTNRYDYVSTEAVMSMSDAQRAFRQAFEKPDFRTEHPVVRVHPETGER
ALLAGDFVRGFVGLDNHESSVLLELLQRRITMPENTIRWAWAPGDVAMWD
NRATQHRAIDDYDDQPRLMHRITLMGDVPVNVHGERSRVVSGTPLEVLAS
379763781YP_005350178.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAAAILEAATELFAERGPAATSIRDIAARAGVNHGLVFRHFGTKEQLVGA
VLDHLGDDLSAQLETDTPAEVVQRSLDRQMRVMARTVLDGYPAGQLQKRF
PNIATLLDGVRPLYDDEVKARLAVANALALQFGWRLFAPVLRSATGIEEL
TDAELRAAVGAEVERMLGPADTQ
379763780YP_005350177.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MITDASFPVDPWHVRETQLDLNLLAQSESLFTLSNGHIGLRGNLDEGEPY
GLPGTYLNSFYEIRPLPYAEAGYGYPEAGQTLIDVTNGKIIRLLVEDEPF
DVRYGELISHVRNLDLRAGTLTRTAHWRSPAGKEVKVVSTRLVSLPHRGL
AAIEYVVEAVGDFVRVTVQSELVANEDQPQTSGDPRVSAILENPLEEVDH
ENTDTGAVLMHRTRSSALMMAAGMDHEVEVPGRVEVSTDARADLARTTVI
CGLREGQKLRIVKYLAYGWSSMRSRPALRDQVAAALHGGRYSGWQGLLDS
QREYLDDFWDCADVEVDGDPESQQAVRFGLFHLLQASARAERRAIAAKGL
TGTGYDGHAFWDTEGYVLPVLTYTAPHTVADALRWRASTLDLAKERAAEL
GLEGASFPWRTIRGQECSAYWPAGTAAWHINADIAMAFERYRVVTGDNDL
EADCGLQVLVETARLWLSLGHHDRHGVWHLDGVTGPDEYTAIVRDNAFTN
LMAAHNLHTAADACNRHPEAAKALGVTTEEAAAWRDAADAANLPYDAGLE
VHQQCQGFTTFAEWDFDKNTTYPLLLHEAYVRLYPAQVIKQADLVLAMHW
RSHAFTPEQKARNVDYYEPRMVRDSSLSACTQAVMCAEVGHLDLAHDYAY
EAALIDLRDLHHNTRDGLHMASLAGAWTALVSGFGGLRDDEGMLSLDPAL
PDGISRLRFRLRWRDFRVTIDVNHVDVTYTLRDGPGGELTIRHAGEDLEL
STESPTTVAVRPRKPLLPPPQQPLGRAPMHRRVLSRPH
379763779YP_005350176.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MRACLFDLDGVLTDTASVHTKAWKAMFDAYLSDRAQRTGDEFVPFDAAAD
YRKYVDGKKREDGVRSFLESRGIELPDGSPDDPDDAETVYGLGNRKNDMF
QKVLKQDGVKVFDGSRRYLEAASAAGLGIAVVSSSANTRDVLEVTGLDRF
VQKRVDGITLRQEHIAGKPAPDSYLRGAQLLDVPAEAAAVFEDALSGVAA
GRAGNFGFVIGVDRVGQAEDLRRNGADVVVSDLAELLQS
379763778YP_005350175.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTAPVWMASPPEVHSALLSSGPGPASLFAAAAAWSSMSAEYASAAEELGA
LLTSTQAGAWQGPSAESYVAAHAPYLAWLTQASAHSAAAAAQHEAAGTAY
TAALAAMPTLPELTTNHVVHGALVATNFFGINTIPIAVNEADYARMWVQA
AGTMATYEAVSTATVAAVPPTDPAPPILKSEATAQHDHEEDDDHHDHEHG
FDSPLNQFVAQILRLFGLDWDPVEGTLNGLPYEAYTNPGDLMWWVVRALE
LFSDFQQFGALLQENPAAAFEFITQLVLLDWPTHLAQLASWLPTQPQLLL
LPMLVAAAPFGALAGFAGLAAPAPPAAPAAVPAAPAPAAPPSLPAAPAMS
PVTAPAAAAAPAPAPAPAPSAATVASPAPPAPPAAGTVPFVPPYALAPPG
IGFGSGMSAGAAAGAKKKAPEPDSAAAVAAAAAREAARTRRRRRARQRAH
GDEFMDMNVDVDPDWNEPETTASHGGAANLGFAGTARKEPVAAAGLTTLA
ADEFGDAPRMPMVPGTWPPGDGKGAPGSGG
379763777YP_005350174.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MLVVDFGAQYAQLIARRVREARVFSEVIPHTATAEDIKARDPLALVLSGG
PSSVYADGAPQLDPALFDLGVPVFGICYGFQAMAQALGGTVAHTGTSEYG
RTELKVLGGELHSGLPSVQPVWMSHGDAVTAAPDGFEVVASSAGAAVAGF
ENRARRLAGVQYHPEVMHSPHGQQVLSRFLHDFAGLGADWTAANIAEALV
EQVRAQIGDGHAICGLSGGVDSAVAAALVQRAIGDRLTCVFVDHGLLREG
ERAQVQRDFVAATGANLVTVDAADTFLDALAGVTNPEGKRKIIGRHFIRA
FEGAVRDIVGDNASDGSGVEFLVQGTLYPDVVESGGGSGTANIKSHHNVG
GLPGDLTFKLVEPLRLLFKDEVRAVGRELGLPEEIVARQPFPGPGLGIRI
VGEVTAERLETLRRADSIAREELTAAGLDTLIWQCPVVLLGDVRSVGVQG
DNRTYGHPIVLRPVTSEDAMTADWTRVPYEVLERISTRITNEVAEVNRVV
LDITSKPPGTIEWE
379763776YP_005350173.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MPGAAAAGRLAWFSVDGVGVAAEKITPENTISHTGTERIKQPLTLLDGCQ
RAGVYFEHTFERPVKEARS
379763775YP_005350172.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MASISSKKAGPTVPDDLLDSESQLALPQWLADLLPAPLPRGTVAVLSGAR
SLLLSMVAAVTAAGGNAAIVGQPDIGLLAAAEMGADLSRLAVIPDPGTDP
VEVAAVLVDGMDLVVLGLGGRRVPPTRARAVVARARSKGCTLLVTGGDWQ
GAPTRLAARVCGYEITPHWGMPAPGFGRISGVRLQVSGMCAGRRVMAQAR
AG
379763774YP_005350171.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MDWPAVAAAAAADLSASVPVAVTLANRVVACSSAARAVGVRRGLRRREAA
ARCPQLHVTTADADRDARFFEAVIAAVDDLVPRAEVLRPGLLVLPVRGAA
RYFGSEAVAAERLIDAVAAAGAECQVGIADQLSTAVFAARAGRVVEPGGD
ARFLSVLSIRQLATEPSLSGPGREELTDLLWRMGIRTIGQFAALSRSDVA
SRFGADGVTAHRLARGEPERPPSGREPPAELEAVLDCDPPIDRVDAAAFA
GRSLAGTLHQALMAAGVGCTRLAIHAVTANGEERHRVWRCAEPLTEDATA
DRVRWQLDGWLSNRTARDPRPTAAVTLLRLQAVEVVSAEALQLPLWGGLG
EEDRLRARRALVRVQGLLGPEAVRVPVLSGGRGPAERITLIPLGDEPVPR
ADPDLPWPGRLPAPSPAVLLDDPVELLDTQGNPIRVTNRGLFSADPARMI
SQGRDERLCWWAGPWPVDERWWDDRPVGGQGAGQGSGRTARAQILLESER
ALLLCYRQRRWYLEGSYE
379763773YP_005350170.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAFADYQKELYDQSLHGNQPQYPIRFEDLEEKAAAAMAPKVLQYVAGGAG
DEHTQRANCAAFKRWGLYPRMGIAPEERDMSVELFGMRFPSPIFMAPIGV
IGVCDPEGHGDMLCARASVRTGVPFFVGTLTSDPMEDIAAELGDSPAFFQ
LYTPPDRKMAASLVHRAEAAGFKAIAVTLDTWVTGWRPRDLSGGNYPQVP
SGCLANYTSDPVFRSRLSRGEDATEAAVRKLPIFGGPFRWDDLEWLRAET
DLPLMVKGVCHPDDVRRAKDIGVDGIYCSNHGGRQANGGLPCLDCLPDVL
EAADGLPVLFDSGVRSGADIIKALALGATAVGIGRPYAYGLALGGVEGVV
HVLRSLLAEADLIMAVDGYPSLKDLTPEALRPIYS
379763772YP_005350169.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAELVTGKTLPNVVVTGIAMTTALATDAESTWKLLLDRQSGIRKLEDSFV
EEFDLPVRIGGHLLEDFDGGLTRAERHRMGYLQMMSTVLGRRVWENAGSP
EVDSNRLMVSVGTGLGSAEQIVFSYDDLRARGMKGVSPLAVSKYMPNGAA
AAVGLERHAKAGVITPVSACASGSEGVAQAWRNIVFGEADIAICGGVEVR
IEAVAIAAFAQMRIVMSTKNDDPVGACRPFDRDRTGFVFGEAGALMVIET
EEHAKARGANILARIMGASITSDGYHMVAPDPNGERAGHAMSRAIQLAGL
SPSDIHHVNAHATGTSVGDVAEGRAINNALGPHGGNAAVYAPKAALGHSV
GAVGAVESILTVLALRDQVVPPTLNLENLDPEIDLDVVAGKPRPGNYEYA
INNSFGFGGHNVATVFGRY
379763771YP_005350168.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MKFRAIELIRAGWGGVLLAAPAEVLSHIHGVRVDRKAIVVTRILGARHLV
QAALSGVDPGPEELAAGVWVDTVHSATALGLALVDRRRARGGVTDAVVAA
SWAFLGWRHLRTGQARTGALRGRDRLARAVLRALPGGRALVAQAQAVRAD
379763770YP_005350167.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MNAPVFVDVDTGVDDALALIYLFASPDAEVVGIASTGGNVGVEQVCENNL
GLLRLCEVTGIPVSRGSDQTLTGPMCLPSKVHGPRGLGYAELPPGGDGLT
DYDSADAWVRAAKAHPGELIGVATGPLTNLALALRAEPTLPSLLRRLVIM
GGSYDHRGNTTTVAEWNISVDPEAAAEVLAAWGQETVGHQRLPILCGLDL
TRKVAMTPEHLARLAAAAGSTTTPLSEHDERATRSTASNPLIRVIEDATR
FYLEAYHDLGHGYQAHMHDPLAAAVALDPGLVNTRPATVDIELTGTLTRA
MTVTDWSGRREPNALIGIDVDAAGFFDRFIERVGPFARRLADTP
379763769YP_005350166.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MPTTSEPPEGTELTPHFDDVQAHYDLSDDFFRLFLDPTQTYSCAYFERED
MTLEEAQIAKIDLALGKLGLQPGMTLLDVGCGWGATMMRAVEKYDVNVVG
LTLSRNQAEHVERLIAQSKSPRSARILLQGWEEFDEPVDRIVSIGAFEHF
GHERYDAFFTMAHDLLPDDGVMLLHTITGLHPTEMVERGMPISFTFARFI
KFIVTEIFPGGRLPSIPMVQERATANGFTVSRIQSLQPHYAKTLDIWAAA
LQAHKEQAIAVQSEEVYERYMKYLTGCADAFRVGYVDVNQFTLEK
379763768YP_005350165.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSRLLESRPDAQVWVLVRRRSLGRFERLAARWGDRVKPLVAELPELDLSD
EVLAELGEIDHVVHCAAIYDITAGEPEQRAANVEGTRAVIGLARRLGATM
HHVSSIAVAGDFRGEYTEDDFDVGQQLPTPYHQTKFEAELLVRSTPGLRH
RIYRPAVVVGDSRTGEMDKVDGPYYFFGVLAKLAVLPSLTPILLPDTGRT
NIVPVDYVVDALVALLHADGRDGQTFHLTAEKTIGLRGIYRGVAKAAGLP
PLRGSLPRSVAAPVLNVRGRARVLRNMAATQLGIPAEVFDLVDLPPTFVS
EKTRNALRDYGIRVPEFSSYAPKLWRYWAEHLDPDRARRDDPRGPLHGRH
VIITGASSGIGRASAIAIAERGATVFALARNGAALDELVAEIRANGGAAH
AFTCDVTDSASVEHTVKDILGRFDHVDYLVNNAGRSIRRSVVNSTDRLHD
YERVMAVNYFGAVRMVLALLPHWRERRFGHVVNVSSAGVQARNPKYSSYL
PTKAALDAFSDVVGSEVLSDHITFTNIHMPLVRTPMIVPSHRLNPVRAIS
PERAAAMVVRGLVDKPARIDTPLGTLAEAGNYFVPRTSRRILHQLYLGYP
DSAAARGLAPAAQAPPPAVRRKPNRPVRAVTGGLRTPRGVKRLVRRVPGV
HW
379763767YP_005350164.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSKRSLFRKASVAVAALTATVIVAGCGGSPQARSITVTFVRHAQSEANAA
GTIDTDVPGPGLTPEGKGQAEEIAHQLGRKDYDSVYASTMTRTQQTAAPL
AAELGKQVEILPGIQEINAGWYNGKPESMAKSTYLVAPVNWIKGDVSYSI
PGSISGKEFNDQFTAAVNKVYYSGHRNPVVFSHANAIMVWTLMNTRNGKE
SLMNTHPLPNTGRVVITGNPMTGWTLVDWDGIRDFHS
379763766YP_005350163.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAIDPSAVGAVTEPMTFEWTDRDTLLYALGVGAGIDDLAFTTENSHDIDQ
QVLPTYAVICCPAFGAAGLVGKFNWAMLLHGSQSIRLHAPLPPAGKLSVV
SEVADIQDKGEGKNAILVLRGRGTDPQSGQLIAETLTTLVIRGEGGFGGM
PGQRPVAPEFPDREPDARIALPTREDQALIYRLSGDRNPLHSDPWFAREL
AGFPKPILHGLCTYGVSGRALVAELGGGVAANITSIASRFTSPVFPGETL
TTLIWRTGEGKAVFRTEASGAEGSGVRVVLDDGAVEYA
379763765YP_005350162.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MPVIIDPRRHDAVLFDLETDLGSTLAARLRDVGVGTAVVPADGPARAAAD
LKVRPGRAVVVAGAAAGVEAARAAGFASVIGVGPAKSAGALRDAGADAVV
SDLGEVGVRTGDLRMSQLPDAMRALTDAADGLAGRRPAVFFDFDGTLSDI
VDDPDAARPVAGATEALAKLADGCPVAVLSGRDLADVTNRVGVPGIWYAG
SHGFELTAPDGTHHQNDAAAAAIPVLEQAAARLRDQLGGIPGVVVEHKRF
GVAVHYRNAERDRVGEVLAAVRAAGRRDALRVTTGREVIELRPDLDWDKG
KTLRWVIDHLHRAGSGSLTPVYLGDDITDEDAFDAVHDDGVPILVRHSDD
GDRATAALFALDSPARAAAFTDRLADQLEA
379763764YP_005350161.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MGWFNGPPSWAEMERVLDSKPRRAGEPAGLPEDAPLSRKRATYRPPGDGR
APRPSVGRSVPYAELHAHSAFSFLDGASTPEELVEEAARLGLRALALTDH
DGLYGAVRFAEAAAELDMRTVFGAELSLGGEARTERPDPAGPHLLVLARG
PEGYRRLSRQLAAAHLAGGEKGKPRYDFDALTEAAGGHWHILTGCRKGHV
RQALSDGGSDAAERALADLVDRFGAQRVSVELTHHGQPLDDERNAVLAAL
APRFGVGVVATTGAHFAGPSRRRLAMAMGAIRARESLDSAAGWLAPLGGS
HLRSGAEMARLFAGGPDVVTAAAELGEQCAFGLALIAPQLPPFDVPDGHT
EDSWLRQLTMAGARDRYGPNAPRAYAQIEHELKVIAQLQFPGYFLVVHDI
ARFCRDNNILCQGRGSAANSAVCYALGVTAVDPVANELLFERFLSPARDG
PPDIDMDIESDQREKVIQYVYDKYGRDYAAQVANVITYRGKIAVRDMARA
LGFSQGQQDAWSKQISHWGGLADSPEVEDIPEPVIDLANQIRNLPRHMGI
HSGGMVICDRPIADVCPVEWARMENRSVLQWDKDDCAAIGLVKFDLLGLG
MLSALHYAIDLVAEHKGIEVDLARLDLSEPAVYEMLARADSVGVFQVESR
AQMATLPRLKPRVFYDLVVEVALIRPGPIQGGSVHPYIRRRNGEDPVVYD
HPSMEPALRKTLGVPLFQEQLMQLAVDCAGFSAAEADQLRRAMGSKRSTE
RMRRLRGRFYEGMRALHGAPDEVIDRTYEKLEAFANFGFPESHALSFASL
VFYSSWFKLHHPAAFCAALLRAQPMGFYSPQSLVADARRHGVTVHGPDVN
ASLAHATLENTGTEVRLGLGAVRHIGDDLAEQLVEERKANGPFASLLDVT
SRLQLSVPQTEALATAGAFACFGMSRREGLWAAGAAATQRPGRLPGVGSS
SHVPALPGMSELELAAADVWATGISPDSYPTQFLREDLDAMGVVPAEKLG
SVPDGDRVLIAGAVTHRQRPGTAQGVTFLNLEDETGMVNVLCAPGVWARH
RKLANSAPALLVRGQVQNASGAITVVAERLGRITLAVGSKSRDFR
379763763YP_005350160.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTINLSVDEVLTTTRSVRKRLDFDKPVSRDVLRECLELALQAPTGSNAQG
WQWVFVEDAEKKKAIADVYLANARGYLSAPGAAYPDGDTRGERMGAVRDS
ATYLAEHMHEAPVLLIPCLEGRPDKSPLGGVSFWASLFPAVWSFCLALRS
RGLGSCWTTLHLLRDGEQQVADIVGIPRDRYSQGGLFPIAYTKGTDFRPA
KRLPAEQVTHWNSW
379763762YP_005350159.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MIAAVSFAPAGSQHGMATFITIGYGDAAGYHRVSDECRQAAHARDDALRA
AGALIGTAGHPVQVRNPDGAGVRIEPGPYLHSALPIAGFAVLEADNLDAA
IERVSQTPCAVAHGVVEVWPLMSWPT
379763761YP_005350158.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MFKLMFYSPRIAPNTGNAIRTAAATGCELHLVEPMGFDLSEPKLRRAGLD
YHDLASVTVHASLAAAWDALSPERVFAFTSHAPTSFAQVRYRAGDVLMFG
PEPTGLDAATLADPHITGQVRIPMLAGRRSLNLSNAAAVAVYEAWRQHGY
AGAT
379763760YP_005350157.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MVEQSIWMQKVAADPGHSHWYIERFRAMARAGDDLAGEARFVDAMAPRGA
RILDAGCGPGRLGGYLAGAGHRVVGVDVDPALIAAAEQDHPGPRWLVGDL
AELDLPARGIADPFDVIVSAGNVMTFLAPSTRVRVLSRLRAHVAGDGRAA
IGFGAGRDYDFDVFLNDAVDAGFAIDVLLSTWDLRPFTDDSDFLVAILRP
A
379763759YP_005350156.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTMFARPAGAAEADAAPPAPVPGADAAAKRPPAWSLSNWPVGWKVLAIVL
VPLILVTVFGVLRIDTAMDSAARLKLAATRADVVPVITKYMSALDVALQA
GSAGRDVEGAKKNYEARKGELQGRLADTDVTDDVRSGVNTLLDAGQMLVS
KASDSGLGLRERVTLYAPILLTAEDVINASVRVDDEHIRAQAQGLSRAVG
ARGQMTMQKILITRGAELPEPQLRTSMATLAGTEPSTLFGMSEVLGAGSP
EAKTLQQQMVARMAIMSDPASVLVDNADLLRSVQATDDIADQVIKNVTAS
VTKAVHAQAADRRSAAILDTVLVLAAIVIALVVVLLVARALVRPLRILRD
GALKVAHTDLEEEVARVKAGGAEPIPTPLPVYTTEEIGQVAHAVDELHTQ
ALLLAGDEARLRLLVNDMFETMSRRSRSLVDQQLALIDRLERNEENPERL
DSLFRLDHLAARLRRNSANLLVLAGAQLARDQRDPVPLATVINAAVSEVE
DYRRVEIAGLPECALVGAAAGGAIHLFAELIDNALRYSPPTTSVRVSASR
GGDGGVVVRIADSGLGMNDADRRIANMRLQAGGDVSPDNARHMGLFVVGR
IAGRHGIRVGLRGPAANETGTGTTAEIYLPPTVLTGLAAAESAAPRHIRA
VSSPSAKLASAIAAPPPADDARRHDGTREPAARNAPPAPGPSVTLLPRRN
PGSSGITDVPTPPAEPPPPRRRRELATPWWENAPQAAPAARPEAAPKPPP
QPTPAPEPAPEPAPAPPVRAASDTSAFFAARPREPRQDKPADPATDDDVI
YRRMLSEMLGDPHDLVNSPDLDWQSVWDRGWTLAAAAEDKPVESHTTDHG
LPVRTPGARLVPGGANATGLAERDEPEHGQNGRSHREPQHAAVTRDPEAV
RASFSNHFGGVRSGRSHARDTEQGPDEQ
379763758YP_005350155.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTSPDNSLDWLVTRFAREVPGVAHALLVSVDGLPIAASEHLPRERADQLA
AVASGLASLATGAAQLFEGGQVLQSVVEMANGYLLLMRVGDGSHLATLAV
TSCDIGQIGYEMAVLVERVGGVVQSTRRSAAHS
379763757YP_005350154.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MDTPESWPAHRKGNLVRPYTLTSGRTDTNVELPLEAPLQTLQPGAPHRYP
PNDARGRIIQLCGQGPPSPSVAEISARLDLPLGVARVLVGDLVLSGYLRV
HRTLSERSTRDERHELIGRTLRGLRAL
379763756YP_005350153.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MQQDSGAHASTKIVIAGGFGAGKTTFVGAVSEIMPLRTEAMLTDASTGVD
ALEATPDKRTTTVAMDFGRITLAEDLVLYLFGTPGQRRFWFMWDDLVRGA
IGAVVLVDCRRLQDSFAAVDFFEHRNLPFLVAVNEFDGAPRYPVAEVREA
LTLPPHIPVITVDARDRRSATDALIAVSEYALATLTPN
379763755YP_005350152.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSEEWVDREFDGHDFTDEDLSRLRTERTVFTECNFSGANLAESQHRGSAF
RNCSFHRTSLWHSSFAQCSMLGSVFVQCRLRPITFDEVDFTLAVLAGIDL
RGVDFSGCRLREASLVEADLRKAVLRGADLRGARTAGARLDGADLRGTTA
DPGLWTTASLAGARVDVDQAVAFALAHGLRLDGGPHDDG
379763754YP_005350151.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTRPAQPLLTARSEHSQGSFTAGRDVVVGNDLRADLRVAHPLIARAHLLL
RFDRGRWLAVDNNTLNGVYLDGRRVPVVDIRDGQSINIGKPDGPRITFEL
GRPPARSFRRRDAGRTAPQPPADAGEFPTTRVAVAGPEGDRRPVTGRAAW
IGRALDNDIVIHDVLASRRHAFLTPTPAGPEIRDANSSNGTFVNGVRVTS
AALSEGDVVTIGNVDLVLRGGALVRLQEAATRAGGLEVREVNFAIGDKRL
LERISLTARPGTLTALIGGSGAGKTTLSRLIAGYATPTSGSVTFEGHDIH
TEYASLRTRIGMVPQDDVVHRQLTVSQALGYAAELRLPPDTSKADRGRVV
AEVLDELGLTEHANTRVDRLSGGQRKRASVALELLTGPSLLILDEPTSGL
DPALDLQVMTMLRQLADAGRVVLVVTHSLTYLDVCDQVLLMAPGGKTAFL
GPPARIGPAMGTTNWAHIFAKVGADPDEANRRFLAQNRPPPPRRTQAPAE
LGAPPRTSKRHQFSTIARRQVRLVVSDRAYFVFLAVLPFVMGALSLTVPG
SAGFGYADPAGESAGEAGMILTLLTMAAAFMGTALTIRDLIGERPIFRRE
QAVGLSTTAYLLAKVAVFCGFAVAQAAIATAIVVLGKGPPTRPAVLLGPS
SSAATVELFVAVAATCVAAAMLGLLLSALARTGEQVMPMLVVSLMMQMVL
CGGMVPVTDRILLDQASWLMPSRWGYAAQGSTVDLWAVSPGPQSPRDSHF
QHAPAAWLLDMGMLAALSVGYGALVRWRIRLAR
379763753YP_005350150.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MVVGRDLRADMRITHPLISRAHLLLRFDQGKWLAIDNGSLNGTFVNGRRV
PVVEIHDGQTLNIGNPDGPLLTFDVGRHQGMAGRPPKTESMNIPVAAPPQ
PAAWSAQPGPPVAAPPGPPPPPAGRTPNWAAPPRRPQPAPRPGPAGQTMY
GAGGGRPPAYPPAAPPPPHNSPLQAPVHSPPPAQHIPAPTRAAPANAKPP
EVANLATKMFQALRPSRSGAIQKPAGSQTIGRATDNDIVIQDVLASRHHA
FLIQTPLGTEIRDAHSVNGTFVNGVRVGSAVLTEGDVVTIGNVDLVFTGD
GLVRRTEAATRTGGLEVNSVCYTVDHGKQLLDHISLTARPGTLTAIIGGS
GAGKTTLSRLIVGYTSPTSGTVTFEGHNIHTEYASMRSRIGMVPQDDVVH
RQLTVNQALNYAAELRLPPDTSKEERARVVAQVLEELDMTQHAETRVDKL
SGGQRKRASVALELLTQPSLLLLDEPTSGLDPALDRQVMLMLRQLADAGR
VVLVVTHSVSYLDVCDQILLVAPGGKTAFCGPPDQVEAAMGTRNWADIFA
KVGADPDEANRRFKERNQQSSQPPTPQSPADLGEPPQTNLWRQLSTIARR
QVRLVVSDRGYTIFLAILPFLIGALSLTVKGPHPGLGPADPMGPAPTQPQ
YIMVLLNIGAVFMGTALTIRDLIGERAIFKREQAVGLSTTAYLLAKIAVF
CVFATGQAAIATIIVRLGKGAPTAHPQFFGNSTFSLFVTVAGTCVASAML
GLLLSALAQSNEQIMPLLVVSIMSQLVFSSGMIPVYQRIGLEQLAWLTPA
RWGYAAGASSIDFPSLVKVKQIPTNDPIWQHSKHIFVFDMAMLALLSIAY
TGIVRWHIRLKR
379763752YP_005350149.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSTPPDVFSPAKLGPITLRNRTIKSATFEARTPEALVTDDLIEYHRLPAA
GGVGMTTVAYCAVSPGGRTEGNGIWMRPEAVPGFRRLTDAIHAEGAAVSA
QIGHAGPVANAKSNKAKALAPVRFFNPIGMRFAKKATREDIDDVIEGHAN
AARLAIEAGFDAVEIHLGHNYLASSFLSPLINRRDDEFGGSLQNRAKVAR
GMVMAVRRAVEKEGTPIAVTAKLNMADGVRGGISTDESLTTAKWLEEDGG
LDAIELTAGSSLVNPMYLFRGDAPLKQFAGAFKPPLRWGMRMTGKKFLRE
YPYREAYLLRDAKLFRAELKMPLILLGGITNRETMDLAMAEGFEFVAMAR
ALLAEPDLINRIAAEDAQHRVHSACTHCNQCMPTIYSRTHCVVTGAPDAA
AAPR
379763751YP_005350148.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MGAITLDGKATRDEIFVDLKQRVAVLTASGRTPGLGTILVGDDPGSQAYV
RGKHADCAKVGITSIRRDLPADISTATLNETIDELNANPDCTGYIVQLPL
PKHLDENAALERVDPNKDADGLHPTNLGRLVLNNPAPLPCTPRGIVHLLR
RYDVEIAGAHVVVIGRGVTVGRPLGLLLTRRSENATVTLCHTGTRDLQAL
TKQADIIVAAVGVPHLLTADMVRPGAAVLDVGVSRTDDGLVGDVHPDVWD
VAGHVSPNPGGVGPLTRAFLLTNVVELAERE
379763750YP_005350147.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTARTVLRAQWPILLVGLIFAAALVLVGANFWRRGSLLIGIGVGVAALLR
LVLSEERAGLLVVRGKGIDFITTAAVGAAMDYIAWTIDPLGTV
379763749YP_005350146.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MRQQPLTIRLLAAAAGLLTVASAFAAPAEAEGNGDDFIDALNHAGIDFGE
PGNAMAVGESICPMLAQPGGSFAGAASSISGRGMSPQMASMFTTIAIQTY
CPQEMANIASGNLSGAMPQVPGMPGQIPGMGGQIPGMGGQIPGMGGQVPG
MTGQIPGMAGQMPGQIPALPSY
379763748YP_005350145.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSSTGLPDVDAVFDALDAEVDRACALVLDALTVQQQLAVLERCERLRRRI
PVIEYPLLNSLARQVPSQDLGGGLSHALTERTLISRHEASRRIQEARDLG
PRHGLTGEPLPPALAATAAAQRAGDLGAGQVAVIRKFYHQLPGWVSAAAR
EFAEAQLAGFGTQFGPEHLKELARGLTDALNPDGTFTDEDRARSRGVTLG
NQQADGMSELRGLITPELRATFEAVEAKLGAPGMCNPLDDIPCVEGTPSQ
AAIDGDTRSKAQRGHDALLAGLRGLLASGELGQHNGLPASIIVTTTLAEL
EAAAGRALTGGGTILPMSEVIRLGRHAHHYLAIFDKGKALALYHTKRLAS
PGQRIVLYAKDRGCTAPGCTVSGYYCEVHHTTDYATCHSTDINDLTFACG
PHHRMLDPGGWTTRKNAKGETEWKPPPHLERNRPRTNTFHHPEKLLRDDD
DDGW
379763747YP_005350144.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MEQRLSLITLGVADLDRARRFYERLGWHGQVVQETVFFQAGGIAVSLWAR
EKLSADLGIADQGDDGFGGIALAHNVRSRAEVDEILAAATDAGATITRAA
AETFYGGYAGAFRDPDGHAWEIAHNPGFALADDGAITVPDFSEA
379763746YP_005350143.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTRSRHDRSLSFGSAAAAYERGRPSYPPEAIDWLLPVGARQVLDLGAGTG
KLTTRLVERGLDVVAVDPIPDMLEVLRTSLPETRALLGTAEEIPLEDNSV
DVVLVAQAWHWVDPERAIPEVARVLRPGGRLGLVWNTRDERLGWVRELGR
IIGSDGDGGRTQVQLPEPFTDLAQHRVEWTSYLTPQALIDLVASRSYCIT
SPTEVRSRTLDEVRQLLATHPALANATGLALPYITMCTRATLAG
379763745YP_005350142.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTIPDAPTQTLPDEGEIGFVHIGSLTTESGAVIDDVHIAVQRWGELSPTR
DNVVVVLHALTGDSHVTGPAGPGHPTGGWWDGMVGPGAPIDTDRWCAVAT
NVLGGCRGSTGPSSRTRDGKPWGSRFPRISIRDQVEADIAALAALGIDEV
AAVVGGSMGGARALEWMVGHPDRVRSGLLLAVGARATADQIGTQSTQIAV
IEADPNWQGGDYHDTGLAPDTGLAIARRFAHLTYRGEVDLDTRFANDAQG
DEDPAAGGRYAVQSYLEYQGDKLLERFDAGSYVVLTEALNTHDVGRGRGG
VAKALRGCPVPAVVGGITSDRLYPLRLQEELAEHLPGCTALQVVDSLCGH
DGFLVESDAVGELIRKTLVLAGADSREGTSQR
379763744YP_005350141.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSSDSSSSNGTTSENTDPTAHWSFETKQVHAGQQPDPATNARALPIYQTT
SYVFDDTTHAAALFGLEVPGNIYTRIGNPTTDVVEQRIAALEGGVAALFL
SSGQAAATFAILNIACAGDHIVSSPRLYGGTYNLFHYSLAKLGIEVSFVE
DPDDLDSWRAAARPNTKAFFAETISNPQIDILDIPGVGGVAHDTGVPLIV
DNTIATPYLIQPLKHGADIVVHSATKYLGGHGSAIAGVVVDGGTFDWTQG
RFPGFTTPDPSYHGVVFAELGPPAYALKARVQLLRDLGSAAAPFNAFLVA
QGIETLSLRVERHVANAQRVAEFLSGHDGVLSVNYAGLPSSPWHERAKKL
APKGTGAVLSFELAGGIEAGKAFVNALKLHSHVANIGDVRSLVIHPASTT
HAQLSPQEQLSTGVSPGLVRLAVGIEGIDDILADLELGFAAAAKFGATAG
ASGTDPHAVAAF
379763743YP_005350140.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSAEKPTVIYTLTDEAPLLATYAFLPIVRAFAEPAGIEIKTSDISVAARI
LAEFPEHLTEEQRVPDNLAELGRLTKLADTNIIKLPNISASVPQLIAAVK
ELQGKGFKIPDFPQSPKTDEDKEIRDRYAKCLGSAVNPVLRQGNSDRRAP
KAVKEYARKHPHSMAPWSPASRTHVATMRGGDFYHGEKSMTLDRARNVKM
ELETESGETIVLKPMVSLRNADVIDSMFMSKKALVEFYEEQMQDAYETGV
MFSLHVKATMMKVSHPIVFGHAVKIFYKEAFAKHQELFDELGVDVNNGLV
DLYSKIESLPASLHEEIIRDLHACHEHRPELAMVDSAKGITNFHSPSDVI
VDASMPAMIRAGGKMWGADGRQKDTKAVNPESTFSRIYQEIINFCKTHGQ
FDPTTMGTVPNVGLMAQQAEEYGSHDKTFEIPEGGVANIVDLDTGEVLLT
QNVEAGDIWRMPIVRDEAIRDWVKLAVTRARNSGMTVVFWLDTERPHEVE
LRKKVKEYLKEHDTEGLDINIMPQVWAMRYTLERAMRGQDTIAATGNILR
DYLTDLFPILELGTSAKMLSIVPLMAGGGMYETGAGGSAPKHVHQLVEEN
HLRWDSLGEFLALGACFEDIGIKTDNERAKLLGKTLDAAIGKLLDNNKSP
SRKTGELDNRGSQFYLALYWAQELAAQNDDEDLRERFAALADSLAENEDT
IVGELAEVQGESVDIGGYYYPDSEKTTAVMRPSKTFNEVLAAAQG
379763742YP_005350139.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSSPGSKEAKIKVKGRVVELDGDEMTRVIWKLIKDQLILPHLDIDLDYYD
LGIEHRDRTDDQVTIDAAYAIKKHGVGVKCATITPDEARVSEFNLKKMWL
SPNGTIRNILGGTIFREPIVISNVPRLVPGWTKPIVIGRHAFGDQYRATN
FKVDKPGTVAITFTPADGSEPMVHEMVSLPDDGGVVMGMYNFKDSVRDFA
RASFKYGLNAKWPVYLSTKNTILKAYDGMFKDEFQRIYDEEFKEQFEAEG
LTYEHRLIDDMVAACLKWEGGYVWACKNYDGDVQSDAIAQGYGSLGLMTS
VLMTADGKTVEAEAAHGTVTRHFRQYQAGKPTSTNPIASIFAWTRGLAHR
GKLDDTPEVVEFAQTLENVVVSTVESGKMTKDLAILIGPDQEWQQSEEFL
DSIAENLEKELAS
379763741YP_005350138.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MLLHGFLMSQTVWDPVAPRLADTGRYEVFAPTMAGHNGGPYAGTWLLSSS
VLADHVERQLDQLGWESAHLVGNSLGGWVAFELERRGRARSVTGVGAAGG
WTRWSPVKFEVISKFIAGMPILGLARLLGPRALRLPLSRRLATLPLSATP
EGVSDEQLRGVVDDAAHCPAYFQLLIKSLLQPGLLELAQTAVPVQLVLCE
KDRVVPPSRFSRHFTDFLPEGTKITKLDGVGHVPMFEAPERITAAIADFI
DECTAGPDRLSDRHRPPAS
379763740YP_005350137.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSTATGSSRIFSGVQPTSDSLHLGNALGAVTHWVELQDDHDAFFCVVDLH
AITVAQDPEALRRRTLVTAAQYLALGIDPARSTVFVQSHVPAHSQLAWVL
GCFTGFGQASRMTQFKDKSLRQGADSTTVGLFTYPVLQAADVLAYDTDLV
PVGEDQRQHLELARDVAQRFNARFPDTFVVPDVLIPKATAKIYDLQDPTS
KMSKSAATDAGLINLLDDPALSAKKIRSAVTDSEREIRFDTDAKPGVSNL
LTIQSAVSGVGVDKLVEGYAGKGYGDLKKDTAEAVVEFVAPIKARVDELT
ADLAELEAVLAAGAERAQDVAGKTVQRVYDRLGFLPQRR
379763739YP_005350136.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSEPAEEGFLDRLRSRHGWLDHVIRAYQRFDERNGGFFAAGLTYYTIFAL
FPLLMVGFAVFGFVLARRPHLLSTIDDHIRSQVSGTLGNQLQELMNSAID
ARTSVGVIGLVTAVWAGLGWISHLRQALTEMWWDSHVESPGFVRSKFSDL
LAMVGTFAVILATVALTTVGHAAPMAALLKWLGVPQFAVFDWLFWLFSIL
IATLVSWLLFTWMIARLPREKVSFVDSMRAGLIAAVGFEVFKQVGSIYLK
TVLRSPAGAAFGPVLGLMVFAYITAYLVLFCTAWGATASTDPRDRPVEPP
APAIIAPRVHMDEGLSTRQTLTAMGLGAVGALALSRIAGLARRGR
379763738YP_005350135.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAWLVLIASGVLEAVWATALNKSDGFSRLGPSLVFVVALALSMAGLATAM
RTLPVGTSYAVWVGVGAVLTVGYAALIGEEPASLTKLLLIGGIVACIAGL
KLVS
379763737YP_005350134.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MGLIAAGTMVVDGRLCRPGWLETAGGRIAAAAPGPPPRPPDRDYPDCTVV
PGFIDMHVHGGGGASYTDADGIGEAAAFHLRHGTTTTLASLVTAAPPELL
SGVRALTDATRSGTIAGIHLEGPWLNRARCGAHDHTQMRDPDPDEIDALL
TAAGDAIKMVTLAPELPGADAAIRRFLDAGVVVAVGHTDATYEQTRRAIE
LGATLGTHLFNAMPPLHHREPGPALALLRDPRVTVELIADGVHLHPDVAR
AVIEAAGADRVAVITDAIAAAGRADGAYRLGAVRIDVVSGVARVQGTSTI
AGSTATMDRLFRAVAGFGANRDAGLAAAVQVTSATPARALGLERVGSLRP
GYDANLVVLDRDLRVSDVMVRGDWL
379763736YP_005350133.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MGTGSRRGLLVGLTAASVGVIYGYDLSIIAGAQLFVTEDFGLSTRQQELL
TTMVVIGQIIGALGAGVLANVIGRKRSVVLILFAYAAFALLAAFSVSLTM
LLGARLLVGLTIGVTVVVVPVYVAESAPTAVRGSLLTAYQLAIVSGLIVG
YVTGYLLAGTHSWRWMLGLACVPALLLAPLVIRMPDTARWYVLKGRVDDA
RRALLRVEPDARVDDELADIGRAVSEGGGRLSEMLPEMVRRPYLRATVFV
VVLGFLIQITGINAIIYYSPRIFEAMGFTGNFALLGLPALVQVAGLAAVG
TALLLVDRVGRRPILLCGTAMMIGADVVLMAVFGRGIGGAVAGFAGVLLF
IFGYTMGFGSLGWVYASESFPSRLRSIGSSTMLTSNLVANAIIAAVFLTM
LHSLGGAGTFAAFAAFALIAFVFVYRYAPETKGRQLEDIRHFWENGGRWD
379763735YP_005350132.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSFLRSMSCLVAAGFVAWAPATIALPLAKAEPGAEPNAAPASCPYKVNTP
PVVDSSEVPTAGDPPIPLAVPAKPVGGDALASCGIVAAPNTPPLPGDVSA
EAWLVADLDSGAVIAAKDPHGRHRPASIIKVLVAMAAINTLNLNKSVAGT
ADDAAAEGTKVGVQEGGVFTVNQLLHGLLMHSGNDAAHALAMQLGGMQQA
LEKINVLAAKLGGQDTRVATPSGLDAPGMSTSAYDIGLFYRYAWQNPTFA
NIVATRTFDFPGHGDHPGYELENDNQLLYKYPGALGGKTGYTDDAGQTFV
GAANHDGRRLVAVLLHGTRQPIAPWEQAAHLLDYGFATPQGTQVGSLVAP
DPSLAPAKSDTAADRLANNAAAGAIIGSADAMPVRVGVAVIGAIIVFSLI
MAARSMNRRPQHR
379763734YP_005350131.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MWARLRRRRDGAAGVVPRALKDLLKQVEKATQVRRSGLDQVLAELTLHRD
AATEPELRSALAWLCNAVSRFGRNPSAPHAREVMLAADAVRRAG
379763733YP_005350130.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTDNLWLHFSRHGPGITPPIITRGEGVTIFDDRGKSYLDGLSGLFTVQVG
HGRAELAEAAVRQAGTLAFFPLWGYATPTAIELAERLAGYTPGDLNRVFF
TTGGTEAVETAWKLAKQYFKLTGKPGKHKVISRSVAYHGTTQGALAITGL
PRYKAPFEPVTPGGFRVPNTNFYRAPEPLRTDPKAFGQWAADRIAEAIEF
EGPDTVAAVFLEPVQNAGGSIPPPPGYFERVREICDEYDVLLVSDEVICA
FGRIGSMFACDDFGYVPDMITCAKGMTSGYSPIGAMIASERLFEPFNDGA
TMFPHGYTFGGHPVSAAVGLANLDIFEREGLNDHVRANAPALRATLEKLY
DLPIVGDVRGEGFFYGVELVKEKATKQTFSDDERRPLLARVGSALFDAGL
YCRTDDRGDSVIQLAPPLISGQAEFDTIEAILREVLHEESARL
379763732YP_005350129.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTSAQQVSEFESLRPHLMSVAYRLTGTVADAEDIVQDAWLRWHRQDPDKG
TQITDLRAWLTTVVSRLGLDRLRSAAHRRETYTGNWLPEPVVTGFGPPAS
EADPLSAVVAGEDARFAAMVVLERLSPDQRVAFVLHDGFDVPFAEVAEAL
GTSEAAARQLASRARKAVAAEPPPEPDPSHNEVVGKLLAAMAAGDLEAVV
SLLHPDVIFTGDSNGKAPTAVHVIHGPDKVVRFMLGLANRYGPAFYTSYQ
AGLVNGELGIYTAGFPAADGYREMCPRIMAMTVRDGKVCALWDVANPEKF
TGSPLRREQP
379763731YP_005350128.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MGGSVTETMGKLMFRGMDMMRHRSAFDVGAATPQGKDFTGFDKTRQILLV
TSKRSGEAMPSPINHGVADGKIYVRTDASTGKVKRINNNPRVVVVPSSLR
GKPKGQAVAGKARILPESEHAHAYKVIAANWSLPMKLFERGLDKGSAALS
IPTTYIEIEPAQEG
379763730YP_005350127.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTQKTRIEPLPPKRAGLLIRAMYRIAKRRYGQVPEPFAVAAHHRKLMTAS
AMHETMVERASKTLPASVRELAVLWTARQIGCSWCVDFGSMLQRLDGLDV
ERLKEIDNYATSPAYTDDERAAIAYADAMTTDPHTVTDEQVDDLRARFGD
AGVFELTYQIGLENMRARVNTALGITEQGFNSGDACRIPWASDDRKRGVA
GRSGSSPVG
379763729YP_005350126.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTDVAEPQAESLEPPLPPVPDEAVMVTVKIARFNPDQPDAYAETGGWQSF
RVPCLPSDRMLNLLIYIKSYLDGTLTFRRSCAHGVCGSDAMRINGVNRLA
CKVLMRDLLPKKAGKPLTITVEPIRGLPVEKDLVVDMEPFFDAYRAVKPY
LITTGNPPTRERIQSPTDRARYDDTTKCILCAACTTSCPIFWHEGSYYGP
AAIVNAHRFIFDSRDEAAAERLDILNEVDGVWRCRTTFNCTEACPRGIQI
TKAIQEVKRAIMFSR
379763728YP_005350125.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MIQQHRYDVVIVGAGGAGMRAAVEAGPRVRTAVLTKLYPTRSHTGAAQGG
MCAALANVEEDNWEWHTFDTVKGGDYLADQDAVEIMCKEAIDAVLDLEKM
GMPFNRTPEGRIDQRRFGGHTRDHGKAPVRRSCYAADRTGHMILQTLYQN
CVKHDVQFFNEFYALDLVLTQTPSGPVATGVVAYELATGEIHVFHGKAIV
LATGGSGRMYKTTSNAHTLTGDGIGIVFRKGLPLEDMEFHQFHPTGLAGL
GILISEAVRGEGGRLLNGEGERFMERYAPTIVDLAPRDIVARSMVLEVLE
GRGAGPHKDYVYIDVRHLGEDVLEAKLPDITEFARTYLGVDPVKELVPVY
PTCHYVMGGIPTTVTGQVLRDNTSTVPGLYAAGECACVSVHGANRLGTNS
LLDINVFGRRAGIAAANYARGHDFVDMPPDPAAMVVGWVGDILSEHGNER
VADIRNALQQSMDNNAAVFRTEETLKQALTDIHALKERYSRITVHDKGKR
FNSDLLEAIELGFLLELAEVTVVGALNRKESRGGHAREDYPNRDDVNYMR
HTMAYKQGTDLLSDIALDFKPVVQTRYEPKERKY
379763727YP_005350124.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSSPDLQLTRGQTAPVKQRSYDRPASLDNPRSPRRRAGIPNFEKFAWLFM
RFSGIALFVLAIGHLFIMLMWDNGVYRIDFNYVAQRWASPFWQFWDLALL
WLAQLHGGNGLRTIIDDYSRKDSTRFWLNSLLLLSMGFTLVLGTYVLLTF
DPNIHA
379763726YP_005350123.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MWSWVLHRISGATIFFFLFVHVLDAAMLRVSPQTYNAVIHDYQMPIVGLM
EYGLIAAVLFHGLNGIRVILIDFWSEGPRYQRLMFWVVGVVFLLLMVPAG
VVTVIHMMEHFR
379763725YP_005350122.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MPEIDWKTLRDKAIQASEGAYAPYSRFAVGAAALVDDHRVVTGCNVENIS
YGLGLCAECAVVCALHSTGGGRLIALACVDQRGSVLMPCGRCRQVLLEHG
GPELLIDHPRGPRRLGDLLPDAFGPDDVAAGRR
379763724YP_005350121.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MPPAFDAPTVIRTKRDGGRLSDAAIDWVVDAYTAGRVAEEQMAALLMAIL
LRGMDRGETARWTSAMLASGERLDFSDLGVPTVDKHSTGGVGDKITLPLV
PVVAACGAAVPQASGRGLGHTGGTLDKLESIAGFTAALSNRRVRDQLRDL
GAAIFAAGDLAPADAKLYALRDITATVESLPLIASSVMSKKLAEGAGALV
LDVKVGSGAFTDSEVQSRDLASAMVALGAAHGVPTRALLTDMNTPLGATV
GNALEVAESLEVLAGGGPPDVVELTLRLASEMLELAGVDGRDPAETLRDG
TAMDRFRQLVAAQGGDLSVPLPIARHAETVTAARGGTMGDIDAMAVGLAA
WRLGAGRSRPGDRVQFGAGIRLHRRPGEPVTAGEPLFTLYTDTPERFGAA
LAELDGAFGVGDAAPASRPLIIDRIAQ
379763723YP_005350120.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTAPLGLEQIRKAPKALLHDHLDGGLRPSTVLEIAGQTGYDELPATDVDE
LATWFRTRSHSGSLERYLEPFSHTVAVMQTPEALHRVAYECVEDLAADSV
VYAEVRFAPELHIDRGMSFDAIVDAVLAGFADGEKACAGAGRPIVVRLLV
TAMRHAAVSREIAELAIRFRDKGVVGFDIAGAEAGNPPTRHLDAFEYMRD
HNARFTIHAGEAFGLPSIHEAIAFCGADRLGHGVRIVDDIDVLPDGQVRL
GQQAAILRDKRIPLELCPSSNVQTGAVKSIAEHPFDLLARARFRVTVNTD
NRLMSDTFMSREMLRLVEAFGYGWSDLERFTINAMKSAFIPFDERLAIID
EVIKPRYAVLIG
379763722YP_005350119.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MCPGIPIDGSAAGMGGGSTIGGGAIGGGSTGAAAMGASGSGGGAMGGGGG
GGAYGPPAHTGSLGMLMQLKSAGPVGAPPMAYGPPWHCASPGIPAHRGSD
GLVGRPGSGSSSGAAGVRAKPGAAFAGIVAPAVAAPKIDRATTVFVIVPR
NLEAVTQVIVPPDTCGPGALRPRVIRSVCSIAAKSGSP
379763721YP_005350118.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAAKERRTGTAKDRALDYVKMRVLTGEFPGGELISEGDVASALGMSRTPV
REAFLRLEAEGLLRLYPQRGALVVPVSPDEVRAVMEARLVLEQFAAGKVI
GRGGAACAAVFGRLSGELARQRDAAAAANWREFVEADRAFHAITLQESGN
AILSGFYASLRDRQMRMIGESTLRDPDRVATILEEHRGIAEALRDGDRAR
AATAVQTHLAGTVRAIGLSVDPDPLWATGFGRDGAD
379763720YP_005350117.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MQQLATPNLDPTVPAPMVNVAEYAFEGRFEEWAEQAEYFEYSRAANPIGS
GLTPRVPIRRFGPELYLDAPTGVIPLDLSAELGGPAGAATSPALLANFVS
IRANEHVDTHPNATSQLYYVLYGRGFAAVNGRLIEWEKGDFVTLPAGAHS
VFYAGADTAMYWVHDEPLMRYLGADATRPRFRATKFRRADAVAKLTEIAS
RPGANEKSRVSVLLANAEQDQTLTITHVLWAMFGVLPPHQVQRPHRHQSV
ALDLILDAPAAGCYTLLGTRLDERGDIVDPIRVDWQAGGAFTTPPGIWHA
HYNETDEPAHLIPVQDAGLQTHLRSLDIKFTQRRDLAAG
379763719YP_005350116.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MWLDMKVPLLGPVSLTGFQNPWFFLALLAVLLVIGLYVVQQFARRRRVLR
FANMEVLERVAPPHPSRWRHVPTILLATSLVLLTTAMAGPTSDVRIPLNR
AVVMLVIDVSESMASNDVPPNRLAAAKEAGKQFADQLTPAINLGLVEFAA
NATLLVPPTTNRGAVKSGIDSLQPAPKTATGEGIFTALQAIATVGSVMGG
GEGPPPARIVLESDGAENVPLDPNAPQGAFTAARAAKGQGVQISTISFGT
PYGTVDYEGATIPVPVDDQTLQKICEITDGEAFHADSLDSLKNVYTTLQR
QIGYETVKGDASLAWMLLGAVVMAGAVLAGLLLNRRLPA
379763718YP_005350115.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSLPGIGPLPLYGFQRPAMLLFGLVPLALLAVYVVVQARRNRRLHRYTDA
PVAQSRWRHLPIAASLLSLALLTIALATPTHDMRIPRNRAVIMLVIDMSQ
SMRATDVEPNRLKAAEQAASQFASQLTPGINLGLVGFAGTPYLLVPPTPQ
HQATIDALKKLDFADSTATGQAIFTALHAIGATAVTGGDNPPPARIVLLS
DGRENKPSNPSDPHDGVYTAARLAKDEGVPISTISFGTKGGEIEMDGQRV
AVPVSTDQMKTIARLSGGQPYTATNIGELNKSYNAIENEIGYRTVPGPGS
SGWLRLGVLAALIATALALLINRRLPT
379763717YP_005350114.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MPIRLSLSAGDRYTVWAPRWRDSGDEWEAFLGKDEDLFVFSSVADLVAFV
RSDTDNDLTDHPAWKALTSAHAHDFEPAEDKQFDLVAVEELVSEKPTAES
VSALAGTLAIVSSIGSVCELAAVSKFFNGNPSLGTVSGGVEHFTGKAGAK
RWHAIAEVIGRSWDDVLGAIDDIATTPDVDAKLSAKAEDELAEEREEDET
EDAVEESAADDIDDDVDDEVDEDDDTEARAAGDTAVLGGDKDFWLQVGID
PIRIMTSSGTFFTLRCYLDDEPIFLGRNGRISVFPSERALARYLADEHDH
DLSDLSTYDDIRTAATDGSLTVKVTDDNIYVLTGLADDLADGPEAVDREQ
LELAVEVLRDIGDYSEDPAVDKALETNRPLGKLVAAVLEPGSVTKPSPPY
AAAVREWEKLEQFVEGRLRRE
379763716YP_005350113.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MVALVALAASPLTPRIGLAAAAIPQPAHIVIVVEENRSENGIIGNKSAPF
ITSLAANGANMTQSYAETHPSEPNYLALFAGNTFGVTKDLCPINAGAAPN
LGSELLAAGHTFVGFAEGLPTVGSPVCTAGKYARKHVPWANFTNVPAANS
MPFSAFPMGNYASLPTVSFVIPNNDNNMHDGSIAQADAWLNRQLSGYANW
AVANNSLLILTFDEDDNGSHNQIPTVFYGAHVRPGNYSEQINHYNVLSTV
EQMYGLPKTGYAASAAPITDIWD
379763715YP_005350112.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTPEEWIAHDPDPRTAAELAACDAEESAARFARPLRFGTAGLRGPVRGGP
DAMNVAVVSHATWAVAQVLKRRAPAGARVIVGRDARHGSAVFATVAAEVL
ADQGFSVLLLPGPVPTPVVAFAVRHTGALAGIQITASHNPPADNGYKVYV
DGGIQLVSPTDREIEAAMADAPPADQIGRAPIEPGQADLVERYVERASGL
RRGAGSARVALTALHGVGGAVAVETLRRAGFAQVHTVAAQFAPDPDFPTV
AFPNPEEPGAADALLALASDVRADVAIALDPDADRCAVGIPDKAGWRMLS
GDETGWLLGDYILSQPQRAETPVVASTLVSSRMLSAIAAHRGAVHVETLT
GFKWLARADAEVPGGTLVYAYEEAIGHCVDPDAVRDKDGISAAVLVCDLV
ATLLRQGRSVVDLLDELARRYGVHDVAAISRRVADPAEAAALMHRLRTTP
PATLAGFPAELTDVTDALIFTGGDDHTSVRVVVRPSGTEPKLKCYLEIRC
APSDDLDSSRRRAGALRAELVAAMRGW
379763714YP_005350111.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTQTSSDPGDLARRAAAVIAERTGIDEHDVAIVLGSGWSPAVAALGTEAI
GKTAVLPQADLPGFRPPTAIGHTGELLSMRIGAHRVLVLVGRIHAYEGHD
LCHVVHPVRAACAAGVRAVVLTNAAGGLRPDMAVGEPVLISDHLNLTARS
PLVGPQFVDLTDAYSPRLREFARQADPTLTEGVYAGLPGPHYETPAEIRM
LRTLGADLVGMSTVHETIAARAAGAEVLGVSLVTNLAAGIGGEPLSHAEV
LSAGAASASRMGALLALILERLPRF
379763713YP_005350110.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MVGPVIAIAVGVVLSVVSVTVGPAPSAKADCPNVQLIFARGTAEPPGLGV
VGDALFAALQPALGSRTVDSYAVNYPASYNFLTTADAANDARDHIAEMVD
QCPSTRLVLGGFSQGAAAISMLAGVPPVGQRIGNFGSAPPLDPALANKIR
AVAVFGNPGNRFDTPLSSTGAFAGRTIDLCSEGDPVCVVGGRDRDAHHDY
SAPPYPGQAASFIAGLV
379763712YP_005350109.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MPTAPLDSLLDSVEAVVRRRGGDLVELSHAIHAEPELAFAEHRSCAKAQA
LVAERGFEITAAPGGLDTAFRADYGSGPLTVGVCAEYDALPEIGHACGHN
IIAASAVGTALALAEVADELGVRVALLGTPAEEAGGGKALLLRAGVFDDI
AAAVMLHPGPTDIAAARSLALSEATITYRGTESHAAVAPHLGINAADAVT
VAQVAVGLLRQQLAPGQLVHGIVTDGGQAVNVIPGRATLQYAMRAVEADS
LRELEGRMYACFAAGALATGCEYDIDNPAPAYDELTPDQWLADVFREEMR
RLGREPVAREYEAALPMGSTDMGNVTKALPGIHPVIGLDSGGAMVHQRGF
AEAATNPSADRAVIEGAIMLARTVVQLAQTPAERDRVMAAHERRRGGERA
379763711YP_005350108.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MRLADAAESWLASHHADLVEWRRHIHRYPELGRQEYATTQFVAERLAEAG
LNPKVLPGGTGLVCDIGPEHEPRIALRADMDALPMVERTGAPYASTMPNV
AHACGHDAHTAILLGTALVLASVPELPIGVRLLFQAAEELMPGGAIDAIA
AGAISGVSRIFALHCDPRLEVGKIAVRHGPITSAADQIEITLYSPGGHTS
RPHLTADLVYGLGTLITGLPGVLSRRIDPRNGTVLVWGAVNAGVAANAIP
QTGVLAGTVRTASRQTWVGLEEIIRETVAGLLAPLAIEHTLQYRRGVPPV
VNEDVSTRILTHAIEAVGPDALADTRQSGGGEDFSWYLEEIPGAMARLGV
WPGVGPQLDLHQPTFNLDERALAIGVRVLANIVEQSAAFELS
379763710YP_005350107.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MRYPEVSGRTSEITVPTRHGPTRATVYHPPAGTTDPPVYVNVHGGGFVVG
HPEQDDPWCRYLAANAGVVVINPDYVLAPRHRFPAAVHQIYDVVRWAAGP
HPDWDGARLCVGGQSAGGNLSAAAARLAWENGGPPIALQVLHYAPLDLVT
PTRDKPSTLGRRAIMKPWMGEVFDTAYIPERAQRRDRLASPAWGNNADHI
AGIAPALIVTAEHDRLCGEARRYAKKLDAAGALAEYYEVAGVDHGYNIMS
QAGDVTRRAYAHIAGHVVRATNRDGTR
379763709YP_005350106.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MPLYAAYGSNMDPEQMLKRAPHSPMAGTGWLHGWRLTFGGEDIGWEGALA
TVVEDPDSKVFVVLYDMTPADEVNLDRWEGSEFGVHQKIRCRVERISSDT
TTDPVLAWLYVLDAWEGGLPSARYLGVMADAAEIAGAPSDYVHSLRTRPA
RNIGPGTSA
379763708YP_005350105.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MATRIVILGGGPAGYEAALVAATSHPDTTHVTVIESEGIGGAAVLDDCVP
SKTFIASTWLRTELRRAPRLGFEIDIDDAKLSLRQIHSRVKQLATDQSSD
IADQLLGVGVHVVAGRGELIDPTPGLARHNIKATAQDGTTSEYEADVVLI
ATGASPRVLPSAQPDGERILTWRQLYDLEALPEHLIVVGSGVTGAEFVHA
YTELGVPVTVVASRDRVLPYEDADAARVLEAAFSERGVKLVKNARAASVT
RTGDGVLVTLADGRTVEGSHALMTIGSVPNTSGLGLERVGIELGRGGYLT
VDRVSRTSVSGIYAAGDCTGLLPLASVAAMQGRIAMYHALGEGVSPIRLR
TVAATVFTRPEIAAVGVPQTMIDDGSVSARTIMLPLRTNARAKMSGLRQG
FVKVFCRKSTGVVIGGVVVAPIASELILPIAVAVQNRITVNELAQTLAVY
PSLSGSITEAARRLMAHDDLD
379763707YP_005350104.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSVLGPEQRQAAWDRLGAEQFDVVVIGGGVVGSGCALDAATRGLKVALVE
ARDFASGTSSRSSKMFHGGLRYLEQLEFGLVREALYERELSLTTLAPHLV
KPMPFLFPLTNRVWERPYVAAGIFLYDRMGGAKSVPAQKHLTRAGALRLS
PGLKRSSLIGGIRYYDAVVDDARHTMTVARTAAHYGAVVRTSTQVVALLR
EGDRVTGVRVRDSEDGAVTEVRGHVVVNATGVWTDEIQALSKQRGRFQVR
ASKGVHIVVPRDRIVSDVAIILRTEKSVMFVIPWGSHWIIGTTDTDWNLD
LAHPAATKADIDYILTTVNTVLAIPLTHADIDGVYAGLRPLLAGESEETS
KLSREHAVAVPAPGLVAIAGGKYTTYRVMAADAIDAAAQFIPARVAPSIT
EKVSLLGADGYFALINQAEHVAELQGLHPYRVRHLLDRYGSLIGDVLALA
DDRPDLLDPIKEAPGYLRVEALYAVTAEGALHLEDVLARRMRISIEYSHR
GVDCAREVADVVAPVLNWSAADIDREVANYTARVEAEVLSQAQPDDVSAD
ELRASAPEARAEILEPVPLK
379763706YP_005350103.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MRDGLGPARVRLRGGPVLAELSARFGAPARAKVLAGEVVGADGAVIDAKT
VLPAGASVYLYRELPDEVPVPFEIPVLYRDDDIVVVDKPHFVATMPRGRH
VAQSALVRLRRELELPELSPAHRLDRLTAGVLVFTARREMRGAFQTLFSR
GLVDKTYLARAAVDPALRLPRVVKSRIVKRRGQLQAVCEPGAANAETLVE
LVSADGLYRLTPRTGRTHQLRVHMASLGIPIEGDPLYPNVIDVAPDDFST
PLRLLARRIEFTDPRSGVRREFVSRRDPYADRVRKR
379763705YP_005350102.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MKRGIVSGSAALLTAAGLIAWAPPVSAGCQYGGGVLSKCDGPVQPDGTWQ
RCVAVTRLIPNGASSYLVPDGHCDVMGPDQRPSDLAFADPPSHID
379763704YP_005350101.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MDIAVTFVGNATTLISVGGLTLLTDPNFLHRGQRAYLGHGLVSKRLKEPA
LGIDELPRLDAVVLSHLHGDHWDRVSQRGLDHDLPIITTPHAAKRLHQRG
FAHARGLQTWQQHTITKGDTTVTLTSLPGRHAPGWSRRLLPPVMGTMVEI
GSADGAPRRRLYISGDTLLIQELNEIPARFDPIDVGMLHLGGTRLPAGRR
LPFGLTVTMDGRQGAELVAMLGLPKAIPVHFDDYAVFASPLSDFTRQMQR
RGLGDRIVTVNRGDSVTV
379763703YP_005350100.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MDLLAPPEVTSTLIHTGPGAGSLIEAAGAWQRLAVELENSVSTYTSTLTS
LIESWDGPSATAMLQSVQPYLLWLRETAQQSAQMASSAEAAASAFSATRA
TVVHPSVVTANRTRLRQLLATNRFGTNTAAIAEAENEYQTMWANNAAAMT
RYQATTSQATGQLSRFTSPVPDTNPDGTANQEAAVMKAASDSFGPQVQDA
LGDSVTGFDPNASWFGWASTWGNQFISSGFPINLLGVWAQLATAQGVASV
GGDIGSGLSEGLGLTSATLANAIKGIGAGASAAPTGALGVGVSLGKLTAP
PAVVGLLPGTQTGVQLASAASPLPAAESGFPMMPMMVPPPTASAGTGWRK
RKQQKYEDVAVGREVKGKVMPRNPSAG
379763702YP_005350099.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MDFGILPPEIISALIHSGPGAWSLIEAAGFWQELSAELEQSASSYTAELS
WLSTTWHGPSSMAMAQALEPYLAWLRLTAQQCQQTAASVQVVAAAFEWTH
WTVVHPSLVAANRARLAMLLATNFFGVNYPAIAETEAEYHTMWVNNSAAM
YRYAATSAGAVKLPQFSPPPEVANPSGATTQAAMVHAATTGNSGAQLLAA
DSIGQGSSAADAFDPNEGWFGYWSTWGNQFIAGGVPVNILGVWAQLATAH
AFASLGEDIGPGLADGAAALASAETRLVSAIGAAGSSLAPRAALGVGISL
GHLTMPPATVGMLGTSQAPVQLASAVSPLPPGGAEPPMLPMAPVRPGSGA
SGARRRKGRDYDDIEYGAELPGTVMHRPPSAG
379763701YP_005350098.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MQTAPQIQGRVWRGGKAQDDFEFGKISDYLAEPDTLVWADLCNPDHDTLG
GLAGELGLNRWAVEDAVAAAERVKATGYETHTFFTVYAAEIAGAATNVVD
APGRTLSMRRISAFVLPQGLITVRLTPDFDMALVTRRWEEIGGQAYGVGA
LVHGLLDVVVDSHFAAVEALDDGIEAIEDELFDGTSRKGDFARRTFGLRR
DLVNLRRVALPMREVVNSIQHHRISDGADRQLDPLYADLYDHVLRVSEWT
ESLRDMVTTIFETNLSLQDARLNTVMKKLTGWAAIIAVPTAITGFYGQNV
PYPGFGTAAGFAASTSVIAVLMVVLYVMFKRRDWL
379763700YP_005350097.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MIPKLLVGVAGVAIVLGASGWTAASASTDPNPFSHLSCACKELDPPGGSA
QRDKISQGIQHGLSAAPPVAQ
379763699YP_005350096.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTSTQIRKPGRARSLLAIGAVPVAGLLSAMTAPASAHATSADDAFLAALK
AKGINFESPEAVVNSGHTVCHELDSGQTPEQVANNVLSSSSLDSYHAGYF
VGVSIKAYCPKYAAAASGS
379763698YP_005350095.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAGCGVRHVSAASARDVSGTFRSGGMDRTYMLHVPAGDPIGLVLSLHGGG
GTGIAQRALTGFNSVADAHDLLVVYPDGYDKSWADGRGASPADRRHIDDV
AFLVGLVGKLRNDFNIAPGHVFVTGMSNGGFMSNRLACDRADVFAAAAPV
AGTLGVGVACNPSRPVSVWEAHGTADPLVPFKGGAVRGRGGLSHSISADA
MVAKWRAADGCAGEPSMELLPDVRDGTVVRRFVSAACAASTEVVFYKIDK
GGHTWPGGKQYLPAAVIGPTTHALDGSEAIAQFFLAHARD
379763697YP_005350094.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MPEGDTVWHTAAVLREHLVGATLTRCDVRVPRFATVDLTGEVVDEVVSRG
KHLFIRVGRASIHSHLKMEGSWRVGERPVRVDHRARIVLETGTVRAVGVD
LGVLEILDRDRDGEAVAHLGPDLLGEDWDAARAAANLMADPHRPIAEALL
DQRLLAGIGNVYCNELCFVSGHLPTAPVGAIADPLRLVSRAREMLWLNRF
RWNRCTTGDTRSGRQLWVYGRAGQRCRRCATPINVDDTKERVAYWCPSCQ
R
379763696YP_005350093.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSTRADSGPPGPADPLGRFSAVTREWFTGTFDAPTTAQAEAWEAIADGHH
TLVIAPTGSGKTLAAFLWALDSLAGAAGRPPGTRVLYVSPLKALAVDVER
NLRTPLAGLTRIAERRGLPPPDISVGVRSGDTPPATRRQLINRPPDVLIT
TPESLFLMLTSAARETLAGVQTVIVDEIHAIAAGKRGAHLAVSLERLDAL
REDKPAQRIGLSATVRPPEELARFLSGGQPTTIVAPASAKTVELTVAVPV
PDMANLANNTIWPDVENRLVDLIEAHNSTIVFANSRRLAERLTARLNEIH
AERSGVELSTEANPKVAGGAPAHIMGSGQTYGAEAILARAHHGSVSKEQR
ALVEEDLKRGLLKAVVATSSLELGIDMGAVDLVIQVEAPPSVASGLQRIG
RAGHQVGEVSQGVLFPKHRTDLIGCAVSVQRMLAGQIETMRVPANPLDIL
AQQTVAAAALEPLDADKWFDTVRRAAPFATLPRSVYEATLDLLSGKYPST
DFAELRPRLVYDRDTGTLTARPGAQRLAVTSGGAIPDRGLFTVYLASEAE
KPSRVGELEEEMVYESRPGDVISLGATSWRITEITHDRVLVIPAPGQPAR
LPFWRGDGVGRPAELGAALGAFTGELAGLTREEFETRCAGLGFDAYATDN
LARLLDEQRTAAGVVPTDTTLLVERFRDELGDWRVILHSPYGLPVNGPLA
LAVGRRLRERYGIDEKPTASDDGVVVRLPDTVSDFASDTGIETPPGADLF
VFDADEIDPIVTDEVGGSALFASRFRECAARALLLPRRHPGRRSPLWQQR
QRAAQLLEVARKYPDFPVVLETIRECLQDVYDVPALVALMTGIAQRRVRV
VEVETARPSPFAASLLFGYVGAFMYEGDSPLAERRAAALSLDSTLLAELL
GRVELRDLLDPEVIAATARQLQHLSAERAARDAEGVADLLRLLGPLTEEE
VAARAGGADVGGWLEGLRAARRALTVSFAGRGWWVAIEDIGRLRDGIGIP
VPLGVPTAFTGEVADPLGELLGRYARTHTPFTTAEVAARFGLGLRVTSDV
LGRLAADGRLVRGDFVAETPGPSGGVAGAEQWCDADVLRILRRRSLAALR
AQVEPVSTAAYGRFLPAWHHVGAAESPRAPGHSGLDGLMSVIDQLAGVRI
PASAIEPLVLAPRVRDYSPAMLDELLATGEVTWSGAGSISGSDGWIALHA
GESAPLTLGGPADIELGDAHRAILDTLAGGGAYFFRQLAHSGVPDAALKT
ALWELIWAGWITGDTFAPVRAVLGGAGARKRSAPAHRSQRPPRLSRYSVA
HAQSRPADPTVAGRWSILAAPEPDSTLRAHYQAELLLGRHGVLTRGAVAT
EGVPGGFATLYKVLSAFEDAGRCQRGYFIESLGGAQFAVASTVDRLRNFS
EGVDPERPQYRAVVLAAADPANPYGAALPWPASGGEGARPGRKAGALVVL
VDGELAWFLERGGRSLLTFTDDPGAHHAAASALADLVASRRVAGMLVERI
DGVPALAPRAEASGPLGALTEAGFHTTPRGLRLR
379763695YP_005350092.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSRALMYHYFPDKRAFFAAVVKDEADRLYENTNMDDVTGLTMYEEIRVGV
LAYMAYHEQNPEAAWAAYVGLGRSDPVLLGVEDDAKNRQMEHIMSRINQL
LTELNTGMEPDVERHLRVILHGWLALTFEICRQRIIDPTTDADKLADACA
HALLDAIARVPEIPEKLGEAMSTSRL
379763694YP_005350091.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTTEQLRARVLGAFDAIGVTASLGEPDAHGLPASTPITGEVLFTVAPTTP
ERAERAIAEAAQAFSVWRTTPAPVRGALVARLAELLTEHKRELATLVTVE
VGKITSEAAGEVQEMIDVCQFAVGLSRQLYGRTIASERPGHRLLETWHPL
GVVGVITAFNFPVAVWAWNAALALVCGDPVVWKPSELTPLTALATQALIA
RAAADVGAPPAVSSLVLGDRDLGGLLVDDPRVALVSATGSVRMGREVGPR
VAARFGRVLLELGGNNAAIVTPSADLDLAVRAVVFAAAGTAGQRCTSLRR
LIVHESVADEVVDRVVSAFRRLPIGDPSAPGTLVGPLIHETAYRDMVGAL
ESARADGGEVIDGDRRHPQGREQPSAYYVAPAVVRMPAQTAVVATETFAP
ILYVLTYDRLGDAIALNNAVPQGLSSSIFTTDLREAERFLAESDCGIANV
NIGTSGAEIGGAFGGEKETGGGRESGTDSWKAYMRQSTNTVNYSGELPLA
QGVEFG
379763693YP_005350090.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTRAKWLPAWQLRALFAAGLSAMYAAEVPAYGTLVAVSEQVNADVVARQP
DAERFGSLRRVTAERHGAIRVGSPAELAAVADLFAAFGMLPVGYYDLRCA
ASPVPVVSTAFRPVDANELSLNPFRVFTSMLATRDARFFDHDLRRRVEAF
LARRRLFDPALLAGARTIAADGGCARDCAHEFVAAAVAAFALSAEPIDKS
WYDELSRVSAVAADIAGVGSTHLNHLTPRVLDIDDLYRRMTGRGITMIDA
IQGPPRTDGPAVLLRQTSFRALAEPRRFRGADGRITEGALRVRFGEVEAR
GVALTPKGRARYDAAMSAADPAAVWAEHFPPTDEQMAAEGLGYYRGGDPS
APIVYEDFLPASAAGIFRSNLDSDAETADAPDESGYDAQCLAGAIGRDIA
DPYALYEEACA
379763692YP_005350089.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSETLDDVDRILVRELVADGRATLAELAASARLSVSAVQSRVRRLEARGV
IAGYSARVDPEAVGHLLSAFVAITPLDPSQPDDAPARLEHIEEIESCHSV
AGEESYVLLVRVASARALEDLLQRIRTAANVKTRSTIILNTFYADRQHIP
379763691YP_005350088.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MGVMTAALERFARAGRRPDGDRDPGRVHEVLARSMLIDGFDFVLDLDRSR
GSYLYDARDGRRYLDMFSFFASSALGMNHPALAGDDAFRAELVAAALNKP
SNSDVYSVAMARFVETFARVLGDPALPHLFFVDGGALAVENALKVAFDWK
SRFNEARGLDPALGTRVLHLRGAFHGRSGYTLSLTNTNPVTVDRFPTFDW
PRIDAPYIRPGADVAALEAASLAQARAAFEAHPHDIACFVAEPIQGEGGD
RHFRPEFFAAMRELCDRHDALLIFDEVQTGCGLTGTAWAYRQFGVQPDVV
AFGKKTQVCGIMAGRRVDEVADNVFAVPSRLNSTWGGNLADMVRARRILE
VIEADELFDRAAAQGAYLLGCLEQLAAEFPGVVLEPRGRGLMCAFSLPSA
ADRDELIRRLWRRAVIVLPSGRDGVRFRPALTVTRAEIDAAMRAIRGALT
DRP
379763690YP_005350087.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MQKAGQRPGGDRLGQEDREVLAAVRFAAAATAAAVGFLLIAAVWVSTCPA
GGVDTVACGPPQRTLLAIGGPMIALAGGIWAFVRTYRVWKARGTWWGWQG
AGWFLLTVMALMVAMGVAPIAGPVLAL
379763689YP_005350086.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MGDTYHDPVDHLRTTRPLAGESLIDVLHWPGYLLVVAGVIGTCGSLAAFA
TGHHHEGMTAGVTAVVAAVLGLIWLGLEHRRIRRLADRWYSEHPEVLRQR
PAS
379763688YP_005350085.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MNDAGSHANKRPRGHRAVELHVAARLENLAMLRTLVGAIGTFEDLDFDAV
ADLRLAVDEVCTRLIRSATPDATLSVVVDPQDDQLVVEASAACDTHDVVS
PGSFSWHVLTSLADDVQTFHDGREPNETGSVFGITLTARRAASSR
379763687YP_005350084.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTPRAAGGSVSRPNEYADVPDMFRELASVAADSMELQRQRDKIVERCLPL
ADHIARRFEGRGEPRDDLVQVARVGLVNAVVRFDVDAGSDFVSFAVPTIM
GEVRRHFRDNSWSVKVPRRLKELHLRLGTATADLSQRLGRAPTATELAAE
LEMDREEVVEGLVAGSSYNTLSIDSGGGGEEEEARAIADTLGDVDTGLDR
IEDQESLRPLLEALPERERTVLVLRFFESMTQTQIAERVGISQMHVSRLL
AKSLTRLRDQLQ
379763686YP_005350083.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAQSWQQSRTAQFTARWGPTGTLITVDGELDAANADQLAAYVQQSVNRSR
RVILDLRGLKFIGTAGFSTLHRINVVCSAAQVSWAMAPSPAVSRLLRVCD
PDGTLPVTTPKAEPLLEPLRVDEGENPRPLLQLVPQPR
379763685YP_005350082.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MASHASSRISKVLVANRGEIAVRVIRAARDAGLSSVAVYAEPDADAPHVR
LADEAFALGGQTSAESYLDFGKLLDAAAKSGANAVHPGYGFLSENADFAQ
AVLDAGLIWIGPSPQSIRDLGDKVTARHIAARAQAPLVPGTPDPVKDADE
VVAFAKEYGVPIAIKAAFGGGGRGMKVARTIEEIPHLYESAVREAVAAFG
RGECFVERYLDKPRHVEAQVIADQHGNVIVAGTRDCSLQRRFQKLVEEAP
APFLTDAQRKEIHESAKRICKEAHYYGAGTVEYLVGQDGLISFLEVNTRL
QVEHPVTEETAGIDLVLQQFKIANGEKLDLTEDPTPRGHAIEFRINGEDA
GRGFLPAPGPVTRYDIPTGPGVRLDSGVEAGSVIGGQFDSMLSKLIVYGA
TREEALARSRRALDEFHVEGLATVIPFHRAVVSDPAFIGDGESFSVHTRW
IETEWDNTIEPFTAGEPLDDEADARPRQKVVVEVGGRRLEVSLPGDLALS
GGGSGGGEAGVIRKKPKARKRGAHAGAAASGDAVTAPMQGTVVKVAVEEG
QEVAAGDLVVVLEAMKMENPVTAHKDGVITGLAVEPGAAITQGTVLAEIK
379763684YP_005350081.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSMPAPLAEVVSDFAEVEGQDKLKLLLEFADELPDLPPELEERAMEPVPE
CQTPLFLHVDASDPNRVRLHFSAPAESPTTRGFASILATGLDEQPAAEIL
AVPEDFYDDLGLAALISPLRLRGLSAMLARIKRRLRESTG
379763683YP_005350080.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MALPPDPSPTLSNYAHPERLVTADWLSAHLGTPGLVIVESDEDVLLYDVG
HIPGAVKVDWHTDLNDPRVRDYIDGAQFAELMDRKGIARDDTVVIYGDKS
NWWAAYALWVFTLFGHPDVRLLNGGRDLWLAERRETTLDVPTKTSTGYPV
VTRNDEPIRAFKDDVLGILGSQPLIDVRSPDEYTGKRTHMPEYPEEGVLR
GGHIPTARSIPWAKAVDESGRFRSREELEELYGFLEPDDKTVVYCRIGER
SSHTWFVLTHLLGKPGVRNYDGSWTEWGNTVRTPIVAGPEPGPAPGPVSV
379763682YP_005350079.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTRLVLASASAGRLKVLRQAGVDPLVVVSGVDEDAVAAALGPGAEPPDVV
CALARAKAEQVAGGLDGAVAADCVVLGCDSMLSLDGRLCGKPGSADAAAS
QWRRMGGRSGGLHTGHCLLRMSDGAITHCEVESACTTVYFAEPTETDLRA
YVAGGEPWHVAGGFTLDGLGGWFVDGIDGDPSNVIGVSLPLLRRLLGRAG
LSVAALWAGN
379763681YP_005350078.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSDGNETNNSAAVSDENGSAATEAAPEAHEPHIQILKGEPTVEEVAALVA
VLGSVGGAPEPEQPEETRWGLPVDRLRFAMSNYQRLTFQQMTHMRH
379763680YP_005350077.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTSVTDHTAEPAAEHTIDIHTTAGKLAELHKRREESLHPVGEEAVEKVHA
KGKLTARERILALLDEDSFVELDALARHRSKNFGLENNRPLGDGVITGYG
TIDGRDVCIFSQDATVFGGSLGEVYGEKIVKVQELAIKTGRPLIGINDGA
GARIQEGVVSLGLYSRIFRNNILASGVIPQISLIMGAAAGGHVYSPALTD
FVVMVDQTSQMFITGPDVIKTVTGEDVTMEELGGAHTHMAKSGTLHYVAS
GEQDAFDWVRDLLSYLPPNNATDPPRYAEPHPPGAIEDNLTEEDLELDTL
IPDSPNQPYDMHEVITRILDDDEFLEVQGGYAQNIVVGFGRIDGRPVGIV
ANQPTQFAGCLDINASEKAARFVRTCDCFNIPIIMLVDVPGFLPGTGQEY
NGIIRRGAKLLYAYGEATVPKITVITRKAYGGAYCVMGSKDMGCDVNIAW
PSAQIAVMGASGAVGFVYRKQLSEAAKEGKDVDALRLQLQQEYEDTLVNP
YVAAERGYVDAVIPPSHTRGYIGTALRLLERKIAHLPPKKHGNIPL
379763679YP_005350076.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MNADPARMSQLGSDSASVLRIISHFDRLHESAADADTVVRCAALLAECPI
GARWASGTVIRYDATGGLEPGGDVPPPAPADEPSVWLERDGPAHALDPVL
LDRLAHTLRAVPARAGASGELHIGDPALLEVVLSGKERREDRVRAVRLLG
LDEKRNICVLAVSAHSPPEALRIIARQLPGSSVRSTAIGNATAVLCQGPI
DTRALSDGLEGAITTAFPGRRTEGANRGPWVGIGASVEALAAATSWQQAL
GALRFASSTGYGRRAVAYERLSALELLADIPLERVRRQRDVLRINEIAAT
PTGALDVDTVEAFLVFGSLRRTAAELHLHHSTVAARLAHVGSQMGWDLND
PMDRFIATLVLMIRRIALSSTELDEPEQA
379763678YP_005350075.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTAGRRIRDDDRMAIIDPNRTWEPLERRLAETTNERHRAVLSVVIEHMKA
EAAPDLERLMATLSPDPAYHFWHGAQDVGAKTTDGVRSYYVDFLATRTNI
LEFEVQRLVVDDDCLVTEGLLKQLYPAAELTRILGMPVDDPDGDYLVVFR
QLLLWPIDKSGKIIGEDSYNPGVVSVTKLSRDELPQEYLDLVHASA
379763677YP_005350074.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAADIATMLLDRLGDEHVGLRTRDRDWTWDEVVRESAARAALARSMRRDG
PFHIGVLLDNVPDFVFWLGGAALAGATVVGINPTRGAAELAEEIRHTDCQ
MIVTDAAGAERLRGLGLELAADRFLQVDDPGYRERVDPLRGQPDVAPGVG
PESLFLLLFTSGTTGASKAVKCSQGRLALIAHTATEKFGHVRDDVDYCCM
PLFHGNAIMALWAPALANGDTVCLTPVFSASRFLPDVRYFGATFFTYVGK
ALAYLMATPERPDDADNALVRGFGTEASPDDQAQFRRRFGAELLEGYGSS
EGGGAVAHAPDAPPGALGRPAHPGVAVVDPETLTDCPPALLDEHGRVLNP
DEAVGEIVDKAGTRTFEGYYKNDDADAERIRNGWYWTGDLGYRDEAGFLY
FAGRRGDWIRVDGENTSALTIERVLRRHPDVVAAGVYAVPDPRSGDQVMA
ALEVADPESFDAAGFAAYLSAQQDLGSKGAPRFLRLSTSLPVTGSNKVLK
RVLQRQRWHTDEPVYRWAGRGAPAYHRMSADEKRSLDAEFASHGRQRYL
379763676YP_005350073.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MDARLLGPADWTAECDVLVAGSGGGGVTGAYTAAREGLNVLLVEATAKFG
GTTAYSGGGGVWFPCNPVLLRAGTDDTIEDALTYYRAVVGDRTPRELQET
YVRGGAPLIEYLEADPNLKFVPLPWPDYYGKAPKARLDGQRHIAAKPLAV
AAAPEFRDAIRGPLDTDRLGAEPPSDYYVGGRALIARFLKAIGEYPGASL
QRDTALVDLVVDDGRVTGAIVETGGQRRAVRTRRGVLLAAGGFEGNDELR
RKYGVPGSARDTMGGPGSRGLALQAGIAAGADTDLLDQAWWSPGMTHPDG
RSAFALWFTGGIFVNQDGDRFVNESRAYDRAGREIIAQLQDGSITLPYWM
IYDDSEGEVPPVKAANVSIVETEKYVAAGLWHSADTLEELAAKIGVPGER
LAATVERFNGFAASGVDEDFGRGDEAFDRAFSAGASPLVPIDSPPYHAAA
FGISDLGTKGGLRTDAAARVLDTSGHPIPGLYAAGNTMAAPSGTAYPGGG
NPIGTSMLFSHLAVLDMRDRRS
379763675YP_005350072.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTDRDQLRAPLDAAALRAELIGTGLGWRQLDVVEQTGSTNADLLARAASG
ADVAGAVLIAEHQTAGRGRHGRGWSATPRAQITMSVGVSVVDVPSTGWGW
LPLATGVAVVDTVAPLLEGSAARVGLKWPNDVLAGPGDSPGKLAGILAEV
AKPVVVIGLGLNVTQSAEEIDGPGATSLLDLGVAEPDRTRLVSDLLRELG
RRIVAWRAARGADWALAADYRARSLTLGNRVRAHLPGGKQIDGTATAIDD
QGRLCLDSGGQTAVVAAGDVVHLR
379763674YP_005350071.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MGYPDNVLAAGEHVIVHRHPHWKRLIWPVLVLIVVTGLAAFGSGYLNSTH
WEQLAKNIIHGVIWGIWLVIVGWLTLWPFGSWLTTHFVVTNRRVMFRHGV
LTRTGIDIPLARINSVEFRDRITERMFRTGTLIIESASQDPLEFYDIPRL
REVHALLYHEVFDTLGSEESPS
379763673YP_005350070.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSFAEATIARLPRVLQPYLLRHHELIKFAIVGGTTFVIDSAIFYTLKLTI
LEPKPVTAKVIAGIVAVIASYVLNREWSFRNRGGRERHHEALLFFAFSGV
GVLLSMAPLWFSSYVLQLRVPTVSLAVENLADFISAYIIGNLLQMAFRFW
AFRRWVFPDQFARTPDKALESALTAGGIAEIFEDEIEGGNVTLLRAWRNR
AGRLGQLGDSSEPRVSKTS
379763672YP_005350069.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MVAMVGGGQLARMTHQAAIALGQTLRVLATDADESAALVAPDVVIGSHTD
LEDLRRVAEGADVLTFDHEHVPTELLDKLVAEGINVAPPPQALVHAQDKL
VMRRRLEALGVPVPRYAEIRSVDELDEFARGIAGPVVVKAIRGGYDGRGV
RMARDPVHAREIAAAFLADGVPVMAEEQVNLRRELSALVARSPFGQGAAW
PVVETVQRDGICVQVIAPAPDLPGDVSAEAQRLALRLAGELGVVGVLAVE
LFETGDGSLLVNELAMRPHNSGHWTMDGSRTSQFEQHLRAVLDYPLGDTD
ALAPVTVMANVLGAATPPQMSVDERLHHLFARMPDARVHLYGKQERPGRK
VGHINFVGLDPARESVAKLRERAHLAAHWLSHGQWTDGWDPHAGDDAERS
R
379763671YP_005350068.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTMTMSEQEARVGVIMGSDSDWSVMQDAAAALAEFDVPAEVRVVSAHRTP
QVMFDYARDAAGRGIEVIIAGAGGAAHLPGMVASATPLPVIGVPVPLARL
DGLDSLLSIVQMPAGVPVATVSIGGARNAGLLAVRILGSSDPALRARIVD
FQQQLAETVRAKDEALQQRRGKVTD
379763670YP_005350067.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAGWAGNPTFDLFQLPEEHTELRAAIRALAEKEIAPHAADVDENSRFPQE
ALEALNASGFNAVHVPEEYGGQGADSVAACIVIEEVARVDASASLIPAVN
KLGTMGLILRGSDELKKQVLPSIADGSAMASYALSEREAGSDAGSMRTRA
KADGDDWILNGAKCWITNGGKSSWYTVMAVTDPDKGANGISSFMVHKDDE
GFSVGPKEKKLGIKGSPTTELYFENCRIPGDRIIGEPGTGFKTALATLDH
TRPTIGAQAVGIAQGALDAAIAYTKDRKQFGRPVSDNQGVQFMLADMAMK
VESARLMVYHAAARAERGESHLGFISAASKCLASDVAMEVTTDAVQLFGG
AGYTVDFPVERMMRDAKITQIYEGTNQIQRVVMSRALLR
379763669YP_005350066.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MIPARAPVTPTASWQSLSLLLVEDDRADAVLVEDLISDAAADIRVVWAKS
MADAERELESARPDCVLLDLHLPDASGIDALDRVAKLDATVPIVVLTGLN
DEYFGASAVAAGAQDYLVKGRVEPEMLRRALLYAIERKRAELIAADLHAT
QLRARENALLERGLLPSPLLLDDPGVDIVARYRPSREGALLCGDFYDVVQ
TPDRIVHVLIGDVAGHGPHEAALGAALRIAFRTLTFAGVHGVDLMRQLER
VLYSERTGTGIFATVLSLEICPERPEVSVIRAGHPGMLLQGGGAVQWVEP
PGGPALGLRADGWPRHELEVPAGHGLLLLTDGLYEGYSGQGTERLGEDGL
LELARSHANRPGPAFVDALIDGAQELAEPRGGLTDDIAVLRIERTTT
379763668YP_005350065.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTAPAPLRLAQLTVRGWLALVLWIMGATVLLGAVVGGVLLDRTDQVSRQV
GEDIQPARVAATHLQAALRDQETGVRGYLITADRQFLAPYYDGQRAERAA
ADEIRRLVGGRAELIADLEAVETAAADWRTSYAEPVIAAVTPKVPSVVST
SMADLGKAKFDRLRVLFDTQNTHLADAAASAVDELNDINGWRDWVLGAMV
LIVLGAAALLGLLSRAAITRPIASLAAACRRITQGNFDEVISAPKRPKDI
RNMAIDVENMRKRMVEELDVSRSAQTLLDEQTAELRRSNTELEQFAYVAS
HDLQEPLRKVASFCQLLEKRYADKLDERGIEYIGFAVDGAKRMQALINDL
LTFSRVGRLGTTETEVQLDATLDAGLANLAVAIEETEAQIVRPTEPLPEI
VGDPTLLTMLWQNLIGNAIKFRHKDRPPRVVIECAPGEGTHDGEWLFSVS
DNGIGIPEEFSDKVFVIFQRLHGREVYAGTGVGLALVKKIVEHHGGTVRI
DTSYTEGTRFEFTLPMPGRVEEEDSVALEGAHQ
379763667YP_005350064.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTPEGRAIDILLVEDDPGDELITREAFEHNKLKNRLHVAHDGEEGLNYLY
RRGEFADAPRPDLILLDLNLPKYDGRQLLEKIKSDPELAQIPVVVLTTSS
AEEDILKSYKLHANAYVTKPVDLDQFMKAVRQIDEFFVQVVRLPTA
379763666YP_005350063.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MVGTRRKIVNALFWIGCVCCLAVVVVPTLWMLVEVVGRALPVFKWSVLTE
NTRGNGGGLRNAIIGTVVIGVGVMLVGGTVSVLTGIYLSEFAGGRTRSIL
RGAYEILSGIPSIVLGYVGYLALVVKFHWGFSLAAGVLTLSAMSIPYIAK
ATESALAQVPTAYREGAEALGLPLGWTLRKIVLKSAIPGIVTGLLVALAL
AVGETAPMLYTAGWSNSAPTGKLTDSPVGYLTYPIWTFYNLPSKAARDLS
YDAAFLLIVFVFLLIILGRMITWFARRHSESG
379763665YP_005350062.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTDIAMGGARARIRGARRPGLAIRSLGAAGAVVPLLALVFVLATLLLEAL
PAIRVNGLHFFTATEWNPGNTYGDAVVTRGVRHPVGAYYGALPLIVGTLA
TSAIALVIAVPVSIGAALVIVERLPKRLASAIGMVLELLAGIPSVIVGLW
GAMTFGPFIAHYVAPVIARNAPDVPVLSYLRGNTGNGEGLLVSGLVLAVM
VIPIIASTTRDLIRQVPVLPREGAVALGMTDWECARRVTLPWVSSGIVGA
VVLGLGRALGETMAVAMVSGAVLGAIPANIYATMTTIAATVVSQLDSAMT
DFTDFAVKTLAEVSLVLMVITLLTNVAARTMVRRVSGTALPVGRGV
379763664YP_005350061.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MLAMAATAPLVFAAAACGSNSQTGAPSQGGGGPVATTPASSPVTLSETGS
TLLYPLFNLWGPAYHDKYSNVTITTQGTGSGTGISQAAAGAVEIGASDAY
LSEGDMAAHKGLMNIALAISAQQVNYNLPGVTEHIKLNGKVLAGMYNGSV
KTWNDPQIAGLNPGVNLPATPVVPLHRSDGSGDTFLFTQYLSKQDPDGWG
KSPGFGTTVAFPTVPGALGENGNGGMVTGCADTPGCVAYIGISFLDQAQG
KGLGEAQLANASDKYLLPDAKSIQAAAAGFASKTPANQAISLINGPAPDG
YPIVNYEYAIVNSGQKDAATAQTLQAFLHWAISDGNNASFLDKVHFQPLP
ADVAKLSDAQIAKISGQ
379763663YP_005350060.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MKSRLGTLLGLVAIAPPVLGIAACGAHATRGAPSTGPAAGSVATAPATST
IELSETGSTLLYPLFSEWGAAYRAKHPNVTVTTQGSGSGAGISQAAAGAV
VIGASDAYLSAGDMAAHKGLMNIALAISAQQVNYNLPGVHQHLKLNGKVL
AGMYRGTIKTWNDPQIAGINPGLQLPAIPVVPLHRSDGSGSTFQFTQYLS
KQDPDGWGRSPGFGTTVSFPAVGEALGENGDGAMVTGCAANPGCVAYTSI
GSLDEADQHGLGEAKLGNASGKYLLPNAKSIQAAAAGVASKTPANQAISL
INGPATDGYPIVNYEYAIVNADQRDDATAQTLQAFLHWAITEGNGPSFLD
KVHFQPLPAEVVTLSDAQIAKIGG
379763662YP_005350059.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MRAVDLTLGFGPKTVLEQVSLDFPARSVTTLLGPTGSGKTTFLRTLNRMN
DKVSGFRHSGDVLLGGRTIFADRDLMEFRRSVGMLFQRPNPFPMSIMDNV
VAGVRAHKMAPRKQFKTVAEARLTEVGLWDAVKDRLGDSPFRLSGGQQQL
LCLARALAVNPDVLLLDEPTSSLDPTTTEKIEGLIRSLADRLTVIMVTHD
LAQAARTGDRTAFFFEGRLVEEGPTKQLFLSPQHEETVRYFAPFRPAQGS
DRGSSQTAGVAESQ
379763661YP_005350058.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MVAAVALALAGCGDNNSSSGSSGKQASVDCGGKKVLKDSGSTAQQNAIEQ
FVYAYVRACPGYTLDYDANGSGAGVTEFLNNQTDLAGSDVPLDPSTGQND
RAAQRCGSQAWDLPTVFGPIAVTYHLTGVSGLKLDGPTVAKIFNGTITKW
DDPALKAINSGLNLPSTPITVIFRSDKSGTTANFQKYLDGASDGAWGKGD
SEVFNGGVGQGASGNNGTSALLQNTEGSITYNEWSFAVGKQLNMASIITS
AGPDAVPITKDTVEKTIAGATFKGQGNDLVLDTSSFYKPTQSGAYPIVLA
TYEIVCSKYPDAATGKAVKAFMQAAIGPGQEGLDQYGSIPLPSSFTAKLS
GAVNAIS
379763660YP_005350057.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSDSGPASRAGSWFGPYRLVRLLRQGGMGEVYEAEDTRKHRMVALKLISQ
QFSGNSEFRARLQREADIAGRLTEPHVVPIHDYGEIDGRFYVDMRLVDGV
DLGTLLRRDGPLAAPRAIAIISQVAAALDAAHAIGVTHRDVTPGNILITG
SDFAYLADFGIARAATDPGLTQFGTAIGTYYYMAPERFTDDTVTHSADIY
SLACVLSECLTGSPPYRADTIERLVAAHLTKAPPSPSQLRPGAFPPALDQ
VIAKGMAKRPEERYRTAGEFAAAAHDALTTSEQRKATTILREGEDAVQRA
EASAQRPEREPQSWPAAETMAGPVAPRPGGTGWSERSGHHPSLIRPAPTT
FGHTYGSGPDFRSPAVPIDSKRKQWIIVGAIALVALVAFIVAVAGYLSTR
SSGPAQEASGQSVLPFNGIDFRLSPGGVALDSAGDVYVTSEGMYGRVVKL
TAGSNATTVLPFHGLYQPQGLAVDGAGTVYVADFNNRVVSLAAGSNDQKV
LPFSGLSYPEGVAVDSQGAVYVADRGNSRVVKLAAGSKTQTELPFNGLMN
PDGVAVDAAGTVYVADTDNNRIVKLDANSNTQAELPFQNVSVPWGIAVDN
SGTVYVTEHDKSDVLKFPAGSNTPTVLPFDGLNTPLAVAVDKERSVYIAD
RGNDRVVKLTP
379763659YP_005350056.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MLDFTQNIAGPMAGQVLADLGAEVIKVEAPVGEAARHITAVLPGRPPLAT
LFLPHNRGKKSVMADLRDDEAKQQIMRLVDTADVVLEGFRPGVMERMGLG
PDELQSRNPKLIYARLSAYGGNGPEGSRPGVDLMVAAESGMTTGMPTPTG
KPQIIPFQLVDAASGHVLAQAVLAALLNRERHGVADVVRVAMYDVAVSLQ
ASQLTIHLNKPNAEPKPSDSTPKPKRRKGVGFATQPSDAFKAADGYLVIS
AYVPKHWDKLCEIIGRPDMRDDERFIDQRARALNYPELTEELEKALAAKT
ADEWVRLLQDGGLMACHAYTWKQVVGTALFAENELALPVGEGEDAVTVIR
TPARYSSFDADATDPPPALGQHTEEYLGAPQPAS
379763658YP_005350055.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MARTDDDTWDLATSVGATATMVAAGRARATRDGLIDDRFAEPLVRAVGVD
FMTRWAAGELDSADVDEPGAAWGMQRMTDMMAARTRYIDAFFAEAGAAGI
GQVVILASGLDARAYRLPWPAGTTVFEIDQPQVLEFKAATIADLGAEPTA
EVRNVPVDLRHDWPSALRQAGFDAGRPAAWAAEGLIGFLPPEAQDRLLDN
ITDLSADGSQLVAEVFANTGTSGDALNAASEKWRQGGLDIALGDLGFPGP
RNDVATYLQQKGWQPVRTPLNQLLANTGLPLQSTDPEAPFAQNYYCTAVR
SAAR
379763657YP_005350054.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTTSAALTQECTAAHDAGWRRGAAWARRLAWISLAVVLVEGAVGLWQGLS
VGSIALTGWALGGASEALASAMVVWRFSGARTFSPSAERRAQRGVAVSFW
LTAPYIAAESIRELVGEHRAETSMIGIALTALALLLMPVLGRANHRLGAR
LGSGATEAEGIQNYLCGAQAAGVLIGLAATALWSSAWWIDPAVGLAIAGV
AVWQGVRAWRGEQCGC
379763656YP_005350053.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MDLALVPDVDDEVRAKDPALQVISDAAGRMRVAVAWVRADSRRAVAVEEA
VAKCEGVRVVHAYPRTGSVVVWYSPRRCDRSSVLAAIGDAAHVAAELIPA
RAPHSTEIRNADVLRMVIGGAALALLGMRRYVFARPPLLGPSGRLFATGV
TVFTGYPFLRGALRSLRSGKAGTDALVSAATVASLVLRENVVALTVLWLL
NIGEYLQDLTLRRTRRAISELLRGNQDTAWLRLDDGPTPREVQVPIDTVQ
IGDEVVVHDHVAIPVDGEVVDGEAVVNQSAITGENLPVSIVAGAHVHAGS
VVVRGRLVVRASAVGNQTTIGRIIARVEEAQHDRAPIQTVGENFSRRFVP
TSFIVSAITLAITGDVRRAMTMLLIACPCAVGLATPTAISAAIGNGARRG
ILIKGGSHLEQAGQVDAIVFDKTGTLTVGRPVVTNIIALHKDWQPEQVLA
YAASSEIHSRHPLAEAVIRSTEERHITIPPHEECEVLVGLGMRTWADGRT
LLLGSPGLLRSEKVRVSKKASEWVDRLRRQAETPLLLAVDGTLVGLISLR
DEVRPEAADVLKKLRANGIRRVVMLTGDHPDIAEVVARELGIDEWHAEVM
PEDKLAAVRELQDEGFIVGMVGDGINDAPALAAADIGIAMGLAGTDVAVE
TADVALANDDLHRLLDVRDLGARAVDVIRENYGMSIAVNAAGLIIGAGGA
LSPVLAAILHNASSVAVVANSSRLIRYRLDAPRNGSGN
379763655YP_005350052.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAVYGLLAKAAGTVVTGLVGVTAYEVVRKAVAKAPLHETAVKGAELGLRG
TRRAEEAAESARLRLADVMAEARERIGEEAPTPSIAEPHDHEH
379763654YP_005350051.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MQQPSTLSGAILDPMLRADPVGPRITYYDDATGERIELSGVTLANWAAKT
GNLLRDELGAGPASRVAILLPAHWQTAAVLFGVWWIGAEAVLAGPADLAL
CTTERLDEADDAVAGGEVAVLSLDAFGRPAPDLPIGVTDYATAVRVHGDQ
IVPEPRPGPALGGRSVDDVLADCQTSAAARGLTSSDRVLSGKPWTEPAEL
VDNLLAIMAVGASLVQVANADPDAQSRRIETEKVTRVL
379763653YP_005350050.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MIATVLTLAVVVGTGIAWSNVRSFEDGIFHMSAPSLGKGGDDGAIDILLV
GLDSRTDAHGNPLSQEELDTLRAGDEEATNTDTIILIRIPNNGKSATAIS
IPRDSYVAAPGLGKTKINGVYGQTREAKRASLVRAGDAAADAAAQGTEAG
REALIKTVADLTGVTVDHYAEIGLLGFSLITEALGGVDVCLKEPVFEPLS
GADFPAGPQRLSGPEALSFVRQRHELPRGDLDRVVRQQVVMASLAHRVIS
GKTLSSPTTVRRLEAAVQRSVVISAGWDVMDFVQQMQKLAGGNVAFATIP
VLDGAGWSDDGMQSVVRVDPHQVADWVNGLLHEQEEGKTEEIAYTPAKTT
ASVVNDTDINGLAAAVSDVLSAKGFATGTVGNNDGGHVKASQVRAAKSDD
MGAKEVSKELGGLPVIADASLAPGAVRVVLANDYSGPGSGLSGTETIMPA
RVSTAGAVATNPNVPPPSPILTAGSDKPECIN
379763652YP_005350049.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSGRIVIAGAGGQLGGYLSSLAADQGREVLAHSSSQWDITDPAAAERIVQ
RGDVVINCAAYTDVDGAETDEAGAFAVNEAGPGHIARACARAGAQLIHVS
TDYVFNGDFGGAAPRPYEPSDQTAPQGVYARSKAAGEQAVLAALPEAVVV
RTAWVYTGGAGKDFVAVMRRLAAGDGPVDVVDDQIGSPTYVGDLAAALLQ
IVDDRVPGPILHAANEGAVSRFEQARAVFEECGADPARVRPVGTDRFPRP
APRPAYSALSGGQSAAAGLRPLRPWRPALVAALAAADRPLPSTRD
379763651YP_005350048.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MLPVVTVTYSPGPHLERFLASLSLATEREVCVLLADNGSTDGTPQAAVDR
YPNVRLFHTGANLGYGTAVNRAVAQLDRDDEWVIVANPDVQWGPGSIDAL
LDAASRWPRAGALGPLVRDPDGSVYPSARHLPSLIRGGMHAVVGPFWKTN
PWSAAYRQERLEPSERPVGWLSGSCLLVRRSAFGQIGGFDERYFMYMEDV
DLGDRLGKAGWLSVYVPSAEVLHHKGHSTGGDPASHLAAHHKSTYMFLAD
RHAGWLRAPLRWALRASLAVRSRLMVRSAVRASGRAKLVEGRH
379763650YP_005350047.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MGTPQVDVVILVGGKGTRLRPLTLSAPKPMLPTAGLPFLTHLLSRVAAAG
IEHVILSTSYRAGVFEAEFGDGSKLGLQIEYVTEESPLGTGGGIANVAGH
LRHDTAMVFNGDVLSGADLGQMLDFHRAQESDVTLHLVRVGDPRAFGCVS
TEDGRVTAFLEKTQDPPTDQINAGCYVFSRRVIDRIPRGREVSVEREVFP
ALLSDPGVKVCGYVDASYWRDMGTPEDFVRGSADLVRGIAPSPALHGHRG
EQLVHDGAAVSPGAVLIGGTVVGRGAEIGPGVRLDGAVVFDGAKVEAGSV
IERSIIGFGARIGPRALIRDGVIGDGADIGARCELLRGARVWPGVSIPDG
GIRYSSDV
379763649YP_005350046.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSLRESVIATLSGWEPPDAGQDSLRHAVLAFVAARDDACRRECVPGHVTA
SALVLDDAGDRVLLTLHRRLGRWVQLGGHCDDDDADIVAAALREATEESG
VDGLRIEPELAAVHVHPVVCSLGVPTRHLDLQFVAHAPAGARIAISDESE
DLRWWPADELPEGTDHALAYLVSRALGRAPG
379763648YP_005350045.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MNFAGKAAASADKVRGGYYTPAPVARFLARWVREAGPKIVEPSCGDGAIL
RELAALSDRAQGVELIAREAAKARRFAPVDTDSLFTWMARAAEAGAGGWD
GVAGNPPYIRFGNWASQHRDPALELMRRAGLRPTRLTNAWVPFVVAAALL
VRDGGRVGLVLPAELLQVSYAAPLRDFLVSRFRDITLLTFQRLVFDGILQ
EVVLFCGIRDTVGSGPARIRTVHLPNADALARADLEAGWAPALLHENEKW
TKYFLDPAAIRLLRALKGSGALLPLGSVAEVDVGIVTGRNAFFTLTDAQA
AELGLRPHCVPLVSRSAQLSGLVYDTDCRASDLAAGHRGWLLNAPREPAD
PALIAHILAGEAAGVHRGYKCSIRTPWWRTPSLWAPDLFLLRQIHRAPRL
TVNGVGAVSTDTVHRVRLSGEDPADPAALAAVFHNSVTFAFAEIMGRSYG
GGVLELEPREAEQLPIPAPAHADPDLAVDVDLLLKAGEIDKALDLVDRRV
LIDGLGLPAEAVADCRRAWASLADRRKRRRTR
379763647YP_005350044.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTPSPGEHGTAAAIEILPVAGLPEFRPGDDLGAAVAAAAPWLRDGDVVVV
TSKAVSKCEGRLVPAPRDPEERDRLRRKLVDDEAVRVLARKGKTLITESR
IGLVQAAAGVDGSNVGRDELALLPVDPDGSAATLRAALRERLGVEVAVVI
TDTMGRAWRNGQTDAAVGAAGLAVLHGYSGALDQHGNELLVTEVAIADEI
AAAADLVKGKLTAMPVAVVRGLSVTDDGSTARDLLRPGTEDLFWLGTAEA
IDMGRREAQLLRRSVRRFSAEPVPADLVEAAVAEALTAPAPHHTRPVRFV
WLQHPGTRARLLDRMKDKWRSDLAGDGRPAEAIERRVARGQILYDAPEVV
IPILVPDGAHSYPDAARTDAEHTMFTVAVGAAVQALLVALAVRGLGSCWI
GSTIFAADLVRAELDLPADWEPLGAIAIGYAAEPAGPRDAADPGDLLIRK
379763646YP_005350043.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MKVTVLVGGVGGARFLLGIQQLFGLGQFHTQGRPDTKAGSHELTAIVNVG
DDAWIHGLRVCPDLDTCMYTLGGGVDPERGWGHRDETWHAKEELARYGVQ
PDWFGLGDRDLGTHLVRTQMLNAGYPLSQITTALCDRWQPGARLLPVTDD
RCETHVVITDPDDGGRRAIHFQEWWVRYRAQVPTHSFAFVGAEKAAATTE
ATAAIAEADVILLAPSNPVVSVGAILAVPGVRGALRAAKAPVVGYSPIIG
GKPLRGMADACLSVIGVESTAEAVGRHYGARRGTGILDGWLVSEGDGADI
EGVAVRSVPLVMTDPEATAEMVRAGLELAGVAF
379763645YP_005350042.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MASTPHTPIDSAPARPARPHLTVVPDAPGAFEPEPLPAPVADQWQDRALC
AQTDPEAFFPEKGGSTREAKKICLGCEVRHECLEYALEHDERFGIWGGLS
ERERRRLKRGII
379763644YP_005350041.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MRGALLPPSVPGWRSRAERFDMAVLEAYEPIERSWHDRLADLDVAVDEIP
RIAAKDPDSVQWPAEVIADGPIPLARLIPAGVDIRGNSTRARIVLFRKPI
ERRAKDTIELGDLLHEILVAQVAIYLDVEPSVIDPTIDDE
379763643YP_005350040.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MATLTFVYSDSTAVVGPLATAREPHSWDLCVNHAGRITAPRGWELVRHAG
PLPTHPDEDDLVALADAVREGGSGDRGAPYGGAPTPVNGFADPHLHHGGT
QATAPSSSVLAPPEHRSGRRRGHLRVLPDPSD
379763642YP_005350039.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MRGLVGEELDQPLVTDLGAAFARLMRAEGARQVVIGHDMRDSSPTLAAAF
AAGVTGQGLDVVRVGLASTDQLYFASGLLDCPGAMFTASHNPAAYNGIKL
CRAGAKPVGAESGLRVIADDVIAGVQGYDGPPGTVSDRDVLADYGQYLRS
LVDTSGLRPLRVAVDAGNGMAGLTTPAVLGPIASITLLPLYFELDGSFPN
HEANPLEPANLVDLQTFVRETGADIGLAFDGDADRCFVVDERGNPVSPST
VTSLVAARELGREIGATIIHNVITSRAVPELVSERGGTPLRSRVGHSYIK
ALMADTGAIFGGEHSAHYYFRDFWGADSGMLAALYVLAALGEQDRPLSEL
TADYQRYESSGEINFTVADAAQCTEAVLRSFGTRIHSLDHVDGVTVDLGD
GNWFNLRSSNTEPLLRLNVEGRTAEDVGAVVAQISAEIAAQTPRAGAAP
379763641YP_005350038.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MNATQAIDLEDTDGLLTADRDGLLRAASSAGAQVRAIATAVEEGALDPLS
AEDRPRSVIWVSGRGTAETAGAILAATLNSVASQPFTLAGEAPPWVGPLD
VLIVAGDDPGDPALVAAAATGVRRGARVVVAAPYEGPLRDATAGHAALLA
PRLGVPDEFGLCRYLAAGLAVVHAVDPRPSVDLALLADELDAEALRNSAA
RELFTNPAKLLAARIADRQIALAGDGAATLALARHGSSVLLRIANQVTPA
TGLADAVVALRAAASSGFGGAIADPDAALFHDEEIDGPLPPRLRVLAIIL
AAEQTVVAARTAGLDDVYLLAAEDVPDGPGGSAGSGVSPALGGPGRVEQQ
LAVLAVRLEMAAVYMRLVRG
379763640YP_005350037.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MELLRGALRTYAWGSRTAIAEFTERPVPAAHPEAELWFGAHPGDPAWLET
DNGEITLLEALDADPEGQLGPGSRARFGDVLPFLVKVLAADEPLSLQAHP
SAAQAAEGYLREERVGIPLTSPVRNYRDTSHKPELLVALHPFEALAGFRQ
VSRTVELLRALAVSDLDPFIDLLNDQSDADGLRALFTTWITAPQPDIDVL
VPAVLDGAIAYLSSGATEFAAEAKTVLELGERYPGDAGVLAALLLNRVSL
GPGEAIFVSAGNLHTYLRGFAVEVMANSDNVLRGGLTPKHVDVPELLRVL
DFAPTTEEQLRPHIRREGFGLIYETPTDEFAVALLDLEDEYVGHEVDATC
SHDGPQILLCIQGSTTVHGKSGSLTLKRGMAAWVAADDAPIRLVAHEPSK
LFRATVGL
379763639YP_005350036.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MPDSKADARDHALVIGGSIAGLCAARVLSDAYSRVTVYERDELPAFPANR
ATVPQDRHLHMLMARGAIEFENLFPGLLDDMVAAGVPKLKNRPDCIHLGA
AGHVLGTGQTLRDEFTAYVPSRPHLEWQLRKRVHDLDNVTIVRRSVAEPR
FDPARQRVTGALVDPADPDGGEPEFVGADLVVDAAGRGTRLPVWLAQWGF
ARPVEQAVDIGINYATQQFRIPDGLIAEKVVVAGASHDQSLGLGMLCYED
GTWVLTTFGVADVKPPRTFPEMLGLAGQLLPGRFSVALAQAEPLGDPAFH
AFPASRWRRYDKLERFPGGIIAFGDAVASFNPTFGQGMTMTSLQAGHLRR
ALQGPDDQLAATLHRATARSTFPVWMMNAIGDITFHHAGTKGPIPWWWRP
SGALFDQFLGAAETEPVLAEWFLRRFSLLDSLYMVPPPRIIGRAIAHNAR
LWLGERRQAVRQRRVATANAAAATASAAEPGEAGRRARHQPGAAGRHHQS
379763638YP_005350035.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MANRWRTKSVEQSIADTDEPDTKLRKDLTMWDLVVFGVAVVIGAGIFTVT
ASTTGDITGPSIWLSFVIAAGTCALAALCYAEFASTLPVAGSAYTFSYAT
FGEFLAWIIGWNLLLELAIGAAVVAKGWSSYLGTVFGFAGGTAEFGSAQV
DWGALVIVAGVATLIALGTKLSSRFSAVVTGIKVSVVLFVVVVGVFYIKR
ANYSPFVPKPEASSEAKGIDQSVLSLLTGAHSSHYGWYGVLAGASIVFFA
FIGFDIVATMAEETKHPQRDVPRGILASLGIVTLLYVAVAVVLSGMVSYT
QLKTVPGRGQANLATAFTANGIHWASKIISIGALAGLTTVVMVLMLGQCR
VLFAMARDGLLPRSLAKTGSRGTPVRITVLVALVVAVTASVFPITKLEEM
VNVGTLFAFVLVSAGVIVLRRTRPDLERGFKAPWVPLLPIASIAACVWLM
LNLTALTWVRFGVWLVVGTAIYVGYGYRHSVQGEREAAAPEPSDSLEADP
NSPVP
379763637YP_005350034.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MGLIAPTALFVMLPLVWALNRLGWHAAAQAPLWIGPILLYVLLPILDLRF
GPDGQNPPDEVMERLENDRYYRYCTYAFLPFQYLSVVFGAYLFTASNLSW
LGFDGPLGWAGKLGVALSVGVLGGVGINTAHEMGHKKDSLERWLSKITLA
QTCYGHFYIEHNRGHHVRVATPEDPASSRFGETFWEFLPRSVFGSLRSSL
RLEAQRIRRLGKNPWNPLTYPSNDVLNAWAMSVVLWGILIAVFGPALIPF
VIVQAVFGFSLLEAVNYLEHYGLLRQQNSSGRYERCTPAHSWNSDHVVTN
LFLYHLQRHSDHHANPTRRYQTLRSLDGSPNLPSGYASMISLTYFPPLWR
KVMDHRVLAHYDGDITRVNIQPRLREKLLARYGAQEARA
379763636YP_005350033.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTAYRCPGCDYIYDEAKGAPREGFPPGTPFSDIPDDWCCPDCAVREKVDF
ETSPIGVNR
379763635YP_005350032.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSEDYKLFVCVQCGFEYDEAKGWPEDGIAPGTRWADIPEDWSCPDCGAAK
TDFEMVEVARS
379763634YP_005350031.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MKRMPYAEASRALLRDSVLDAMREELLTRDWSAITLSDVARAAGISRQTI
YNEFGSRQGLAQGYGLRLADRLVDAVNAALGAHVGDIYAAFLQGFRDLFT
ELSADPLVISLLTGVAKPDLLQIITTGSAPIITRASERLTTALTHSWVAT
SDEDAGVLARAIVRLALSYVSMPPEADHDVAADLARLMTPFAERHGVVKV
P
379763633YP_005350030.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTTTENALTPDVRNGIDFKVADLSLADYGRRDIELSEQEMPGLMSLRREY
HDVQPLKGARISGSLHMTVQTAVLIETLVALGAEVRWASCNIFSTQDHAA
AAVVVGPHGTPEEPKGVPVYAWKGETLEEYWWAAEQVLTWPDEPANMILD
DGGDATMLVLRGAQYEKAGVVPPDDEDDSTEHRVFLNLLRKRFETDKDKW
TQIAASIKGVSEETTTGVLRLYQFAAAGDLAFPAINVNDSVTKSKFDNKY
GCRHSLIDGINRGTDVLIGGKKVLICGYGDVGKGSAESVAGQGARVTVTE
IDPINALQALMEGFDVKRVEDVIGEADIIITTTGNKDIITLEHMKAMKDK
AILGNIGHFDNEIQIARLEKSGATKTNIRPQVDLWTFPDTGKSIIVLSEG
RLLNLGNATGHPSFVMSNSFSNQVIAQIELWTKNDEYDNEVYRLPKHLDE
KVARIHVEALGGKLTKLTKEQAEYIGVDVDGPYKADHYRY
379763632YP_005350029.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MLIAIEGVDGAGKRTLTEGLLSAFEAAGRSVATLAFPRYGQSVTADIAAE
ALHGEHGDLASSVYAMATLFALDRAAAVQQLERLRRDNDVVIMDRYVASN
AAYTAARLHQDAGGPAVAWVHGLEYQRLGLPAPDWQVLLAVPAELAGQRA
RSRAASDPGRARDSYERDDGLQQRTGDVYAGLAATGWGGPWRVVDKDVDP
GGLAASLMAR
379763631YP_005350028.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MDSMRQRILVVDDDASLAEMLTIVLRGEGFDTAVIGDGTQALTAVRELRP
DLVLLDLMLPGMNGIDVCRVLRADSGVPIVMLTAKTDTVDVVLGLESGAD
DYIMKPFKPKELVARVRARLRRNDDEPAEMLSIADVEIDVPAHKVTRNGE
QISLTPLEFDLLVALARKPRQVFTRDVLLEQVWGYRHPADTRLVNVHVQR
LRAKVEKDPENPTVVLTVRGVGYKAGPP
379763630YP_005350027.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MGAVSRAVAIAWRRSLQLRVVALTLGLSLAVILALGFVLTSQVTNRVLDV
KVKAAIEQIERARTTVGGIVNGEEARSLDSSLQLARNTLTSKTDQASGAG
MAGAFDAVLMVPGDGPRAATTAGPVDQVPNSLRGFVKAGQASYQYATVHT
DGFSGPALIVGTPASSQVANLELYLIFPLKNEQATIQLVRGTMITGGAVL
LVLLAGIALLVSRQVVVPVRSASRIAERFAEGHLSERMPVRGEDDMARLA
MSFNDMAESLSRQITQLEEFGNLQRRFTSDVSHELRTPLTTVRMAADLIY
DHSADLDPTLARSTELMVSELDRFESLLNDLLEISRHDAGVAELSVEAVD
LRTTVRSALSNVGHLAEDAGIELQVDLPTHEVIAEVDTRRVERILRNLIA
NAIDHAEHKPVKIRMGADEDTVAVTVRDYGVGLRPGEEKLVFSRFWRADP
SRVRRSGGTGLGLAISIEDARLHQGRLEAWGEPGDGSCFRLTLPLVRGHK
VTTSPLPMKPIPQPSQPGGQSAPQSGSERKERPQRQREHAERTL
379763629YP_005350026.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MRRLLGLLMLAVLLAGCAGVPSSSAPQAIGTVERPAPSNLPKPTPGMDPD
VLLREFLKATADPANRHLAARQFLTQSASNSWDDAGSALLIDHVVFVETR
AAERVSATMRADILGSLSDMGVFETAEGVLPDPGPIELVKTSGGWRIDRL
PNGVFLDWQQFQATYKRNTLYFADPTGKTVVPDPRYVAVPDHDQLATELV
SKVIAGPRPEMAHTVRNLLAPPLRLRGPVTRADGGKNGIGRGYGGARVDL
EKLSTTDPHSRQLVAAQIIWTLARADIRGPYVINADGAPLDDRFRDGWTT
SDVAATDPGVADGAGAGLHALVNGSLVSLDGQHTSMVPGAFGRMGDQTGA
ALSRSGREVASVVTLHRGAPDMAASLWIGDLGQEAVQSADGHSLSRPTWS
LDDVVWVVVDGNNVLRAIQEPASGQPARIPVDSVAVATRFPGPITDLQLS
RDSTRAAMVIGGQVILASVEQTQAGQYALTYPRRLGFGLGNSVVSLSWRT
GDDIVVTRTDANHPVSYVNIDGVNSDAPARGLQMPVTTVVANPSTAYVAG
PEGVLQYSPSADGQQGWSDVPGLTIPGAAPVLPG
379763628YP_005350025.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MRLGLIPDTPEEWKALASGRVPVPFLQIHFAFGLAHAVITATRLGVFESL
TPQAATANETAKRCGIDPSATKKLLTALAGSGYLSVRADRYALTPTSRTW
LAAGSPHSLVDAVLFASEEWELMSHIENYVRSGTSIDIHERMTDDQWRHY
QRCMRALAGQTAEEVTRHIPVPCGATAMIDVGGSHGHYSVALCRRHARLH
AVVLDLPDAVRAAAPLLAAEQMGPRVTHLEADALTHDFGVDAYDLVLLSN
LAHHFNESQNADLFGRLGRALRPRGVFAVIEPIRPETGDVVEQLAALNEL
YFGITSRSGTWTARDIADWQRGAGLRPASAPIMLSDGDTGLQIATRPDGG
DPPRPASPRSRSPKV
379763627YP_005350024.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MLTEPLSIPGSDPINHAKFAPTQHFSDRQIAALNTRLVGDAVHPQHPDYQ
GARRIWNYMIDRNPAVVVRCATEADVATAIAFARDHAIPLTVKGGGHSVA
GHSMIDDGAVIDLSPIRRVTVDPDAGLVRVGGGCVLGDMDRATAPFGLAT
PAGVMSETGVAGLALGGGMGWLSRKYGLTCDHLLSARVVLADGRVVTAHH
DENPDLYWGLRGAGANFGVVTEFEFATQVVGRTVPLGIALYRLGHAADAI
AHHGQVVRRAGDDLKVMVYLRRAAAEPGVPDELVGAPVCAFVSVWTGDPA
EASDVHHELWAGAPRVSGAIQELPYLELQSLNDSELGPGACNYTKGGYVG
EIDGCIESLVESATRLPNQLSAIEFGYQHGAQDRVGEDDTAFADRHADHL
INVLGRWQPTDDARRHIDWVRATFAETTPWQTGGLYSNFMAVDDDDRVKD
AYRGGKYERLAIIKAKYDPENIFRNNPNILPAKATG
379763626YP_005350023.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MLFTKQLFSPDNLINQPLVGTPFVESLVRGFLLAANHPHRDALTGDAKYI
APQAIRTAIEIIEEEAHLPLTLSSIAARSHVSVRSLQQGFQRHLDTSPMA
YLREVRLRKAHQTLLESNPSTVTVASVAYRWGFTNLGRFASAHATRYGEA
PSATLRTAFRPRAINTRTAASVASASTGAEQVRI
379763625YP_005350022.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MMYPLVLDLADDGVPVTVTCRVLGFSTQAFYKWRKAPLSQRDWDDAHLIN
AARDIHADDPAFGYRFIADELPGRGIFASENRVARLCSQERIWSVFAKKR
GLNRRSGPPVHDDLVQRQFSAQAANQVWLADITEHRTDEGKLYLCAIKDV
YSNRMVGYSMDSRMKSSLAVAALDHAVALRSPAATIVHSDRGSQFRSRKF
VHALSHNGLHGSMGRVGACGDNAAMESFFALLQRNVLDRRRWSTRAELRL
AIVSWIERTYHRRRRQRALGRLTPIEFELLHTQAATAA
379763624YP_005350021.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MPRPFPAEFRADVIAVARKGEAPLRQIAKDFGISEACLHRWLKIADREDG
ANRLSPAAVSEDVSAQLREAHKRIKLLEQEAEVMRRAVGYLSRDANPK
379763623YP_005350020.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MWECPIVQSAALTESHAADQRDADLKLAAENVMSKAISNALVGIIYSPAP
KHGRRLCCRTIITNIFL
379763622YP_005350019.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MGHSHIANVLAALHHHHIAEDELLWPTLHARVPLRAEDVHRMETEHALIA
KLAGSVERWLAQWIATADSTPSQSRAAEALISEMTSLADLVGDHLNAEEE
RVVSRGQHNRRAATLPGRHAAAAEVAGEVVRTTRYGPLSRPS
379763621YP_005350018.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTIMPSSATHPDPRGVDDLVARFEHEALPLLDQLYRAARRYTRTHADAED
LVQETMLRAYAGFPSFKAGTNIRAWLFTIMNNTWINNHRTASRRPNEWLS
GEIGDVSVSVRTRYSHTGQLSAECEALELLGDDEVREALQKLPEGQRMAL
YYADVEGLRYKEIAAVLDMPLGSVMSRIHRGRQNLRKLLANFAIQRGYLR
EPDDAVIAA
379763620YP_005350017.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MKNKTTQPLSFRKHRVVVIGGGYSGALAANRLQQRPDVDITVVNARPIFV
ERIRLHEMVAGSGEATRDLAAMLGKTVRLIVGTVERIDFCHRRVELASGE
TLPYDYLIYAVGSTGAVPASVPGAHEFAYPIAELEQAERVRAVLAGLPAD
ASICVVGGGLTGIEAASELAEQRPTVHVTLLCGGTLAPSIGEKARRSVRR
QLTRLGVEVLDDAVVAEVDAGYVRLTDGRELPSALTVWTAGFGVPELAAR
SGLSTDGLGRLVTDETLTSIDDPRIVAAGDAAAPSNQPLRMGCQAALPLG
ATAANTVLDRIEGKQPGVINQAFVGQNISIGRRHGTIQLSYRDDTPRRIY
LVGKLAASVKEFVCRSTVKVITKEARKPGAFRWPSGDRDARAPQVVRQAA
PTA
379763619YP_005350016.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSNAPSFQGPDDGSYVLGHVDREVRRLLLQGRLYDDYTTYVLQLAGLRPG
MRVLDIGCGPGDVSFIASRLVGPTGRVLGVDASSDIIEFARARAREHGLN
NVGFEATAIADVFLDEPVDAVIGRMILMYLPDPVEALRRLATMVRPGGVI
AFCEMNSAVAGSLPDLPLWRSLVDSVVQAFRYAGCDTTFGVKLDAVFRRA
GLGAPRVRLGAVGGDTDVAIQLAETWRSMLPVAERAGLVSEELADLDTLA
QRLLDQAAAAQAITITPALIGAWARV
379763618YP_005350015.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MKVETRKFYEELGYPEQWLGEAERYRAEDAYVMFDPDWAEPLPPIPEETV
DVIVRANAGQRPDAPAIVYLGHTITYGELHALVGRAAAVLQSNGVRRGDV
VAVMVPTSAMHWIVFFALARLGAVHCGVNVMYRADELRFVLDDAEPRVIV
CLDKLLPVVERATVGAARTSVFTVSIADLADRGFAPYPSLDAWWPSSDEP
ETSSAPNLLDQMMKTRPRMHPAEVGDVRVEVGQIVYTAGTTGHPKGVLQS
HYNLIHNAITHTAAMPGVSTPVTVSILPLFHTGGFFVYSLPTFVRGGTVI
PRPLFEPGDFMGCVQQHAANVLFGPPTLYAALVQRGVERAALRGVRICAT
GAAPIPADLPRRWKAMTGLDLHGGWGMSELNSLGTFNALPGKPTPDTLGV
PVVGEVRVTVDGRVAARGTNGDIEFRGPQVSRGYLGRPEDTLESFGADGW
LRTGDIGYIDHADALHYVDRKKDLLVISGYNVSPAEIEATLLRHPRIAEA
AVVGESDPYRGEIPVAFVVGDVTPADVDAHCRAHLAAIKVPRRVEIVASL
PKNSMGKTLKRELPTRRTGE
379763617YP_005350014.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MMPNANELSVAARRRRERERNARRDSILAAAQETFSTRGFAGSTMEEVAL
RAEITKPTLYGYFRTKDELLLTLMLPVFADIGSQLQALQRDLEAGAIGSC
PQLIGHFLDAVLTPYRSDPERFRLTQLLHQTRLVETLDPDTLAALDTQGR
KDFTLARSILRTAVQLKLIRDVPVAPLADVIWGIVVGTIQVEDIKNRTGG
HAQHTATLQLAADLLAAALDPATEPGDPR
379763616YP_005350013.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSEDLADKVAIVTGAARGIGAAIARRLSVAGTIVVMTDLDRAELRSAAAQ
LAGPSTAVAIDLTAAGAPDAVVDAAVRAHGRLDIVVNNAGYTWDGPIHTM
SDEQFQAMLDIHTVAPFRLLRAAAQPMRTAAKEELAAKRLSHRKVVNVVS
LAGLMGQGGQVNYSAAKGATIAMTKALAKEWGHLGINVNAVAPGFIETRL
TAATDAGNRIEVAGRAHHLGISAAVRQSALATNRWGASDRRPRSPRPSRG
WPRPLRITSRATC
379763615YP_005350012.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MVTESNVVKYEERGRVAVVTLNRPEQRNAFDRELSAATLAAWDRIKADPD
IRVAIVTGAGPAFSGGADLKKLIPHIRAASDEDNRRRAWEGPGWAGISGG
YTINTPIIAAINGDCIAGGHELAEFCDIRITVPHARFGHQEIKWGLMPGD
GGCSRLPRIIGLGRAMELILTGRIYDAEEALRIGFVTKIVDPQELMPEAL
ALAETIASNGPLAVRAAKQTILRGIGRPLNDNIPFETETFSYLCKSDDWT
RGQRAFLAGETPDFQGR
379763614YP_005350011.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MADVRDMYLMHDTLRREFRLMPGLFRGVARGDTRRAAAVAAHADLLCRLL
HVHHEAEDAVLWPILRERAGTQATVVVAAMVEQHAAIDAALARAAELMPI
WRATARRGANLADVFDHLFTVLVEHTVMEEEQVLPLAKRCVTAQEWKQMA
KHGMHSFSAKDLLLCFGLMMHEGDPDVVKGALDDAPLAGRILIPRLGKRA
FASHAKRVHGNAAAQDR
379763613YP_005350010.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MPQGESTQLDQADIEARVLDIVYGHWRSQILRALATLSVADHLADGPLTA
AEVAAREGSLPDRTYRLMRAGVAIGMLRSTGQGLFESTPLLEAMQSGAPR
SLHPIIMGFTAPWHTLSVRLLADAIRTGIQPATTALGTDLFTFLEENPEQ
GREFSDLMAALTVHWAGDVADRLDTTDVRCAIDVGGATGSLLRQLQGRNP
QLRGVIFDRPNVAEKVAQSIAASGQAQRLDAVGGDFFVAVPPGDLYLLKM
ILHDWDDEHCVTILDRCREAMEPGGRVVIVEWIMGDPDDPGFAALMDLNM
LTSCQDGRERTLDEFDALLQGAGLRRTAIHRNPLGHSVIEARAK
379763612YP_005350009.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MELRQLEYFIAVASEMNFSRAAQRVHVVQSALSTSVSKLEKELGVELFDR
SKQQIKMTPAGELFREHARRVIHTARLAKDSIDDYRGELSGTVEIGSLIS
FGPLDVPKILGDFHRTYPFVRIILRLSPTGSMPHVSAIADGSLDLAFVSA
PDRFPAGVEMRLLCEEPMLFVCRPDHRLAQRKHIAIAELAHEDLIGFPAE
FGLRRVVENAFRAAGVTPRTPYEAAVNYWMAAGLVQHGLGTIFMPASDAG
RFPDLRAVPLQPEIVWPIFLATGGQAQIAPAAAKLAEMLLAAAPRPRRRS
KDK
379763611YP_005350008.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSIDDVGAPLDALTVIQCVAPPFLPANAEVMTVTVDYPPGCPGIAPHRHG
GPVFGFVLEGEMLFELEGEAPRVIKAGEAFWELGGDVIHYSDANNRADAP
LRFLATMMCAPGQPMLTFVDDDELERRCDRRVKARRE
379763610YP_005350007.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MLDLILPAECGGCGAPSSRWCEACATELAVRPDEPHVVNPRIDAGVPVFA
LGRYANARRQAILALKEHGRADLVAPLARALALGVHRLLSWGILDTPLTI
VPAPTRRSAARRRGGDPVLRLARAAVAQHPEIAVAQALRIKALTRDSVGL
GTAARERNITGRVVLCGRPPAADVMVVDDIVTTGATARESVRVLQAAGVR
VVAVLTIAAA
379763609YP_005350006.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MFKGRNVEIPDHYRLYVSQKLARLERFDRSIYLFDVELKHAPNRRQRKSC
QRVEITARGRGPVSRAEACANSFYAAFESAVDKLESRLRRVKDRRKVHYG
DKTPVSLAAATAVPPPEPARGAPEAPVDHGASNDGVDQDHEPGRIVRTKE
HPATPMTVDDALYEMELVGHDFFLFHDKHTERPCVVYRRHAYDYGLIRLG
379763608YP_005350005.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MIARLLLIALRALHRHRAGSESLATPILGDVALWAPNVDFLRQFA
379763607YP_005350004.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MLSKLLRLGEGRMLKRLRRVADYVNTLSDEIEKLTDAELRAKTDEFKKRH
ADGESLDDLLPEAFAVAREAAWRVLDQRPFDVQVMGAAALHFGNVAEMKT
GEGKTLTSVLPAYLNGIGGKGVHVVTVNDYLAKRDSEWMGRVHRFLGLDV
GVILAQMTPDERRVAYNADITYGTNNEFGFDYLRDNMAHSLDDLVQRGHN
FAIVDEVDSILIDEARTPLIISGPADGASNWYLEFARLAPLMQKDTHYEV
DLRKRTVGVHELGVEFVEDQLGIDNLYEAANSPLVSYLNNALKAKELFNR
DKDYIVRDGEVLIVDEFTGRVLYGRRYNEGMHQAIEAKEHVEIKAENQTL
ATITLQNYFRLYDKLAGMTGTAQTEAAELHEIYKLGVVPIPTNKPMIRAD
QSDLIYKTEEAKYIAVVDDVVERFEKGQPVLIGTTSVERSEYLSRQFQKR
RVPHNVLNAKFHEQEATIIAVAGRRGGVTVATNMAGRGTDIVLGGNVDFL
TDQRLRERGLDPVETPDEYEAAWHEELPKVKEEASKEAEEVIEAGGLYVL
GTERHESRRIDNQLRGRSGRQGDPGESRFYLSLGDELMRRFNGAALEAML
NRLNLPDDVPIEAKMVTRAIKSAQTQVEQQNFEVRKNVLKYDEVMNQQRK
VIYAERRRILEGENLKEQALDMVRDVVTAYVNGATADGYAEDWDLESLWT
ALKTLYPVGIDHAPLTHHDADSERDDLTREELLEALLKDAENAYAAREAE
LEEIAGEGAMRQLERNVLLNVIDRKWREHLYEMDYLKEGIGLRAMAQRDP
LVEYQREGYDMFMAMLEGMKEESVGFLFNVTVEAVPTPQVAPVQAPEGLE
EFATAAAAQQGGTTTAVREEAPSTLRAKGIDNQAPALTYSGPSEDGSAQV
QRNGGDAKTPAGVPAGASRRERRAAARQQGRGAKPPKSVKRR
379763606YP_005350003.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTTARTPLDAATAVLHHPVLPAGDDERFVGFGVLGLPFASGHYLALRQFP
ATSFSPGYRSVWHRDPHGAWTFYATTPGPQSCARFFSAATSRDAVQCDID
VAWVTPWSLFVAIPGLLAWQIDLHATWSTRLMSAVGARLPAWAWTNRAAL
AVLGRIAGPTLRAGRIRLAGTAPNGQRFMIAPAQVWAVGHSRAVLREVDL
GPVGPLRPQARLAGFRPPQRGVFAVGSGHFDSFDAARHEAVRRTAAIG
379763605YP_005350002.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MPESELPTRAELLAALSVAIDLGLGQPAEHMLRAALIATRLADRLGLCAD
ERDCAYYTTLIMWVGCHADSHEYARWFGDDIAVRHDSYLVDWSGIPYLRF
LASNVGRGQPLAHRMAVLATLFANARGHISRLIHSHCASAALLADRIGLS
PDVQAALAFAFERYDGGGLPAGARGETIPIQMRIAQLADMVEVHHRTYGV
AGAVAMVSSRRGGQFDPRVADAFLRDADAILAGPPAGDAWAAALGEAPDR
HQRLDDAALDALLVALGDFVDLKCPFTLGHSRAVARLAGDAALAAGMDTD
AVALTRRAGHVHDLGRIGVSNHIWSRQGPLSASEFERVRLHPYLTVRILN
QVPGLGRLAEVAGNHHECLDGSGYPRGLAGPALHMPDRILAAAVCYQSAR
EPRPYREPMSAGAAARRLRGRAQAGELDAVAVEAVLHAAGQPAQRPNLRP
DRLTPREVEVLCLVARGASNKEIAASLVISEKTARNHVERTYAKIGVSNR
IGASMYALRHGLVNPVPS
379763604YP_005350001.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MFKRAGEAHNQRMKRFLIVGYGAAAYLLFLAAFLYLVAFLGNFWVPRTVD
HGLPAPIGEAVLINIGLLAVFAVQHSVMARPSFKAWWTRIVPSPIERSTY
VVLSSAVLVLLYWQWRTMPAVVWDVRPPAGRLALWTLFWLGWAIALAATF
MVSHFDLFGLRQVYLAWRGKPYTHIGFHARMLYRLVRHPLMLGFVIVFWA
VPTMTAGHLLFSVAMTGYILVATHLEEHDLVEALGEQYRDYRRRVPMLLP
LGHRPRRDPAQPAELH
379763603YP_005350000.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MPVVDYEPETRDVPRTVPSCRPSSRTPLRRRGGHATPRSYTGQLSRAPAP
VMSARMRQAATFADAALRRVLEVIDRRRPAAQLHPLLSPSLVDSVVAVGR
SVAGRAPGHAGAAVLRRMRLQPAGHRDPDAAAEVFGSYSRGNRVHAIACR
VEQVGAASGARWMVVALHIG
379763602YP_005349999.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MVTRLSPPDASFYRLENTATPMYVGSLAILRRPRAGLSYETLLATVEQRL
PQIPRYRQKVREVPVGTARPVWIDDADFDITYHVRRSALPSPGSDGQLHE
LIARLAARPLDKSRPLWEMYLVEGLSKNRLALYTKSHQALINGMAALEIN
HVISDRTRRPPPAPEDIWIPERDPGNTRLVLGAIGEWLTGPSAQLQAVGS
AIGGLVTNYGELVGAGRRAFDFVRNLARGDAPSSPLNATVSRHRRFTVAT
GSLEDYRAVRARYDCDVNDVVLAVIAGALGNWLMSRGVAVSPTATVRAMA
PLSVYDDGDLDASGPGQAISQVMPFLVDLPVGEPNAVVRLSQIAHATESN
PTAAQLVDARTIVTLSGFAPPTLHAMGIRVATSFPSFSKRTFNLLITNAP
GAQSQMYVAGTKLLETYTVPPLLQNQALAIGVTSYNGMLYYGINADREAM
SDVDLLPGLLSQALEELLEASRS
379763601YP_005349998.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTVVYIPATLAMLQQLVADGSLRPVSGTAFALTPKLREAYAAGDDDELAD
VALREAALASLRLLAGEAPSDSRPPRRAVLAADVDFDASGVTYRPDLDDA
VVRLPGAVPIEDVIAAYVDNAGAEEAVARAIEAVDAADLGDEDAELIVGD
AQDHDLAWYANQELPFLLELM
379763600YP_005349997.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSVSKAPRREQELPLGKRNPSIAGNVVDTKRPVVAGADRHPGWHALRKLA
ARITTPLLPDDYLHLANPLWSARELRGRVVQVRRETEDSATLVIKPGWGF
NFDYQPGQYIGIGLLMDGRWRWRSYSLTSTPAATPARSGSARTVTITVKA
MPEGFLSSHLVAGVEPGTVVRLAAPQGNFVLPDPAPASILFLTAGSGITP
VMSMLRTLVRRNQIGDIAHLHSAPTESHVMFRGELAALQADHPGYRLQLR
ETRTQGRLDLSALDADVPDWRERQTWACGPEGLLTAAERVWSAAGIAERL
HLERFAVSKAAPAGAGGTVTFAQSGRTVAADAATSLMDAGESVGVQMPFG
CRMGICQSCVVGLVEGHVRDLRTGQEHDPGTRVQTCVSAASGDCVLDI
379763599YP_005349996.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTTMAISDVDVFAHLTDADIENLAVELDAIRQDVEDSRGERDARYIRRTI
AAQRALEVTGRLLLAASSRRSAWWAGTVTLGVAKIVENMEIGHNVMHGQW
DWMNDPEIHSSTWEWDMSGSSKHWRYTHNFVHHKYTNILGMDDDVGYGLL
RVTRDQRWKRFNIFNLVYNTLLALLFEWGVGLQHVELGKIAKRRMDNDEA
RERVDEFLAKAGRQVFKDYVAFPALTSLSPGATYMSTLKANALANVIRNV
WANAVIFCGHFPDGAEKFTKTDMIGETKGQWYLRQMLGSANFEAGPALRF
MSGNLCHQIEHHLYPDLPSNRLHEISVRVRQVCDKYDLPYTTGSFLFQYA
KTWRTLAKLSLPNKYLRDDADNAPETRSERMFDELEPGFLGTDPATGRRR
GLKSAIAAVRGWRRGKRAAVARSVDDGLAA
379763598YP_005349995.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MNRTGIEGYRDFLARRDGEADLLNRRLANRERFFGELEANPVRSAHPADR
QTFLRNLRRRRPEPGLDPKMLFLLATAKLNQAERFGVGLGETYGRNSDES
LPPENVYLELEEHYHTRLLAYALDVFDLTFQVVPPPFVMRQFVKTSVFLP
ERLGFLFVGAAEMAGCIMFDELRRVGGRLFADEPDVAQRIELLYSEILTD
EIGHVGYCASRCTSAERAIMRRIYPFIGRLFARQTAEIGLLVDKEALAAR
LDRPFDVDELTADLGNETYLVAHP
379763597YP_005349994.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MASARAASPANSAAASVREARRLETRARLFDAALSEISQRGFAAADVSAI
AAAAGVVRGTFYFHFPTKEHVLIEVERNEETRIISELGDAKGDLASVLSQ
VVQHVLRAERRLGDAVFRDMLGLHFSSTRPVEDELTQHPLAQFLVGVIGR
AQDEGQVPADADAAELGTFFLTGLFALLSTGAHDEALLGRYVATIVKGME
KR
379763596YP_005349993.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSASETKFEGIRVRYDSAKSYDALVGALLADIGESPVPIDDITTTTGDWQ
EYEGRIQNHAGPSGFMLFGTVDHGAWITKAGIDRKALRVILGNPLIAITM
LRHDVKAGLFAPVELLVADEGDDGSSVTYVKPSSLMVVEPNPELLSAAEQ
LDAKLAALAEKVTGGS
379763595YP_005349992.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MQLSPVLYSREGTVEKVVGKIAQLARRDVQFATFPETVIPYYPYFSFVQR
PFEMRPEHLRLLDQAVAIPSPAVDAIAEAARAAGMVVSIGVNERDGASLY
NTQLLFDADGTLLQRRRKIMPTYHERMVWGQGDGSGLRAVDSAVGRVGQL
ACYEHFNALARYALIADDEQIHSSMFPGSFGGDLFARQMEISVRNHALES
GAFVVNATAWLEADQQAQIMADTDCPIGPISGGHFTAIITPQGEYVGEPL
RTGEGDVIADLDLSLINTRKALMDAGGHYSRPETLSLLIDRTPRTQVHES
IGPEEVESVCV
379763594YP_005349991.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MNQGRDAVIVGAVRTPIGKGKASGALHDVLPADLLAHSLRELVTRTGVDP
AQVDDVIAGAVTQVGDQAVNIARNALLGAGFPETVPGVTIDRQCGSSQQA
ISFAAQGVIAGAYDLVIAAGVESMGRVPMGSQVSPGSNPFGEGMDARYPE
GLVPQGISAELIAAKWGFSRTELDEFSAGSHEKAARATKDGLFDNELIPI
AGLATDEIIRPGTTVQTLSGLQPAFYSEAAKARFPQINWEITPGNSSPLS
DGSAAVMITSSEVAQKLGLRPLARIHTTTVVGSDPLYMLTGVIPATEKVL
SKAGLTLADIDLFEVNEAFAPVVLAWAHDTGADLAKTNVNGGAIAIGHPL
GASGARIMTTLVNALEQRGGRYGLQTMCEGGGMANATIIERLG
379763593YP_005349990.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTLLQGPLADRDAWSAVGECAIEKTMGVVGTKSAMLIMREAYYGTTRFDD
FARRVGITKAATSARLAELVELGLLRRQPYREPGQRSRDEYVLTQAGIDF
MPVVWAMFEWGRHHLPGRHRLRLTHVGCGAEVSVEIRCAEGHLVPPDELG
MRLAKKPG
379763592YP_005349989.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MKPGDYDESDVKIRSGRGSRPRTKTRPEHADAQAAMVVSVDRGRWGCVLG
GDVDRRVTAMRARELGRTPIVVGDEVDVVGDLSGRTDTLARIVRRGERRT
VLRRTADDTDPTERVVVANADQLLIVVALADPPPRTGLVDRTLIAAYAGG
LTPILCLTKTDLAPPEPFAEQFVDLDLTVVVAGRDDPLLAVADLLAGKIT
VLLGHSGVGKSTLVNRLVPDADRAVGDVTDIGRGRHTSTQSVALPLATSG
WVIDTPGIRSFGLAHIQPDDVMMAFSDLADAIEDCPRGCGHMGPPADPEC
ALDTLTGPAARRVAAARRLLAALNQAS
379763591YP_005349988.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MHATVTVPGSKSQTNRTLVLAALAAAQGQGTPTISGALRSRDTDLMIGAL
RTLGLRVDGDGTELTVSGRVVPEPMAQVDCGLAGTVLRFVPPLAALAESI
VEFDGDEQARARPIAPLLDALRGLGVRIDGSGLPFRVLGTGAVPGGTVEI
DASASSQFVSGLLLCAASFAEGLTVRHTGSALPSAPHIAMTVTMLRQAGV
DVDDSVPNRWRVRPGPVAARHWVVEPDLTNAVPFLAAAVVTGGAVRITGW
PANSVQPAEHILAVLGKLNAVVTQHDSHLEARGSGDYGGFDVDLRAVGEL
TPSVAALAALAAPGSVSRLSGIAHLRGHETDRLAALSAEINRLGGDCTET
PDGLVITATPLRPGVWRAYADHRMAMAGAIVGLRVAGVEVDDIGATTKTL
PDFPRLWADMLTAQEDRGM
379763590YP_005349987.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MCGRFAVTTDPALLAQKIKAIDETTGADADSSAPNYNVAPTSTIATVVSR
HSEPEDEPTRRVRLMRWGLVPPWAKAGADGAPETKGPMLINARADKVTSS
PAFRTSAKSKRCLIPMDGYYEWRVNSDAAAGKKSRKTPFFMYREDGEPLF
MAGLWSVWKPAKDASPLLSCTIITTDAPGELAQIHDRMPLVMPERDWDRW
LDPDAPIDEKLLARTPDVRAIRTREVSTLVNNVRNNGPQLLEPAEPEPEQ
MKIL
379763589YP_005349986.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTIASTDRSGPQTPYLLIRGTARVEEGGAPELLDKIATTIFGPGTGFPPP
DAPPGYLTHITIEKVGGVGPWAA
379763588YP_005349985.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MGVSDADTIQTEGNYPTREACQNAGPGVKATAPGSWNNFWCVADRNVNGN
WKSVLSN
379763587YP_005349984.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAASTRSRKRDGDERRRDLCDAAIRVLAEHGSRGLTHGQVDRCAGVPEGT
TSYYYRTRTALLRGVGKRVAEIDVANLQSVIDEPVDPVSPFAHLARLTMM
QADGTGLMLNRARHELLLGAARDPDLAETAQVFVARINAMARDAIAHLQP
DTRDPELLAAQTTAVTTFIAGIFTRLAAGDRTVGAAEQLTHLLEAVATAV
ALAAQRG
379763586YP_005349983.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MGLQGLIDKVAVVVGGATGIGAATAARLAGEGCRVIVGDVADDCARRTAE
RIAATGGAATHVAFDLADPASVAALIDTAATTFGGVDLLFNVGADMSIIR
ADTDVVDIDFDVWDRVMAVNLRGYVAAMKYAIPRMLDRGGGAIVNMSSAA
AFQGEPARPAYATAKAGIGALTRHVASRWGKDNIRCNAVAPGFTATETIR
SVPQWPDLEAGALKRIRGPRVGEPGDIAALVAFLLSREGEWINGQVVNID
GGTVLR
379763585YP_005349982.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAGIHRERPGAGDLSAATDTPALALGDGVWMSPGVSNAYAVATDEGRVIV
NSGLVFEGPLHRKAFAKVPGPTRAIIVTQGHADHWGGVKALRDEGTNVVM
HRNYRYWRDDNTLLMGYRVPKTSFAFQKFSDAVLEHFKTLDPATIDFSFP
EPTTTFDQRHNITVGGRTFELAWTPGGETTDALVVWLPQERILFTGNLFG
PLFGHVPNLMTIRGDRYRDPILYIESLNTVLDYGPQRLITGHFDPIEGAD
RIAEEVSAMRDAMQAVHDRTAELMNSGADVHTAMREVTVPEHLDIGEGYG
KTSWNVRAIWEMYTGWFRHRSTTELYGIAPDSVAADVVSAAGADALVDAA
RAHLAVGRPVQAIHLTDLILAAQPLHAAARAVAAEAHEALLADADNFWEK
AWLTKSINELRSPE
379763584YP_005349981.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MNTVNFDFTGATVLVTGGTSGIGNAIAAAFAGAGAAVTVTGTRGSATDYS
ETDLSAYTYRQCQIQDPKLVDALADSLGELDILINNAGGPYPAGDEYDPD
GYVASVTQNMFGPMRLTMRCHDLLKSSQAPGGASVVSVVSMSAFRSAVFV
PGYASSKMGLLALTMNLSRRWANDGIRVNAIAPGLIDTRMTHPAMGIPEV
MDVEIGFHTPLGRPGTPQDCAGATLFLCTDAASYITGTTIAVDGGYLTV
379763583YP_005349980.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSDNNFDNVSTTDDVFKLAAQRTGLTEIDSDSWRDGLAIMLDELNSSAAF
TPFGRERVLTDATDALGRRMQVHAYIQEHPEVLDAPVERPLIVLGMPRTG
TTVISYLLDQDPARRSLLHWQCVHPIPPATTEALRTDARCLALLEEQRKI
LDMVTQAKVPLPHWEDADGPTEDMFIHNQDFKGLSWDSFLSTSRYAEWLF
HEADMTSTYEYQKRYLQVLQSTAPGNWSLKMPSHSVHIEALLKVFPDARL
IWAHRDPYRATGSLCNLWKLPKGMVLHPDAIDLNAMGRNAMAQMRYHVQR
PLRARDRIGDERFFHMYYHEMMRDPMDVMRRIYEWADEPLTAETEARMRN
WLAGHPQDRFALNAYTLDQYGLTVEALEPIFAEYLDTFDIELEGTA
379763582YP_005349979.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MNPADCYHTGLVVDDMAAAAERLTRVMGYRWTKPVDAALSVATADGDIEV
PFRFVYSVDAPHLEVIQAVPGTIWTPPPRGGAHHLGYWVDDMAGAAAQLE
RSGYRLEARPSGETLSMFAYYVDPAGVRIEIVDRALFPDWPGFLQSMAA
379763581YP_005349978.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MKMSMVTGPGKAEVLDAERPTVGPNDVLVRMRACGICGSDAFYITIGGLP
PRQGHTPLGHEPAGEIAEVGAKVSGLAVGDHVVINPMAAPSGIIGNGGPS
GALADYLLIENAVRGTSLEVIPDHVPWEVAALNEPMAVARHGANRCRPKP
TDKVAVFGAGPIGLGATLAFKSLGVSHVVVVDLLPGRLDKALQIGADAVI
NSADEDVVARLIELHGAGDSMYPGKAGTNIYLDAAGVPAVVNTALAAAQK
GATVGIVGVHKEPVPVDLINLMSNEITLLGSMGYPDEIFEVTKDLVANWE
KYALIVSHTIPFGSVGDALELAQTPGAADKVVVTFG
379763580YP_005349977.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MGGAATPGIAALMKAGVPHQVLHFDAVTDLSESSDVAPEQVFKTLIVALP
GELAVAIVPVPWRLSLKAVAAALGVPKAVMAEPAAAERATGYVVGGISPF
GQRKRLRTVLDGSALRWDRILCSAGKRHYDVAVAPRDLIRLTGAITADIS
RT
379763579YP_005349976.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSLNGKTMFISGASRGIGLAIAKRAAQDGANIALIAKTAEPHPKLPGTVF
TAAKELEEAGGQALPIVGDVRDPDSVEAAVAKTVEQFGGIDICVNNASAI
NLGSVTEVPMKRFDLMNGIQVRGTYAVSQACIPHLKGRENPHILTLSPPV
LLGREWLKPTAYMMAKFGMTLCALGIAEEMRDEGIASNTLWPRTLVATAA
VQNLLGGDEAMGRARKPEVYSDAAYVVLNKPSREYTGNMLLCEDVLVESG
VKDLSTYDCVPGSKLGVDFWVDGVNPPGYSGP
379763578YP_005349975.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTHRIENQLDQPRARSDYFRAEFGPRYRCPLPGVDPDRTDSGVALV
379763577YP_005349974.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MADSLDGRDSAAGPSITEPAAPEETDAELTARFERDAIPLLDQLYGGALR
MTRNPADAEDLLQETMVKAYAGFRSFRAGTNLKAWLYRILTNTYINSYRK
KQRQPAEYPTEEITDWQLAANAEHSSTGLRSAEVEALESLPDSEIKDALQ
ALPEEFRMAVYYADVEGFPYKEIAEIMDTPIGTVMSRLHRGRRQLRGLLA
DVAKERGFNRGQQAHEEVSS
379763576YP_005349973.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSEFAGQGGASADACPNDESHGSVGCAEVIRQVWLLLDGECGPDTREQLR
RHLEACPGCFKHYGLEERIKALIATKCKGERAPEGLRERLRLEIRRTTII
RGTQ
379763575YP_005349972.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MKMAEDVRAEIVASVLEVVVNEGDQIGKGDIVVLLESMKMEIPVLAEVGG
TVSKVSVSVGDVIQAGDLIAVIS
379763574YP_005349971.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSTLGDLLAEHTMLPGNAVDHLHAVVGEWQLLADLSFADYLMWVRRDDGV
LVCVAQCRPNTAPTVLQTDAVGTAIASERLSLVADTFASGTAKRDDVAGQ
ENSWLPGTHVEASPVRYGGQVVAVLTHHQTAVAADRASGQLEIAYRQCAG
DLVHMLAEGTFPDAGDVVMSRSTPRVGDGFIRLDVKGVVDYASPNALSAY
HRMGLTADLEGHNLIEVTRPLISDPFEAQEVAEHVRDLVAGGRSMRMEVD
AGGATVLLRTLPLVVDGASAGAAVLIRDVTEVKRRDRALISKDATIREIH
HRVKNNLQTVAALLRLQARRTANAEGREALIESVRRVSSIALVHDALSMS
VDEQVNLDEVIDRILPIMNDVASVDRPIRINRVGDLGVLDSDRATALIMV
ITELVQNAIEHAFDPAVEEGSVTIRAERSARWLDVVVHDDGRGLPDGFSL
ETSDSLGLQIVRTLVSAELDGTLGMTQAPARGTDVVLRVPIGRRTRMLL
379763573YP_005349970.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MDWRHKAVCRDEDPELFFPVGNSGPALAQIADAKLVCNRCPVTTECLGWA
LNTGQDSGVWGGMSEDERRALKRRNARTKARSGV
379763572YP_005349969.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MRAVLIVNPTATSTTPAGRDLLAHALKSRLQLSVEHTNHRGHGTELAQKA
VADGVDLVVVHGGDGTVSGVVNGLLGRPGTLPSGPVPAVAVVPGGSANVL
ARSLGISADPVAATNQLIQLLDDYQRRGTWRRIGLIDCGERWAVFNTGMG
VDAEVVAAVEAERSKGGKVTAWRYIRASVPAVWAYTRREPMLTLELPGRE
PITGVSFAFVSNSSPWTFANERPVWTNPGCSFESGLGVFAPTNLKTIPTL
RIVRQMFAKRPAFNFKHLVTEDDLPCVRVTSTGGPVACQFDGDYLGVRET
MTFKSVPDALAVAAPPQQKRR
379763571YP_005349968.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTPPSAPTAVRRAGVVVAVQGMAALIVAVVLVVRGIAGADQHVANGLATA
GWFVLVGAGVIAAGRALMLGKRWGRGLAVITQLLLLPVAWYLAVGSHQPG
YGIPAGLVALVVLGLLFSPAAVRWAAGGQGDSASPANRDPDSR
379763570YP_005349967.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTTDIRRAAPHDVAAITEMIHALAEFEHAADQCTVTETQISAALFGDRPT
VYGHVAEVDGEVAAMALWFVNFSTWDGVAGIYLEDLFVRPGFRRRGLARA
LLAALANECVQRGYTRLSWAVLNWNTDAITLYDGIGGEPQNEWTTYRLSG
SRLAGLAESP
379763569YP_005349966.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MNREPPFALCGPTRTLIADGVSRRYCDVGAAQAALRSNQAPIVLGALPFD
LSSPAALLTPRAVDVTHGLPDWPTGPLPPVRVAAALPPPGDYRDRVRRAR
DQLAAADNPLHKVVLARALELVADAPMDARAVLRRLVAADPAAYGYLVDL
SAAGDGYAGVALVGASPELLVARSGDRVECRPFAGSAPRAADPDADAANG
AALAASAKNRHEHQLVIETIRAALQPLCDDLSIAAEPQLSRTAAVWHLCT
PISGRLRDTSTSAIDLALALHPTPAVGGVPTDAAVQLIAELEGDRGFYAG
AVGWCDAAGDGRWVVSLRCAQLSADRRSALARAGGGIVAESDPDDEVAET
TTKFATILNALEVQR
379763568YP_005349965.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MGLHDHRLVLLRHGETEWSKSGQHTGRTEVELTDAGREQAQLAAGVLGEL
KLVDPLVISSPRRRSLVTAELAGLSVDDATEQLAEWDYGSYEGLTTEQIR
ESVPDWLVWTHGCPGGESVAQVSERADAAVTTALRHMESRDVVFVSHGHF
SRAVITRWVELPLVEGSRFGMITASVAVCGFEHGVRQLRALGLTGQ
379763567YP_005349964.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAVANQKGGVAKTTTVASLGAAMVEEKKRVLLVDLDPQGCLTFSLGQDPD
KLPVSVHEVLLGEVEPNAALVETAEGMTLLPANIDLAGAEAMLLMRAGRE
YALKRALAKLADRFDVVIIDCPPSLGVLTLNGLTAADEVIVPLQCETLAH
RGVGQFLRTVADVQQITNPELRLLGALPTLYDSRTTHTRDVLLDVADRYS
LPVLAPPIPRTVRFAEASASGSSVMAGRKNKGASAYGELATALLRHWKNG
KPLPTFAVEV
379763566YP_005349963.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MVRPERRTKRDILAAATIAVVVAVTAALIWWTSDARATSSRPAAVPAPNP
SPARQVPAGLKQLWTASSPATTEPVVVGGVVVTGAGVRIDGRDAGTGQSR
WSYARDTSLCGVSWLYRYAVGVYRDDRGCGQVSTLDGSTGHRGPARSGYA
DPRVRLSSDGMTVLSVGDTRLELWRSDMVRMVAYGETDARVKPSSRGLHS
GCRLISAAASSSAVSVLESCANQADLRLVLLRPGKDDDEPQQHVVAEPGI
APDSGARVLAVRDTTTAVYLPAPQPRVDVIDETGATVASTLLPKPPSRSA
AVSHAGSLMTWWTGDSLMVFDVNTLALRYTIAAGDKTAPLGPGVMMAGRL
LVPVTGAIGVYDPVSGTGERYIPVDRAANPPPPGRAVVPAVSGSRVFEQR
GDTVVALG
379763565YP_005349962.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTTLTSTTELTFAQLGVRDEIVRALAEKGIESPFAIQELTLPLALAGDDL
IGQARTGMGKTFAFGVPLLQRITSGTAARPLNGTPRALIVVPTRELCLQV
TDDLALAAKHLTADEGRRLSVVPIYGGRPYEAQIEALRAGADVVVGTPGR
LLDLSQQGHLQLGGLSVLVLDEADEMLDLGFLPDIERILRQIPVDRQSML
FSATMPDPIITLARTFMNQPTHIRAEAPHSAATHDTTVQYAYRAHALDKV
ELVSRILQAEGRGATMIFTRTKRTAQKVADELAERGFAVGAVHGDLGQVA
REKALKAFRTGDIDVLVATDVAARGIDIDDVTHVINYQIPEDEQAYVHRI
GRTGRAGKTGVAVTLVDWDELTRWALIDKALGLDNPEPAETYSSSPHLYD
ELSIPADAGGTVGAARKAQGARRTGERATQKPGQKSEKTARRSGTRRRTR
GGQPVSAHPSGNGAASSNGDAAAETPAGSPPGNAGSSRRRRRRRKPAEAA
AAAPTAQNN
379763564YP_005349961.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSADHPGVNELFAVLAYGEIAAFYRLTDEARMAPDLRGRISMASMAAAEM
QHYEQLRDALESRGVDVVSAMSKYVSALENYHRLTMPSTWLEALVKTYVG
DALAADLYLEIADGLPDEVADVVRGALAETGHSQFVVAEVRAAVTSSGKQ
RSRLALWSRRLFGEAITQAQYLLADHDELVDLVMSGAGGLGQLNAFFDRL
QQTHDRRMHELGLS
379763563YP_005349960.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MQVVSHTRAIPDPRFRMANFGPMGTTLPHLDDRIRSYPDDDADDCDTDPY
LNADYNWTGWPADSRWRPATAILGAVVAVGAIATAVIINSGDSASTKATL
GAPAPHPVTSAPATTKASAPPSPSRVAQLPPETVTTVTTPSAAPSTPAAQ
TPTAAPPLAPAPPTAALNPRTVVYSVSGTKQLLDLVNVVYTDARGVPQSE
FNVSLPWSKVVVLNPGVQTESVVATSFYGQLSCSVFNAAGQRIMASGSPS
NMATCSR
379763562YP_005349959.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTVEVKIGITDSPRELVLASDQTPAEVEDLVSAALGEGSGLLRLSDERGR
RFLIHTSKIAYVEIGVADARRVGFGIGAEIEAGKHAGKGR
379763561YP_005349958.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSELAKMPARRAVRSADRGRPADGAAAPNRRGNRLPRDERRGQLLIVASD
VFVDRGYHAAGMDEIADRAGVSKPVLYQHFTSKLELYLAVLARHVENLVS
GVQQALSTTKDNRRRLHAAVQAFFDFIEHDSQGYRLIFENDYVTEPEVAA
QVRVATESCIDAVFALISEDSGLDPHRARMIAVGLVGISVDCARYWLDSD
RPISKADAVEGTVQFAWGGLSHVPLTRS
379763560YP_005349957.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MELPPSASSYLAEAVSGAGFGRATVGVGGPLCNPGKMTSQRPPRSSGRVP
VLRDEWREPLRALRDPLAAPEAGRARADRERQRQWRKQTWLGRFVSTYGW
RAYALPVLAVLTAVVMYQTVTGAGASKPTNSQPIESPPAIGAVGTTIIDA
PPRGLAAFDANLPAGTLPDGGPFTEAGDKTWHAVPGATPQFGQGTAKVFR
YTVEVENGIDPTMFGDDEAFAQMVDQTLANPKGWTHNPQFAFIRIDGASG
AKPDFRISLVSPVTVREGCGYEFRLETSCYNPVFGANREARVFINEARWV
RGAVPFEGDIGSYRQYVINHEVGHAIGYLHHEACEQQGALAPVMMQQTFS
TSNNDAAQFDPDTVKADGKTCRFNPWPYPIA
379763559YP_005349956.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MLSVSSLPPLVAPADHLTGDEVARYSRHLIIPGLGVDGQKRLKNARVLVI
GAGGLGAPTLLYLAAAGVGTIGIVEFDVVEESNLHRQIIHGVADVGRPKA
VSARESMLAINPLVDVRLHEVRLDSTNAVELFSCYDLIVDGTDNFATRYL
INDAAVLAKKPYVWGSIYQFEGQISVCWEDAPDGRGLNYRDLYPEPPPPG
TVPSCAEGGVLGIVCASIASVMSTEVIKLITGIGDSLLGRLMIYDALQMT
YRTIAIRRDPSDASRPKITELVDYEQLCGATADTPAGDATAITPRELREL
LDSGKELALIDVREPVEFDIVHIEGAQLVPQSSINSGEGLAKLPRDRMPV
LYCKTGVRSAQALAVLKQAGFADAVHLEGGIVAWAQQMQPDMILY
379763558YP_005349955.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MLSAFGLAGVKPIYLGASWEGGWRCGEVVLSLVADNARAAWSARVRETLF
VDGVRLARPVRSTDGRYVVSGWRADTFVAGTPEPRHDEVVSAAVRLHEAT
GKLERPRFLTQGPAAPWGDVDIFIAADRAAWEERPLASVPPGARVAPATA
DAERSVELLNQLATLRKPTKSPNQLVHGDLYGTVLFVGTAAPGITDITPY
WRPASWAAGVAVIDALSWGEADDGLIERWNALPEWPQMLLRALMFRLAVH
ALHPRSTAEAFPGLARTAALVRLVL
379763557YP_005349954.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAPVTDDQVERVRALVAAIPSGRVATYGDIASVAGLSSPRIVGWIMRTDS
SDLPWHRVITASGRPARHLTTRQLELLRAEGVLARDGRIALGEVRYEFPD
GA
379763556YP_005349953.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTAKLYVHRYGPSGPARILALHGLTGHGQRWQHLSGLLPEIGLAAPDLLG
HGRSSWAAPWTIDANVSALSALLDAQPGTPVVVVGHSFGAGLAMHLAAAR
PSQVSGLLLLDPAIGLDGAWMREIAEAMLSSPDYPDAEEARLEKVHGSWS
DVEPALLEAELDEHLVALPNGRYGWRISLPAMMAYWSELARDAVLPQAQT
PTILVRAKRTSPPYVTDELIAGLAQRLGSRFRLLDFDCNHMVPYAKPDDV
AALARELLEAR
379763555YP_005349952.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MVSRLQKEGLTTMTDEHGFPIDEAPEGDAVEQLRPADSDDDAGLDTDYVS
ARDREANEADVIEQAYVVSADDDRDDDR
379763554YP_005349951.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAHTWEADASAVLAPGARGIVRVLGGPGTGKSSLLIDAAVARIDAGIDPE
SVLLLTGSGRLGMAERSALTTALLRSRPGRVAVSEPLVRTVHGYAYAVLR
RAAERAGDAPPRLVTSAEQDAIIRELLAGDLDDGPRATSAWPAQLRPALS
TAGFATELRNLLARCAERGIDPGELERLGRRCRRPEWIAAGQFARQYEQV
MLLRAAVGTAAPEATTPALGAAELVGAALEAFAVDPELLAAERGRIRVLL
VDDVQQLDPQAARLVRVLAAGAELALIAGDPNQAVFGFRGGEPAGLLDGD
GPAVTLTTSHRCAPAVARAVSGIAARLPGGGAGRRIDGAGAGEGSVTVRL
AASAHAEAAAIADALRRAHLVDGVPWSQMAVIVRSVPRAGARLPRALAAA
GVPVAAAAATGPLAEEPAVRALLTVLLAAADGLDGQQALALLTGPIGRVD
PVSLRQLRRTLQRANPDRPPGDFAELLVETLSGAVPPGPQFRSLRKVRAV
LDAAARCHEAGEDPRYTLWAAWDRSGLQRRWLSVSERGGPAAAQATRDLE
SVTALFDITDDYVSRTSGASLRGLVEHVAALHLPNANPEPAATAGQVRVL
SAHAALGHEWDFVVIAGLQDGLWPNTVPRGGVLGTQRLLDELDGVTADAS
MRAPLVAEERRLLVAAMGRARRRLLVTAVDSDTGGADHAAALPSPFFFDI
AQWADEDVETTALQPVSAPRVLSAAALVGRLRGVVCAPDGAVDELARDCA
ATQLARLAKAGVPGADPAGWHGLTPVSTGEPLRGGGDVVTLTPSTLQTLT
DCPLRWLAERHGGTNPRDLRSTIGSVVHALIAEPHRSESELLAELERAWQ
HLPFAAQWHSDNELARHRAMLEAFVEWRSQSRGALTEVGVEVEIDGTLQT
GDGEQVRLRGRVDRLERDAAGRLVIVDVKTGKSPVSKDDAQQHAQLAMYQ
LAVSEGLVAPGGDTVEPGGARLVYVGKAGAAGAVEREQDPLTADAGDEWR
QVIRRAAAATAGPQFVARRNDGCTHCPIRPCCPAHTDGAAR
379763553YP_005349950.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MNARYNPSELACALGLFPPTEEQSAVIAAPPGPLVVIAGAGAGKTETMAA
RVVWLIANGYAEPAQVLGLTFTRKAAGQLLRRVRSRLARLAGVGLGPVGD
AVAEPEGAPVISTYHAFAGSLLRDYGLLLPVEPDTRLLSETELWQLAFDV
VNGYRGELHTDKTPAAVTSMVLRLWGQLAEHLVDTGQLRDTHVELERLVH
GLPAGPYQRERGPSQWLLRLLGTQTERAELVPLLDALDERMRAEKVMDFG
MQMASAARLAAGFPQVGEDLRARYRVVLLDEYQDTGHAQRIALSALFGGG
VDDGLALTAVGDPIQSIYGWRGASATNLPRFTTDFPRSDGTPAPALELRT
SWRNPPRTLRVANAVSAEARRRSVAVHALRPRPDAPPGTVRCALLPDVVA
EREWIADQLDAHYRRARADGVSPPTAAVLVRRNADAAPIADALRARGIPV
EVVGLAGLLSVPEVAEVVAMLRLVADPTAGAAAMRVLTGARWRLGARDIA
ALWQRARALGGTAGDPAPPSPEAIARAADPSHVDADTVCLADAIADPGPA
GSYSAAGYQRITALGAELSALRAHLGHPLADLVAEVRRVLGVDCEVRAAA
GVAAGWAGTEHLDAFADVVAGYAERADGAATRLDASATASVGGLLGFLDA
AEAVENGLAPAPLAVARDRVQVLTVHSAKGLEWEVVAVAHLSGGTFPSTA
SRSTWLTDAAELPPLLRGDRAAAGALGIPVLDTSDVTNRKQLSDKISEHL
RQLDQRRVDEERRLLYVAITRAEDTLLVSGHHWGATGVKPRGPSDFLVEI
KDVIDRAAAAGDPCGTVEHWAPSPADGERNPLRDNVIEAVWPADPLAVRR
EEVERGATLVRRALAAGPGRPCADVDGWAADVDALLAERARLIEPPVREL
PGQLSVSSLVGLARDPAGTAQRLRHRLPSRPDPHALLGNAFHSWVQKFYG
AECLFDLGDLPGAADSDVGDSAELAALQAAFTESPWAARTPVAVEVPFEM
PIGETLVRGRIDAVFADPDGGATVVDWKTGEPPHGAEALRQAAVQLAVYR
MAWAALAGVAESSVRTAFYYVRAGTTVVPGELPSAAELAGLLIDPDGTRC
DPRRPSIGEAVPVVT
379763552YP_005349949.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MGNGRSRKLSGLDETLTAQRGHQLIGVVRIPEEHASPIRVITRRLAIALV
VLFGAAVIVYLDRDGFRDVRNEPLTFLDCLYFSAVSLSTTGYGDITPYTE
TARLVHTLIFTALRIAFLAVLVGTTLEVLSERSRQGWKIQRWRSRVRNHT
IVIGYGTKGKTAVAAILGDETIQAEVVVVDTDRSTLEHAESAGLVTVHGD
ATKADVLRLAGAQHAASIIVATSRDDTAVLATLTAREIAPNAKIVASIRE
AENQHLLQQSGADSVVVSSATAGRLLGLATTTPSVVEMIEDLLTPDAGLA
IAEREVEQSEVGGSPRHLRDIVLGVVRDGHLWRIDAPEVDAVEANDRLLY
IRSVGH
379763551YP_005349948.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAIADFQLRSVPLLSRVGADRADQLRTDVEAATAGWAEAALLRVDSRNQV
LVSDGRVVLGAAAELGDKPPSEAVFLGRLEGGRHVWAIRGALQAPEDPDA
RTEVVNLRSLGPIFDDTSGQLMSSAVALLNWHEKSRFSSVDGSPTRPARA
GWSRVNPVTGHEEFPRIDPAVICLVHDGGDRAVLARQAVWPERMFSLLAG
FVEAGESFEGCVAREIREEIGLTVRDVRYLGSQPWPFPRSLMVGFHAVGD
PAQDFSFNDGEIAEAAWFTRDEVREALAAGDWSSSSESKLLLPGSISIAR
VIIESWAAID
379763550YP_005349947.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTVLKSNGIPYEAVDIEHDAAAADFVSSVNGGNRTVPTVKFADGSTLTNP
SAAQVKAKLAETGS
379763549YP_005349946.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MDAMPTVADPLTAGLDDEQREAVLAPRGPVCVLAGAGTGKTRTITHRIAQ
LVAGGHVAAGQVLAVTFTQRAAGEMRSRLRAIDAAAGTGPAVGAVSALTF
HAAAHRQLRYFWPRVVGDTGWQLLDSKFAVVARAASRTRLNASTDDVRDL
AGEIEWAKASLIGPEEYPAAVAAAGRDIPLDAAQIAGVYAAYEALKARGE
HVTLLDFDDLLLHTAAAIENDPAVAEEFRDRYRCFVVDEYQDVTPLQQRV
LTAWLGDRDDLTVVGDANQTIYSFTGASPRFLLDFSRRFPDATVVRLERD
YRSTPQVVSLANQVIAAARGRVAGSKLHLVGQRPPGPAPTFHEHPDEPAE
AAAVAASIARLIESGTPPSEIAVLYRVNAQSEIYEEALTEAGIAYQVRGG
EGFFNRQEIKQALLALHRAAERGAEGPLPDVVRAVLEPLGLTAQEPVGTR
ARERWEALSALAELVDDEVAQRPQLDFPGLLAELRMRADARHPPVVQGVA
LASLHAAKGLEWDAVFLVGLADGTLPISHALAHGAESEAVEEERRLLYVG
ITRARTHLALSWALARSPGGRQGRKPSRFLNGIAPQARAEPGPNKSRRNR
ATATRCRICNNNLTTPAAVMLRRCETCAADIDEDLLLRLKAWRLDVAKEQ
KVPAYVVFTDNTLIAIAELRPDDDEALIAIPGIGARKLEQYGPDVLELVR
GR
379763548YP_005349945.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSARIAPRPDLPCHAGDPDLWFAEAPADLERAKSLCVDCPVRRQCLAAAL
ERAEPWGVWGGEIFDRGSVLSFKRPRGRPRKAA
379763547YP_005349944.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MDDGYVADIKRGRAARNAKLASIPVGFAGRAALGFGKRLTGKSRDEVQAE
LLEKAAHQLFTVLGELKGGAMKVGQALSVLEAAIPEEFGEPYREALTKLQ
KDAPPLPAAKVHRVLDAQLGTKWRERFSSFDDTPVASASIGQVHKGVWSD
GREVAVKIQYPGADEALRADLKTMQRLVGVFKQLAPGADIQGVVDELIER
TEMELDYRLEAENQRAFAKAYHDHPHFAVPRIVASAPKVVIQEWMQGIPM
AEIIRHGTTEQRDLVGTRLLELTFDAPRRLEMLHGDAHPGNFMLLDDGRM
GVIDFGAVAPLPGGLPIELGMSIRLARDKNYDLLLPTMEKAGFIQKGQQV
SVRDIDDMLRQYVEPVEVEVFHYTRKWLQKMSAIEIDRSVSQIRTARQMD
LPPKLVIPMRVIMSVAAILCQLDAHVPIKALSEELVPGFAEPDNAVV
379763546YP_005349943.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTQQCQAALSTYALDPAMPVLLRPDGAVQVGWDPRRAVLVRPPGGLAAAE
LATLLRTMSSPTPLPELQRRALDRGLTDTEGLRSLVAQLVRAGVATECGR
PRGRAPSVRVHGRGPLSELLVESLRCSGARIAHSSQPHAAVSAGDVDLVV
LSDYLVADPRMVRDLHDQGVAHLLVRVRDGIGLVGPLVIPGVTSCLGCAD
LHRSDRDAAWPAICAQLRETVGVADRATVLATAALALSQVNRVIAAVRGQ
GAASEPEPPQTLNATLEFDLHAGAIVARQWVKHPLCAC
379763545YP_005349942.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MADLPFGFSPGEDPDKHGKKDPDSGSNPSDPFAAFGMSGDFGMGDLGQIF
TQLGQMFSSAGTVGPGGTASGPVNYELARRVASNSIGFVAPVPDTTNSAI
ADAVHLAETWLDGATALPAGTAKAVGWTPADWVDNTLATWKRLCDPMAQQ
ISTVWAASLPEEAKSMAGPLLQMMSQMGGMAFGSQLGQALGRLSREVLTS
TDIGLPLGPKGIAAIMPDAVESFTTGLERPRSEILTFLAAREAAHHRLFS
HVPWLSSQLLGAVEAYAMGMQIDMSGIEELARDFNPASLSDPAAIENLLG
QGVFEPKATPAQTQALERLETLLALIEGWVQVVVAAALGDRIPGAGALGE
TLRRRRASGGPAEQTFATLVGLELRPRKMREAAAFWERLTQAAGVDTRDG
IWQHPDLLPNAEDLDEPAGFIDRVIGGDTSGIDEAIAKLEREDPDSDGPV
DN
379763544YP_005349941.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MNRRILTLMVALVPIVVFGVLLAVVTVPFVSLGPGPTFDTLGEVDGKQVV
AIQGTLTHPTTGHLNMTTVSQRDDLTLGEALTLWLSDTEQLVPRDIIYPP
GKSREEVDKANSADFKQSEDSAEYAALGYLKYPSAVTVAKVPEPGPSAGK
LKAGDAIDAVNGTPVATVDAFTGLLKNTKPGQTVTIDYRRKNEPAGVAQI
TLGSNKDRDYGYLGVAVLDAPWAPFVVDFNLANIGGPSAGLMFSLAVVDK
LTTGGLAGSNFIAGTGTITADGKVGQIGGITHKMVAAHAAGATVFLVPAK
NCYEASSDNPSGLRLVKVETLSQAVDALHAITSGGQPPSC
379763543YP_005349940.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MPKLTRRSRILILIALGVIALLLAGPRLIDAYVDWLWFGELGYRSVFSTV
LVTRFVVFLIAGLLVGGIVFAGLAVAYRTRPVFVPSNDNDPVARYRALVL
SRLRLVSAGVPVAIGLLAGIIAQSYWVRIQLFLHGGDFGIKDPQFGKDLG
FYAFELPFYRLLLSYLFVAVFLAFVANLLAHYIFGGIRLSGRTGALSRSA
RIQLVTLVGLLVLLKAVAYWLDRYELLSHTRGGKPFTGAGYTDINAVLPA
KLILMAIALICAGAVFSAVVLRDLRIPAIGLVLLLLSSLIVGAGWPLIVE
QISVKPNAAQKESEYISRSIAATRQAYGLTADVVTYRNYTGDAQATAQQV
ADDRATTSNIRLLDPTIVSPAFTQFQQGKNFYYFPDQLSIDRYLDRNGSL
RDYVVAARELNPDRLIDNQRDWINRHSVYTHGNGFIASPANTVRGIANDP
NQNGGYPEFLVNVVGANGNVVSDGPAPLDQPRVYYGPVISNTAADYAIVG
RNGADREYDYETSNETKNYTYTGLGGVPLGDWLSRSVFAAKFAERNFLFS
NVIGSNSKILFNRDPARRVEAVAPWLTTDSAVYPAIVNKRLVWIIDGYTT
LDNYPYSELTSLESATADSNEVAFNRLAPDKRVSYIRNSVKATVDAYDGT
VSLYQQDEQDPVLKAWMRVFPGTVKPKSDITPELAEHLRYPEDLFKVQRM
LLAKYHVNDPVTFFSTSDFWDVPLDPNPTASSYQPPYYIVAKNIAKNDNS
SSYQLTSAMNRFKRDYLAAYISASSDPATYGRITVLTIPGQVNGPKLANN
AITTDPAVSQDLGVIGRDNQNRIRWGNLLTLPVGQGGLLYVEPVYASPGA
SDAASSYPRLIRVAMMYNDKIGYGPTVRDALTGLFGPGAGAAATGIQPTE
AGTPANPPPSAPAPAATPGSPPPAAVPPAPDGSVALSPAKAAVLQEIQAA
IGAAKDAQKKGDFAGYGAALQRLDDAITKYNNTK
379763542YP_005349939.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MADVAHEGKHSRVVVIVVFDGVTLLDVAGAGEVFVEANRFGADYRLKIAS
VDGRDVTSSIGTRLGVTDCLSAIDSADIVLVAGSDHLPGRPIDPALVEAV
RSVAARTGRMASICTGSFILAQAGLLDGRRATTHWHDARLLARAFRDVTV
EPDAIFVRDGDVFTSAGISSGIDLALALVEMDHGTELVRDVARWLVVYLK
RAGGQSQFSVLVEADPPPQSPLRAVTEAVAADPGADYSVKKLAALASLST
RQLTRLFQSELGMTPARYVELVRVDFARNALEAGRSVTETAGMAGFGSIE
TLRRAFVNHLGISPKAYRDRFRTAYA
379763541YP_005349938.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTTSSIDAIAGIHVPDTALAREVTEFIRDTEDELLFNHSRRVFFFGALQG
LRRGIHPNLELLYAAAMFHDVGLTDHYRNSTVRFEVDGANAARDFLMDAG
ADKADADTVWLGIALHTTPGVPEFLAPEVALLQAGVEVDVVGVGREQLAP
EALAAVTAAHPRPDFKNRILAAFNDGMKHRPHTTAGTMNADVLAHFDPKF
ERVDFVDKILHNSWPE
379763540YP_005349937.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MDIHEALYTTRMMRRLRPDPVPLDTQARILDAAIRAPNGANTQRWHFVAV
DDPALIGEFAQLFRRARALEYEKFGAGTGPMVAPAPGADAAAHAETMRRI
KGSGDYLADHFEEIPLLLFVFAIDDLGGANIFPAIWSVLLAARAEGVGGV
MTMVLRNFEDRVNELLGVPVEEGWTMSAMLALGYPRGKWGVAANRHPVHE
VSSRNGWNTPFGVEVPQPLWPPQDTASLPAAG
379763539YP_005349936.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MGRDVIVVTGASSGFGRLSAEALALAGHRVYASMRDTDGRNASQVEAIGY
FAKDNGVELRAVEMDVQSQTSVDAAIERIFEANGRIDVVVHNAGQMVFGP
AEAFQPQQLAELYDVNVLSTQRVNRVILPHMRRQRQGLLVWVSSSSAAGG
TPPYLAPYFAAKAAMDALAVAYARELARWGIETTIIVPGAFTSGTNHFAR
AGSPADEAVVDEYEGGPYAGFAARIREAVAAIVPPDADASTVAEAVVNVV
QEPFGQRPFRVHIDPADDGAEVGFAVLDRLRAEMLHRIGMHDLLQPARLF
QS
379763538YP_005349935.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MIAVRVADPHVVTSSGLYSSSPARHDGRMAEANATTRVVVIVVFDGVKLL
DVAGPAEVFAEANRFGARYSLEIASVDGRDVTTSIGTRFAVTCPLSALES
VDTVMVAGGDTLIGRPIDPALIEALKTVPGRTRRLASVCTGSFILAQAGL
LNGKRATTHWRHTGRLARIFPEVSVEPDAIFVRDGDVFTSAGVSSGIDLA
LTLVEADYGAELVRKVARSLVVYLKRAGGQSQFSVMVEADPPPDSPLRAV
TDAVNADPGADHSVKKLAAQASLSTRQLSRLFQSELGLTPARYVELVRVD
FARAALEAGRTVAETARVAGFGSTETLRRVFLSRLGITPSAYRDRFRTSY
D
379763537YP_005349934.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MKYQNTTLTGAYAGEKLFQRNTFRVPAYQATTIPWRRHRVHGVENSRVVS
HPLAKGCCSGARRRSR
379763536YP_005349933.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MLDYVGERAAGCRVIRASGVESEMELAYAAVHQLCAAMLDRLDYLPVPQR
DALSTALGQTIGPAPDRLLVGLAVLNMFSSMAEVEPLVCLVDDLQWLDQA
SSQTLVFVARRLAAESVGLVLTTRVVNPELKKLPTLEVNGLTETDARALL
ETVLATPLDARVRDQIIAETRGNPLALLELPRSLAGRELAGGFGLPGAPR
LSAAMEQSFRRGVEALPDQSRRLLVLAAAEPLGDPGLLWRAAARLEIRAQ
AATPAIEAGLAEFGARVRFRHPLARSAAYRAAPLHIRQQVHAALAEVTDP
DSDPDRRAWHRAHAAPGPDEDVAAELERSAGRARARGGMAAAAAFHERAT
MLTLDPALRVERALVAAASKADAGAFDSTLDLLAMAERGPLSELQHARAD
LIRAQLAYATNRGGDAPLLLLRAARRLEPIDARLARETYLDAISAAEFAG
RLASPGGHVLEVARAATAAPRSAELPRAPDLVLNGLAANFIEGYSAAVPY
LRAALDATGTGMSVDDELRWMWLTSQAALHLWDDAHWDRLSQRYLTLARK
TGAMNALPLALSTRAMLLTFVGDLTAVSVLVEEQHTVTEATGSNLAPYAA
MTLASIRGHQADAEALISRTVAEAPQRGEGISIAVAEWTKALLHNGLGNY
AEALAAARRGLEQQEYPSLRYPGVANWAAAEFVEAAVRSGMREEATQAME
WITEMTSASRTGWALGVETRCRALLADGEAAELLYRESIAHYGHSRVRAE
LARTHLLYGEWLRRGRRRTEARTQLRIAHEMLDAMGMEAFAERARRELQA
TGETARKRTAGVDGEKLTAQETQVARLARDGLSNPEIGARLFISPRTVQY
HLRKVFTKLDISSRSQLDRVLPTDRPGSG
379763535YP_005349932.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MPAPEVAARYDFVICGSGSSGSVVAGRLSENPDVTVLLLEAGETDDVSAV
HDPTQWPLNLGSERDWCFVSQPSAHLKGRSVLLSMGKVLGGGSSINVMVW
ARGHRSDWDYFATQAGDEAWGYESVLDIYRRIEDWHGPAVSARGTGGPMS
VTSPPDPNPIAPAIVEAARSLGIPSYPSNNGAMMDRGGGAALLDVTLRNG
LRQSVYRSYVHPHLHRPNMTVLTGATVTRLVVGRNRATAVEFSHNDRTHQ
VVAAHEVVVSLGAINTPKVLMHSGIGDADELRRFGIPVVAHLPGVGRNYQ
SHPRIDCVWEFREPLEPRNNAGGAGVFWKSDQNLEAPDLQICFGEVPLSS
SANAAAYGLPEHGWTACAGVLRPKSSGRVRITGARPCDPVSVEDNMLAHH
DDLAAAIACVDLAREIGNSTVLRRFNKREVMPGDLTRAELEQFIRYGAEC
YFHQSCTAKMGRDSMSVVDSNLKVHGIEGLRIADASIMPRITTGNTMAPC
VVIGERASDILKTAHGL
379763534YP_005349931.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MPALVSKSSDAGFDDAEIRCSVGFPDHPEPGLAEQPLMPVHRASTRVVVA
SSENALV
379763533YP_005349930.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MRPDPIPLGTQARILDAAIRAPNGGNTQRWHFLAVDDPALKRSLGELYRR
GREKEHEEFRTGTMAAPAPGLDPTAHADTLRRVIRSGDYLADHFDETPLL
LFVFAIDDHGGANIFPAIWSALLAARAEGVGGAMTTLLRYFPDAVNELLG
VPIEQGWTMSAMVAFGYPLGRWDVAANRRPVHEVSSRNRWGASFGTDVPR
PLWPGSDEPILGNRLRQVNPDSRC
379763532YP_005349929.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MPEFGETAVVLGGSIAGLMAARVLADYYTTVTVVERDVLPERPVARRGVP
HGPSPHIPQVRATQTMEELFPGLLDELVAMGARVWKDGDLSRIWMSFAGH
KFLQSGTIPDPETVIKYYVNRPLLEWCIGRRARHIPNIEFLVGHDAVRLT
STPARNRITGVVTAQRDSGAERILAADLVVDATGRGSRTPVFLDDLGYRR
PHEDELMVHAAYASTLLHVPPGTLREYMAVSGALPGRPTGFAMFAGENDT
YMVGMQMMAGGQPPSDHDSLLARLAEVAPAHVVEAVRRAEPLGPLRQHRF
PANRWRRYDKLTAMPQGLIVIGDAMCSFNPVYGQGMSIAAVEALILRTCL
ERGDRDLQRRYFRAAAREIRTAWQAAVGADLTLPQIQGPRPLSMRITNAY
LRRVMAAAETDPVVVQQFMRLIGMVDRPSRLLRPSMVLRVMTKSRRATKD
KTHVSAQPCKEEQVNGHL
379763531YP_005349928.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MKMGMNTHRSTRTRFGSERYRFVIPDYSRSTELDDSLGRDVVLRQLVLHG
LATVLLMMAAFAISC
379763530YP_005349927.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTGPAFVTPEDVSECLGFKPGQRITGSGGVLTAAIWRFENKSAYELVGPA
VDTTDLIAMPLSGHHHHTYFGDGRRKWGREHPAFHMNVVVAGEQPRGVFS
AERPFSYLHVYVPHAMVEMLAVESGAVKVARSVTLIDPMCSRDPLAESIC
RQIVREMTHRDGCSRMMIDSLGQQLVVRLIRQHSSVSGSPSLAKKSGPGY
RDWRLRRAIDYLEAHLSDDVGLNELAAVVGLSTTRLSGLFLEGTGEPPHR
WLMNRRFMHACELLGNPSLSITDIAHQCGFASSQHLAAVMRRRLATTPTA
YRRDLLA
379763529YP_005349926.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MMTISLSANRRNAADVRPFRAAASLFEDLQRVLVDLIELHLQGKQAHWNL
VGTNFRDLHLQLDAIVDTAREASDTIAERLRALDAVPDGRSDTVVATTTV
PAIPPGLIGAAEAVDLITTRIYAVVGTIRAVHDDVDAADPATADLLHAII
DDLEKEAWLLKSENVTP
379763528YP_005349925.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MRLVIAMTGATGAALGIRLLETLGHLGVETHLVLSDWARATIKLETDTSV
EAVRALASHAYSARDLAAGISSGSFRTDGMVVCPCSMKTLSAIRIGFSDN
LITRAADVTLKERRRLVLVAREAPLSEIHLENMHYLARAGAVIFPPTVAY
YARPTSVDEVTDYVVGRVLDQLGIEHSLIKRWKDDQQHPNGDSALTEADR
WATRIEQELRQPLCAPIE
379763527YP_005349924.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MHVVASKYDPETRARAVRLVLDHRDDYPSEWAAITAVSQRLGMTAETLRS
WIRRHQVDEGERDGVSSDAAAQIRALKRRNAELEQTIEILKAATSFFVRE
SDPRNRR
379763526YP_005349923.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MLSEHGMPIAPRTFHAWATRAPSKRALWDATITQILAGCYEPDEQGRRKP
ESLYGSLKMWAHLQREGIPVAKSTVERLMRKNGWQGVRRCKKVRTTIPDP
AAVRPPDLVDRQFAVPAPNLLLVADFTYVKLVTGIFVYVAFVIDAYAGAI
LGWEASASKHTRFVESAIRQAAALRRRQGHPIDGAIHHSDAGSQYTSVRF
GETLSLSGIRPSVGSVGDAYDNALAETTIGLYKNECVRADSPFRRGKLNT
VGDVEYITADYVAWYNQQRLMHRLGRIPPAEAETRYYSQLVTDQSAGSQN
PEGA
379763525YP_005349922.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MLGLPEGTSDSAIVRHLREAFKKPIPPRVVDSGPVKENIVEGDDINLWEL
PVPKWHGEDGGRYIDTFCGVVTEDKVTGRDNIGLYRGQIVDRDKIAKLLV
PSQGWGGHMEEYKPEPMPVAVVYGWHDVLPFCAGSPFPKNVCEWDMMGAL
LGRPVDLVPCESVPLHVPATAEIVVEGFIDPDPSTFVVEGPFAEYPGFIG
GAAPAPVLRVTRITHRNDPVLRGTLEGIRPGMFNEDSITNFARSAITWNV
LDDLGIGGITDLWMTEVTNGQNTLVQIQKRYRGHAQQIAAALWGTGGSVW
FHKNVMVVEEDIDIHDPVALDWAMSYRVNAGLGDIAFFGPGLGSSLDPST
PPEKNDTNKYGAGQWTRVLIDATRSWEIEPRAEWGGRRFPPTDRLSPELE
SIIAGRWEEYGIGIPYLDDEGREMLTLQKLSKRMPEV
379763524YP_005349921.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTDVAVSVALPPSIESAQHIASAEKLGYRRAYCYDSPFGGDDVWLALHRA
AERTTTIELGPAVLIPTQRHPLVNAAETVSLHRVAPGRILTSFGTGFSSR
AAIGQPPIAWSYMEAYIRAYQALLAGEVVDWEGAAIKLMLSSSQSEVLPL
RIPLLLAATGPKGAGVAKRVGADGIISMFNVVPGQRDFARTVVATMGTVL
DEGESLADERVRSAVGAPWAAAYHFVYTTQGADALREMPGGAAWLDVIER
IPQRLRHLHIHQGTMVEMNTADMAAWHAGGYASVPSVTLSGSADAVGRAV
AAMAEAGATEVMIEPSGPDIPCELERFMAAVRG
379763523YP_005349920.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MPVYQCYSPPGLLSESAKARIADEITTIHTSATGAPELFVNVLFHEIPVG
DCFVGRKQASHSYLFGAIRHGRDAATRQTMLREFSRMWSRATGQSEAEFL
VALTEVDPANAMEAGLVLPEPGREQEWFDENRVRLTQMGMAL
379763522YP_005349919.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MRSIQVAASATALVLFGSAGVAAAAPPKDYCAELKGANTGQACKIQMADP
GYNVDISFPVNYPDEKSVADFITKERDDFLNAAKSSAPRDQPYQLTISST
NYGSAIPPRGTEAVVFKVVENTGAPKTTFKSFNWDQTYRKAIVWTAASDD
KNNTPLWRVDDPLQTVAPIVQSELQKQAAPPANPAQTPPGNQPQTTPPAN
QTPTPPPVAIAPAAAYDPANYQNFAVTNDGVIFFFDQGRMVPDATQVLVP
RSAIDPMLA
379763521YP_005349918.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTLKDIALNTLDGRPTTLAELSDGATLVVNVASKCGLTPQYTALEKLAKD
YRDRGLTVVGVPCNQFMGQEPGTADEIQEFCSTTYGVTFPLLAKTDVNGD
GRHPLYAELTKAADADGQAGDIQWNFEKFLLAPDGAVVQRFRPRTEPDAP
EVISAIEAVLPR
379763520YP_005349917.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MLAAFGFESLGVVVGDMYFVDPSPLEGQETPERGVRLELRLVDRAEPQGS
IYAGVPIAFTRPVWRVDLFGSTESPPGTLDRAHHHPRFDGWEPGRRHFVP
ELSADPVSWLAEQLADPSAVLTRAGVDADAVSEADKEGLAAAAPEIVAAV
KRLLDGVRDGELAPEPAEPVAAARTGWL
379763519YP_005349916.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MQINSQRTPPYKWIAVATLLVLAVIFTLVYIQFRGGFTPKTELTMLASRA
GLVMDPGSKVTYNGVEIGRVGKIAETVRDGKPAAKFTLEVYPRYLALIPS
NVNADIKATTVFGGKYVSLTTPAHPSPQKISAHTVLDARSVTTEINTLFQ
TITSIAQKVDPVKLNLTLSAAAQSLAGLGEKFGQSVVNANAVLDEVNPRM
PQARKDIQRLAALGDTYADASPDLFDFLNNAVVTSRTINAQQKDLDQALL
SAAGFGNTGADLFTKGGPYLARGAADLVPTAQLLDTYSPEIYCLMRSEVD
ALGPTGAAEGGFNGYSLNMDTEVLSGLGLIANPVSAVPVIASLVGGIAGV
VGGAPNPYIWPENLPRVNARGGPGGAPGCWQKISRDLWPAPELVMDTGNS
IAPYNHLDTGSPYAIEYVWGRQVGDNTINP
379763518YP_005349915.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSDVHLAAILALCAALASAIGNVVRQRSAQEVTDRRVGHLTLFGMLLRDT
RWWLGGLGDIGSYVLLAAALDKGSVLLVMSLQVTALLFALPIYARMSHHP
ITRREWTWALLLAVALAVLIAIGDPTGGQQRAPLQTWLVVAAVIGPLLLL
GLLGARIWVDRPVAALLLAAVAGSLLAVFAVLMKGVVDILERHPGQVWQS
FELYALVGCGVAGMIYHQSAYRAGALTASLPTIIVAKPVVGGILGIVVLG
ETLAAGGWEWFVLAVTAVVVIVATVGLARGEAATVSAGAGRDVKSNERPT
AATQA
379763517YP_005349914.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MADWTAARLPSFAGRTIIITGANAGLGEITARELVRVGGHVILAVRNTDK
GHAAAARMAGPGRAEVRQLDLQDLSSVRRFAEGIDTVDVLVNNAGIMATK
HAVTVDGFEGQIGTNHLGHFALTNLLLPKLTDRVVTVSSLMHHFGYISLK
DLNFQSRPYSAWLSYSQSKLANLLFTSELQRRLDGVGASLRALAAHPGWS
HTNLQGNSGRKLGDAAVLAVDRIVSTDADFGARQTLYAVSQDLPGNTFVG
PRFGLYGRTQPTWRNWPAKRAGTGAALWELSERLTGTAFPL
379763516YP_005349913.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MFLGVIVNPKARKNRAAPRERIDELRRLVGPWGEVHETASIDDLRDTIAQ
IGPRVTHLVGDGGDGALHWLINETERCIGDPESWPAFVPSNGGSVNAVAR
KARVRGRPETIIRALVAAAEADQPPPEMWLDTLVLDGETADGAAFHRLCF
GLAAGGVGNRFYDRYYDAPDHGRLAVARVIARSFGDYITSKIAPSRVKTP
NYASILFTPTSAHVVIDGEEVPSRTHSLLHAGAIDLRIGGPLRLFPKASE
PGALHFQAGYLRPSRIVAQLPTALTNGMLRGKGLRDVNGHEMIIEAEDEP
LSPIIDGERFLGIVKLVARAGPRIRIAQVAPSTIARAHSAPAP
379763515YP_005349912.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]METLIDYLHKWEALKPDQTLFRFVDVDGRELEHYTYQSFADRTRELAAYL
SKEAGLKAGERALLVYPPGLEMIAALYACARIGVIAVPVSPPLPMSFESG
LAKLSFIARDCGAKAVLSTKQFEYDFRLLLGQRHGGQAWSDAALPELPWF
ATDGAQEFGGAPVADTPGDVLFLQYTSGSTNDPKGVIVSHANVIANGSAF
TGDVVLASWLPQHHDMGLISAYMFILLLGGSTHAMSPLDFLARPSSWLRL
ISDVRATHTPGPNFALEYCLREDKLPASELAGVDLSSLECIVVGAEPLRA
NTFDQFRKRFGDYGLRPEALTGAYGMAESTLIVSIRGRQTITVNKRGLEK
NVARVEKALPENSNQVPLVSCGKPIDETLVRIVDPESRTALGEGRVGEVW
LDGPSKGGGYWNRPELTTEMFGARIAGDDHHTYLRTGDLGFLYEGELFVC
GRSKDLIIVRGVNCYPSDVEAVVERSAGQVRSGCVAALSVERDEQEALVV
VAEVRDEHNLPDAKALARAIRRHCHIDPHTIVFAPPRSIPKTTSGKIRRA
RTRQLWLDGTLPAFTSWVNPAATRGRDAVEVGAGPLERFRNLIESYDLTG
DEDCSFADLGIDSLALAELRTDLQAVLEEHGAGELADEVNTRLLQRLTVA
EFFGLMRQFGEGSGQPLDALRRALDQISADYEAYETAQMRADAALPLPEL
APARAGAPTDILLTGATGFLGPFLVGSLLSRTSYNVHALVRATDAAHGLD
RIVASLRRAQLWTPALEAEVRARVRVICGDLAEPALGIGEAAFQQLAEDV
DAVVHNGALVNYVRTYDALRPANVEGTRELLRLAMTAHRKTFHLVSSTFI
YGWSTEPVVGEWDANEKMAGLDFGYSQTKWVGEQLALAAQRKGLDVRIYR
PSLISPTRAGFGSQDDILVRLTAFMIEHGLAVNALNQISLLPADLIADHI
VALMDLPDESGSVFNLTADDYYNLTDITRILTERYGYRFEYHDIESFAEQ
LDRQCTPNDQMYPLVDFLTRSAGKIAAMRDKRYDNTQYRHRRGLATVRLR
EPALTETVDHLVRFLRSERLITEVEDETQRSA
379763514YP_005349911.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MATMFTVDDMAAGPHDASLDHERIVLQARDVDFDWSTLPFYYVPNEPFTT
HFCNVLHLLLPAGEEFIVDAFKDTLPLIKDDQLRRDVQGFVSQEAMHSQA
HAGVLGHFAANDIDVTPFTDQMRWLFTQLIGDRPHWSRRRRQSWLLERVS
MVAALEHYTAILGEWILDTPQHDALGTDPVMLDLLRWHGAEEVEHKAVAF
DTMKHLRAGYWRQVRTQLLVTPALLWLFIRGVRFMYSVDPYLPPGTKPRW
RDYFRAARRGLVPGPFQFLRVIGAYYTPSFHPSQLGGVGRAVDYLARSPA
ARASH
379763513YP_005349910.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MIASDGVSLAVHAYTEIDPRRPTVLAIHGYPDNHHVWDGVAGELAGRFNV
VAYDVRGSGDSSKPARRTDYVLPQLVSDVGAVIDSLGVGQVHLLAHDWGS
IQGWAAVTDDTVMAKVASFTSISGPHLNYAGRFLRSPRTPRAVFDVVKQA
LASSYIWFFLCPVVPELAIRSRATGKVFAAVERIGRSRGSDRQRAAATRS
IDDYLNGLNLYRANMPAPFFVPVKQLPQTRVPVQVLVARRDYFVSPALQR
FTGSIPDGGRIVPIEGGHWVVTSHPDVIAGFTGEWVNLTSEPAGRHGMGQ
A
379763512YP_005349909.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAVTRAIWDSIPADLYGRRKRDRMYTALYGVGTLFGGMASASRWTPSRVQ
PVRRTTTAVITKREEPAPDVVALTLADPDGGLLASWTPGAHIDVRLPSGR
RRQYSLCGAPGRRTDYRIAVRRIPDGGGGSIEMHDTLHVGDSIEFEGPRN
AFYLVTDEHEVLFVIGGIGVTPILPMIQTAQQHGIDWRAVYAGRSRDYMP
LLDEVVAVAPDRVTVWADDERGRIPTAADLLADAGPTTAVYVCGPTALLE
SVRIARDEHANAPLHYERFGPPPVIDGVPFELELARSQRVLTVPSNRSAL
DVMLDRDSTTAYSCQQGFCGTCKVKVLAGQVDRRGSAAEGDDEMLVCVSR
AKNGRVVIDA
379763511YP_005349908.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSDTVKVTVDRDSVAMGDDVDSHREFWVYPASATIDDLLVEISSHFLPGV
AGPAGWYVYVGTRHERQHWEIGLIYTRDDLRQRDHICRLSPGERTLGDLA
RWTGSSELDVYASYLTFDQARPLSLDEVEGSSTFTGCRPTKLESEAAADA
KRDWVLMRELDRLARSVAGARRDWVRANLLAAPPPWIDIFIARNFHYLTE
LHCPASMSIAAELLGVDASRDEDLAAAANADAHPLVVTLAMVLAAFEWGT
QRGTWRAGEQPSHKVYLELLAHCGYRLSPIEQVMAGHISVEQLKFGAADA
ARLDRIRQLRDQQYQLRMSRYYAKTITDEQYQAAIGPVHAELSSLGELPG
PM
379763510YP_005349907.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MPKKPLRPPAPPESGPNGPLLGTWQAAGLSMAVIASAAADGLGALLGAVT
VIPVIYALTRLRAYAPHARSTAELIGATLGPRAGFAAGAIQLLAYLALAA
RFAVALGAVVLVDFSSGDDPAKVVLSLPACALVAALAVGAVVCWVTTRVV
ASVVTLLVVAGLLVYVYLALAVTARVAAGSDAVVIGTAATPSQLSGQLVG
FGLGMVGVELVTARAARIARPGRSMSLAVAVVIGAAVILWVGDHQGVAGP
WRWNAKFLTEAVPEFYADAGWTWMAVAGVALTAAAALASGWAAVRVAAGL
AAAREATPNTGPRVAVVGLVAAMAATVSAHGMRGIATVVFGAAALLLILL
YVFATEANSRIPGDSLVAWWVRLIVPALAVVLVVKPVVDAHFAVVEVATV
IATMLGACAASVAASLSRAPRVVAKSE
379763509YP_005349906.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MLSEHGMPIAPRTFHAWATRAPSKRALWDATITQILAGCYEPDEQGRRKP
ESLYGSLKMWAHLQREGIPVAKSTVERLMRKNGWQGVRRCKKVRTTIPDP
AAVRPPDLVDRQFAVPAPNLLLVADFTYVKLVTGIFVYVAFVIDAYAGAI
LGWEASASKHTRFVESAIRQAAALRRRQGHPIDGAIHHSDAGSQYTSVRF
GETLSLSGIRPSVGSVGDAYDNALAETTIGLYKNECVRADSPFRRGKLNT
VGDVEYITADYVAWYNQQRLMHRLGRIPPAEAETRYYSQLVTDQSAGSQN
PEGA
379763508YP_005349905.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MHVVASKYDPETRARAVRLVLDHRDDYPSEWAAITAVSQRLGMTAETLRS
WIRRHQVDEGERDGVSSDAAAQIRALKRRNAELEQTIEILKAATSFFVRE
SDPRNRR
379763507YP_005349904.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSKTTAAFFVQAAVAFAISFLTALAGIYFLPLDAWQRLFLGITFLFLVSS
AFTLAKVIRDQQEAATVRVRLDEARIERLLADYDPLNTAS
379763506YP_005349903.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSTLARFPDVAEVAARTPADRDRVLDVIRITSLIGVVLGHTVMAISVIEN
HVLIWDNLLTTSMLFQAATWLLQIMPLFFFAGAAACLSSWSPGTNWGDWL
MKRCTRLFRPVFYYLAFWAVALTVLYRALPQHIYEPIAGVSTQLLWFLGA
YVLVLAAMPMLYRITTARRLAAGVAAVYGAIALIDVIRLHSPGMMPLGYL
NLCVWLIPAMFGVAYRRRLLDGRAALTVAGVFFAVDIALVRWGPYQISMV
GTGDHHLSNTSPPSLLLAGHAIILSALAIAGAPAIARWAQRPRVWWWTAI
GNSGAMTLYLWHMPVLLGVHLLFDYLGSPRFPGQPDFLAVSVAQVLIVVL
AVAVLFVALRPLENNPLAGWDGAGTVTSRGRGAVVGALLCVAGVAILAAI
RWGLKDDGLVCMAVVVAALVAARAVAHETGGGTPLTAGHGSESRPCSIT
379763505YP_005349902.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAEDAAPATVMVVDDHPIWRDAVARDLAEGGFTVVATADGVAAAGRRAAV
VKPDVVVMDMQLPDGNGAQATAAVLAASPSTRVLVLSASDEREDVLEAVK
AGATGYLVKSASKSELAQAVTATAAGRAVFTPGLAGLVLGEYRRIAQSKD
DGPARPSLTERETEVLRYVAKGLSAKQIAVKLSLSHRTVENHVQATFRKL
QVANRVELARYVIEHGLDSEP
379763504YP_005349901.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MLTTMANHGPDPTTPLWRAAQVFRLLSCVYAAGFQIAINPDLRRPALGWV
LFTVLIGWSAACAVAYLRGFGRRPSWVLAEIAIAVLLMWSNTVVATPHWA
AENQTWPTTLWASNPTISAAIQFGPGGGMLTGLAVMATNFAVKDYLALNL
GHNATVIIELAIGMAIGMAAQTARRAHAELQRAAQLSAAVQERERLSREV
HDGAIQVLALVAKKGHEIGGATAELADLASEQERALRRWAACADIDPDAD
GATMDLRTLLRCRASDRVSISLPATPVLLGRGIGTELDAAVGNALDNVGA
HAGPEARAYVLVEDLGDSVVVSVRDDGVGIAAGRLEEAARQGRLGVSQSI
VGRLASLGGTAQLRSGPGEGTEWELCVPRGEGRRG
379763503YP_005349900.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MESTWELNGETASVEQALSGGNAQPAGWFRFHFTDQRWEWSEQVQRMHGY
EPGTVVPTTDLVLSHKHPDDRGQVAATIDQIVNTRQAFSTRHRIIDTGGN
VRHVVVVGDRLYNDDGDVIGTHGFYIDVSASNGQVHEDAVSAKLAQISEN
RAGIERAKGMLMLIYGLSDSAAFELLRWLSQEANVKLRTLAEQIAEDFRG
AGLPLNTQSEFDHLLLTAHQRVRPADDRG
379763502YP_005349899.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MLMRSDPFRELDRFAHQVLGTAARPAVMPMDAWRQGEEFVVEFDLPGIDA
DSLDIDIERNVVTVRAERPALDPNREMLATERPRGVFSRQLVLGENLDTD
KIQASYSEGVLSLHIPVAEKAKPRKIAVGRGDGHRAVAEGATQREVINA
379763501YP_005349898.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MVEHRGEAGAPASGHGVYGISVAAELSGIPVQSLRLYERYGLLTPARSQG
GTRRYSADDLARLRRISGLVEAGVNLAGIARILELEDDNETLAAANTDLR
STNRTLREAAKAAKPAESRDREGTRR
379763500YP_005349897.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MGELTETGAQVVDGARKEADAYRGDNPRPLGGYLAVLVVYGLVVTAAVIA
AVVSGRTLPSRWRIQDLIILTLGTHKLSRTLTKDAVTSPLRAPFTHYAGT
GGPAEVQEEVREHSELRHSLGELLTCPFCLDMWVATGFAIGLVFVPRFTR
LIAGVFSALAGADFLQLAYAMAQQSAEG
379763499YP_005349896.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MDITIISPVDYMLYTPLLPDVAGGVVDARFVAVPLANSLRGVHAVRGRVD
GVDFAQQTLTYCDPEERSHSMSWDRLVLTPGSVTRLFDVPGLARHARGLK
TTAEALYLRDHFVEQLELANIEDDPQVAAARRTVVVVGASYSGTELVAQL
RALADAAAKQMGFNPAEVRFLLLDLAEQVMPEVGKKLGEAAMKVLRKRGI
DVRLGVTLKQAHADHVVLSDDSRIDTHTIAWVTGVTGAPLIQDLGLPTEK
GRITVRPDLQVPGHPEVFAAGDAAAVPDLTQPGQITPPTAQHATRQGKVL
ARNVAASLGYGSPKQYKHRNLGLVVDLGPRYAVANPLNIHLSGLPAKLVT
RSYHLYAIPRGVNRWAVSLAYLTDVLFNRSVVSIGLSSEDDAQFTASEGI
PMPKTS
379763498YP_005349895.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MPPAQNPGQTAGAGESGEAASHDHNGGHRPECRRTSVVRSVPRRPGTDDG
LKTTVRQGNPRGQAGQNGPGRPPARMPPPTLLSWRFVIVPCASLYGS
379763497YP_005349894.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MELVANLEREHSGTAAGLHELLDDGVQHVTGAQYAGITLAEKGASVSSVA
ATHRYPTVLDAIQDTSGEGPCLAAAWEHHIMHIADLSSERRWLRYRRMAL
EQTPIRSILSFELFIDGGSMAALNFYADHRTRSARSRWRSARCSPHTLPS
GGR
379763496YP_005349893.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MFATHIALGWSMMRRNDQFRSALASRDIIGQAKGVIMERFGIDAVEAFQL
LTRVSQQSNIKLIEIARALIESEHPLKHRAH
379763495YP_005349892.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MKAVTWHGKRDVRVESVPDPKIEQPTDAIVEVTSTNICGSDLHLYEILGA
FMKPGDILGHEPMGIVREVGTQTGDLRVGDRVVIPFQISCGSCYMCGQQL
YTQCETTQVRDQGMGAALFGYSELYGEVPGGQAELLRVPQAQFTHIKVPV
GPPDSRFVYLSDVLPTAWQAVAYADIPEGGTVTVLGLGPIGDMAARIADH
LGYRVIAVDLVPERLGRAAQRGIHTIDVGRLDSSLGDAIRDLTDGRGSDS
VIEAVGMEAHGSPTAKLAQQATGLLPDALAKRLMQTAGVDRLSALYSAID
IVRRGGTISLIGVYGGMADPLPMLTLFDKQVTLRMGQANVKRWVDDIMPL
LTDDDPLGVDTFATHVLPLDEAPHAYEIFQKKQDGAVKVILNP
379763494YP_005349891.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTPAEAADAGAPTPTGEVWPGRAYPLGATYDGAGTNFALFSEVAERVELC
LFDAEGTESRITLPEVDGFIWHAYIPNIEPGQRYGYRVHGPYDPQAGHRC
NPNKLLVDPYSKAIDGSFEWNQSLFSYNFGDPDSRNDDDSAASMPKSVVI
SPYFDWGNDRPPDRHYADTVIYEAHVKGLTQTHPDIPEQLRGTYAAVAHP
VIIDHLKDLGITAIELMPVHHFANDSTLVDKGLSNYWGYNTIGFFAPDFK
YSSATTPGGQVQEFKAMVRSLHEAGIEVILDVVYNHTAEGNHLGPTLSMR
GIDNAAYYRLVDDDKQYYMDYTGTGNSLNVGHPHALQLIMDSLRYWVTEM
HVDGFRFDLASTLAREFYDVDRLSTFFELVQQDPTVSQVKLIAEPWDVGP
GGYQVGNFPPQWTEWNGKYRDTVRDFWRGEPATLDEFAYRLSGSADLYEH
TARRPVASINFVIAHDGFTLRDLVSYNEKHNEANGEDNNDGESHNRSWNC
GAEGPTDDEAVKALRARQQRNFLTTLLLSQGVPMICHGDELGRTQNGNNN
GYCQDNELTWIDWANADAGLLEFTRTVSALRAEHPVFRRRRFFSGKPVGR
RGQGGLPDIAWFTPDGTEMSDEDWGAGFAKSVAVFLNGHGIPGRDERGQR
VLDDSFLLCFNAHHEPIEFTLPPKEFGAAWQVVVYTGPDETTPADEVPGG
GTLNVEAHTAVVLQGLPSS
379763493YP_005349890.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MLRAERREREGQPMDRPGPDARLESAMNTSGRAAALLVLVVAALTWVGWT
AGIERLTRIYPTWPQMMPWTALWLAALGAAILLQWGSPSRERRWAGRCLA
AAAAAFAVLVLAEYASLGSFTVDRIWFGEAVGMREWSWPGRPSVQTALSA
LPLATAVALIRVDRCTRAVWPLCLAASAAIPFVTAGAYLFDALALVGVSP
SKGQAFLTAAVLLLLVAATSLARVDRFPLAWLLARPDRSSLVRLLAILAG
FPLVVAVVRPIFLELGPDANAQWTFSILLGTAVVGAVTFYFSQREQHLLI
AKELASKQRAEAETRYRILADNAVDIIVHFRGGGVAWISPSVEPALGGPL
SRWTGPDFARRIHPEDRDKLQTALRRIAGGEQVLQRFRVCSLDGEYHWVD
GHGKPYTDAQGNTDGLIAALRVVDDQVEAEQQLERLARFDTLTGLVNRAE
AMARLDAALRQPRPPETHVGVLFCDVDHFKAINDRWGHGTGDVVLATVAA
RIRASVRREDTVGRTGGDEMLILLPGVRSADELAQIAEKIRRRVAEPIHV
SGNTIGATLSIGATLALPAESVDAVTARADEAMYRAKSGDRNAVVAT
379763492YP_005349889.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MVVGASSGLGRCIGVGLAQRGDQVALLARRLQRIEAAAKEAGPNATAIEC
DVTDEASCRAAIGRAVDALGGIDNLVYTPAVGPLVRMVDTDADTWRRIFD
TNVIGASLVTAAAMPHLTASAGKAVYLSSDAGTFGPPWPGLGAYGVSKAA
LERLVEAWRAEHSDVGFTNLIVGECAGGEGDAATGMNADWDMDLAMKAVP
LWSSRGCMPGKLMPVDDLIDVVHTILRTNASTSMPLVVARGAPASPAAFA
EANQS
379763491YP_005349888.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MKYVDVDGVGRVSRIGLGTWQFGSREWGYGDSYAAGAAGDIVRRARALGV
TLFDTAEVYGLGKSERILGEALGDERAEVAVASKIMPVAPFPAVVRQRAR
ASARRLGLDRIPLYQIHQPNPVVPDSVIMPGMRDLLDRGTIGAAGVSNYS
LQRWQKADTALGRPVISNQVHFSLAYPKALKNLVPFAERENRIVIAYSPL
EQGLLGGKYGVANRPGGVRAMNSLFGTENLRRVEPLLQLLRDVATQLGAK
PAQVALAWLISHPGVVAIPGASSVEQLEFNVAAADIELPTESRDALTEAA
LAFRPTSAARFLTDLAREKLSRR
379763490YP_005349887.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTNPQDPYWQNPLSYDPLGRVPPIEPMEPIEPPAEPPGIPPPPAPPPYRP
AVNTLATLSLVFAFVFAPAGAVLGHLGLARIRRTGELGRDRALVGVTLSY
VFILLAVVALAGWATLGGSTSSHRTAHDSTTSAGPPPPTVPPDTITTLLP
GLDALRNITSDANLEVGPTWNSPGRSAQDGSIDRPECWGSIAAGSPDAYT
PGSFTGYHAGEFTDTRSMFKSIQVIQGVAAFRDPAGAQSQLDTLLSGWRQ
CGGSTVTVTASGGQPIKMAVSAPADAGNGITTLDLTPKGIQVRSARAVAA
KANVVLDLNVSASGTTDSERPRLAAVTIANYILGKIPG
379763489YP_005349886.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MARAITSPTDVVDYLVSQHEQIKAMFADTLAASGEAREKAFVELRRLLAV
HETAEEEIVHPRAKRKIANGTTVVDKRLHEEHEAKTVLQRLEKLDVDSEE
FTRELTKLRDAVIDHAEHEEHDEFAKLGEELSADELERMGRAAQLAEAIA
PTRPHAGVESQVANLAAGPFAAMLDRARDAIVGKG
379763488YP_005349885.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTATAKAPGADRYLPEERDIDALRSAAETCHGCALFEDATQTVFGNGHPG
APIMLVGEQPGDQEDRAGEPFVGPAGRLLARALEDAGIDPVLTYQTNAVK
HFKFTRKGGKRRIHQKPGRTEVVACRPWLIAEIEAVQPEVIVCLGATAAQ
SLLGTTFRVSEQRGRELKLPASVDIARTPEPIVVATVHPSSVLRDRSERR
DEVYQSFVDDLRIARSGLA
379763487YP_005349884.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSKQEVSDYLLERLRAWGVEHVFGYPGDGINGLLAAWGRADNKPQFIQSR
HEEMSAFEAVGYAKFTGRVGVCAATSGPGAVHLLNGLYDAKLDHVPVVAI
VGQTNRSAMGGNYQQEVDLLNLFKDVASDYVQMVTVPEQLPNVLDRAIRI
AMTQRAPTALIIPSDVQELPYSPPEHAFKMVPSSLGIEYPDIAPDDAAIA
RAADVLNAGKKVAMLVGTGARGAHEELAEVADLLGAGAAKALLGKDVLSD
ELPWVTGSIGLLGTRPSYELMMGCDTLLTVGSSFPYTQFLPQFDQCRAVQ
IDIDGRMIGMRYPYEVNLVADAKSALRALIPHLRRKEDRSWREGVEKNVA
RWWETMDKEAMVSADPINPMRLFSELSPQLPENAIVTADSGSSANWYARN
LRFRGNMRGSLSGTLATMGPGVPYGIGAKFGHPDRPVIVFAGDGAMQMNG
MAELITIKRYWSEWKDPRLIIAILHNNDLNQVTWEMRAMAGAPKFAESQN
LPDVDFAAFAASLGLNAMAIKDPDELSDAWRNALSADRPTVLDVFTDPDM
PPIPPHATWEQFKSATTAVLSGDEDRVGFVKVGLKTKMQEFMPHKKS
379763486YP_005349883.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MMRLRRSVLSKPGIARKRRGKSFSYYEPGGKPVSDPETLQRIKDLVIPPA
WKKVWISPHPNGHIQAVGVDAAGRRQYLYHSAWQAERAEEKFDRVLELST
RLPACRAEIAKDLARHGLTRKRVLALALRLLDRGYFRAGGEQYAEEHESY
GLSTLLCEHVVVRRDAVEFDFPAKSGVRRTVEIEDPDVVRAVRALMRRPD
RTERLLVCRNSSGWIDVRADDLNARFKELAGDDYTVKDLRTWHGTVLAAA
AFADADPAVSGRVAKRVEAAVMKEVAEELGNTPAVARGSYVDPRVVTGYE
QGLTIAAAARRAERAKSPDLAQEILDKATRMLIRRVAKADSANGSSGLRK
TA
379763485YP_005349882.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAMGIVGAPSAAAAPDCSPAGVNSTVSSVQGSAEQYLAAHPGANQVVTAA
YGQPRPEAASSLRSYFTGHPQEYYDLRGILAPIGETERQCNVTALPPYLE
SAYHEFMAG
379763484YP_005349881.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MGIAARAQRVVALTAWAFAVWILLTWTPTVENLLVGLVVAVGCGFAFAPL
GPVAGPWSALAPRRLAALVALAAACAARIVAANLSLSRRILSPSRPLCSG
MIIAPTQARSDGELAATGLLTSLVVDNQFVDLDRGRHLLQYHAMAVPRGP
ARESVNGPLESRVIAVSRSRGGTSG
379763483YP_005349880.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSGVLSGVCIAQLLVACVLLIRLARGPSVSDRVVALNTISTQCALVVLFY
AAVADRAIYLDVALWLASFSYLGALVWARYLERGLL
379763482YP_005349879.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MFFSLSGAIGILRMPDVYTRIQCSSKTITAGALPLLAGLAVAKGPFTEYG
SRALLVAVLLLLVNPIAAHALARAAYKTGVPMWHGAVIDQPEGPGAGR
379763481YP_005349878.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTSLWAVDYLCLALVVGCAVLVVFLRSITGSVMALSAMGTVLGALFVVMA
APDVALATVAVGAIAQPVLYLIAIGKIRTDVFDRGELGEALDDGGARDD
379763480YP_005349877.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MVVPAMTDRRPPREAGWHRAWLGGLLVGGFAAVVAVGFTALPDGSNALPD
IARHAMAIALPRWGTTEAVSEVVYGSRAFDTFGETFLLLAAVVAVLLLSR
GREPRSEFVGEASAGRAEQEKADPDEGPDRRESQARAAEDQERRDEPEPA
PEHADDDALGAPAPERAVAMTVVVRVGARVAAVILAVAGVYLAAWGYTPG
GGFPAGVVLAGCVVLLYTALGHRAVRAAVRPATLEVAEMAGAAAIVGVGL
VGMWLTGSFLDNWLPLAPQQTIRAGGTLQVISTAELVEVATGITIAVFAL
LGMGHDWTPDEHES
379763479YP_005349876.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MIVANYVAAGVLFCLGLFAVTSRRNLIKIVLGLSLMESSTYLLLVSMAYR
NDSTAPVLAGLPGGRTQKDLVAGNVADPVLQNFCITAVVIGVAITAVFLT
VVVRVAQHYRSVDAADLTELRG
379763478YP_005349875.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MVLPLIGAVLAPLAARRAPRAPLWVAVTALSASLAVLLGVAARVFAGTGH
LLTHFLSNEHPVRGASLGIALVADPFGLTFATLAAGVGIVLVVSALSELG
DLGRRELGGLACLVQLLLAALIGAALTADTVNLFVWFEVAALASYGLTGF
FLERPIAVEAAFKNLVLTSIAGFSVFIGSAMLYSATGALNFGQLHGAVAT
GATRATLLAVAFLVAGFATKAGLVPFHAWLPDTHTPVPGAVSALFSALMV
DLGVVALARLRLQVFVNLPSLPALLTGLGLASALVGAAMALLQDDLKRLL
AWDTVAQTGVLTTGFASRTADGVAGAVYHLVNHGLFKALLFLCAGAVVHA
TGLTKLSEMGGLARRRPLLTAAFTVGVLSIAGLPPLNGYASLGLIHKGLS
DRPAVLGCALLAQVLTVAALGRAAYLGFYRRRNRAYAHLEPIRPGMKASL
IMLSACCLGFGVLAGPFVAHVAGPATAGLLDPAGYAAGALGSAVTLPNPG
VGFGYFEPKTLGTIAIELILGVALLVLALRRDGVARSLGWLRRVHTGSIN
DYAAFVTGGMIVVSCALLL
379763477YP_005349874.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MKAVTTIAVIGATGTAGSRVVARLRSRDVAVVEISREQGVDVFSGLDLCE
ALQGVDVAIDVSDPVPPEPSDIGQSLATASHNIVGACAIQEVHRLVVPTI
AGIDDPEFDGIPYYEGKRAAKNIVLDGPVPTTIVKSTQWYECATHCDAVS
CDGDEVIVEDWLIQPIAADTVADVLVEAALGQSHTPRTITGPHPIRLPEL
TSKLLAQQGDGRQVRTVRPAVAALANGALLASGHAVVVGPDVDTWLRTLA
PSTDGHHAADGEKPGGA
379763476YP_005349873.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MGDQKSGPQEAVQGAVEGVKGKAKEVGGAVLGRDDLADEGRAQQDKADAQ
RDAGKKEAEAESARAGADAAEERQKKNQ
379763475YP_005349872.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MADDEVMAIARKLVAPQRHPVDSADVGVEIIRVTGEAPSTYDIERVLGAM
KSAGDRPC
379763474YP_005349871.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MRVATFNILHGRTIGDGVDVARLRDCVRRLDPDVLSLQEVDCDQPRSERA
DLTAAAAEAMGAVEHRFVAAISGTPGATWMAATGREQPGTAAYGIALLSR
YPVASWQVLRLPRIPMRFPMYLPGPNRVMIVDEEPRAAVIAQLRTPMGGL
TVANTHLSFVPGWNRRQLLRVIHDLRGFPGPRLLTGDLNMTPKTVGRWSG
MRALATAETFPADNPNRQLDHILTDDPRLCGGAVDASPMPISDHRPLVVD
LQRV
379763473YP_005349870.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MKTVPAGNCAFAADPLTHGGTPVPLWLAAFAESPLPTLDLAECRRLIVVA
PHPDDETLGLGAMATQLTALGVDVQVVSVSDGGAAQPDVSVTDRLRMATI
RRYELGRAASLLNVPSPISLGFPDGELTDHEDTLADTLAEILDGGGPATW
CAATWRGDGHPDHEAAGRAASAACARTGTTLLEYPVLMWHWARVADPAVP
WDRAYSVPSPSWAMCRKRRAAQCYRSQLEPAGGESSPTLPGFVLARLLAV
GAAMGELVFR
379763472YP_005349869.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTAGLVEHWLESGRLELPLPASGRTAERWQRLARLAEDNIVAARIAESHV
DAVAILHELGGKPPDPGQLWGVWAAEAPDTALTATDTDGAFTLNGTRVWC
AGAGFCTHALVTARLEDGTQGLFAVTVTDPAVKALPSTWWNAGMAGSDTR
PVQFTNAQAVAVGDPGAYLNRPGFWHGAIGVAACWLGGARRVADPLYRCA
ASRSADAYSLAHLGAVDAALAASDAMLAEAAAQVDADPFDRSGTAQLLAR
RVRTVVEHAVDEAITRTGRALGPGPLCQDGRHAQRVADLSIYIRQSHAER
DLAELGQLAGRQAMRAP
379763471YP_005349868.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MEPLDAHADATSCASRLREALRGAASALKEHGPRFALAGSYALWAYGAPE
PSHDVDLVVAEADVETAVATLTNAGFAIERPPEDWLFKARTGDTLVDVLH
RINGVPVDAATLDQAEQQEVLAIGMPVLPPTMVLVQQLRSLGEHHCDFGR
LLPAVRAVRERLDWQRIEAETAENDYAVAFLVLADRLGLSRQ
379763470YP_005349867.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MPRSSIKNEKLYQDLRKKGDSKEKAARISNAAAGRGKSSVGRKGGKSGSY
QDWTVPELKKRAKELGMSGYSSLTKDKLVAKLRNH
379763469YP_005349866.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MATDQNPKQRDLESARFRRDTGYLTTQQGVRVDHTDDSLSVGERGPTLLE
DFHAREKITHFDHERIPERVVHARGAGAYGYFEPYDDSLSQYTAARFLTT
PGLQTPVFVRFSTVAGSRGSADTVRDVRGFATKFYTEQGNYDLVGNNFPV
FFIQDGIKFPDFVHAVKPEPHNEIPQAQSAHDTLWDFVALQPETLHTIMW
LMSDRALPRSYRMMQGFGVHTFRLVNDRGEGTFVKFHWKPRLGVHSLIWD
ECQKIAGKDPDYNRRDLWEAIESGQYPEWELGVQLVPEEDEFSFDFDLLD
ATKIIPEEQVPVRPVGKMVLNRNPDNFFAETEQVAFHTANVVPGIDFTND
PLLQFRNFSYLDTQLIRLGGPNFAQLPINRPVAEVRTNQHDGYGQHAIPQ
GRSSYYKNTIGGGCPALADENVFRHYTQRLDGQTMRKRAESFENHYSQAR
MFWMSMTRVEAEHIVAAFAFELGKVETPEIRSAVVAQLARVDGELAAQVA
AKLGLPAPPEEQVDTVTASPALSQVTDAGDTIESRKVAVLAANGVDVVGT
QRFIELMGQRGAVVEVLAPVAGGTLEGGSGGELPVDRSFTTMASVLYDAV
VVACGPRSIATLSNDGYAVHFVTEAYKHLKPIGAYGAGVDLLRTAGITNR
LAEDTDVLNDQSVITTKAAADELPDRFVEEFAGALAQHRCWQRRTDPVPA
379763468YP_005349865.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MATSRATSRASDRHLLVSDHHVLLSQGPTENGHRPAINALFRSVAVAFGP
RAIGVLLSGVLDDSVLGMGAIRARGGTAIGQSPEDALFPAMPVNAAEAGV
VDRQADAADIGAVLKELSHREIEGFAMECDAAMELENRIAMRSRFATDFD
TEKLGSPSGYTCPDCNGSLVSISEGNFRCQVGHAWTAEALLGARDNELEG
ALWIAVRSLREKARLARDMADRAGPGLLVRRYAAIAEETERALHVLSDRL
SGAARQPGDAG
379763467YP_005349864.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTGRSPAPRIALEPVEDAAILTVQGVLDSSTYRTIRDAVIKAAIAAPRAV
IVDINGLHAPSASAWTVFTSARWHVSVWPDVPILLVCEQPVVRRAITRAG
VTRYVPMHPDRKLALEAVHGQSVKVRRRARTELSRSSASIDLARTVVADW
LTNWDIREVIAVAATVATVFVENVLDHTESVPVLIVESYQDIVSVAVEDN
SPQLPARHEDADRGAHIVSGLAIVSAVSRRWGATPTLSGKTVWALVGREN
RL
379763466YP_005349863.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MESATDEAFEALLRYMRDSRGFDFTGYKRTSLMRRVRRRMDQAGYTSFEE
YLDFLQASSDEFTALFNTILINVTSFFRDAEAWDYVGAEVIPRLLAERGP
DDPIRVWSAGCASGQEAYTLAMMLAEALGAEEFRQRVKIYATDVDEDALG
EERGASYDAKAVESVPPEMLGRYFEQVNGRYVFRKDLRRAVIFGRNDLVT
DAPISRVDPLVCRNALMYLNAETQRMCWGVYTLRSCPRARCFSGTPRCSS
VMVTDSRR
379763465YP_005349862.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSLNHRIFRKAAGTHVGADRYEPGGAFYERHAELPGLATVRDLAFRASPV
AQIVVTGEDTVAMINQQAETLFGLSARDIGRLLRDLEVSYRPVELRAYVE
QAKVERRPARIQDVKWQRPGTETVWFEIHVNPLVDAENGLLGVSIVFFDV
TRNCNPRSRNSRPPTRNCSPPTKNSRR
379763464YP_005349861.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MNEELQSTNDELQTINDMLRERSLELDEAKSFQDSLVDSIQSGMVVVDRE
MKIVLWNRGCEDLWGLRADETLGSRLTALDIGLPLDGVLPLIGNAFVDPD
TSGEVVVDAVNRRGRPARVRVTCTPFRSNIGTVGGALLLMEVLG
379763463YP_005349860.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MKIAIVSGDDVVGEDPEQLGAALTTQGHDAVVCLRQNGRRRARAGACRSV
SVPVGPRAAASATDVLPYVGDWAARLERVWSKEQPDVVHAYGWLGGLAAQ
LAARRQRVPVVQTFLGLATASGAHAGNGSERRRIEPLLARGAAWATGESS
ADVDLLAQLRRSRARVSALTCGVDSERYTPAGPAIARDGLQRVLCIAPNP
LQHNGFDIAISALYRVPGAELVIAETEATNPAHDDARAQLQYLAKEFGVA
DRVRFAGTIPGNEMPMWVRSADVMVCTPREPLRPSTALQAMASGVVVVAA
TVGALADVVLDDITGVILPPENPVGLAAALRRLLAQRFQCESMGAAGRSR
AQSRFAWERIALDALNVYQSLGAQGRASTDLSSTAAR
379763462YP_005349859.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MEYKQFRGIDARAARRLFAAAYRPGWRLSGFTGHCAVSHRRRDTGSMTVD
EVAIQGRLTLEIPAGDTVVVIQPRAGSLSVAGGPSATADFPILVAHGMSC
VLHCNGARFDVVVLAAEVLHAVAAEWHTALSQRTQFLKWRPRSRAAVRAW
HRALDYVLTTLACADTAQQPMIAAGMANLLAGALLECYPSNLTEQDPGGD
GTLPETLKEAVSFIHRHTTEDIGINDVAAAVHLTPRAVQYLFRRQLDTTP
TEYMRRVRLRRAHLELIAASAGTSTVTEIAQRWGFAHTGRFAVLYRQTYG
QSPHTTLRQQTPA
379763461YP_005349858.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MRRSPLEHGPVAAAKDETILSRHSVWVWEIRLFGYHIALTDVRTWIRPAP
ATATGAVVGGRYAAKQLLHRVSG
379763460YP_005349857.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSARRAVRAFDPFPERLPPSETLPVRAADGTWLHAEVFGPADGYPIVLTH
GITCAIRAWAYQIVDLAGDYRVIAFDHRGHGRSGVPRAKAYSLKHLASDL
DSVLDATLAPHERAVVAGHSMGGITIAAWSERYRHKVPRRADAVALINTT
SGDLIRNVQLLAVPHGLSPARVLAGQALIGVFGGFPVPGAARIPSRYVVA
MLATGRDADPSIARLVYELFENTSPRGRAGCARALVTSMGSRYLDLSGLT
VPTLVIGSERDRLTPISQSRRIARDVPNLIGLVELPGGHCSMLEHPREVS
RQLRTLAEAAIHQSATSRISS
379763459YP_005349856.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSQPPRIVDVVVVGAGFAGLAAARELNRQGHDVVVFEGRDRVGGRSLTGS
VAGLPADLGGTFVGPTQDAVLAMAAELDVPTTPTHHDGKNLIHWRDWTHA
YRGTIPKLSLTGLLDIGRLRWQFDRIARGVPLAAPWDARRARELDGLSLG
GWLRSVRATASSRDLLAIVARVTWGCEPDDVSMLHAARYAHAAGGLDRLL
DVEDGAQQDRFPGGTQQIAEAAAAELDTRVVLGAPVRRIERHGAGVTVTT
DVGETEAGFVIVAIPPAHRASIEFTPPLPAEYEQLARHWPQGRLSKAYAA
YSTPFWRANGFSGQALSDRGPVFITFDVSPHPDGPGILMGFVDARAFDSL
PGDQRRRDVLRCFATLFGDDALKPLDYVDHRWGAEEFAPGGPTAAVPPGS
WTRFGRWLREPVGPIHWAGTETADEWTGFLDGAIRSGQRAAAEITALL
379763458YP_005349855.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MLGPLDEYPVHQIPQPIAWPGSSDRNFYDRSYFNAHDRTGNIFVISGIGY
YPNLGVKDAFLLVRRGDTQTAVHVSDAIDQDRLNQHVNGYRIEVIEPLHR
LRIVLDETEGIAADLTWKGLFDVVQEQPHILRSGNRVTLDAQRFAQLGSW
SGHIVVDGEEITVDPNTWLGSRDRSWGIRPIGEAEPAGRPADPPFEGMWW
LYVPMAFDDFAIVLIIQEEPNGFRSLNDCTRIWRDGRVEQLGWPRVKIHY
RSGTRIPTGATIEATSPDGTEVHFDVESKLPVPIHVGGGYGGDSDWIHGM
WKGEKFAERLTYDMTDPAIVARAGFGVIDHVGRALCRDGDKPPVEGWGLY
EHGALGRHDPSGFKDWLTVAP
379763457YP_005349854.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MATEPAVDNVDRLQRSSRDVTTLPTVMSRWLSTVLPDGAKPEVTVESGVD
STGMSSETIILTVRWQQDGQPTEQKLVARVAPTAEDVQVFPTYRLDHQFD
VIRKVGELTDVPVPRVRWLENTGDILGTPFFVMDYVDGEVPPDVMPYTFG
GNWFADAPAERQRELQDATVGVLASLHSIPDARNTFGFLTEGQIGDTALR
KHFNWVRSWYDFAVPDIGRSPLLERTFDWLEANWPTETAAAEPVLLWGDA
RVGNVLYKDFAPVAVLDWEMVTLGPRELDVAWMIFAHMVFQELAGLATLP
GLPEVMREDDVRATYARLAGVEVGDLHWFYVYSGVMWACVFMRTGARRVH
FGETEKPDDVESLFYHAGLMRRLIGEDQ
379763456YP_005349853.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MKADPSGLDKAPGAGRPRDPRIDSAILSATAELLVQTGYSNISLAAVAER
AGTTKSALYRRWSSKAELVHEAAFPVAPTALEAPAGDIAADTRMMIEAAR
DVFTTPVVRAALPGLVADMTADPALNARVMSRFVDLFAAVRVRLREAVDR
GEAHPDVDPDRLIELIGGATMLRMLLRPEEELDDAWVEQTTAIVVHGVRR
379763455YP_005349852.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTGRLAGRAAIVTGASRGLGRAIALALAAEGAAVAVGGRTEEVWDDRLPG
TIGETVADIEAAGGRAVAVRADLTDRDEIARLVDSARDALGPIAILVNNA
AFTAPGRPPAPGGEPRPKPAKPPSGAAKPGWPGFVSTPLHAYRRHFDIAV
FAAYQLMQLVCPDMIEAGGGSIINITSVASRLPGDGPYADRSGGVLPGYG
GSKAALEHLTQCAAFDLTDHNIAVNALSPSKPILTPGLSYYARNFDDTAS
ADEFARAAVELALVDPGKVTGRTIGHLQVLDGSFRPFALD
379763454YP_005349851.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MALIVLLLVVAAALRGYFPAQQHATRSESGGRAAMVFVVAILAATLALVA
IAVVARLRDPRAPAPSAGALSDMLGTGRGRPSWRVLLIGLAVIVAWLLIV
MLLSRLLAPHGIGPAPSPSETGGQPPSGHGGSPPPPQQQHRPRDGSQSML
GVLLASTAAMLFVIVAGTVATARRRRHPIALRIADEPAESPAAAAPPRSL
ARAAERGLAEMTDLSREPREAIIACYAAMERELAHVPGAVPQDFDTPSEV
LARAVERHALHADNAVQLVNLFTEARFSPHVMNEGHRDVAVRVLRLVLDE
LRSLSVA
379763453YP_005349850.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MKKTATLGVCLIIAIELLTLTQHDRRLVLAASGIGLAVVLLGLRRTLGRA
PEAGTEPEADDLGDSLRRWLSTTETTIRRSEATRADWDRHLRPMLARRYE
IATGQRQAKDPAAFHATGRMLFGVELWDWVNPNNVIRNGDRQPGPGRAAL
EEILRKLEQV
379763452YP_005349849.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTLPAATTTAHCEAILDEIERVVVGKRAALKLILTAVLARGHILIEDLPG
LGKTLIARSFAAALGLQFTRVQFTPDLLPADLLGSTIYDMQSGRFAFRPG
PIFTNLLLADEINRTPPKTQAALLEAMAERQVSIDGETHQLSRPFIVLAT
DNPIEYEGTYPLPEAQLDRFAIRLELRYLSERDETSMLRRRLERGSAEPT
VNQVVDAHDLLAMRESVEQVTVHEDVLHYVVSLANATRHHPQVAVGASPR
AELDLVQLARARALLLGRDYVIPEDVKALATAALAHRITLRPEMWVRKIQ
GADVIGELLHRLPVPRTGASPGDTG
379763451YP_005349848.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTQGREIEFRWRASGLTRAVATCAGFAMAAAVIGARWQLIAFAAPLLGVL
CSISWQRRVPEIRVHGEPDAQRCFESEQAHLRVWISGEEQGLSAARLTVP
DVEGMELEIADADAGRAKTVAATAQRWGRYRIAARVEVIARGGLLTGTGV
VDAAEVIVFPLTPPQATPIPQIELLDRLGAHLTRHVGPGVEYADIRPYVP
GDQLRAVNWPVSARRGQLHVTERLTDRAADVVVLIDGYRQPAGPATAATE
RVVRGAAQVVQTALRHGDRAGIVALGGNRPRWLGADIGQRQFYRVLDTVL
GAGDRFERTTGTLAPRAAVPAGAIVIAFSTLLDTEFALALIDLRRRGHVV
LAVDILDSSPFEDDQDPLVDRMWALQRSSMYRDMATVGVDIVSWRGDSGL
EQSMGVLPDRRRRVRGRLRG
379763450YP_005349847.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MDSGGAGALGRLGSPAFATGFGLLMVGSAAGGSHGFAVAAWVAALVSVGA
GTVFRFAATVAVLLAVVTVTLSDPPVVFVALSGLCAAAYLVCRHATGAAA
PVVLSSWPTAVAAVGFTFAGLVATSFPLQLPWLPLAAPLGALVIYLLAIR
PFLA
379763449YP_005349846.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTLPTPSIQYFLLSPTLIVFGIAVVGVLAEAFLPRRIRYAGQVTLALGGL
IAAFVAVVAVSRSIKSSGRAAVLGAMAIDRPTLYLQGTVLLVAVMAVIFI
AERTQTKTESKVSVATGAGGTGGLDSFTPQASAVPDSDAEREAERAGAAQ
TELFPLAMLSVGGMMVFPASNDLLTMFVALEVLSLPLYLMCGLARHRRLL
SQEAAMKYFLLGAFSSAFFLYGVALLYGATGTLLLTGIRDALTTRGDSSL
ALVGVALLSVGLLFKVGAVPFHSWIPDVYQGAPTPITGFMAAATKVAAFG
ALLRVIYVALPPLHDQWRPVLWTISILTMVVGTITAVNQTDVKRMLAYSS
VAHVGFILTGVIADNHTGLSSTLFYLLAYSFSTVGAFAIVGLIRDDDGVE
DAALSHWAGLGQRSPIVGVMFSMFLLAFAGIPLTSGFVSKLAVFKAAAQG
GAAPLVIVGVVASGVAAYFYVRVIVSMFFTEATEDTPHVVAPGILSKAAI
AVCAAVTVVLGIFPQPLLDLADHAAHLLH
379763448YP_005349845.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MNPMTSVPWLSVLWLVPLAGAVLIILMPPGLRQLAKWTGLVFGVATLAVA
IVVTLGFKTGGAPYQFVEKHQWIPAFGAGYTLGVDGIAVVLVLLTAVLIP
VLQIAGWNDGGQRTRGVHAYVALTLAIESMVLISVIALDVLLFYVFFEAM
LIPMYFLIGGFGGGSGRSRAAVKFLLYNLFGGLIMLAAVIGLYVVTSQHG
SGTFDFREIVAGVASGRYGADSAVFKALFLGFMFAFAIKAPLWPFHRWLP
DAAVEATPATAVLMMAVMDKVGTFGMLRYCLQLFPDASTYFRPLIVVLAV
IGVVYGAIVAIGQTDIMRLIAYTSISHFGFIILGIFVMTSQGQSGSTLYM
LNHGLSTAAVFLIAGFLISRHGSRAIADYGGVQKVAPILAGTFLVSAMAT
LSLPGLAPFISEFLVLLGTFNRYWLAAGFGVTALVLSAVYMLWLYQRVMT
GPVATGNEKIGDLRARELIVVAPLIALLLVLGIYPKPVLDIINPAVENTM
TTIGQHDPKPTVPVGNPRPAQARTAEGPR
379763447YP_005349844.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTNLIGTQYSWLLVALPLAGATILLFGGRRTDRWGHWLGCATALAAFALG
LSLLGELLGRPADDRVIHQKVFSWIPVGQLQVDLGLQIDQLSVCFVLLIS
GVGSLIHIYSVAYMAEDPDRRRFFGYLNLFLASMLLLVVADNYVVLYVGW
EGVGLASYLLIGFWYHKPTAATAAKKAFVMNRVGDAGLALGMFLMFSTFG
TLSYAGVFAGAPAAGRGALTAMGLLLLLGACAKSAQVPLQAWLGDAMEGP
TPVSALIHAATMVTAGVYLIVRSNPLYNLSPDAQLAVVVVGAVTLLLGAF
IGCAKDDIKRALAASTMSQIGYMVLAAGLGPAGYAFAIMHLLTHGFFKAG
LFLGSGAVIHAMDEEQDMRRYGGLRAALPITFATFGLGYLAIIGVPPFAG
YFSKDAIIEAALAAGGVRGYVLGAAALLGAGVTAFYMTRVMLMTFFGKKR
WAPGAHPHEAPGLMTWPMILLAIGSVFSGGLLAVGGTLARWLEPVVGKHE
EVTHAFPVWVSSALALGVVAIGIAVAYRLYATADIPRVAPLSVSPLTSAV
RKDFYGDALNEEVFMRPGAQLTHALVEVDNAGVDGSVNALAALVSQASNR
LRGLQTGFARNYALSMLTGAVLVVALILAVKLW
379763446YP_005349843.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MNPANYLYLSALLFTIGAAGVLLRRNAIVMFMCVELMLNAVNLAFVTFAR
MHGHLDGQMIAFFTMVVAACEVVIGLAIIMTIFRARKSASVDDANLLKG
379763445YP_005349842.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTGFAGHAVTSVMASSFAHDTIARTSTGEAVTFWVLGALAVIGALGVVLA
VNAVYSAMFLAMTMIILAVFYMIQDALFLGVVQVVVYTGAVMMLFLFVLM
LIGVDSAESLRETLRGQRVAAVAAGVGFGILLIAAIGDVAAGGFAGLTTA
NAAGNVEGLAALIFSRYLWAFELTSALLITAAVGAMVLAHRERFERRKTQ
RELSQERFRPGGHPTPLPGPGVYARHNAVDVAALLPDGSYSKLSVSPMLQ
SRGADGKKTPSPEASSGLSQGGPS
379763444YP_005349841.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MDAVAGFGVTLGSMFKKRVTEEYPEKPGPVMPRYHGRHQLNRYPDGLEKC
IGCELCAWACPADAIYVEGADNTEELRYSPGERYGRVYQINYLRCIGCGL
CIEACPTRALTMTNDYEMADDNRADLIYEKDRLLAPLLQDMLAPPHPRAE
GATDKDYYLGNVTAHGLRDNQHAGDSR
379763443YP_005349840.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTTGLTVFGHDTWWLVLGKALAIFVFLMLNVLVAILLERKILGWMQRRPG
PNRAGPWGVLQSLADGIKLALKETITPGGVDKFVYFAAPVISTIPAFTAF
AFIPFGPVVSVFGHRTPLQLTDLPVAVLFILGLSAIGVYGIVLGGWASGS
TYPLLGGVRSTAQVISYEVAMGLSFAAVFLYAGSMSTSQIVAAQDRVWYV
FLLLPSFVIYLISMVGETNRAPFDLPEAEGELVAGFHTEYSSLKFAMFML
AEYVNMMTVSSLATALFFGGWHAPWPLNMWAGANTGWWPVLWFTAKMWTF
LFIYFWLRASLPRLRYDQFMGLGWKLLIPASLVWVLIAAVVRTLRNQGYQ
HWTPVLVVSSIVFATVLVMLLRKPFSAPGIRALERQLRRQAKKLPAASIS
TPVFPTPPLPAKEMKSLAAASKEEARG
379763442YP_005349839.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTSLAKTETGDEVRPPEMVTLTIDGIEISVPKGTLVIRAAELMGIQIPRF
CDHPLLEPVGACRQCLVEVEGQRKPMASCTTVATDDMVVRTQLTSEAADK
AQHGVMELLLINHPLDCPMCDKGGECPLQNQAMSNGRADSRFTDEKRTFA
KPINISSQVLLDRERCILCARCTRFSEQIAGDPFIDMQERGALQQVGIYA
NEPFDSYFSGNTVQICPVGALTGTAYRFRARPFDLVSSPSVCEHCASGCA
QRTDHRRGKVLRRLAGDDPEVNEEWNCDKGRWAFTYATQPDVITTPLVRD
ADGSLQPTSWSHAIAVATQGLEAARGRTGVLVGGRATLEDAYAYSKFARI
VLDSNDIDFRARPSSAEEADFLAARIAGRPMTVSYADLESAPVVVLAGFE
PEDESPIVFLRLRKAARKRGLPVYAVAPFATRALDKMSGRLIKTVPGAEA
AALDGLATGEVGDLLSTPGAVIMVGERLATVPGGLSAAARLADTTGARLA
WVPRRAGERGALEAGALPGLLPGGRPVDDETARAQVARAWNVSELPSGRG
RDADGILAAATDGTLGALLVGGVEPDDFADPEAVLAALDGAGFVVSLEMR
DSAVTRRADVVFPVASTTQKAGAFINWEGRFRPFDAALRNTQDATQSDHQ
VLDALADEMGVYLGMSTVDAAREELAALRHWDGKRPASPDVAAPQPPEVG
AGEAVLAGWRMLLDNARMQDGEPHLAGTARKSVVRLSADTAAEIGAAEGD
AVTVSTSRGSISLPLLVTDMPDRVAWLPLNSSASAVYRQLGATPGSTVKI
GVGK
379763441YP_005349838.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTTTSETSGATPLTPVLSRFWDDPESWTLETYRRHGGYEAMKKALAMEPD
AVIGVVKDSGLRGRGGAGFSTGTKWSFIPQGDTGAAAKPHYLVVNADESE
PGTCKDIPLMLATPHVLVEGVIIAAYAIRANHAFIYVRGEVLPVLRRLQN
AVAEAYAAGYLGRDINGSGFDLELVVHAGAGAYICGEETALLDSLEGRRG
QPRLRPPFPAVAGLYGCPTVINNVETIASVPSIIGNGVDWFRSMGSEKSP
GFTLYSLSGHVTRPGQYEAPLGITLRELLAYAGGVRAGHRLKFWTPGGSS
TPLLTDEHLDVPLDYEGVGGAGSMLGTKALEIFDETTCVVRAVQRWTYFY
KHESCGKCTPCREGTFWLDKIYERLEAGTGTHEDLDKLLDISDSILGKAF
CALGDGAASPVMSSIQYFRDEYVAHVEGGGCPFDPRDSMLIPNGKA
379763440YP_005349837.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTGPQGQPVFLRLGPPPDEPNAFVVEGAPTSYPPEVRARLEVDAKEIMGR
YPEKRSALLPLLHLVQAQDSYLTPAGLEFCGEQLGLSGAEVSAVASFYTM
YRRGPTGDYLVGVCTNTLCAVMGGDAIFDALKEHLGIGNDETTADGSVTL
QHIECNAACDYAPVVMVNWEFFDNQTCESARELVDSLRSGEPKAPTRGAP
LCAFRETSRILAGLPDERPDQGQGGAGAATLAGLKVAKEHGMQAPGAPEG
QP
379763439YP_005349836.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSTTTESTHDGAGETLVVAGGQDWDKVVEAARNADPGERIVVNMGPQHPS
THGVLRLILEIEGETVTDARCGIGYLHTGIEKNLEYRYWTQGVTFVTRMD
YLAPFFNETAYCLGVEKLLGITDQIPERVDVIRVLMMELNRISSHLVALA
TGGMELGAMTPMFVGFRGREIVLTLFESITGLRMNSNYIRPGGVAQDLPP
NAQTEIAEALEPLREVLREMSGLLNENAIWKARTQDVGYLDLTGCMALGI
TGPILRATGLPHDLRKSEPYCGYENYEFDVITEDTCDAYGRYMIRVNEMW
ESIKIVEQCLDKLKPGPTMVEDRKIAWPADLKVGPDGMGNSPEHIAKIMG
GSMEALIHHFKLVTEGIRVPPGQVYTAVESPRGELGVHMVSDGGTRPYRV
HYRDPSFTNLQSVAAMCEGGLVADLITSVASIDPVMGGVDR
379763438YP_005349835.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSSPNQDPHEAIGRADEEVIDVRRGMFGVQGSGDTSGYGRLVREVLLPGS
SPRPYGGYFDELVDGLAEALKKGGVEFTDAIEKVVVYRNELTLHVRREAL
PQVAQRLRDEPQLRFEMCLGVSGVHYPHEAGRELHAVYPLQSITHNRRVR
LEVSAPDDDPHIPSLFGIYPTTDWHERETYDFFGIIFDGHPSLTRIEMPD
DWHGHPQRKDYPLGGIPVEYKGAQIPPPDERRAYN
379763437YP_005349834.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MGLEEQLPGGILLSTVEKVAGYVRKNSLWPATFGLACCAIEMMATAGPRF
DIARFGMERFSATPRQADLMIVAGRVSQKMAPVLRQIYDQMAEPKWVLAM
GVCASSGGMFNNYAIVQGVDHVVPVDIYLPGCPPRPEMLLYAILKLHEKI
QEMPLGVNREDAIAEAEQAALSARPTIEMRGLLR
379763436YP_005349833.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MNVYIPILVLGAIAAAFAVGSVVIASLAGPSRFNKSKMAAYECGIEPTET
SVSGPHATAGQRFPVKYYLTAMLFIVFDIEIVFLYPWAVSYDALGTFALV
EMVVFMLTVFVAYAYVWRRGGLTWD
379763435YP_005349832.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSDSLPQSSVALRILVYSSNAQTRERVMRALGKQLHPDLPELSYVEVATG
PMVVRTMDEGGIDLAILDGEATPTGGMGIAKQLKDELETCPPLVVLTGRP
DDAWLASWSRAEGAVPHPIDPILLGRTVLNLLRTPVR
379763434YP_005349831.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MGVTMTTLETLLHDPDLAGGWNLVLDRSAITFKVRNMWGLVNVKGRFTDF
TGDGQLTGKGAVFGRVDIRAASLDTGIGRRDKHLRSADFFDVDRFPEIGV
VVTALRPTTGKAADVRANFTIKGITAELPLPVTISELDDGSVRVAGETTL
DRARFDLGWNRLGMIGPTVTAAAEAIFVRESR
379763433YP_005349830.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MPASRAETVIEAADRLFTAIERGDVAAVGAMWSDDIAVWRVGSRHDPLKT
DDKARAMRVIEWFIGATTQRRYEILDRQLFDDGSAQGFVQQHVLHATGHA
GQSISLRVCIVIRVGTDGRIERIDEYFDPAGIAPLLD
379763432YP_005349829.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MMHDDESAELTAKLAAVLTSAIGTDTAVENLRALTGGASRTTWAFEAVTG
AQRRSLILRTGPPDDVHAGMELEARSQAAAAAAGAPVPHVLIADDSPAAL
GNPFLICDEIKGETIVRRIQRRLDSGDGHAGRARLLQQCAQAAAAIHRAD
PHGPGLAHEDQLDEWRRRLDDMGDTTATFEWGFRWLAANRPDPTPAVLVH
GDFRMGNLIVDGSDLAAVLDWELVHVGQAYEDLAWFCIRAWRFGAPASLG
AGGLGSIESFLRAYEQAGATTVDRVAFHWWLVLATLRWGVICRFQAERHL
SGQHRSVELATIGRRVCETEWDLLNLLAPADDGRRAAARGGGGQSGPGGP
VSGAYGRPQAAELVAAVAEFLETDVRAATDGQVNFHARVAANALRIVERE
LLDDSGAESRAALAGLGVADEDQLAAAIRSGEMDDRAADVTACLRTLVRR
RLAVAHPGYDSE
379763431YP_005349828.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MDFTLPEHLPGVLAEMDEFIETEIKPLERENIQYFDQRREHARTDWDNDG
IPTREWEDLLAEMRRRADKAGWLRYGLPASLGGRDGSNVDMAVIREHLAR
KGLGLHNDLQNESSIVGNFPQVIMMERFGTDEQRRVWSEALITGERSMAF
GLTEPKHGSDATWLETHAERDGDTWVINGSKRFNTGVHRATHDLVFARTS
GEPGGARGITAFLVPTDTPGFDVPYYWWTFNMPTDHGEVELTDVRVPADA
VLGEVDRGLEVAQTFLHENRIRQAASSLGAAQYCIDRAAEYAGGRTVFGK
PLSVNQAVQWPLAELQTEAQMVRLLVQYAAWHLDRDHHMEVSDKVSMANY
RANRLVCDAADRAMQIFGGLGYSRHEPFEHIYRHHRRYRITEGAEEIQIR
RVAQRLFNFGRK
379763430YP_005349827.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSAPEATRELTAKGRQTRQAIEQAARKLFAERGFHGTTVADITSAAGKSP
AVFYRYFTDKEDLLAALAKSFLHEVVTPSGASVHLPDAPDDDAFFTSVVT
GYWNMFKQNIGIMIAVAQLAATQRRFAAVQNEFRRLGIDLVAASVRRAQE
QGYGAELNPEHTAAAIALLFENFTTVFVGPSNLGIKISDKDAIATLSTIW
KRTLYGA
379763429YP_005349826.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTTQHVQIREVALRDGLQIEAPIPLSAKLELLAAVAATGVREVEATAFVS
PTKVPSMADAAELAAHLHDYPDIEFSALVASPNGARRAVAAGLRSIEYVV
AADDTFSKANVGRTSAEATNQIDEIVAIAHDGPTGVPVTVEVVIATAWDS
PFEGPTPPQRVLDIAAAARERGADRLSIADTIGTTTPGRVSSLIAQLRPV
IGDMPLGGHFHNTRGSGLASAYAAVTAGVTRLDASVGGLGGCPFAPGATG
NIATEDLVYLLRDSGVDVDVDLQAAIAAAAVAKSLVGHDLPSSLLRAGDR
IQN
379763428YP_005349825.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MIPTGPLDGVRVLELGTLIAGPFAGRLLGDMGADVIKVELPKAPDPLRTW
GQAEVDGQHVFWTVHARNKRAITLDLRHAQGRELFCELVEKSDIVVENFR
PGTLEKWNLGYDVLSERNPGIILVRVSGYGQTGPDASKAGYASVAEAASG
LRHLNGFPGGPPPRLALSLGDSLAGMFGAQGALAALYRRSVTGRGQVVDV
ALTESCLAVQESTIPDYDVGGVVRGPSGTRLEGIAPSNIYRSADGSWVVI
AANQDTVFARLCKAMGRPELATDDRFATHVARGRNQDELDNIIGCWAAER
QPGEIIETLSAAGVIAGPINTVAEVVNDPQLRARDMLVEHYDERLQRNVL
GPGIVPVLSESPGRLRNAGPARPGEHNDDVYVGLLGKTAAELEELRAQEV
L
379763427YP_005349824.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTHAVKPKKHEYDRIPYLVAFQNNSGVRDVYGGLAEITVLESYLLKPRDN
PSDTVLVFMHPIGGGAYLPMINALARAGHHVIYCNSRFRGTDSALLMEKV
VEDLGECIKDAKKRLGYSKVVLAGWSGGGSLSVFYQQQAQNPTITSSPTG
DGPDLTKLDLPAADGIMLLAAHISRHGTLTEWLDASILDESDPTKRDPEL
DLYNPDNPNQPPYSQEFLARYRQAQIDRNRRITAWVKDKLAELRAAGRPD
DEFGFVVHGTMADPRWLDPTVDPNERAPGTCYLGDPQVVNMSPVGLARFS
TLRGWLSQWSYDDARGDAVSCGPDIAIPALVIGNLADDACTPSHTRRLFE
AIGHPDKEIHEIPGATHYYAGPDQRDALRTAVTIVTDWLVRHDFASAE
379763426YP_005349823.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTAELGPSEEPSMESFVHLRKGKTPRRLHADLDGLKDDELGRGGFTGRTA
NLYRRNDPTAYRSVGPLRPLDVLSSELKPGDATDAGGGPLLMFSNDDCRI
LLSRRHEPMPFFARHVDGDLLCFVHQGTGLAETEFGPLRYREGDWLYIPK
ACTWRQLPDTATTMLMIEARDEFRIPPPGALGRHFPFDPSQVVIPEPVPA
DDDASGGEYEVRLIHEGGPTTLFYQHNPLDVEGWRGDNFAFTFNIADYNV
VTSDSVHLPPTVHLFMQATGVYVMNFLPKPAEGVPGTERTPWYHRNVDYD
EIAFFHGGSLYGIPMPPGLISHAPQGVHHGAPEKARERARRKFDEYSRVD
WQVIAIDTRRRLTPSAEILAHDLGQH
379763425YP_005349822.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MADIDEPTGDGVVVDVHAAGVAFPDALLTRGLYQYRPQLPFVLGAEIAGV
VRSAPEGAHVGPGDRVVGLTMLSGGMAEVAILAPDRVFKLPDNVSFEAGA
GLLFNDLTVYFALTVRGRLQRGETVLVHGAAGGIGTSALRLAPALGASRT
IAVVSTQDKADIATAAGATDVVLADGFKDAVKELTHGRGVDIVVDPVGGD
RFTDSLRSLAPGGRLLVVGFTGGEIPTVKVNRLLLNNIDVVGVGWGAWAG
THPGALAEQWAGLERLLTSGELAPPEPATYPLDEAAAAVASLENRTAKGK
VVLRVRG
379763424YP_005349821.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MDTFHALVARQDGDRITASVETLRPDDLPPGDVTIRVLYSSVNYKDALAL
TPGGGVVRNYPVVPGIDLTGEVVESTSPDFAVGDAVLAHGYAIGTGHHGG
YAEYARLPADQVVALGALSPHEGAAIGTAGFTAAMSVQALIDWGIAPDAG
DIVVTGATGGVGSVSVDLLAAAGYRVVASTGKADAAERLKTLGAAEVIGR
LPADPDAKPRPLGKARWAGGVDCVGGATLADVLSTIDYGGAVAASGLTGG
PALHTTVMPFILRGVALLGMDSVLMPIGPRRALWARLGDSLRPRHLDSLV
SDVDVKDVVGVIDQVRAGKFSGRAVVRVAGGF
379763423YP_005349820.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MDPFPLGGFSVNRVGFGAMQLPGPNAFGPPRDRDEALAVLRRAVELGVDH
IDTAQIYGPDVANELIREALHPYPPNLALVSKVGGRRDGDGAWLPAGEPA
ELRRDIETNLRTLGVERLAVVNLRVFDSSAPDQLFDDQLSAMISARDAGL
IGAIGLSNVSREQLAHACERTEIACVQNAFNLIHRESAAVLGECTTRGIA
FVPFFPLGAAFMRPNPVLGHQLVQGIAQRLGRTPAQVALAWTLGVAPNVL
LIPGTSSLRHLEENVDVASIELDDDDRERLNAVAT
379763422YP_005349819.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAINLELPRKMQAVTTKTHQGAAELMRPIARKYDLKEHAYPVELDTLFSL
FEGASESFEFAGANALGGEDEERDKNHNGANMAALLQTLEASWGDLAMML
SVPYQGLGNAAISAVANDEQLQRLGKVWAAMAITEPGFGSDSAAVATTAT
LDGDEYVINGEKIFVTAGSRATHIVVWATLDKSQGRAAIKSFVVPREHPG
VTVERLEHKLGIKGSDTAAIRFDNVRIPKENLLGNPEIEVGKGFSGVMET
FDNTRPIVAAMAVGVGRAALEEIRKILTEAGVEISYDRPAHVQSAAAAEF
LRMEADWEASYLLSLRAAWQADNKIPNSKEASMSKAKAGRMVTDVTLKSV
ELAGTAGYSEQTLLEKWARDSKILDIFEGTQQIQQLVVARRLLGLSSAEL
R
379763421YP_005349818.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTDTGSPKTTARSRVKRRDHKSAVGLQPHKRTGVDIAIALITPLVGQEFL
DKYQLRDPLNRALRYGTKTIFSTAATTSRQFKRVQNLRTGPTRLKSSGKD
YFDLTPDDEQKMIVETLDEFAEEVLRPAAHDADEAATYPQDLIAKAAELG
ITAINIPEDFDGIAAHRSSVTNVLVAEALAYGDMGLALPLLAPGGVASAL
THWGSADQQATYLPEFAGENVPQACVAIAEPQPLFDPTRLKTTAVRTPSG
YRLDGVKSLVPAAADAELFIVGAQLDGKPALFIVESSAKGLTVKADPSMG
LRAAALGHVELSGVSVPLGARLGEDDASDQDYSEAIALSRLGWAALTVGT
SHAVLDYVVPYVKEREAFGEPIAHRQAVAFMCANIAIELDGLRLITWRGA
ARAEQGLPFIREAALAKRLGADKGMQIGLDGVQLLGGHGYTKEHPVERWY
RDLRAIGVAEGVVVI
379763420YP_005349817.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSRTEDLALALTLADRADSLTSSRFGSLDLRVDTKPDLTPVTDADRAVET
ELREALARERPKDSIVGEEFGGDTTFTGRQWIIDPIDGTKNFVRGVPVWA
SLIALLHDGVPVVGVVSAPALQRRWWAADGHGAFVAFNGTPPRRISVSSV
AQLNSASLSFSSLSGWAQLGVRDRFIALTDAVWRVRAFGDFLSYCLVAEG
AVDIAAEPEVSVWDLAALDILVREAGGTLTALDGTAGPHHGSAVATNGLL
QGQVLGSLTVN
379763419YP_005349816.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MWEFGLLILLIAVLAVFLVQRFVPRGPRGELLSGTLLVTGVSPRPDATGE
QFVTIAGVINGPSVNEHAVYQRMAVDVDQWPTIGQLFPVLYSPKNPDNWR
IAPPTPPAPQEPQS
379763418YP_005349815.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MDFGFLPPEVNSGRMYAGPGSGSLLAAAGSWDSLAAELSITAAVYESVLS
GLTGLSWYGPASQAMAASAAPYVGWLHATAERAQQTGIQARAAAAAYELG
RAMTVPPPAVAANRTQLATLVATNFFGQNTAAIAANEAQYAEYWAQDASA
MYSYSASSAATVQFSPFSAPREATTQDGVTAQQDAVTQATANAANSNAGP
GSQLFAFSRRDGFARILDTIQGAQVAFRSIFTAEGFNAGIIQADKNLGIL
PNLAAVPAALPKAPALSGAASGLGNVNAVLARAGRIGPMSVPAGWAAAAG
DPVPALPGGGLSGLPATEALARTGPAAAGVPGIPGGTVRRAPLVVPRYGV
RITVMTRPPAAG
379763417YP_005349814.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MINAVAASAGASGVCPQTALRGDVSTMDWAFVPPEINSARMYTGPGMGSL
LAAAGSWDALSAELSSAAEGYESALSGLDLQWRGPAAQAMAFAAIRYAEW
LQVTAEQTRQTAMQARTAAAAYEQAYAMTVPPPVITANRTLLAALVASNI
VGQNTAAIADTEAQYADYWAQDAAAMSAYSVSSAAATQLPRFAPATNSTN
ESGVSAQKAAVTAANSNAAANKAVTQSYSPLSTQQTGDTYNYYGDIYDLS
DTTAAAGGKPFFAALDAIQGTGVGFSAPYNMEQFVSGIIGAENNLGILAK
PLAAAPALAAPALSSTTTSLGGGLGAGLGNVTATLSHAGSIGPMSVPASW
AAPTSTHISPLEPAGFTTLPGTEEPVASGYPGYPGMPGGGASRSVGAGVP
PRYGVRLTVMPRPPAAG
379763416YP_005349813.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTTLVIGLIAAGIVVLVVLATWSLVVLREYERGVVFRMGHVRPLYAPGLR
LLIPLLDKMIRVDQRLVTLTIPPQEVITRDNVPARVNAVVMFQVTDALKA
ILAVENYAVATSQIAQTTLRSLLGRADLDTLLAHREDLNSDLRTIIEKQT
EPWGVQVRVVEIKDVEIPESMQRAMAREAEAERERRAKVINARGELQASE
ELREAAETLSKSPASLQLRYLQTLLELGADQNSTVVFPLPVDIITPFLRN
PEMLRGVVDSFNHRG
379763415YP_005349812.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTVTAPATSVWLIAGYSLALLAVGWSFDVMARRASAHAARWRTGQFTYRP
DHDAWICPQDHWLWPTSFDPKHRVMRYRALPVVCNSCPVKSDCTTSEHGR
EISREIDPWPHSDAGRFHRGIACCVAALGIVLPLATLIANHSAADALVLM
ATVLLVALLGAPLVRHLWNTPSNAPEHLPHRTAIEDQVAAAIDRYSTRWG
GWKPKEDNTT
379763414YP_005349811.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTAQPTSAQQSSSQPLVGKGWVQGVALVMIFGFLVMGILAYRTYSASMPM
PDKVVSESGQLLFTGEDITRGQELYQARGLMEYGSVLGHGAYLGPDYTAE
YLRAATQDVADQLRAQGVSEPRDRVVTEFRTNRYNPATKTLVFTDRQAAA
FDHIQNRYAAYFGENSTKYGLLPHMITDRAQIRELTGFFAWTAWAAAAER
PGHRYTYTNNWPAEPRVDNGPTAPVIVWSALSLIALLGGIGIMFAVYGRW
SQKVGWHSAESSTLSFRQPGEVSLTPAQRACIWFFAIVSVLFLAQTLLGA
AAEHYRADLSNFFGLDLARVLPYNLARTWHLQLSLFWTAAAFLAGGIFLV
PFIARREPRRQALLAYVLLGAVAVVVFGSLICEALSIYGVIPAGGLFSQQ
WEYLDLPRLWQVLLIVGMFLWIAIIWRGIRGRLKTESKMNMPWLFFFSGL
AIPAFYAVGLLAGSDAHYTVADFWRFWVVHLWVEDFLELFTTVMVAYMFV
LLGVVRERIALGVIFLDVILYSAGGVIGTMHHLYFSGTPVEHMALGAFFS
AAEVIPLTFLTVEAWAFLQLGARQQSGDANPFPHRWAVMFLVAVGFWNFL
GAGIFGFLINLPIVSYYQIGTALTANHGHAAMMGVYGMLAVGLAMFAFRY
VIPADKWPEKLARISFWCMNIGLAWMVFATLLPLGVLQLYHSVNDGYFEA
RSLGYITKPGNAVLEWLRLPGDVILIVGGVLPFVWIAWIALRNFRSGTTA
QELPESPLYTQAAVEPEAGAAVPAKD
379763413YP_005349810.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MIHRSTSRRLAQVGTVVAEVDNGTVLRHAFEEARLRGATLRAVSISRDAA
LGNFTAPAQLDRRLARWMRLYPDAHAEQALRARDPLWQPMNRAPGRTGND
DR
379763412YP_005349809.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MRSDEPVSVLTEDENWNRLGSVTLGRLVTNFAGEPEIFPVNFVAQDRTVL
FRTAEGTKLFSAVANHAVVFEVDDHNLVEGWSVIVRGRARLLKTDADIAH
ADRAQLLPWTAMRKPHYVRITPTEVTGRHFRFGPEPDS
379763411YP_005349808.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MRPYHVAIVGSGPSGFFAASSLLKAADASQDIDVAVDMLEMLPTPWGLVR
SGVAPDHPKIKSISKQFEKTAQDPRFRFFGNVSVGEHVQASELAERYDAV
IYAVGAQSDRALNIPGEELPGSIAAVDFVGWYNAHPNFEEATPDLSGARA
VVVGNGNVALDVARILVTDPDVLGQTDIADHALESLRPCGVDEVVVIGRR
GPLQTAFTTLELRELGDLENVDVIVDPAQLEGVSDEDAAAAGKTAKQNIN
VLRDYAKRSPRPGHRRIVLRFMTSPIEIKGEGRVERIVLGRNELVTDANG
RVSANDTGEREELPVQLVVRSVGYRGVPTPGLPFDEKTATIPNSGGRVDG
SRNEYVVGWIKRGPTGVIGTNKKDSQDTVDTLLADLASAARPDGGGLADF
PDDHADQLAEWLASRQPKLVTSAHWELIDAHERAAGEPHGRPRVKLPSLA
KLLRVSHG
379763410YP_005349807.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MEPDRQADIAALDSTLTTVERVLDVDGLRARIEKLEREASDPQLWDDQTR
AQRVTSELSHAQGELRRIEELRGRLDDLPVLYELAAEEGEGAAEALAEAD
AELKALQAEIEATEVRTLLSGEYDEREALVTIRSGAGGVDAADWAEMLMR
MYIRWAEQHKYPVELFDTSYAEEAGIKSATFAVHAPFAYGTLSVEQGTHR
LVRISPFDNQSRRQTSFAEVEVLPVVETTDHIDIPEGDVRVDVYRSSGPG
GQSVNTTDSAVRLTHVPTGIVVTCQNEKSQLQNKISAMRVLQAKLLERKR
SEERAELDALKGEGGSSWGNQMRSYVLHPYQMVKDLRTEYEVGNPAAVLD
GDIDGFLEAGIRWRNRKDDE
379763409YP_005349806.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTHRWHDFWRGEIGEWIITRGLRIAMVLIAAVLAARFVNWVAQQVTRQLN
LGFAESDALVRSEASKHRQAVASVISWVSVVIIGIWVMLQIADVLQFSVG
GLVAPATVVGAALGFGAQQLVRDLLSGFFILVERQYGFGDLVTLTVVAAT
EASGTVENVTLRVTRLRSPDGEVLTIPNGQIVKVVNLSKDWARAVVDIPV
STSADLNRVNEVLHQECDRAMDNPVLGALLLDAPTVMGVESIEVDTVTLR
MVARTLPGKQFEVGRQLRVLVIRALARVGIVTAADARVELVDDASVPAAE
RQTDNDVQGAGQKR
379763408YP_005349805.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MKFTLNILEKRGDDTDAEHRWPNYVFGGRMRTSTLVLIIAFFLVWWTYDT
YRPAPAPKPPAQQVVPPGFVPDPNYTWVPRSRVQQPPATVTYTPTPTTTP
PPPPPPPPVTTTTTTTPPFQMPQLPCILPAPFCPPSTSPPTPTPEQPQPG
PGPTPTTSPPAR
379763407YP_005349804.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MMITLDHVSKKYKSAARPALEDVNVKIDKGEFVFLIGPSGSGKSTFMRLL
LGEESPTSGDIRVSKFHVNKLRGRHVPKLRQVIGTVFQDFRLLQQKTVYE
NVAFALEVIGKRSDAINRVVPDVLETVGLSGKANRLPHELSGGEQQRVAI
ARAYVNRPLVLLADEPTGNLDPDTSKDIMDLLERINRTGTTVLMATHDHH
IVDSMRQRVVELSLGRLVRDEQRGVYGMDR
379763406YP_005349803.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MRFGFLLNEVLTGLRRNVTMTAAMILTTAISIGLFGGGLLVVRLADNSRE
IYLDRVETQVFLTDDISANDATCASAPCKALRDKVDARQDVKSVRFVNRQ
DAYNDAIKKFPEFKDVAGKDSFPASFIVKLNNPEQHAEFDAAVQGQPGVR
SILNEKDLIDRLFAVLDGLRDAAFAVALVQAVGAILLIANMVQVAAYTRR
TEIGIMRLVGASRWYTQLPFLVEAMLAASIGVAIAVIGLMLVRALFLDNA
LSQFYQAHLIAKVDYADILYISPWLFLLGVSMAALTAYATLRLYIRR
379763405YP_005349802.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAKGSGRAKAAGGKGGSKQVVATNRKARHNYSIIESFEAGVALQGTEVKS
LREGQASLADAFATIDDGEVWLRNLYIAEYQHGSWTNHDPRRNRKLLLHR
QQIDRLVGKIRDGNLALMPLSLYFSEGKVKVELALARGKRAYDKRQDMAQ
RDAQREVVRELGRRAKGMT
379763404YP_005349801.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MGGVAARRVAALRVMLVAYPIETVLLGVMAIFVGGPIHVGAVLWGTLYGI
GMAFGMWAFFAALGSGPISVVSPLAAVLNAAVPVAVGMALGERPGQAALV
GVVLALGAVMLVSREAPVEGTPYRFTPKVAWLTVVAGSAMGLNLVFLHQA
PHVCKLWPLVFARVAASLVIFAMAATSQNLKMPRGKPLRLAVAVAVLDIF
ANITMLAALHTWLLSLASILISLYPAATVVLAMVVLRERVTRWQGIGMVL
AMGSVAMIASA
379763403YP_005349800.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MADRPVTKLDKSTVLTGLFAVWDDLDALLAGLSEAQWRAASPLPGWDVKA
LVSHMIGTESFLAGIAAPQPDIDVSVLEHVRNDIGAMNECWVRHLGTHAD
ADVLESFRAITDDRRAALTSLSDEEWNAVTATPTGPDTYGRFMRIRVFDC
WMHEQDIRVALERPPSDDELAGPAASLAVDEIAATMGYVVGRLAKAPEGS
RVQFELTGPLARTIRVRVDGRAAVVDSFAGQEPTATIRLDGLQFTRLAGG
RPMCPARAQDVELGGDKDVAGQIVEHLNFVI
379763402YP_005349799.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTGPRTQAERTRVTIEQIVSVARRAFAEDGFDATSVDGIVEGAGMTKGAL
YHHFPGKRALFAAVYEAEQVAIGQAVLRAARRGNSSWQNVLSGCRAFFDA
VLDPGVQRITLIDAPAVLGWETMRKLEDEHVTSLLRQGLSQAIADGHLGR
QRVEPLAHLVHGAMCEAAMTVARSADPMRESRDSLAALENLLNGIVVRRK
R
379763401YP_005349798.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MDAGEVSSIRGNRNHVSSRGHVCPKAFGLKELHEDPDRLRAPHLRSADGR
LQPASWEEAFAVVDRRLTAVIDQHGADAVALYLGNPVAHDFATTLYGSAA
MRALGSRNIYTANTVDAMPKFVACQLMFGGMYTVPLPDVDRCSYLLILGA
NPMVSNGSLLTAPGMRGRLRALRRRGGRLVVVDPSRSRTAQEADEHYRIR
PGTDALLLLSLVHVLFSEDRIDLGRLGPHTRGVETVEQVAREFSPETVAP
HCEIPAEEIRRLARDLATAPAAAVYGRTGTCTQRFGTVSSWLIDVLNVLT
GNLDRPGGAMFARPAADLRLVTAGRTGTAIGRWRSRVRGAPETLGELPLA
CLAEEIDTPGAGQVKALITVAGNPARSAPNSSRLSAAFEQLELMVSLDLY
RNETTRHAHVLLPALSPLTKPHYDLFFGHFAIRNTATYSPPVLPAQPGDK
ADWQILLRLIGILARQGATADLKAIDDMVAESLAKAVGGDAHGQLRGPER
LLDLLLRAGPYGDADGPLTLARLREYPNGMDFGPLSPQLPGILNTPSGQI
ELAPPPLVDDVAQLRASFLRPRKHSMVLVGRRHLRSNNSWMHNLPTLAKG
PDRCTLQIHPTDVARLQLGKHARVKSRAGVIDAPVEVTDAVTPGVVSLPH
GWGHDEPGTAAAIAAQRPGVNSNLLADGIELDPLSGTAVLNGIPVEITAT
PTPTLDATQENSHVH
379763400YP_005349797.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MLREALRNYAEAKNRHDVEAIVAAYAPDGSYQDSGVRQPVTGHAQLRKFY
AAFFQSVPDYQGHFDGTAFGDDTAVVWGRMTGTVGNNLLGLTTDPGSRID
VPVTFVCTFRGGQLTSDCGYFDTRILHHQVGFAGPAAALEPPVSTVASFV
AGWARFWAAPTDTTRVHGLVTDDVALHWPGIAEPLRGRNAYVAQLAAAVK
HVPDLTLSVADYAHRGNVLLIAWEGRGTVDGSVRRWCGADRFRLRDGQSA
ETTVVFDTRGMTPSRKRHLIPAKP
379763399YP_005349796.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MLNLPFIHGWDVAGVIEEVGYGVNRFNVGDRVFGMPWFPRQAGGYAEFVT
GPSRHFAAMPAGLDFTEAAALPLAGLTAWQMLVDVAHVAPGQRVLIAGAA
GGVGHLAVQIAKAHGAYVIGTARAAKHRFLAELGVDQALDYTVTPVHEVV
GDVDVVIQMFGGDAGVEALGCLRPGGILVSAQAAWTPGLHERAKELGVHA
YDYLVEPDAAGLRGIAQLVECGKLRVHIAERLPLADAARALTISSQGRTS
GKIILTVV
379763398YP_005349795.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MNEPDVGPMTSLASHRQLHDPGGKGALRVGIVALLAADQWPGTEPDQLAR
MVRTIEDLGFDSLWANDSLIGPRIEALTFLAAAASVTERVTLGTAALLPA
LRRPVQAAQALASIDRLAQGRLVVAVGAGFPGISETEYAVSEVSWRRRSR
RLDETVALWRQLWAGAGPSAFHGDTIALSDIPSGIRPFNPAGPPVWLAGD
TPRARARAGAAYDGWLPYPPTPSGFATGLGDVRAAAKLAGRPTDAVTPAL
FVTVLVTDSPDGGRSELDRFTTATYGFPLAAVESLQAFAAGSAEAVAAKL
ANYIDAGVRHLVCRIGVLTQDGFRVQLERLRDVKDRLEEASRAYP
379763397YP_005349794.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MLTRERTTVGLLREYQNFSDLLARLDMSMWTRATRCAGWQVRDVAAHVVG
QAIDTVTGASGTRSADEQAASLRAQPPNDLAAQMRQIGESTAGLLTAFGD
DMWVRPSPAPRFTVGRAIHALLMDAYVHADDIRDAINQPSDLREGLYDSL
DFVLDILSRDPIIAADSHVVRLLAIPAAAFPKESGIDAHKFLLAATGRRD
PRMLGLPETVNIFRA
379763396YP_005349793.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAIGARLGVAGGNQGTMFVMVAVHRAPMRSRNDAVEPQAAIDRARRLGLC
GFGQYVDRSGEQERLVRRVGRFADLDDGSFVWSRDTDGWFWLGRICGPYF
YDAGEAAAAVDLVHVRPCEWLSAPTPEQEVPSAVIATFRRGGRNFQEIHH
RSIGEHTQRIWDARRNQPADD
379763395YP_005349792.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MMLSKVAMKTTAAAAGIATAGILMASPALADPQVVAFGQSAEIPSANGAE
AINYTVNNLQPSGHNDGIWYSDVTATGVRGNATPVIADFNARAVNSSTYA
VMKGHEVDGLPNQPIAPGAQATGRLYFDVRGGTAPDSVVYRDAAGIDKVV
WKS
379763394YP_005349791.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSFVEEKVLPQLLRVHDTVYQKTNGWIGHRALWIPSLLLHTVGAKTGKRR
TTSLTYARDGDKYLVVASKGGAPEAPGWYHNLKANPDVEINVGPRRFAVT
ARPVLPDDPDYPRLWQIVNNNNQNRYVEYQKRTSRPIPVVVLSPKG
379763393YP_005349790.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MPFTQLVTMADVESVSPVTQARGLRPPKPAFRQDLEGLRAVAVLAVVLFH
AGVPGVGGGFTGVDVFFVISGFLITGMLYREVSTAGTVRLGRFYGARARR
LLPASAAVGVVTAIASAILLPPLQAEGVIGDGIASALYIGNYWFVFHGID
YQLAYTPPSPFQHYWSLGVEEQFYLVWPAVIIGTAWATRRRRRRAAGVSS
ERPYLLVLALVAVLSFAASLLATPIVPSVAFFSLPTRAWELAVGGLVALT
TTQWRRLAALPAAIAGWAGLALILLGCTVLSVMTPYPGTAALLPVLGTAL
VIGAGCVHPTRGCGHLLAWSPIGAIGRISYSWYLWHWPVLLLAPPLLGHP
LGLVGRLATVAISGGLAVLTLRFIENPLRFAPFVRRSAFRSLLLGGGATA
VAVCVGAALLVAIPAPVGHGAPAAALKVTGPIPPAGDSLDAYDAAVQYAF
AQVQTMVAVSADLKAVPSNLDPSIGAASAENPIAYFKGCLRNFLEADQPE
CISGDRASKTGVALVGDSTAAMWIPAFQQVTGRRHWRLEALTKGGCPMLD
LPIINPFLRREFTECDKWRDLVVARLRNQHPQLVVLSLWRKYGDRYDFPA
GVTSYDSAWLGSLTRLVQQLRGTGAKVLVLGPAPDPHALVPTCLSGHLDD
ATACAPPRSTAVNDPGIAAEAAATKAGGGQYADLTELFCTLDRCPVIVGN
TVVFHDANHLTFEYARELAPVMGALADRALLPG
379763392YP_005349789.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAERPKARPRAPGPSDIVAELAAAGFDNARQIARGAAGVVYRCRETALGR
NVAIKVLPTFGDDESRERFLREGYAMGGLSGHPNIVNILRVGVTAGGRPY
IVMSYCAAGSLGLRVQREGPIAWPEAMRIGVKLCGALETAHLTGTLHRDI
KPANVLVNDYGEPQLTDFGTAHVAGGYETASGLFSGTVDFLAPEVMTGDP
ATVETDVYSLGATLYALIAGNAAYERRSGEDLLAQYTRIKSTRVPDLRPN
GIPDAVCSAIEKAMRFDPAERPASAAEFGRELQESLRRNGLKPDSMAITA
AGAGSGRIARPVPRPPRIAKPGPRIAGPESATSLMNALGDRTTSTPPHPP
SRPPGRPQPGRAPAVSRGPNTSEPTQMIPEQTSVTDAIAPTSSADRVPDT
PRGLATGAVAWPKPSKAKRSRATAALIAVAIVVAVLVLGSGVYVLLTHGK
RHPQAAASPPSQASVKWQPITNARIARDAAATTQADGTIWIFGGIGSNHA
VVANHEGYDPVIDSWKSGDDLPVPVQQAMAVTWQGNPIVLGGWRAAGAQK
VASDQVWRVVNSHWVELPHLLQPRAAAAAAVVGDRIIVTGGVDANGALLN
STEIFDGNAWTLGTPIPTPRQMLAAASDGKLVYTVGGTNGNADLVAVEAY
DPAAKTWTKLPDLPQPRSDLGVAIADRRLVAAGGQSAGQVLKSVAVFDLS
TKTWDGLPDMGTARHGMAVDAVGKSIYAVGGSTAVGDDQVTATAEALQLP
PRLAQPAAQWRSLPDAPTPRLMTAWTVLGDKIWIMGGLRDGVALQTVESY
DPRTGAWQAQPPLPVPLHHAAAATYRNEVVVLGGASGDLTQASTKVFALR
GGNWVELAGLSHARAAPAAAVVGDKLVVAGGQNAKQLVGQTEVFDGSSWR
DAANMPTPREHLAAASDGTYMYAVGGRFLSADKNSAAFERFDPQAGTWTK
LVDMPTPRGSYGAAFIDGRIVAVGGEEPTQVLGVAEMYDIANAKWSTLPP
LPTPRHAEAVAAVGNTVYCIGGANRPTHEGPVATVEALDFV
379763391YP_005349788.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MLTVQSEWSQRSFAPGHDIVVGSDLRADMRVAHPLIARAHLLLRFDGAKW
IAIDNGSPSGIFVNGHRVRAVDIHDRQSLNLARPDGPRLSFGIGRHDGAV
GQLPPTLEAVPVIAPPGAPKTARPEPPRRPGVPPPRIARPQPAPPRYPPA
GQPPRAPHPAPQPAGLQPLTEIGAQTLEASGFDSANLRRAVQRSRSRLGA
PPAGAAVIGRAEDSDIVISDVLASRHHAYLVPGPTGMEIHDAQSINGTFV
NGTRILSAPLTEGDVVTIGNVDLVFNGEILLRRAEAATRTGGLEVREVDF
HVDNKRLIQKVSLTARPGTLTALIGGSGAGKSTLSRLIAGATCPTSGSIT
FEGHDIHAQFASLRSRIGMVPQDDVVHRQLTVTQALNYAAELRLPTDTSK
SDRAQVVAQVIEELGLTKHADTRVDKLSGGQRKRASVALELLTGPSLLIL
DEPTSGLDPALDLQVMTMLRQLADAGRVVLVVTHSLSYLDLCDQVLLMAP
GGKTAYCGPPGDIEATMGTTNWAKIFGMVGADPDEANRRFLAQAKPPPPV
SDADKPADLGAPARSSTWRQFSTIARRQVRLIVADRAYFIFLALLPFVMG
ALALTVPGSTGFRVADPNGDGSDEPGSVLMLLTMAAVFMGTALTIRDLIG
ERPIFRREQAVGLSTKAYLLAKMAVFFVFAIVQSTIATTITILGKGAPTR
PALLLGSATLELYVATAAMCVAAAMIGLVLSSLARSNEQIMPLLVVSLML
QLVLCGGMVPVTDRIGLDQMSWAVPSRWGYAAQASTVDLWTIEPGPLAPK
DRHFKHTAGTWLFDVGMLVLLTVVYAGIVGWRSRLKRH
379763390YP_005349787.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MEQNLPFDLDALLVFGKVVECRSLSKAAALLGMPKSTVSRKLSKLEADLG
IKLLRKNTHQLTVTDLGEKIYSHGVNILAEANGVRALVEGSKLEPQGELR
VAIPVFVGIDYASRVGAKFLKQYPQSRLDIRLVDNVVHPVHDGFDVVFGT
GPLQDSTLIARKVFSLELFLCASPEFIRELPEPITAPTQLDTVPFIDCGV
SEGPRRLTVAKNKRRHELSPTVRARANNFQVCKQYILNGLGVGAMPSQII
VTSELRDGSIVPVLPEWRLEQLDVYMIHPFQLSFSTLISAFYETACDIIT
ENTARS
379763389YP_005349786.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSQDVLVTKPSSGHWTDAYPELGRGPVSLEDCVSTEFYEKEREHVFKKTW
LYVGRVERVPKSGSYFTRELRFLDTSIIIVRGKDDVIRAFHNICPHRGNK
MLWEDDPFEEVQGRAPVLYCRFHGWRYKLDGSLHAATRKDLLLDFDAESC
RVPAIQCEVWEGFIFVNLDPHNTEPLRSYLGELAHGIEGYPFAGPHKVYR
FKVELQCNWKIFVDGFAESYHGPYLHASSFGALTAEARDAFDQPNPFTDA
LAYRLKGPHRMFSFAGEPSQKTPYSKPIECVMEASAAGPWNKRTDRGPMP
PGLNPTRSEKYGFDSFQFFPNFVLIFGSSGFSTHTHWPTGPHSHIFEVEM
FYQPPKTHKERLGQELTVTFLNDIILEDASPSEGLQAMLNSGALTHFTMN
DEEILLRHLHKVVGDYVAAGEKAKAGR
379763388YP_005349785.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MNALLPHEFSQLEHLVPEWAIEDGHERYVKRVNSSMAEIQAFYDEVFPHA
EDAVAYIDKFDYAEPLPEDVANLRNLLYSLITVSLAVELWRQPRVKHSAK
TILTRLS
379763387YP_005349784.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MGLSTTRLDVIDCTPLIGSEIKTDLDTLLSGREAEAIRAILEQRGVVFFR
GLQISDEQQVTIAKTLGSIVQNEGEGGIYKISLDTNVNQRAEYLKGSLFW
HFDGSLQPYPNLATLLRAMKLSDSGGQTEFCNTYAAYEELPEADKETIAG
LRVVHSAERSQYYVRPEMSYEEIAFWQKSPTKSCPMVWTHRSGRKSLLLG
ATADYVIDLPVEESRALLARLRDWATQPRYVYRHEWQLGDLLMWDNTGTM
HRALPYAADSGRLMHRTVLAGEEPLD
379763386YP_005349783.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MKLGIATPVVTNVAGAALTWEKTATIEDIGRVAETADGLGYHHLTCSEHI
GIPSTEAARRGSRYWDPLATLGYVSARTSRIRLVTMTLVLGYHHPLAIVK
RYGTLDHVSGGRVILGVGVGSLREEFDLLGAPFDDRGARADDALKALRAA
LPTNEPVYDGEYYSFGGLTIDPCALQPHMPIWVGGRTKRSLRRALTLADG
WCPYYVSIATAAEWLRARELPDGFEVVLPADQPLDPVGEPAKTEDALHTI
AAAGTTTLSARFIHHSLEHYLEQIHALAELHDKTF
379763385YP_005349782.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAVQLVALHNSVEAAWRPAVNVAARVEQLTRTTGDAILLTQSCVDAPASR
PVGLVDRGPHTLKGKSAAVQVFTLEKKKLVSALTRKR
379763384YP_005349781.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MKVDPAALHVGSNDMFNAIGEAALDFFSHEDGLAAAAPGWIGSSELALGE
LAARWQARHDHHQLQVDGLGSHVAEAMLGYLTNEDESARAFRSVRE
379763383YP_005349780.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MGQLTPNDVKRWDLGAIQKVFETANGRANTLQALGENLQQVHNVLSGWQG
EAGEAFRADLGKARRDIEADGQESRQVAAAVARAEGDVRACKRELEDIER
ALRPMAGPSRRTGELTWATRGLGAIP
379763382YP_005349779.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MGDTWIGRDPIEFAAQQQLLQDQLIALNVHAHSADHELATAVRFAVGEVP
LDTGGHAPSGGAPPQGPPNPAAERKPRTWQDMLLSDGPADAGPDGASPKG
PSVRAGAVGKPLSLQDMLLPAGPAGPGRGGVPPPRLNPADVESFKAMARQ
TMIRDGVPPNQIEARLNDVVSQTQQWIDNGMPNYVPPEPKAPPPPGFSEG
FSDRWFATEQGIKNLFGQGGPGAPSVLKSWEQMLKGTAETALNPVGTGLT
EIKSAIDSPSLAYYLGGETSDAATTLPTMLFGGEGAMVRAGLPAEVVTEG
GAPLAVVRGWNPTGGMAWDDFASQFGTPASRSYPLNDGFPLGYEPQPARL
PEGAIIDRFGSEHGRYLAPDGTPFADRALAPESVGGAYNRYMVTGQPLPP
GWQVVEGPVQPYYGQTPSPGSLQYMILGPDGVEPSVWKLVRLGILDEYGP
RLGR
379763381YP_005349778.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSAGIGHGKALSPSALIAASLTGLVWLAPTAHADPDPISVGAYLHTLNVL
HVPYDNPGRIVDIGNNVCQQARGGTDFDTIYPTVASNGYASAQAGQIMGA
AVGTFCPDMEAAFDRWTNS
379763380YP_005349777.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSRSFDVLTESPASVEQIHAAFGREDYWLARIAAGAADTTLDSLVADADG
TVTVRTTQRLGRQLLPGLVAKFVTGEVKIVQTETWRPDSDRQVRGRVTVS
ASGGLGSGHADTWLAPTDDSGSQLRAALQVNVKIPLVGGKLEKSIGAGLA
EGIPEMLRFTTTWIAENT
379763379YP_005349776.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSIDDESVTTLEDLRGDLAQRYKRTPTGGSSIDSAIAEADMAALDRDGYV
IWENLLSAEECAHIRQTVRPWLGHTGRNSFEGRRTQRIYSVLSRTRACDR
LVDHPRVLAALDRLLMPNYLLSALQAINIQPGEAAQLAHHDDGFYPIPRP
RAPLAAATIWAIDDFTADNGATVLYPGSHRWGKRRPDSDDEALPVVMPAG
SCVFFVGTLWHGGGANNTAHERLAITAQYCEPWLRPMEAYTLSVSRDIAR
TVSDDIRRMLGYSIHPPFVGNVDGLHPLRLLGSGPDA
379763378YP_005349775.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MHDDRLLSPGQTCWRTARADKFAPIVDAADYFKHVKAAMLRARRRIMLIG
WDFDSRVTFERGRKTLPGPNQLGTFLYWMLWKRPGLDIYLLKSNLRLLPA
FDGLWYGLAPVSLVNQISSKRMHFAIDGAHPLGSVHHQKIVVVDDAVAFC
GGIDLTLDRWDTRAHEHVNRHRRTARRSYGPRHDVAAAVDGAAARALGEQ
ALARWQTATKQALAPVEARHSAWPGKLEPTLRNVDIGIALTLPELDDRPE
VREVEALNLAAIAAARDTIYVENQYLASRTIADALAARLREADGPEIVIV
LARKGNNPLERGTMDSARHLLLHQLWGADEHDRLGIYWPVTDRGAPIYIH
SKVLVVDDRLLRIGSSNFNNRSLGFDSECDVAIEAPPASSDDDVRREIAS
VRNGLVAEHLGVSPGELNRAIAEHRSVHKAVEALRGDGKTLQPFTERTVA
DEAGPLAENELMDPDHVPRSLSRSVQRFITGLRG
379763377YP_005349774.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MLAGFVVFIGVATPAHADPAGNSAADVSFLTALNKAGITYESPATAVGVG
KRACELMDQGHPQVDVIHNVSSSNPGFTVDGAAQFTMIAASAYCPQHLGQ
PVTPTGS
379763376YP_005349773.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MINKRLDDTMRRRFFRGMEFAAPVGDPGWFGPDSAVWRVHSHLPALIFGL
YCAAFMESLDPSIYWMGMHHSRLIKRDSNGNPISRVPQIDPEGAATRLGH
SVAFFIGTAYGSTETAERLATSVRAMHHTIKGTRPDGARYDADDPEWLRW
NYATVVWGLATAHELYHPMPLRGKNLDRYYGEFVRVGHALGGTDLPTTKA
ETLECLESYLPKLAVTHGKAMGTGPNVPMPQAAVDWAIRDTMPKWAKQLL
QHRDPNIIERTARRTAVWSIINGINAAAGPTPEFRQAQARVKGGTTVPHT
VPIYVPGTDQVRTRSEVELSFQSV
379763375YP_005349772.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSSPTRWAGVPLKDRRAERRALLVEAAYRLFGSGGEAAVSVRSVCRECGL
NTRYFYESFGDTDDLLGAVYDRVSEQLAEVIAAAIEEAGDSLGARTRAGI
AAVLGFSSADPRRGRVLFTDARTNPVLAARRRATQDMLRQGVLTEGWRLN
PGSDPVAAEVAAAMYTGAMAELAQQWLAGHLGNDLDAVVDYALKLVLR
379763374YP_005349771.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MGQIEHAMDPVRRVLGRKVSIGGLIELAVWLAIPYLCIGFAWTVFHPEQT
QRIHARIEVVSPAAADAFAFGVATVLWPAALQIADACPAP
379763373YP_005349770.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSIDRFGLSAGTIRLASGVSFLVDPLRANKLWGDPEEPTPTAQLLLRSMG
YRDALIGALLAGAALRGKNTRGWFLASAGADVADLVGGLSVHSELKPSQQ
LIGLGGAVVGIVTGLWGAVRPARRTGEAPEPA
379763372YP_005349769.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MGFGVLTFVTDEGIAPADLGKALEQRGFESLFLAEHSHIPVDAKTPYPSG
GPIPRKYYRTLDPFVALTAAAAVTERLLVGTGIALVPQRDPIHVAKEVAS
LDLVSQGRFRFGVGVGWLREEIANHGVDPAVRGRVVDERLDAMIQIWTSE
KAEFHGEFVDFDPIYSWPKPVQQPYPPLYLGCGPAGFKRIARLNAGWLSM
TGSAGELAPQLDQLRELVGRDVPVIHFHGGEATAAELEGYRDLGLQHLLV
NLPTEPRDQTLQRLDELQDEFAKLA
379763371YP_005349768.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSVAPDTTVALQDRFFRELPEMAVRWQAETFPGLRLLVLNDRLAESLGLD
AAWLRGDDGLRFLTGNLVPSGAAPVAQAYAGHQFGGFVPRLGDGRALLLG
ELVDTDGRLRDIHLKGSGATPFARGGDGLAAVGPMLREYIVSEAMHALGV
PTTRSLAVVGTGRPVYRETTLPGAVLTRVASSHLRVGSFQYAAATGNKDL
LRRLTDHAIARHHPAAAEAERPYLALFEAVVAVQAALIAQWMLVGFVHGV
MNTDNMTISGETIDYGPCAFMDAYDPDTVYSSIDFWGRYAYGNQPVIAGW
NLARFAETLLPLLSDSSEESIALAEQSFGVFQARYDAVWTSGMRAKLGLS
AGVDAEFATALVEELLLLLKQNHVDYTSFFRQLSHVARGDAEPARGLFMD
LAGFDAWLARWQALRPDADAMDRTNPIYIPRNHLVEEALTAATDGDLAPV
ERLLAAVTEPYVERPGWERYASPAPEDFGKYQTFCGT
379763370YP_005349767.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MADMIIQSPDEVVAFLKAQHNLIEDMFDQVLHATDPKAREEPFAALRQLL
AVHETAEEMIVHPRARKEADDGDAIVDARLNEEHGAKELLSQIEQLDVTS
QRFIDELTKLREAVLEHAKQEETEEFPVLTRQLDDDDLKRMGTAVRAAEA
IAPTHPHPGVESAKLNFALGPFASMLDRARDLIGHAVG
379763369YP_005349766.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MRRAIAIVSTTGALLFGGAGVANAAVPSAPAPSPTTTTLADNDNSQHSDN
SGLWGLLGLLGLGGLAGLMRRKDAAARPGVAPTTPRDRGV
379763368YP_005349765.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MPDQLFGTSLRLRGTRPPFETTRRRQISEMYEQVNSSAAAPEDIGSRIDP
VLARSWLLVNGTHPDRFQSAVDSRADIVVFDIEDAVAPKDKHVARDNVVS
WLGAGNVDWVRINGFGTPWWADDLAALAATPVGGVMLAMVESVDHVTETA
KRLPDVPIVALVETARGLERITEIAATKGTFRLAFGIGDFRRDTGFGDDP
ATLAYTRSRFTIASKAADLPSAIDGPTIGSNPLKLIEATAVSTQFGMTGK
ICLTPDQCAVVNEGLSPSQDEISWAKEFFAEFERDGGEIRNGSDLPRIAR
ATKILELARAYGIEALDIDEEERDHSPAPSDTYHY
379763367YP_005349764.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MFEELTAVDPAADESSLVERIAELEMLKSAAAAGQARAAAALDAARRATE
AATGVPAARRGRGVASEVALARRDSPARGGRHLGFAKALVHEMPHTLAAL
ECGALSEWRATLIVRESACLDVEDRRALDAEMCADPSSLSGMGDARVAAA
AKAIAYRLDPHAIVERAAKAEEDRTVTIRPAPDTMSYVTALLPVAQGVSV
YATLRREADTCGDGRTRGQVMADTLVERVTGRSATVPTPVAVNLALTDET
LLGGDDAPADVAGYGPIPASVARSMVAEAAADRRSRATLRRLYTHPQSGA
LVAMESRARLFPQGLAAFIGLRDQHCRTPYCDAPIRHRDHAQPWADGGPT
TADNGLGLCEHCNYVKENAGWRVSTSVDENHTHTALFTTPTGTTYCSTAP
PRGPTITMSKLEVRVGVALARHAA
379763366YP_005349763.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MRVYDDVSADEGQRVLVDRVWPRGMRKDDPRVGIWCKEVAPSKDLREWYQ
HRAERFDEFTSRYEAELRDSAALAELRKLAKRVPVTLVTATREVDISQAV
VLAKLLGAH
379763365YP_005349762.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSDAERVLPRELTDLPEEIRSVPPPPIPDLPEPYGLRLAEPDADAEMIAE
WMGRPHLVEAWESHWPVARWHRYLRAQLDGGFSRPFLALHDGVDRAYIEM
YRAAKDSIATRYDHDPYDLGLHVAVADLDYIQRGHVGYLLPHLVGSIFTL
DPRCRRIMFDPDHRNALARKFCERGGCAFLGEHDMANRRMALYVLPRTPD
DVPRA
379763364YP_005349761.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTTATTAVVWLGVAFIGGVGSVLRFVIDRAVARRVSRPFPFGTLVVNISG
AALLGFLGGLALNKEAALLAGTAFVGAYTTFSTWMLETQRLGEERQLRSS
LANVVVSVVLGVAAAFIGQRLAELF
379763363YP_005349760.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAQRDYRELAAVFAGGALGSLARAALSDLAGGHPESWPWPTFTVNIVGAF
LVGYFTTRLLERLPTSSYRRPLLGTGLCGGLTTFSTMQVETVRMIEHGHW
GLAVGYTVASIVLGLLAVHLATKLVRRVRVRR
379763362YP_005349759.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MVANPRAGQPAQPEDLVDLPHLLTAYYSIQPDPGDVAQQVAFGTSGHRGS
ALNGAFNEAHILAITQAIVEYRTAHGITGPLFIGRDTHGLSEPAWVSALE
VLAANDVVAMIDSRDRYTPTPAVSHAILTYNRGRTDAPADGIVVTPSHNP
PSDGGFKYNPPNGGPADTDATNAIAKRANEILRDGSGVKRIPLARALQTA
QRHDYLGNYVDDLPNVVDIDAIRAAGVRIGADPLGGASVDYWGEIATRHR
LDLTVVNPLVDATWRFMTLDHDGKIRMDCSSPDAMAGLIRGMSDNPGRYQ
IATGNDADSDRHGIVTPDAGLLNPNHYLAVAIEYLYTQRPSWPGGIAVGK
TAVSSSMIDRVVAGIGRKLIEVPVGFKWFVDGLIEGGIGFGGEESAGASF
LRRDGSVWTTDKDGIILALLASEMLAVTGTSPSQRYQQLTAEYGTPFYAR
VDAPADRDQKARLAKLSADEVTATELAGEPITAKLTAAPGNGAALGGLKV
TTANAWFAARPSGTEDVYKIYAESFNGEEHLAEVQETAREVVNKVIG
379763361YP_005349758.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MVALGYGVISPALPSFARSFGVSIKAVTFLVTVFSLARLCFAPVSGQLVQ
RLGERRIYIGGMVIVAVSTGACAFSQAYWQLMAFRVISGIGSTMFYVSAL
GLMIHISPPDARGRVAGLFTTSFMVGAVGGPAVGALAAGWGLTAPFIVYG
VALLGVAVVLFFGLRNSALAAPGPPTRSTVTMREALRVRAYWSSLGANFA
TGWSAFGLRVALVPLFITDVMGRGVGVIGIALAAFAGGNALAMIPSGYLS
DRMGRRTLMIVGLALSGAATIFLGAASSLPRFLVAAVVVGAVTGIYMSPM
QAAVADILGSEARAGSPVAAVQMMSDLGAIVGSMTLGWVAERLSYGWGFI
ISGIVLLIAAVGWVVAPETRTVPVPEPDPLPSPHTLNLPEQQL
379763360YP_005349757.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MVTPRSGAAVNSHRLFMAFLAVTIFISAVAGVVAAASTGHETAALVIALV
AGGSFMTAAFC
379763359YP_005349756.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MQAVALSAIDEYIARRAHKAKVADALQRVLREEAGVLERLKDA
379763358YP_005349755.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTDYLDLEDLLEIARKAVGVDVIVRDYGLLESALARPRASIFGQDAYPDP
HVKAAALLHSLTRNHALVDGNKRLGWAACRTFLAINAQWISAPEDDRFDL
VIRVATGAMAGLDDIAAQLRGWSHP
379763357YP_005349754.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MVGQCFDIEVTRDADGWAITVPEIGRSTRTTSRAAVELAARECIATWTGI
PIGYVAVYVVSEIA
379763356YP_005349753.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MYRTASRRTAVPVRVSVARQLGGDIDGAWWPRADRITNELPGLVAALTPL
LGDICSVNVNWPALQRPPDFNWHGWEHKRQHVMTFIGGEERVNLLIVPYA
TYSGLALMVLRRAAGLPVEAKDRDKPAFVTAGSILQAARQQRALDR
379763355YP_005349752.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAVSRFVDAMLCAAESSTHGLVTGEPGSPVRSSWAEVHQSARRVAGGLAA
LRVGAGDRVGVLAGAPAEVAPIAQGVWLRGACLTMLHQPTPRTDLQAWVR
DTLAVITMIEATVVIVSEPFMAAVDVLAEHDVAVVTMAELLSAAPTTVVD
SDENDLALLQLTSGSTDCPKAVMITHANVFANAEAMFVGAQYDLDTDVIV
SWLPLFHDMGMTGFLTVPMLFGAELVKITPLDFLSDILLWPKLIDKYRAT
MTAAPNFAYAMLAKRLRRHAKPGDFDLSSLRWALSGSEQVEPADVEELCL
AGVPFGLRPEAILPAYGMAETTVAVSFSECGRGLVVDEVDGDMLAVLRRA
VPTAAGRTRRLASLGPLLKGIQARVVDEDGAVQAPRGVGVIELRGDPVTS
GYLTTAGFMAAQDDQGWLNTGDLGYLTEQGHVVVCGRAKDVIIMAGRNIY
PADVERAAGRVVGVRAGCVAAVRLDAGRSRESFAVAVESNDVDDPAQVRR
IKHEVAHEVVTEVAARPRSVVVLAPGAIPKTPSGKLRRGYALPLVT
379763354YP_005349751.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MDVMSTQNWCDAPEIHPSQIRVGDVIGTRRPTELRLTVKMISGPQSGPRQ
WTFFSRDDNGQQRTSTFGEDDVVRRYAKAA
379763353YP_005349750.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MDHHPAVQIAGSDGARPQAGVLHVISPHTEEPIAEVNAAGSDDVDAAVAA
ARAAFGPWGRSEPAERVAAIRRLADIYDGRRAEMATTITAEIGAPISFAQ
RAQVGLPAFMMRAFCDLAERHPWQETRPGFFGSDVHVRKEPVGVVAAIVP
WNMPQFLIVTKLVPALLAGCAVVLKPAPESPLDALLLGEMIAEAGLPPGV
VSILPGDGALGAYLVAHPGVDKVSFTGSTAAGRAVAASCAVNLTKVSLEL
GGKSAALVLDDASPDKVAAGVRSASLSNSGQICNALTRVLVPQGRHDEYV
DALAAEMAGLRVGDPNDPDTQLGPLVSRRQQRRVRDYIEIGQNEGARVVI
GGTDMPDGLDRGWYVRPTLFAAADNSMRIAREEIFGPVITVIPYRDDEEA
LAIANDSDYGLAGSVWSNDSDRALAMATRIHTGTVGVNQGYTMDPFAPFG
GVKASGYGRELGPEGLDGYLETKSIAIAAES
379763352YP_005349749.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MGTEPVSYRDSISPEIYELERDAIFKRAWLNVGRVEQLPRKGSYLTRELK
VVNTSIILVRTTSGDIKAYHNVCRHRGNKLVWNDMPQEETAGVCRQFTCK
YHGWRYDLDGNLTFVQQEEEFFDLDKGRYGLVPVHCDVWEGFIFVNFAKK
PEQSLREFLGPMITGLEGYPFDKMVSRWCYRSEVKANWKLYMDAFQEFYH
APVLHANQSPTAYSKAAAEAGFEAPHYRLDGPHRLVSTSGVRAWEMADEM
RKPMEDVCQSGLFGPWDKPDLGPMPEGLNPAKCDPWGLDSFQLFPNFVIL
FWGQGWYLTYHYWPTSYNSHLFEGTLYFPAPRTPRERVAQELAAVSFKEY
GLQDANTLEATQTMLESQVIDEFLLCDQEVLIRHLHKETAAWIDDYRRTT
SAGV
379763351YP_005349748.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MNEMPMLPAEFADLEPFADWCLASEPERYAKRLASSMVEMKAFYDAITPR
AEEALSFCDKFSLDDLPDDVLNLMHLLYSMIMVSFPVECWKQPRVPDSGA
STLDCVSEPVP
379763350YP_005349747.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTEAIVLRAARWADVVTGRIHAPAVIVVDGERISAINPEGPLPDSATIVD
LGDVTLLPGLMDMELNLLIGGPGGPEGLPSPMHGVQDDPAYRTLRGAVNA
RTTLEAGFTTVRNLGLMVKTGGYLLDVALQRAIDQGWHVGPRIYPAGHAV
TPYGGHLDPTVFQRLAPGVMPLSVAEGIANGVPDVIACVRYQIRHGAKLI
KVSASGGVMSHSTAPGAQQYSDAEFAAIADEAHRAGVRVAAHAVGDTAVQ
ACIRAGIDCIEHGFLASDETIQMMVDHGTFLVSTTYLTEAMAIDRIAPEL
RKKALEVFPRAKAMLPKAIDAGVRIACGTDAPAIPHGQNAKELGALVQRG
MTPAQAIRAATVVAAELIDADDELGRLAPGYLADIIAVPGDPFDDIAKTL
EVRFVMKNGQIYKSPAA
379763349YP_005349746.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MELTDNILWLLKQAFYYSLTTINEAMREHGVSTAQIGVLRQLANEPGLSG
AELARRLLISPQGVQLALTALERRALVERKQDPQHARILRAYLTGEGRKV
AETVVSDAIAAHQEVFGVLTEEEQRTLRELLGRVVEKGTGHELFDDHVDG
379763348YP_005349745.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MGDHHSTANAGPATVTGGAAGAVDMADAPEGFVPLRVKHVIPETRDAVSI
VLDVPRGSAARFGYQAGQFLTLLVRVDGREYRRCYSMSSSPAVGEDLRIT
VKRDRGGAVSNWLNDTAAPGDLLYALPPQGRFVLNDTGRDLVAFAGGSGI
TPVFSLLRTALVSGTRGARLFYANRNRDAVIFDEALKTLEKRHADRFVLH
HHLDDQRGFATQADIAAFVENTDGADFYVCGPNEFMDTVRTALGAAGVPT
GRLHIEHFDVTDVAAAAPPETDAVTDEVTIVLDGSTTTAPYYAGNTLLQT
ARMAGLRAPSSCEIGSCGTCMGRLTQGSARMINNDALDQDEVDDGWVLTC
QAVPTSPTVRVVYE
379763347YP_005349744.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAVVTGGASGMGEATCHELGRRGLKVAVLDVNEHAAQRVTDGLRAEGATA
LAVGADVTDRSAVEQAFAKVRSELGPVTVLVTSAGMFGFSPFLDITAASW
SRIIDVNLTGTFHCCQVALPDMVEANWGRIVMISSSSAQRGSPFAAHYAA
SKGAVITLTKSLAREYAANGITVNNIPPSGIETPMQHQGQAAGYLPSNEQ
IASNIPVGYLGTGADIAAAVGFLCSEEARYITGQVLGVNGGSVM
379763346YP_005349743.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTRSGRPPEGSWTEHYPELGTGPVSFRDSTSREFYELEREAIFKRAWLNV
ARVEELPRVGSYLTKEIEVVGASVIVVKGKDERIRAFYNVCRHRGNKLVW
NDYPGEETRGTCRQFTCKYHGWRYDLQGALKFVQQESEFFDLDPAKYGLR
PVHCDVWNGFVFINFDTEPRQSLREFLGPMITGLDDYPFGKLTERYDWVA
HNNSNWKIFADAFQEYYHVPSLHSQQVPAEVRDPNAGFTCGHFQLDGPHR
LVSTAGRRRWLLPPEYMYPIERATRSGLVGPWQTPDIGELPAGLNPGGIE
PWGISNFQIFPNIEILIYGGWYLLYRYWPTSHNTHRFEAYTYFHPASTVR
ERIEHEVAAVVLKEFALQDAGMLGGTQAALEYGIVDDFPLNDQEILVRHL
HKVVVDWVEAYRREQDPVGV
379763345YP_005349742.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTMHPMLPSAFAELEDYAQTWCLATETERWNARVGASMPQLLDFYNAFFP
RLEEAIDYCDKFPLDNLPDDALNLLHMIYSLVMVAMAVEIMHQPAPVDAA
DAVMTRTGWPVP
379763344YP_005349741.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MGLLTITKLTESVGAEVAGLGPTELADDSVGAAVLDALEDNGVLVFRGLH
LDPVAQVGFCRLLGEVDHSSDGHHPVAGIYPITLDKSKNASAAYLKATFD
WHIDGCTPLGDECPQKATVLSAVRVAEWGGETEFANSYAAYDDLTDEEKQ
RFGTLRVVHSLEASQRRVYPDPSPEQVQRWRSRRTHEHPLVWTHRSGRKS
LVLGASADYVVGMELDEGRALLDELLARATTPEKVYSHSWSVGDTVIWDN
RGVLHRAAPYDPDSQREMLRTTVLGDEPIE
379763343YP_005349740.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTTDGRHPLRLTPLPAGEWDERARESLASLIPTERANPVGAGNVLSTLVR
HPDLTAAYLPFNAYLLTRSTLSPRVREVALLRVVHRSKCGYLWSHHLPIA
ARAGLSESEIDDIGTGRCADETDRAVIAAVDDLTADSTVAETTWDDLCRL
FTEQQCMDLIFTIGGYLLLALAVNTFGVQDEAHH
379763342YP_005349739.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSANDTPLAGRVAFVTGAARGQGRSHCVRLARAGADIVAIDACAPVAAHN
GYPASTPEDLAETTRLVESEGRKMLADQVDVRDAAGQQRVVDEAITQFGR
LDIVVANAGVLNWGRLWEISAQQWQDVLDVNLTGVWNTIKATVPAMIQAG
NGGSIITISSAAGVKAVPGCGHYCASKFGVVGMTNSLAVELGEHGIRVNS
VHPYGTDTPMGNDPSMWQLFADHQTYIHSFSPGALPTDSLADPDLVSDIV
LWLASDASSLVTAAQIPADKGYLKI
379763341YP_005349738.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSEHRSDEPGVKRPFIPRMVRAFAIPIIFFWGLLAVTTNTFMPQVERVAE
ELAGPMVPHYAPSQRALLHIGEKFQESNSTNLTMVVFEANRQLGDQDHRY
YDDLMRRLQNDTKHVQYVMDLWGKPFTAAGAQSVDGKCTYVLLRLAGDIG
QIQANQSVDAVRDIIRKDTPPPGLKVYVSGAAPLASDTLAIANASLNNVT
IVTIILIVVMLLLVYRTPSTLLVPLLGVLIEMLVAKGVVSTLGHYGYIEL
SSFAVNIVIALTLGAGTDYGIFLMGRYHEARQAGESREDSFYIAYKGVAP
IIIGSGLTIAGACYCLTFARLNYFHTMGPAVAITMLFTIAAAMTLGPAVL
TVGSLFGMFDPRTSTKGLLYRRIGASVVRWPVPILAASSAVVMIGAIFVP
TYRQNYDDRQYQPAGAPANLGFQAADRHFPKSKLFSEMLMVETDHDMRNS
ADFISLDRVAKALIRLHGVAMVQGMTRPLGRALEHASIPYLFTTQGSGNG
QQLPFNREQNSNTDAQAEIQAHSVAVLRKEIGFFQKVSDELHQTVLTVED
LQRVSEEMNEEVSNLDDFFRPIKSYFYWEKHCFDIPICWAFRSLWDTIDH
IDHLAEDINHARISLTEVDKAFPQIIAQLKATADDTEALQLKLVNSYGSA
DLQSIQTDQTFDDLINVGNDFDRSRSDDYFYIPHEGFDNEDVKTGMKLMM
SPDGKAARFIVTHEGDAMGPEGVEHVEQFPDAIKTILKETSLAGARVYIG
GSGSNDKDIKQYAMSDLLIAAIAAFVLIFLIMMFITRSLVAALVIPGTVA
FSYAGAFGLSILFWQHLVGLHLHWLVLPLTFIILVAVGSDYNLLLINRVK
EELHGGIHTGLIRALGSTGGVVTSAGLVFAFTMLAMLTSDLRTIGQVGST
VCIGLLLDTLIVRSFVVPCILRILGPWFWWPTLVRSRPLPQR
379763340YP_005349737.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MPLVAVVAVGVGLLCMYKVHQFSEPEPVVTVNGPQAPEQFNPKRITYEVF
GSPGQGGKLVYIDIEGHPHQVDFTTLPWTHTETTTLTVASGSISVHVHGG
QVGCRMLVNGVVRDEQSDDHQDADVQCRVKSA
379763339YP_005349736.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSASLYGLLTAISLALAVLLAAVAGFYVNRLERRPTLPISEEIGSAKAVL
HKVRKREPMSQDEVDYARQVVADRRSVMALCIPGALFMLSCFFVFGSLYH
LHGATPSERTFLGVIPMLTSTNLAIQLRRSASLKRRLQKLP
379763338YP_005349735.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSTNKINRGILLAMVLIGTIAYGLLYSHASTVFKLLVPLALLFLLGMVIR
DVLKDRDSGKP
379763337YP_005349734.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTFRFRGLALVALTMALALLLAPRASADAYTDELVAHFNAETHVVTDPGA
RPPLRNVGELNRQILAGPWTWSPQPPVWVAAVAPGNSGVTTADAIHGAMS
AREPKFSGVIVVIDSHGYHVRAYKVPKVIADRVDELMNQSATEHGPDPYA
TTSAFVSRLAALDVPANAPVATSAVAHEKHDDWAWLKVTLVISGIALAMG
ALLWIVVRRNRKHRKPIDK
379763336YP_005349733.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MLTYLYLLGAIFAEVVATSLLKSTEGFSRLWPTVVCLIGYAISFALLAVS
ISRGMQTDVAYALWSAIGTALIVLIAVLFLGSSISLTKVVGVGLIIAGVV
TLNLSGAH
379763335YP_005349732.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MPDNASRGYGEPDTLITLARRPFGKELRAMAFPAHVLSLDVSGAIGERAS
LAATYYPARAGNAAAAVLVCLPGGTYSREYWDLEIPGHDGYSFAEFATGD
GYAVVTIDPLGTGESSQPARDFDFADIAATLACAVAALPDTIGVHAPPVA
VAHSLGGYLALTQQALFPSYSGMALLGCTNRHVAPLNLDAALIARAGSPQ
GRAELAQEILSALPQPYFEGPREHLQSWFHLADVPAAVVAADSVTAKSVV
PRVFGTAMIPGIVADHAARIDVPVLVGFGAVDVSPDPRAEAALYRSCPDI
TTVVLADSAHCHNMASSRHRLWRRLLDWTATVTCGS
379763334YP_005349731.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTKGLDRRLARHAPAVLSAFRLVYGLLFAAYGSRSLFDWPVRSPVVVAFG
SWPGWYAGLIEIVAGLLVAAGLFTRTAAFIASGEMAVAYFWMHQPMALWP
VADPPGGNGGALSILFCFAFFLLVFIGGGPYSLGAARGRRLPLNRR
379763333YP_005349730.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSVQQCDGMVALVTGSSRGLGKAIAARLAESGATVALTARTMDPDPKYQG
SLSQTRDEIVAAGGKAIAVQADLSQAEDRERLFAEVTGAVGAPDILVNNA
AVTFLRPLDGFPERRARLMIEMHVLGPLHLCQLAIPAMRERGRGWILNLT
SVGGDLPPGPPFSEFDRTAGFGIYGTAKAALNRLTKSLAAELYDDGIAVN
AAAPSNPVATPGAGTLDLAKTDTEDIALITETAFRLCTGDPKSLTGRIAH
TQPFLAEVGWTAPAG
379763332YP_005349729.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAELDLGELRARLADAGVTDVAPLSGGASSLTFGGDLGGRRVVIKVAPPG
VEPVAHRDVLRQARILKALAATSVPVPDVLREDLGRPPDTPPLYVMSRVD
GDCVEPLFDGCAPVADVTDRYRNACRAMAALHRLSPTELGLGDEPVVDPV
AEVHRWSDTLNTVDPALAPGWPNVRDTLLACAPSAMAPGVVHGDFRLGNL
LASGARINAVIDWEIWSIGDPRIDVGWFLINCDPDTYRRVPAPDAMAPPT
AELAELYRCELGCEATDLGWFTALACYKSVATWSLIVKHNRRRRSPRAEL
EAMAASLPRLLGRALSMLD
379763331YP_005349728.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAMISRRCACLLVAGSTVLAALTGGTGTALANPDAGQQPDIPAIDEWPIQ
FPTTMTNPIDDDENELSTTGGGVGMVCQNLGAHCG
379763330YP_005349727.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSVIAAPSADSEPQLGPAPPDAAPPAGAAVPSNPPAILNTPDGWTLGLGA
KDEMQVPVAPLTTAISSREYMSSGIFVGSLRGPEEAHGVLEVGYQIGCGI
DMSTSNGVIMEGGAGIIPGVSPTFDATGTLPPLLPFVSAPINGVMSVGLK
PGLVIVVPVIKKQFKGANPWVMISNFHVKIDGCVGQSFIRSYAVLTRQTD
LSDVVLSYVGVTKAV
379763329YP_005349726.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSWDFSTDPEWAEQLEWVEGFVREECEPIDLIVKESHDLGDPVRQALIPP
LQEIVKERGLWATHLGPHLGGPGYGQVKLALLNEILGRSECAPIVFGSQA
PDSGNSEILAHYGTPELKARYLEPLLDNRIISCFSMTEPQGGADPKVFRT
TAVQDGDHWVINGEKWFSSFASMASFLIVMAMTDPDAPPYQRYSMFVVPG
DTPGINVLRDVGLGYQPTGGGREGYVRYENVRVPADHMLGPRGGAFVVAQ
TRLGGGRIHHAMRTVGLVRRIFDMICERAASRYTQGEVLANKQLVQQMVA
DSWMEIEAFRLLTLQTAWKIDQFNDYHAVRADISAVKAMMQKVLHDVSSR
ALQLHGSLGTTHEMPFVQYLVESFVLGLADGPTEVHKVTLARLLLKDREP
APDLFPSEHLLRLRAAAEEKFADKLAGIPRG
379763328YP_005349725.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTGPLRGVRIVMMGGLGPAPFCGMLLGDLGADIVRIDAVAGVDAPLPIDY
TVRRGQRSLAADVKDPRGRDLVHRLAAGADAFVDVYRPGVAERLGIGPDA
LTERNPRLVYARMTGYGQDGPLAGHAGHDINYLALTGALHAIGTAESPVP
PLNLIGDYGGGGMLLAVGLLSAILEARESGVGQVLDVAMVDGVATLLAPY
FGMLPAGTWRDEREANLLDGGAHFYGVYATADGGHVAVGAMESKFYAELC
DRLGVTVPQDDDAPAAWAAHRAALAARFAEKPRDEWERILDTPGCCATPV
LSLTEAPRHPHHVARRTFVELDGITQPAPAPRFSRTRPATPSAPALPGDH
TQALLREAGLDAQTIAELVDSGVVAQSKRRR
379763327YP_005349724.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MPTTLELDRPGDGVAVLRLNRPQRLNAINETMQTELRGLLGDLAVDATVR
AVVLTGAGRGFCAGIDVRDFGPSMLEASAPALERMRFQERMAALAEAVRA
LPQPVIAAVNGPCVGAGLALCLAADIRICSAAATFGNAAILLGLSGAEMG
MSYHLPRIVGTSVAADWMLTGRTVSATEADRRGLVSEVVAADGLAGRAVE
LATLIAGHAPLGAQLTKRALQVNTDAASFESALELENRNQVITHATDEAA
ERCKKWSS
379763326YP_005349723.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MHPQALLARCLTALAERTDFDPVDVDDVIAGNGILSGDHGDDIARMSVLL
AGWPETVPGMTLSRFCGSGQQAVTVAAAGIAAGSEDLAIAGGVESMSRWG
VTAGVPTIDGNNPDLRAVYPTVPQGISADLIATLEGFGREVVDAYAAQSQ
SRAAVAIEERRFDRSLVDVAAPAGRLEHDEHPRPGTTTETLSRLTPAFEA
MGAARADGEQRTFDEICLERYPGVDRIDHVHHAGNSSGVVDGAAAVLLAS
SNWMHTHRVTPRAQIRATAAIGSEPIIMLTAPGPAAQRCLERAGMTVADI
DLWEINEAFAAVPLKTMRDLDIDPDVVNVNGGAIALGHPIGATGAMLIGT
VLDELERRDLTTGLVTMCTGGGMGTATIIERV
379763325YP_005349722.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTKIGYFLTCEQFGPKELIDQAKRAEDAGFDALWISDHYHPWNDEQGQSP
FVWGVIGALSEATSLPVSTAVTCPTIRIHPAVIAQASATAAVQLDGRFVL
GVGSGEALNEHILGDPWPSAGVRLEMLEEAVEVIRKLHQGGEVSHHGKHY
EVQEARVYTRPEQPVPIYVSAFGPQAVEVAARIGDGYSIAMPDGDLVKQF
REAGGGDKPVQAGTKVCWDRDADAALKTAHRLWANEGLPGQTSQILPRPK
DFAALMSLVPPETVAESVACGSDPEKHVAQVRQYIDADIDEIYVQQIGPD
MDGFFAAWRQAVLPELRGETR
379763324YP_005349721.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MRVGELMSHPGTQLYDVMRTAFAAREFTDDPLPDEVLGRIFDNARFAPSG
GNRQGAHVTVVRDAAVRRRLAELGMPAARRYFAQLQAGENPWNSIHPSAV
PQKAIEETEIPDTFVAPIAKAPVVLVVSVDLTVVAALDQHLDRVGIAGGA
SVYPLIWNILLAARSEGYGGTITTMAIAAEGDVRGLLGIPDRHAVAAVVP
LGKPVRQLSKLRRRPVAEFVTRDRFDGPPFG
379763323YP_005349720.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MRVGIDFGTTHTVAAAVDRGNYPVVSFDGVDAWPSIIAANAAGELRFGAD
AAAVRHDPGWSVLRSFKRLLNDAGPQTQVNLAGRDYRLADLLTGFLAQLK
TDLQRHSNADLASGEPIEAAISVPANASSAQRLLTLDAYVAAGFRVVALL
NEPSAASLEYAHRYRSTITTKREHVLIYDLGGGTFDASLLKMTGHANEVV
VSEGIQRLGGDDFDEAIVELVLAGAGRPVVDAATRDLLAEECATRKEAVG
PQTRRFLVDLSPVDRPPFSCPIDDVYAVCAPLVDRTMELLDRVLRDPARG
RKDVDLSEVAGIYVVGGAGGFPLVSRMLRSTFGDKRVKRSPHPFAATAIG
LAVFLDKESGFALSERFSRNFGVFREAEAGAGVVFDPIVCKDVSLPDDGR
SPLVVKRRYRAAHNIGHFRFVECSRLVNGRPDGDVTPYDPVLFPFDPALR
DRDDLGRQPVGRWAEGRDGPDVEERYVIAPSGAVEVTLTTHPAGFERTFR
LERCGSAS
379763322YP_005349719.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MLLLDVAKASTDVGSTSSRLRKVAHIADLLARAAPDPALVMIVVSWLSGE
LRQRQIGVGWAALRSRPPPASHATLTVGAVDATFSEIGAVSGKGAQARRA
ALLTTLFAAATEAEQTFLLRLLGGELRQGALAGIMADAVAKAAGIPAAAV
QRAAMLGGDLPAVAAAALSGEPAALQAFTLRVGRPVGPMLAQTAPSVADA
IERHGGRAIFEAKLDGARVQIHRSGDQVTVYTRSLDDVTARVPEVVEATL
ALPVNDLIADGEAIALRPDNRPQRFQVTASRFGRSVDVAAAVAAQPLSVF
FFDILHRDGVDLLDAPTTDRLAALDALVPPAQRVDRLLTSDPVEAGAFLD
ATLAVGHEGVMAKAPDAQYQAGRRGAGWLKVKPVHTLDLVVLAVEWGSGR
RRGKLSNIHLGARDPDSGEFVMVGKTFKGMTDAMLDWQTARFTDLAIGGT
DGYVVHVRPEQVVEVALDGVQKSSRYPGGLALRFARVVRYRDDKGPAEAD
TIDAVRALY
379763321YP_005349718.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MEIKGKKVVVIGGASGMGRASAELLHDRGADVAVLDREGSDGKTVAEGIG
GTFYPVDVTDFTGTEETLQAAVDKLGGLHVVITTAGGGIAKRTLTKSGPH
DLESFQSVIDLNLIATFNISRLAAAHMAKNEPEDPDTGERGVIINTASIA
AFEGQIGQVAYTAAKAGIAGMCLTMARDLGSVGIRVLGIAPSLFATGLTQ
GIPDEFAAALTKDAAFPKRLGRPEEYAKLVAAIVDNPMLNGQCLRLDAGQ
RFAPK
379763320YP_005349717.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MGIALTDDHRELAEVARGFLTAQKARWAARSLLDAADEPRPGFWQNLVEL
GWLGLHVDEEYGGSGFGLPELVVVIEELGRAVAPGPFVPTVIASAVIAKD
GAAEQKSRMLPGLIDGTVTAGVGFDGQVQVANGVANGEAGIVLGAGLAEL
LLIAAGDDVLVLECDRAGVSVEVPENFDPTRRSGRVRLQDVRVFDDDILA
GARQSALARARTLLAAEAVGGASDCVEAAVDYAKVRQQFGRTIATFQAVK
HHCANMLVGAESGIAAVWDAARAAGEDASEDEAQFRLIAATAAALAFPAY
VRNAELNIQVHGGIGFTWEHDAHLHLRRAVVTTALFGGDAPAADVFERTA
AGAVRENSLDLPPEAEELRAGVRADVAEIAALDKDAQRDKLIETGYVMPH
WPKPWGRAADAVEQLVIEEEFRAAGIKRPDYGITGWVILTLIQHGTPWQI
ERFVEKALRKDEIWCQLFSEPDAGSDAASIKTRATRVDGGWKINGQKVWT
SGAHYCARGLATVRTDPDAPKHAGITTVIVDMKAPEVEVRPLRQITGGSD
FNEVFFNDLFVPDEDVVGEPNSGWTVARATLGNERVSIGGSGSFYEGLAS
QLVQLTQERPDRLAGGHVRVGNYLAGETALRLLNLRRAARSVEGAGPGPE
GNVTKLKLAEHMVEGAAIMAALLGPEVALLDGAGALAGRLMMGARGMAIA
GGTSEVTRNQIAERILGMPRDPLIN
379763319YP_005349716.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSDGALLIEYCDGCARWVHPASGECRECGGSLVAREVSGRGTVFTYTVNH
HPYNPEIPTPYVIAIVELAEQRGLRVAANIVDCEPDSVTCGMPVTLRPER
GAAGAPQFAPA
379763318YP_005349715.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MYMTHFEKDAILSGIGISRIGRRTGIPGLELTMEAVRGAIEDAGLAATDI
DGIATLGDTPAEDVNAQLRIDAADCGSGFGTGGLLSPVMSACRAVAERRA
RHVVVYRTIQMLGGTVPVKQEENAPAPPLARMFETPEGEPKPAVGAMDDV
NDLVAAQAYSAANWLALNCRRHMELYGTTKEQLGWIALNGRRNAALNPRA
VYRDPMTMADYLGARPVSTPLGLLDCDVPIDGSIAVVVSHAEYAADCPHR
AVRVEAIGGSDGAGGWFHRDDYPKMAMSDATAQMWSRTQLRPADLDIAQL
YDGFTYLTLAWLEALGVCGDGEAGPFVEGGARIARDGLLPLNTYGGQLSA
GRMHGYWALHEGCLQLRGDAGERQVARRPEVGVVSVGGGPVAGCMLLTC
379763317YP_005349714.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSEDLKAGHADKLASILARDIEADIVRRGWAVGESLGSELALQQRFGVSR
SVLREAVRLVEHHQVARMRRGPNGGLYICEPDAGPATRAVVIYLEYLGTT
LGDLLNARLVLEPLAASLAAERIDEAGIARLRAVLDAEEKWQPGLPAPRD
EFHIALAEQSKNPVLQLFIDVLMRLTTRYALASRTDSATEAIEAVEHLHA
HHSKIVAAVTAGDSARAKTLSERHVEAVTGWLQRHHPGDRVRGRTRRRRL
DSEMPRGKLAEMLAVTIGDDIAASGWHVGSVFGTEAALLARYRVSRAVFR
EAVRLLEYHSIAHMRRGPGGGLVIAEPAAQASIDTIALYLQYRDPSREDL
RCVRDAIEIDNVAKVVKRLDEPEVAAFLVAHRSRLPDAAQPTPDDVRRAI
AEEFNFHVGLAQLAGNALLDLFLRIIVELFRRHWSSTGQALPTWSDVLAV
HHAHLRIVEAVEAADESVACYRLRRHLDAAASWWL
379763316YP_005349713.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MIESESAEVTADTETRQYGFVHSALIYHSQQEFLDLVGRFVGDGLASGEA
VLLAVPPETLALLQGELYDGEALPVDVYMTDVTEAARNPSRFMAMEGAFI
DEHPDRRVRIVSQLAWPGRTEEEFVACIEHEALVNTAMDAYPATSLCLYD
ASAIGDEVLMDARATHPLLWKSGALHRSPDYAPNEVLQRCNQPLAANPGA
VTYMVRKSADLRPARSFAVDYAGWMGLSQECIEDLQLVATELATNSLMYT
GGACRLAFWKDDGYLVCEARDTGQLDDPLVGRLDPGPCGPASRGLYLVNA
ISDLVRTHTARTGTTIQAYLRFEPAPEPAG
379763315YP_005349712.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTPADAPASGGTLGGTVGGVVGGVIGDVGGIVGGLLP
379763314YP_005349711.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTFPERNPLQHLDAATVWFGDRFGVSLPRGLREQADAMSWETFLATYGRS
TGPLRLGQWECTGAVRPGPQARNFQAVIALSDRIGTATVAASGPIAALTA
MLHQRGITVEIVNFHQMQSPTGTATFIRGSDGARAEWAMGLSDDPTQSAL
RAVIACANRLLAVD
379763313YP_005349710.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTTISTPHYLLDQARRRFTPTLNTIPGMGAIEKRLLAHEWDTKVLAEPPA
GSDLKPVMGDAGLPILGHIIELFRGGPDYALYLYRNKGPLIYLDSPIMPA
VTALGPDATQAVFSNRNKDFSQKGWHPVIGPFFNRGLMMLDFDEHMYHRR
IMQEAFTRSRLTGYVEHIDRVATDIVAGWPTNDARFLFHPAMKELTLDIA
SLVFMGHEPGSDHDLVTKVNQAFTTTTRAGGAIIRQPVPPFKWWRGLRAR
QLLEDYFNERVKERRNATGNDMLTVLCHTEDDDGNSFTDEDIVNHMIFLM
MAAHDTSTSTTTTMVYNMAANPEWQERAREESARLGDGPLDIESLEKLET
LELIMNESLRMVTPLPFNMRMAVRDTELLGHYIPAGTNITIWPGMNHRLP
ELWTEPDKFDPERFAEPRSEHKNHRYAFAPFGGGAHKCIGMVFGQLEVKT
VVHRLLRRYRIELARPGYQPRWDYGGMPIPMDGMPIVLRPL
379763312YP_005349709.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSSHPANPEPGARRRGDKQRQAIVEAVRELLQEKPFAELSVSTISLRAGV
ARSGFYFYFDSKYAVLAQLMAEATEELEELTQYFAPRQAGESPEEFAKRM
VGSAAAVYEHNDPVVTACNEARHTDVEIRDLLDQQFEVVLAQIVAIVEAE
MKAGTARPISDDLPTLIRTLTGTTALVLTGDPVLTGSDSDRDRRVRVLEQ
LWLHALWSGRP
379763311YP_005349708.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MANKASGRYFAGKRCFVTGAASGIGRATALRLAAQGAELYLTDRDSDGLA
LTVADARALGAQVREHRALDIADYDQVAAFAADIHAAHPAMDVVLNIAGV
SAWGTVDRLTHEQWSKMVAINLMGPIHVIETFVPPMVAAKRGGHLVNVSS
AAGLVALPWHAAYSASKYGLRGVSEVLRFDLARHRIGVSLVVPGAVNTPL
VGTVEIAGVDREDPNVARWIRRFAGHAVSPEKAAEKILAGVAKNRYLIYT
SADIRALYAFKRLAWWPYSVAMRQVNVIFTRALRPGPPNPAPLVRHEQLQ
PHPEQADRAVEGE
379763310YP_005349707.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSGVERSGELPMCVPQLPAQERGDALRNRALLLDAARRLVAERGADAVTM
DDVAAAAGVGKGTLFRRFGSRAGLMMVLLDEDERASQEAFLFGPPPLGPD
APPWDRLVAFGRERMRFAHTHHALLSAANRDPRTRYGPPAAVLRRHVRVL
LASAETSGDLVVQADALLALLDTDYVEHQLNDGGHTLQTLGDAWESLARK
LCGR
379763309YP_005349706.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAIKILALVGSLRAASINRQIAELAAAVASDGVSVTLFEGLADLPFYNEE
IDDAMNADAPPLAPVAALRAAAADADAALVVTPEYNGSIPAVVKNAIDWL
SRPFGDGALKGKPLAVIGGSFGQYGGVWAHDETRKSFGIAGARVVDSIKL
SVPFKTLEGRPPAEHAELSANVRDVVGKLAAEAG
379763308YP_005349705.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MPKTCLRPLRADFGGFTEPGWLGDPGIRRCIETLHLVADKMSRYKMF
379763307YP_005349704.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSITVYTKPACVQCSATYKALDKQGIVYDTVDITLDSEARDYVMALGYLQ
APVVVAGNDHWSGFRPDRIKALAAVELSA
379763306YP_005349703.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MDTTGRNLVYFSSVSENTHRFVEKLGIPATRIPLHGRIEVDQPYVLVLPT
YGGGRATPDLNAGGYVPKQVIAFLNNEHNRSLIRGVIAAGNNNFGAEFAY
AGDVISRKCGVPYLYRFELMGTQDDVDAVRAGLADFWKEQTCQQPSLQSL
379763305YP_005349702.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MPGETDYHALNAMLNLYDADGKIQFDKDREAAHQYFLQHVNQNTVFFHNQ
DEKLDYLIKENYYEREVLDQYSRNFVKTLLDRAYAKKFRFPTFLGAFKYY
TSYTLKTFDGKRYLERFEDRVVMVALTLAAGDTILAEKLVDEIIDGRFQP
ATPTFLNSGKKQRGEPVSCFLLRIEDNMESIGRSINSALQLSKRGGGVAL
LLSNIREHGAPIKNIENQSSGVIPIMKLLEDSFSYANQLGARQGAGAVYL
HAHHPDIYRFLDTKRENADEKIRIKTLSLGVVIPDITFELAKKNEDMYLF
SPYDVERVYGLPFADISVTEKYYEMVDDARIRKTKIKAREFFQTLAELQF
ESGYPYIMFEDTVNRANPIDGKITHSNLCSEILQVSTPSVFNDDLSYAKV
GKDISCNLGSLNIAKTMDSPDFAQTIEVAIRALTAVSDQTHITSVPSIEQ
GNNESHAIGLGQMNLHGYLARERIHYGSEEGVDFTNIYFYTVLYHALRAS
NRIAIERGSKFGGFERSKYASGEFFDKYTEQVWEPATPRVREIFAEAGIR
IPTQDDWRRLKESVAEHGIYNQNLQAVPPTGSISYINHSTSSIHPVASKI
EIRKEGKIGRVYYPAPYLTNDNLEYYQDAYEIGYEKIIDTYAAATQHVDQ
GLSLTLFFKDTATTRDVNKAQIYAWRKGIKTLYYIRLRQLALEGTEVEGC
VSCML
379763304YP_005349701.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTNLANLDCMNVQPIPEGYTSLTPFLVVDGAEAAISFYIDVFGATLVEKM
AGPNDTIAHAELDFGHGRLQLSDPNPGYHLEAPGRTESVTHSLVFYCTDV
DAVLARAQRAGATVREEAQTFVTGDRFGSIVDPFGQRWSIMTRVEDIDPA
EREHRLASWGADNL
379763303YP_005349700.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MVGRAGSASTFDLRRQAPSQAAAKFVEHFWSVCWDLTGQPPRESQVITFP
SINLSHEWGTDSPRHGFALPATLVHGVVERVFTITLSGRGAVVGARFRAG
GFTARFGRDAAALTGRIVRVDDDLFSGPTLFDDDIELAAAQLDMAIGAAT
ICDPTYDALTALLRRMHDDEALHRVEQVMACSPWSARTTQRVFRRYVGVP
VKWVLCRYRLQQAALAIESDRRVDFADLAVRLGWYDQAHFTNEFRSMLGC
SPGEYAQRHR
379763302YP_005349699.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MREVVRMPRPPRPHPAAKPGAKVDARSERWREHRKKVRGEIVDAAFRAID
RLGPELSVREIAEEAGTAKPKIYRHFHDKSDLFQAIGERLRDMLWAAIFP
SIDLKTDSSREVIRRAVEEYVNLVDKHPNVLRVFIQGRSPASPQILNEGR
GITLAVADMFDNELREMELDHAAVELAGNAAFGCAASATEWWLGPDPDSP
LRMPREQFVAHLTTIMMGVIVGTAEALGIRMDPDQPIHSVVPANRAAG
379763301YP_005349698.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTDVVTHTETAPVPAAKASKPVHTRAVIIGTGFSGLGMAIALQKQGVGFV
ILEKADDIGGTWRDNSYPGCACDIPSHLYSFSFEPKPDWKNPFSYQPEIW
DYLQGVTEKYGLRRYIEFNSLVDRAHWDDDEHRWHVFTADGREYVAQFLI
SGAGALHIPSMPDIEGRDEFAGPAFHSAEWDHSVDLTGKRVAVIGTGASA
IQIVPEIVGQVAELQLYQRTPPWVVPRSNPEIPLAVRRAMENVPGLRALV
RLVIYWGQEALAFGMTKRPNLLKFIEAYCKYNIRRSVKDRELRRKLIPNY
RVGCKRILNSSTYYGAVADPKTELVTDHIARITADGIDTVDGTHRQADVI
VYATGFHVTDSYTYVQIKGLHGEDLVDRWNREGIGAHRGITVADVPNLFF
LLGPNTGLGHNSVVFMIESQIRYVADAIATCDKLGAQALAPTRAAQDEFN
DELQRRLGPSVWNSGGCSSWYLDEHGKNTVLWGGYTWEYWRATRSVRPAE
YQFFGVGTGRHAAAVQS
379763300YP_005349697.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSAYQTVVVGTDGSDSSLLAVERAAAIAADHGARLIVVTAHLPVPKERGR
YAIPPGSDHGQDYRTVGEAPYYRILRDATERAHQAGANNVEERSIVGAPI
NVLVQVAEEVRADLMVVGNVGLNSVAGRLLGSVPSEVSRRVKTDVLIVHT
AN
379763299YP_005349696.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MARTPDTERRRQLLDALVTEFATGGVGDRSLRAVADAVGTSHRMLLHHFG
SREGLLVAIVEEVERRQMGLLAELPDDPVEGFAAMWADVRRPELRQFERL
FFECYARAAQGEKPFARMVPGAVDGWLGEVKEAADGPVDPALARLGLAVI
RGLLLDLVATDDDAGVDAAARAFAELLR
379763298YP_005349695.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MITEDSVEIDAPAQVVWKVFSDVERWPEWTASVTSLAAVDGPGLAVGKRF
AIKQPRMSKLVWKITELEPGTSWTWEQRAPGARASARHDVIAQPGGGTLV
RQRIDQNGMLGALVGRLMRSMTRRYLKLEAQGLKARSEQLSRADGAHP
379763297YP_005349694.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTENMKLIDRVSAINWNRLQDEKDAEVWDRLTGNFWLPEKVPVSNDLPSW
GTLTAHEKQMTMRVFTGLTLLDTIQGTVGAVSLIPDALTPHEEAVYTNIA
FMESVHARSYSNIFSTLCSTAEIDDAFRWSEENPNLQRKAEIVMQYYKGD
EPLKRKVASTLLESFLFYSGFYLPMYWSSRAKLTNTADMIRLIIRDEAVH
GYYIGYKFQRGLALVDDARKQELKDYTYELLFELYDNEVEYTQDLYDEVG
LTEDVKKFLRYNANKALMNLGYEALFPRDETDVNPAILSALSPNADENHD
FFSGSGSSYVIGKAVVTEDEDWDF
379763296YP_005349693.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MIQWLQCGYPDGVPGPDRVPLLELLRSTPLTEDQIKEVVDAIDEETRPGE
EINRDVIADFISDMTHYDAGPENIARVAARLAAAGWPLAGITNPPEAAEN
PGAANGKAEPAPHTAS
379763295YP_005349692.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MRTVSAYAATSATEPLTKTTIERRDPGPRDVAIDIKFAGICHSDIHTAKG
EWGTPNYPVVVGHEIAGVVTEVGAEVTKFKVGDHVGVGCMVNSCGRCSSC
DAGLEQYCKNGATFTYNSIDKDGTSTQGGYSQAVVVDENFVLRIPDSLPL
DKAAPLLCAGITLFSPLRHWKAGPGTRLAIIGLGGLGHMGVKLGAAMGAE
VTVLSQSLKKMEDGLRLGAKHYYATADPETFKKLRSSFDLMLNTVSANLK
LNDYLSLLDVDGTLVELGIPEHPMEVGAFPLALARRSLSGSNIGGIAETQ
EMLDFCAEHNVTPEIEVIDPDYINEAYERVLASDVRYRFVIDISKL
379763294YP_005349691.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAAAVVLACGGCGSHRPAATPPARSLVTPTTQIAGAGVLGNDRRPDDSCA
REAAEADAGAAKRRVHNAAGVEPDVVQVPADPQRIVVLSGDQLDALCALG
LQSRVVAAALPDGSPTQPAYLGGAVHGVPGAGTRSHPDVKAIEAAHPDLI
LGSQGLTPTLYPQLAAIAPTVFTGAPGAGWEDNLRAVGAATARGTAMDGL
LGGFAKRATDVGARHDASHFQASIVRLTTEAIRVYGANNFPASVLGSVGV
DRPATQRFTDKPYVEIGATDADLAKDPDLSIADADVVYLSCATPAAADRA
ATVLDSGPWRKLSANRDNRVYVVNDEIWQTGEGLIAARGIVDDLRLVNAP
IN
379763293YP_005349690.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSRILAVDDGDVRAGPTNCRKWVCGAPRPSSRRREGSMVATRFARLRRAR
DRHGSMVATRFARLRRARDRHGGRRC
379763292YP_005349689.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MGPKGNLVYKLITTTDHKLIGVMYTVTCFAFFFIGGLMALLMRTELAAPG
LQFLSNEQFNQLFTMHGTIMLLLYATPVVFGFANLVLPLQIGAPDVAFPR
LNAFSYWLFLFGGLIAASGFIVPGGAADFGWTAYTPLSDAVHSPGAGGDL
WITGLILAGLGTILGAVNMITTVVCMRAPGMTMFRMPIFTWNILVTSILI
LIAFPILTAALFGLAADRHLGAHIYDASNGGVLLWQHLFWFFGHPEVYII
ALPFFGIVTEIIPVFSRKPVFGYTTLVYATLSIAALSVAVWAHHMFATGA
VLLPFFSFMTYLIAVPTGIKFFNWIGTMWKGQLTFETPMLFSVGFLLTFL
LGGLTGVMLASPPLDFHVTDSYFVVAHFHYVLFGTIVFATYAGIYFWFPK
MTGRLLDERLGKLHFWLTFIGFHTTFLVQHWLGDLGMPRRYADYLPSDGF
QPYNIASTVGAFILGASMFPFVWNVFKSWRYGEVVTVDDPWGYGNSLEWA
TSCPPPRHNFTELPRIRSERPAFELHYPHMVERLRAEAHVGRAHGPADKD
VTRLDDVQVRS
379763291YP_005349688.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MNSPPKVSVLITVTGVDQPGVTATLFEALSRHGVELLNVEQVVIRHRLTL
GVLVCCPAAVADGDELRHDVESAIRKVGLDVSIERSDDVPIIREPSTHTI
FVLGRPITAGAFGAVAREVAALGVNIDLIRGVSDYPVTGLELRVSVPPGT
DGRLRTALNRVSSEEHVDVAVEDYTLERRAKRLIVFDVDSTLVQGEVIEM
LAAKAGAEGKVAAITDAAMRGELDFAQSLEQRVATLAGLPATVIDEVADQ
LELMPGARTTLRTLRRLGYACGVVSGGFRRIIEPLAEELMLDYVAANELE
IVDGTLTGRVIGPIVDRAGKATALREFAQHAGVPMAQTVAVGDGANDIDM
LAAAGLGIAFNAKPALREVADASLSHPYLDTVLFLLGITRGEIEAADAID
GEVRRVEIPPE
379763290YP_005349687.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MPENGSEAADPDLLIELREVALQRGGNVLVGPLDWAVELDERWVIVGPNG
AGKTSLLRIAAAAEHPSSGVAFVLGERLGRIDVTELRSRIGLSSSALAQR
VPGDEVVRDLVVSAGYAVLGRWRERYEDVDYRRAIDMLESLGAEHLADRT
YGTLSEGERKRVLIARALMTDPELLLLDEPAAGLDLGGREELVARLADLA
ADPDAPALVLVTHHVEEIPPGFSHCMLLAEGRVVAAGLLTDVLTAENLST
AFGQAIALDVVDGRYFARRVRTRAAHRRQL
379763289YP_005349686.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTSPEEAPLVPRPAATVMLVRDTGPGLGVFLMRRHAKMEFAAGTMVFPGG
GVDDRDRNADIAWAGPPPEWWAQRFGIEPDLAEALVCAAARETFEESGVL
FAGPAGRGRSAPDSIVGDASVYGDARRALADGTLSFADFLRRENLELRSD
LLRPWARWVTPEAERTRRYDTYFFVGALPKGQRADGENTESDRAGWTTPE
AAIEDFAAGRSFLLPPTWTQLDSLAGRTVAEVLAVERQIVPVQPHLEIQG
DNWVFEFFDSDRYHQAREAGGLGWRH
379763288YP_005349685.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAALSEFVSVVVSDGSQDAGLAMLLLSRPPTNAMTRQVYREVIAAAEELG
RRDDVAVVILFGGHEIFSAGDDMPELRTLRGAEAETAARVRQEAIDAVAA
IPKPTVAAITGYALGAGLTLALAADWRISGDNVKFGATEILAGLVPGGDA
MARLTRAAGVSKAKELVFSGRFFDAEEALALGLIDEMVAPDDVYDAAARW
ARRFLDGPRHALAAAKAGINDVFDLERAERLAAERRRYAEVFSAGQGGGD
RADPGGR
379763287YP_005349684.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTSSTDAVPTPHATAEQVEAARHDSKLAQVLYHDWEAETYDEKWSISYDQ
RCIDYARGRFDAIVPDAVLRELPYDRALELGCGTGFFLLNLIQSGVARRG
SVTDLSPGMVKVATRNGQSLGLDIDGRVADAEGIPYEDNTFDLVVGHAVL
HHIPDVELSLREVIRVLRPGGRFVFAGEPTSAGDVYARELSTLTWRIATN
VTKLPGLGSWRRPQAELDESSRAAALEAIVDLHTFTPGDLERMAANAGAT
EVRTVSEEFTAAMFGWPVRTFEASVPAGRLGWGWAKFAFNGWKALSWADA
NVWRRVVPKGWFYNVMVTGVKPS
379763286YP_005349683.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MLVETVLLRRRAAEKLSGLGCAVSDWLFTDEALQQATAAPVAVHRAGRLA
EAAPDAVVHDATCSIGTELAALRGRGITTVGSDVDAVRLAMARHNVGAAG
LCRADALHPVTRDAVLVVDPARRAEGRRRLRIDDYQPGLAALLEAYRGRD
FVVKCAPGIDFDEVRRLGFDGEIEVTSYRGSVREACLWSSGLARPGVTRR
ASVLDRGEQVTDADPDDCGVRPVGRWIVDPDGAVVRAGLVRHYGARHGLW
QLDPDIAYLSGDRLPAGVRGFEVIERLVFDERRLRQALSALDCGSLEVLV
RGVRVDPDALRKRMRLRGRRPLSTVITRIGSGTSGRATAFVCRASR
379763285YP_005349682.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MRYLIAAALLATAVLLGWPAAAEPPSCASLGGSVEAGQMCRVHATGPNYM
LTMTFPTDYPDQQALTDYITQNRDGFVNVAQSSGGRDQPYQLEATTDQHS
AGQPPHNTRSVVLKFFQDVGGTRSSIWYKAFNYNLGTKQPITFDTLFPPG
TTPLDAIFPIVQRDLERQTPLGAAILPSTGHDPSHYQNFAITDDQLIFYF
APGEMLPAFGGPAQAQVPRNAIPPLAI
379763284YP_005349681.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MPIDDPTAQDAATTTAEGRRASTADIVATLVLLVIHGGLYGATFVVLGLL
VMSTDPCSYQKCGDPAWIDRAMNLGTWGGAALLVADVVVAVYLLVRGRRA
FFVPIIGCLAQVALAALAVAMELRAGPV
379763283YP_005349680.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]METDVLARHLVSGLRRCSSALLAAALVAGVGGCGTTDSWVDASAAQGWPA
QYADAANSSYTPTGGATKLSLQWTRSVKGSLAAGPALSGRGYLALNAQTS
AGCSLMEWENNHNGRQRWCVRLFQGGGFGGPLLDGFDNLYVGQPGAFLSF
PVTQWTRWRQPVIGMPTTPRFLGSGELLVATHLGQVLVFDSHRGQVVSSP
LDLVDGIDPTDATRGLADCAPARQGCPVAAAPAFSAANGMAVLGVWQPGA
PAAVLVGLKYHPGQTPLLTKEWTSDAVGAGAIASPVLSADGSTVYVNGRD
ERLWALRTADAKVKWSAPLGFLAQTPPAITPQGLIVSGGGPDTRLVAFKD
AGDHADQVWRRDDAVPLSSSSLAGAGVGYTVVGGPPANGAPGMSVLVFDP
GDGHTLNSYPLPAATGYPLGVAVGTDRRVVAATSDGQVYGFAPA
379763282YP_005349679.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTSMWGAPVHRRWRGSNLRDPRQARFLTLASLKWVLRNRAYTPWYLVRYW
RLLKFKLANPHIITRGMVFLGKGVEIHATPELAQLEIGRWVHIGDKNTIR
AHEGSLRFGDKVVLGRDNVINAYLDIELGDSVLMADWCYVCDFDHRMDNI
DMPIKDQGIVKSPVRIGPDTWVGVKVSVLRGTSVGRGCVLGSHAVVRGVI
PDYSIAVGAPAKVVKNRQLAWESSAAQRAELAAALADIERKKASR
379763281YP_005349678.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSRSEVAGQISAKMTDAAGNKPESVNCPNDLPATLGAQMTCEMKVKNRPF
GVNVTVTSVEGGDVKFDMVEMVGKEQVAAAISTQLGQRVGRKPDSVTCPD
NLRGVAGATLRCQLTDHGQKYGVLVTVTNVAAGDVNFHFKVDDRPQPDS
379763280YP_005349677.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MPALLWFRRDLRLRDHPALLAAAEAHEVLACFVLDPRLESSSGQRRLQFL
GDSLRRLRADLDGRLLVTRGRPDTQIPHIAKEIGATSVHISEDFAPFGTR
RDERVRAALGAVPLVATGSPYLVSPGRVTKPDGSPYQVFTPFLRQWHEVG
WRAPATSGAASARWLDPARLQVEHCEIPDPGVSLDVAAGEAAARAQWKSF
LDNGLRSYADDRNRPDLRGTSRMSAHLKFGTVHPRTLAADLDLRGGGAQA
YLRELAFRDFYADVLHHWPASAWRNWNKDFDGIPTDSGAEAERRFAAWKA
GETGFPFVDAGMRQLRETGFMHNRVRMSVASFLVKDLHLPWQWGAEWFLD
QLVDGDMANNQHGWQWCAGCGTDAAPYFRVFNPTTQGEKFDPTGDYIRRW
VPELRSADDAHLRRGRRPDNYPQPIVDHAAERAEALRRYQSI
379763279YP_005349676.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MNKSILGATALGVAAAAGAGSVASANAASPWYARLRKPAYQPPRAAFPVA
WTTLYADIAVTSAVAIDRFRATGRHDQARSYAAALVVNLLLNAGWSWLFF
RYHKLGAAAVGAAALTASSADLVRRTAQAGPRGGPALLPYPMWCGFATVL
STHIWRLNR
379763278YP_005349675.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTGRRSWLLALVAALLGVGFMVLIGENAAAGQSPKSLPDDSASAEVDALS
RQFTGGDRAPVIVVVSRTDGAVLSPSDVSAARAARDRAQAAAPPGGDGAA
PALPSTDGKAVLGIVPISGGLSGLDLDRTVTALRTAAASGLPTDLQVHVT
GGPAFGADIASAFTNANITLLAVTTSVVALLLIATYRSPVLWLVPLLVVG
FADRVAAAVGTAVASLTGLSFDGATSGITSVLVFGAGTNYALLLISRYRQ
ELRRHSGHRVALRHAVRRAGPAIVASNATVVLALLTLLFAATPSTRSLGA
LAACGLVVAAVSVLVILPPMLAVCGRRLFWPFIPHADDAEDRDSGAWRRI
AESVARRPALVAVVAIAVLAALGTGLWGTRIGLSQTEQFRVRADSVSGYA
VVAEHFPAGLANPTLVVAPTAHASPVRQAIGATPGVVSVTESGRAETGLT
KWSVVIDAPPSSDRAFGIVAALRDSTRAADPGALVGGADAQALDVRDAAA
HDRVLLIPAILAVILVVLYALLRSALAPPTLLAATILGALAALGMGGWAS
IHIFGFPALDNTTPLFAFLFLAALGVDYTIFLVTRAREEAARHGARDGMV
RAVSATGGVITSAGIVLAAVFCVLGVLPLIVLTQLGIIVGLGILLDTFVV
RTLVIPALFALIGDRIWWPTSPANAEPVEQQADRAQRERSTP
379763277YP_005349674.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTADRGAMKNRKRRHIDVCLSEPVGYAGVSTGLDRYHLPYNALTQTSLGD
IDLSTTFFGANLRSPILIGAMTGGAELSGTINRNLAAAAQQLGVGMMLGS
QRIMLDSALGERAADSFTVRDVAPDALLFGNIGLSQLAKAAVPDLAKALD
RVGADALAVHTNPLQEAMQHNGDTDFSGSVDRLREAADALGYPVLLKEVG
HGIGGAAVAELLGADGTLPVAGIDVAGAGGTSWSRVEQFVRYGELRHPEL
ADWGIPTARAVVEVREALPEIPLVASGGIRTGMDAAKAIALGADVVAVAR
PLLPAAIESTAAVVDWLQPFIDELRVCLHGCGAANLAALRDVDLVRVT
379763276YP_005349673.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAVILAYGSPALGHLLPVGALLAELARRGHDVHVRTMAGGVSTMRSVGVH
AAPVDPRIEAIAGKDWRARNALEVLTSSVDVLCRRAVFEVDDLRRAVAEV
RPDAVIVDANCWGALSAADAGEIPWSLFSPFTPYLRSRGVPPFGPGLRPL
PGVVGDLRDATVRPIVRYLFDRPMLPRVNAIRVQLAVPPVTSVDGFMRRA
PLLLAVGGEPFEYRHPGWPDVLHHIGACVFEPTETVTAGWIDDLDRPVVL
VNTSSLRQADEPLGRIALHALADEDVHVVATFPAGIPTDLPRPDNATVCR
FVPHTAVLEKAACAITHGGMGTTLKALDRGVPVCVVPFARDQAEVARRVE
VAHCGTRLRAKKLTPARLRAKVRQAMTMADGARRVAAGFAATGGVARGAD
LIEQRLLGCTVERPVH
379763275YP_005349672.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MDRAELEKLMSADMRAITAQSDRIGRHFARQNEVSGTDFHALLHIMVAET
AGTPLTAAQLRRRMDVSPAAITYLVDRMIDAGHLRREPDPQDRRKTLLRY
EKPGMALARSFFTPLGAELHTALAELPDRDLAAAHRVFTAMIEAMSAFES
TLTAPAPKRPATPEGKRTPAKGRGGAVR
379763274YP_005349671.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTEDKDTTWARFHDAVNMTAGELEKWLATEESNAVGQKQGESESTGHASG
RRIVEILTAKRKDLTEADYAHMRKVVGYAKRHLAQRPQGNIDESPWRYSL
MNWGHDPAKS
379763273YP_005349670.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSNREFDKGDAVEWQSHGTTVRGTVEGEITSDTEAAGRTVRASADQPQYK
VRSDKTGADAVHKPDALRRAD
379763272YP_005349669.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSFDNTGEGATQAVGKVTEALETIERARGHLYSFHQLTGHADLQLDEAVS
RLHELGHAGLAQHISRELIGRNVLPGRWSFQVVEDYDDGYYRCFKEIEQL
VRMRLAGGQRHRYEMAMKEERRTAGHPAHTASPNDESTNGENL
379763271YP_005349668.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTVGAHLAYLLYVPSGGFLALRWPRTMALHVPAVGWGIAVVTLRLPCPLT
ILESWARRSAGMNPLPTAGFIERYVAGHFVPTGRIGAAQALAFSAAGVSW
CVLARRILHPRRRPVGVNG
379763270YP_005349667.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MKIRDQLQSLRAWPKDWPLQVIPRVSWADQRPTYRDAQPAVIDAALRRSQ
HRPTGNWYAFAASRQVVGGRPFGALVAGVEVVAWRDEQHRLCVGPRSCPH
LGADLATGTVHRGTLVCRWHGLTLDGRAREFGWSPLPGHDDGTLVWVRLD
AVGREPPLELPVIPERPTGDTLAAVARMEGVCEPIDVIANRLDPWHGAWF
HPYSFTRLEVLTTPTEHADRFLVAVTFRMGRLGVPVVAEFSCPEARTIVM
RIVDGEGAGSVVETHATPIGLGPDGRPRTAVLEATIAHSGRPGFKRASRV
APLITPLMRFASSRLWRDDLAYAERRYQVRAARG
379763269YP_005349666.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTAHADRRRRTLPAPTGLPDAGALPSRPRVAVVGGGIAGLAAATGLAERG
VAVEVIEREPYLGGRVGGWTERDGGVDLAMNRGFHAFFRQYYNLRALLAR
IDPRLRMLTPVEDYPLIDGAGRRDSFRGLPRTPPWNAVAFAARSPTFRLR
DFTRIDARAAAPLAAVSVPGTYERLDHIDAAAFLENIRFPEAARHLAFEV
FSRSFFADPAKLSAAELATMFHIYFLGSAEGLIFDVPCANYDSALWQPLC
GYLEGRGVRFRLGTAALGIEGDSAGRFRVHTDSGERLDVDAVVLATDVAG
LQRIVAGSSGLGTDDWRARISRLRTAPPFAVHRFWLDRPVSARRPAFLGT
AGYKPLDNISVLERYEREARAWACAHQGSVVELHSYALDSAPSRAAALRR
LHAVYPETAAAHIVHERLLHRSDCPLFAPGTYTDRPAVITPTPGLVLAGD
AIRIDLPVALMERAATTGWCAANQLLKRWGLAGHPLSTVPTRGRSPLLRW
LATREGAARR
379763268YP_005349665.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MRVGDAGPAPADLAAAFDAGAAAYDRLVGASPGYHAQLLLSARRMRIPAR
GKGLRLLDAGCGTGASTAALLAVAPHADIVAVDASRGMLDAARAKDWPAT
VRFVHTPVEQLAEHGITGPFDAILAAYLIRNVADRDDQLRNFRTLLRPGG
TLAVHEYSVRDSRAATRIWHAVCWGIIIPSGWWRTRDTALYRYLWRSVLA
FDGAARFRTRLADAGFTAVHSETMPGWEANIVHTFLADAPS
379763267YP_005349664.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSGLGYTLPAALAVLAVCALELAVLRTGLFRRPAYWLSMVIVLGFQIPVD
GWLTKLSSPIVSYDDRQLSGLRFPFDIPVEDFLFGFALVTAVLLLWERQH
ARR
379763266YP_005349663.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSDRWQYLVVLAACLLITAPLEALGPGVYRQWRRFLKAVLPVAAVFLIWD
EIAVAARVWTYDGAYLSGLSIPFRVPIEEVLFFLVIPTCALLTYNAVGAI
LARVHRR
379763265YP_005349662.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MMRSELAAAGIDDPRLREGYRQCRELNAAHGRTFFLATRLLAPDQRPPVH
ALYGFARYADDILDDLDPRLDPCSRGRRLQQLSERFFSDGAHLDDPLVAA
VTHTARRYRISAGLFEDFLNSMRMDLTVTDYPDRAALNLYMRGSAEAIGL
QVLPILGTVTPMEEAAPYAAALGRAFQLTNFLRDVDEDLVRGRVYLPTDE
LAADGVDRELLTWCHAHRRTDPRVRRALAAQHEIARQTYRFAAAGIATLA
RRSRPCVATAAALYAEILDCIERSEFAVFDHRATVGRARRLRVAGAGLIR
SWRARNRERDDLNSGAA
379763264YP_005349661.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MRTIDGRTDHVVVVGAGLAGLSAALHLAGRGRAVTVVEREPWPGGRAGRL
DIDGYRIDTGPTVLTMPDIIDETFAAVGETRSNRLELSPVDPAYRAVFAD
GSALDVHSDADRMADAIADFAGSGQAAGYRRLRTWLTRLYRTEFDGFIGA
NFDSPLSLLTPRLAQLTAIGGFRRWDRMVKRHISDERLQRIFTFQSLYAG
VAPRDALAVYAVIAYMDTIAGVVFPRGGVRALPDALAAAATDAGVQFRYG
ATVTALEQSGGRVRAVLTEQAGRISCDAIVLTTELPQTYALLGRTPRRAV
RLRASPSAVVAHLGCPAVARDTAHHTILFGEAWDQTFTDIIRDGRLMTDP
SLLVTRPTAGDPALAPEGRDLLYVLAPAPNLERGTIDWSRAGAAYAEGLV
AHVADRLLPGLREDATVLDVVTPADWARQGMAAGSPFALAHTFGQTGPFR
PANMVRGIYNAVLAGSSTVPGVGVPTTLISGRLAADRITGAATRAIAVLD
TKAGLP
379763263YP_005349660.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTGSSGGDDFGEWRSEVRRRVLVEVAEFVAQRRAADLDGAGIEAVGDILA
DFVSGGKCLRSTFVYLGWLCGAPADPAALRAAASFELVHAFALLQDDVMD
GSDVRRGRPSAHRQFGRWHRERGLPGASRRFGESAAILLGDLCLIWAEQM
LRDSGIDPRRLQLAWPRYDAMRTELAVGQFADLINDARQAPGLEFVLDVA
RRKSGNYTVRRPLEIGAAMAGCGAHTLCQLGRYGRAVGEAFQLRDDVLGV
FGSPAVTGKPGAIDLLERKATSVVVAAHQLADPATRRELTELANREGLGR
DAIDRWKALIIGTGAVGLIEEMIGDRVASARAHLGDLPIEEPVRIALAEM
AAACTDRAV
379763262YP_005349659.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAQFARAHVFVYARCLATVVRVDGEIDAANARDLTEAIRGFARLKTPVVL
DLSRLRFLSVEGFRALLFVNDELRKARVHCSVVTGKAIRPLLRIVHDNGL
ATTDSVPEAFQTIEDILAARRRFVSELARPRQPRSRVPRSAAS
379763261YP_005349658.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MEKLGRRWCRLALAPAAIMMFIGAPGWAGADPGITVFPGMEIRQGNTVCM
LGMVEPRLRVALTSGQCDGGQSMVTDRDRKPIGDVVLGRRQVDTDSAADT
SMLPVEYEVIALAGNVTASDVLPTGRQLRSTPGLRAQPGLPVCQLRRSTG
QRCGPVGTVTNGRFAIPDMVVDGRDFGGPVYALTDDNKAVIVGLYEGMWR
ASPQFESWQAVMAQVYIDSHSYSGQQQLPALRMINWRTAARAVAAP
379763260YP_005349657.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MNVFDLVALPFQWGSAIRGKRIFHPSGVLARGFIERIAPAGQGLPIPSSE
IVARVSKASGTPGALPDFVGLAFRLTPPEPAGKPWDILLVSAGSGVLSRA
VALRPTASWNGQTLTTLMPLHYQNHNWWLRARTPSDIDGLGLSLANVRNR
LERGNIEIALDQACGRGHFTPVGHLTLTAVVDDEQHRDVSFDPVVNTAPG
LSLHPRWLADLRARAYRQSRDGRDADE
379763259YP_005349656.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MPKRIVITGASGNVGTALLRRLTADDSDYEIVGISRRRPPSDDVYRSAHW
HELDLADSGVELELLKVFRGAACVVHLAWGFQPTRNRRYLDAVGVNGSAA
VLSAAHNAKVPHLLHMSSVGTYAAGRYGQKVDETFSTAGIPSSAYSRAKS
AVEHMLDGYEGHNPDGVGITRMRPGFILQRDAALGLRRYTLPAYVDPRWV
RWLPLLPLDRSLSVSIVHADDVADACVKAIERRALGPFNLAAEPPVGRDD
IAKALRARPIHVPSPLLGLLVAASWRARLQPLDRGWLDMAFSLPLLGTDR
ARNVLGWSPRWSSEAALADLVDGFLHTWGTQSPVLRARSCAEAISRDLHE
GPLTVRRVP
379763258YP_005349655.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MGLDYSSVVHAPITDVFDWHARPGAFHRLSPPWQPMRLIAEASSLEDGRA
TLALPGGLRWIAVHQPDGYDPPRRFVDALGGDGLATLPARMALRWRHTHE
FVDIGDDRTRVIDRVETAVPGSLLRPMFDYRHRQLADDLAAHRLAAENGL
KRSTIAVTGSSGLVGSALTAFLRTGGHRVILLVRRDARDTDERRWDPEDP
DPQLLAGVDAVIHLAGASIAGRFTDKHRDAIRDSRIGPTRRLAELLARTD
PRPAVLISASSVGYYGYDRGDDTLSEDSDRGEGFLADVVADWEEATAPAQ
EAGLRVVRVRTGIVQSPRGGTLRLMRPLFAAGLGGRLGDGRQWLSWIGID
DLVDVYHRALWDTALSGPVNAVAPQPVRNAEYTSTLAAVLHRPAVLPVPS
LGPRLLLGGQGARELACASQRVAPRKLVAAGHRFRQPDLTQALRHLLGRG
QSTVRAPGGR
379763257YP_005349654.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MDHEVKILMVSWEYPPVVVGGLGRHVHHLSTALAAAGHDVVVLSRRPTGT
DPRSHPSSDQISEGVRVIAAAQDPHEFTFGTDMMAWTLAMGHSMVRAGLS
LKKPGSSHAWRPDVVHAHDWLVAHPAIALAQFYDVPMVSTIHATEAGRHS
GWVSGGLSRQVHAVESWLVRESDSLITCSGSMADEITELFGPGLAEITVI
CNGIETARWPFAARRPRTGPAELLYLGRLEYEKGVHDVIAALPRVRRTHP
GTTLTIAGEGTQQGWLIEQARKHRVLKAIRFVGHLEHAELLAVLHRADAA
VLPSHYEPFGIVALEAAAAGTPLVTSNIGGLGEAVIDGRTGVSCPPRDVT
RLAAAIRTVLDDPRAAQQRARAARERLTSDFDWHTVADKTAQVYLSAKRG
ERQPQARLPIVEHALPDR
379763256YP_005349653.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MNSTPDRVPGLFTLVLHTHLPWLAHHGRWPVGEEWLYQSWAAAYLPLMRV
LNTLAGEDRQGLITLGVTPVVNAQLDDPYCLGGMHHWLANWRLRAAEAAS
VRSIPRSKSAGYQSCTPEALRALGIREEAEAENALEDFATLWRHGGSAPL
RGLLDAGTVELLGGPLAHPFQPLLAPRLREFALREGLADAGQRLAHTPTG
IWAPECAYAPGLEHDYAAAGVTHFMVDGPSLHGDTALGRPVGDTDVVAFG
RDLQVSYRVWSPKSGYPGHAAYRDFHTYDHLTGLKPARVTGRNVPSEGKA
PYDPERADHAVDIHVADFVETVRNRLTSESARIGRPAHVIAAFDTELFGH
WWYEGPTWLERVLRALPEAGVRVGTLTDAIADGFVGSPVALPPSSWGSGK
DWQVWAGDQVADLVQLNNEVVDTALSTVDKALSQTATLDGPIPRDHVADQ
ILRETLLTVSSDWPFMVSKDSAADYARYRAHLHAHATREIAGALASGRRD
TAQRLAEGWNRADGLFGALDARRLPR
379763255YP_005349652.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSAPVPDLPPHTPGVTASVGDAVMMLTGERTIPGLDIENYWFRRHEVVYQ
RLAERCVGREVLEAGCGEGYGADLIAGVARRVIAVDYDESAVAHVRARYP
RVDVMQANLARLPLPDSSVDIVVNFQVIEHLWDQTQFVAECARVLRPSGL
LMMSTPNRITFSPGRDTPINPFHTRELNADEMAELLIAGGFSDVSISGLF
HGPRLQEMDARHGGSIIDAQIARAVTDAPWPPDLAADVAAVTTDDFELVE
SGSGAATGRHIDDSLDLIAIAVAP
379763254YP_005349651.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTNIVVLIKQVPDTWSERKLTDGDYTLDREAADAVLDEINERAVEEALQI
REKEAADGVEGSVTVLTAGPERATEAIRKALSMGADKAVHLKDDGLHGSD
VVQTGWALARALGTIEGTELVIAGNEATDGTGGAVPAIIAEYLGLPQLTH
VRKLSLEGDKVTGERETDDGVFNLEATLPAVVSVTEKINEPRFPSFKGIM
AAKKKEVTVLTLAEIGVESDEVGLANAGSTVLSSTPKPPKTAGEKVTDEG
EGGNQVAQYLVAQKII
379763253YP_005349650.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAEVLVLVEHAEGALKKVTSELITAARALGEPSAVVVGAPGTAAPLADGL
KEAGAAKIYVAESDDVDKYLITPVVDVLAALAESNAPAAVLLAANADGKE
IAGRLAARIGSGLLVDVVEVKEGPKAIHSIFGGAFTVEAQANGDTPVITL
RAGAVDAEPSAGAGEQVTVEVPAPAENATKITAREPAVAGDRPELSEATI
VVSGGRGVGSAENFSVVEALADSLGAAVGASRAAVDSGYYPGQFQVGQTG
KTVSPQLYIALGISGAIQHRAGMQTSKTIVAVNKDEEAPIFEIADYGVVG
DLFKVAPQLTDAIKARKG
379763252YP_005349649.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSIASVLIPADKLSGASTTPRYSLLLSTDPGLIEAAQRLRYDVFTSTPGF
ALPPDGGHGSDRRDEDRFDEFCDHLLVRDDNTGELVGCYRMLAPAGAIAA
GGLYTATEFDIRAFDPLRPSLVEMGRAVVRDGHRNGGVVLLMWAGILAYL
DRYGYDHVTGCVSVPIGDEADDQPPGSRLRGVRDVILARHGAPAHHRVRP
HRPVVVDGTALDDIPAPARPSVPALLRGYLRLGARVCGEPAHDPDFGVGD
FCVLLGKQHADTRYLKRLRSVSAAAEMAGK
379763251YP_005349648.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTGIAHSWLPRASCGAGCVRPGDAVACPPPLVALRVTLRLLLALLLAPGL
PLLALPLPGRTRVQRIYCRLVLRCFGVRIAVSGNPIRNLRGVLVVSPHMS
WLDVFAIGSVLPGSFVARADMFSGPATAIVARVCKVIPIERSSLRRLPGV
VDAVAHRLRAGQTVVAFPEGTTWCGRDCGAFYPAMFQAAIDAGRPVQPLR
LTYHHIDGGLSTVPAFVGDETLLGSIRRLLAQRRTLARVHVESLQLPGTD
RRALAGRCQSAVGAGTARGAGHGRVLVA
379763250YP_005349647.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MVYLDHAATTPMHPAAVEAMTAVLGTVGNASSLHTSGRAARRRIEESREL
IADKLGARPSEVIFTAGGTESDNLAVKGIYWARRDAEPRHRRIVTSEVEH
HAVLDSVNWLVEHEGAEVTWLPTAPDGSVSAAALREVLTHHDDVALVSVM
WANNEVGTVLPVAELAAVAAEFGVPMHSDAIQAVGQLPVDFAASGLSAMS
VTAHKFGGPAAVGALLLRRDVACVPLAHGGGQERDIRSGTADVAGAVGMA
AAARISIDGLEVNSARLRALRDRLVDGVLGGIEDVSLNGARDPLRLPGNA
HFTFRGCEGDALLMLLDANGIECSTGSACTAGVAQPSHVLMAMGADPTSA
RGSLRLSLGHTSVDADVDAVLRVLPGAVERARRAALAAAGAS
379763249YP_005349646.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MKVLAAMSGGVDSSVAAARMVDAGHDVVGVHLALSSSPGTLRSGSRGCCS
KEDASDARRVADVLGIPFYVWDFAEKFQADVIDEFVSSYARGETPNPCVV
CNQKIKFSALSARAVALGFDTVATGHYARLSGGRLRRAVDHDKDQSYVLA
VLSAEQLRHAAFPIGDTPKSQIRAEAARRGLAVAEKPDSHDICFIPSGDT
RAFLGSRIGVRRGAVVNADGTVLAEHDGVHGFTIGQRKGLGIGGPGPDGR
PRYVTAIDAETATVRVGDAADLEVRELTGRAPVFTSGVTPSGPIECAVQV
RAHGETADAVAELAGGELVVRLRVPLRGVAPGQTLVLYRPDPDGDEVLGS
AVIAATSR
379763248YP_005349645.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MLMAVSCTRVVDGAALAGPDNNRRVVQGVNVDTILLDQSRMRAITGAGEH
LTIIPSMDGTSPVNIDALAQTAPRECRFIYDETATFGTDLEAFHKTTFQD
PPDGALISEGAAAYRDADSARTAFNALVGTVGDCANGSGGQLYVGEWNAD
GTSLHLRPGGCGRDYRILSVAMLEVTFCGFAQSVSDIVMTNIAANVPR
379763247YP_005349644.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MNLPAGTLGTQPLPTGGPGDVEYGWPVSVFAGPSGVGSWPGIAAREAAAV
IVGELAGALPHIVELPARGVGADLLGRAGALLVDVAIDTVPRGYRLVARP
GAVTRRAISLLDEDMDALEEAWEAAGLRNDGRVVKVQAPGPITLAAEIEL
ANGHRAITDPGALRDLTSSLAEGVAAHRAQLSRRLETPVVVQFDEPSLPK
ALGGALSGVTALSPVAPLDEAVAGGLLDACAETVGGEVALHCCAPGVPWD
LLQRSAFSAVSVDPGALSAADLDGIAAFVESDRAVVLGVVPASAPARRLS
AEEVAGGVVAVTDRLGFARSALRERIGVTPACGLAGATPAWARTAIELAR
KAAQMFAEDPDAIK
379763246YP_005349643.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MKIEKQVVLRAPLERVWRAISDAEEFGRWFGVRFDGPFVAGTSVTAAISP
TTVDGEVAKRQQSHAGVTSTWQIVAVEPRRRFAYRWHPFAIDPEVDYEGE
PTTLVEFTLAEQSDGVLLTITESGFEAIPEARRGASFEANGEGWAIQTTL
VRKYIEGVRV
379763245YP_005349642.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSGRVAVGAPIFGALGDPNRLRIIVRLCDQGPSSTSQVTSVVPVTRQAAS
KHLQLLESVGLVTSSRRGRERVWTVQTGPLASASDYLDQLSRRWDAALDR
LRSFVEDGVED
379763244YP_005349641.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSSAEADSVAPEVRRQWQDLAEAVREHQFRYYIKDAPIISDAEFDTMFNE
LLALEERHPELRVADSPTQLVGGAGFATDFAEAQHLERMLSLDDVFDRDE
LVAWSNRVENEVGKEPHYLCELKIDGVALSLVYRDGRLERAATRGDGRVG
EDVTLNARTIDDVPERLSAAKDFPTPSLLEVRGEVFFLLADFEALNASLV
EDGKAPFANPRNSAAGSLRQKNPAVTARRKLRMICHGIGRTEGFAPKTQH
EAYAALKAWGLPVAEQTARVRGLAAVEERIGYWGEHRYDLEHEIDGVVVK
VDDVALQRRLGTTSRAPRWAVAYKYPPQEAQTKLLDIRVNVGRTGRVTPF
AFMTPVKVAGSTVGLATLHNAAEVKRKGVLIGDTVMIRKAGDVIPEVLGP
VVDLRDGSEREFVMPTTCPECDTPLAPAKEGDADIRCPNARSCPAQLRER
VFHVAGRGAFDIEGLGYEAAIALLKAEVIADEGDLFTLTEDDLLRTELFR
TKAGTLSANGRRLLDNLDKAKKVALWRVLVALSIRHVGPTAARALATEFG
DLDAIMSASTERLAAVEGVGPTIAAALTEWFTVDWHRAIVDKWRAAGVRM
ADERDTSVPRTLEGLTVVVTGSLAGFSRDDAKEAILARGGKAAGSVSKKT
DYVVAGDSPGSKYDKAVELGVPVLDEDGFRRLLADGPQKTPAE
379763243YP_005349640.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSGRYGDSTRSLKAVNSQAVSGQPVAPQPVLAATYHLSADETLDSYGRSS
NPTWRQLESALAELEGAAGAVVFGSGMAAVSAVLRAWAPPGSTVVVPADG
YYQVRRHATEDLALAGVTVVAASSSQIYDAAAQADVVLAETPTNPALDVV
DLHRLATICHGRGARLVVDNTAATPLGQQPLSLGADAVVASATKALSGHS
DLLAGYVATSQSELLAAAERQRLLAGAVLGGFEAWLLLRSLETAGLRFER
QCQNARAVATMLAGHPAVRAVRYPGLAQDPAHPVAMAQMRRFGGLLWVEL
ADAAAVHALVDASELLIAATSFGGLHTSVDRRARWGDPVADGFARISLGI
EDTDDLVADIEHALMTSR
379763242YP_005349639.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTQTAEECAQASPWSPREAEILAVTLRLLQEHGYDQLAVDAVANAARASK
ATVYRRWPSKAELVLAAFIEGVRQVAVPPNTGTLRGDLLSLGETIAVECG
QHASTIRAVMVEVSRHPALNEALQHQFLDQRKAMIQHVLHQAVDRGEITE
DVITDELWDLLPGYLIFRSIIPGRPPTRRTVQAFVDGFLIPGLTAGPGA
379763241YP_005349638.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MLPDPISATDLNIYGDAELPWARALDAMKALPSEETPQFLGTVRADGSPH
SAGIGSIEHGGHIYFTSGPATLKSRNLAANPACTLSFRLPGVDLVLDGVA
HRTTDVRELDEVTARYRDSGWPCERDGDAVTAPYSAQSAGPPPWYLYRFV
ARGAVGVATAEPHGATRWRFAP
379763240YP_005349637.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MVIVSVLVVALAGFGIYRLHGIFGSHDNTTANSGLAAEIVPFNPKQVVLE
VFGAPGAVATINYLDVNAQPQQVKDAPLPWSFTITTTEPAVIGNVVAQGN
GDTLGCRITVNGEVKDQRTVHKVDAYTFCLDKSG
379763239YP_005349636.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSNEQQPRSFVPRTIRRLALPILLFWVGLAALTNIAVPQLEDVGKTHNVA
LNSPDAPSLKAIKRIGEKFHEFDTDSSAMIVLEGDKPLGADAHRFYDEMI
RKIERDKKHVQHVQDYWGDTLTAAGSQSSDGKAAYVQVNLAGNQGSALAN
EGVGAIRDIVEHMKPPPGVKTYVTGAAPLISDQFDVGSKGTAKVTGITVG
VIAVMLFFVYRSVLTTLLVLATVLIEMSAARGLVAFLGNAGVIGLSTYAT
NLLTLLVIAAGTDYAIFFVGRYQEARGSGEDRETAFYTMYHGTTHIVLGS
GLTVAGAVACLSFTRLPYFQSLGVPAALGILVALFAALTLGPAILTLGAK
VGIFDPKRAIRTRGWRRIGTAIVRWPGAVLASACALALVGLLALPGYKTS
YDTRPYMPASAPANIGYTAAEKHFSRARLEPELLMVETDHDMRNPESMLI
LDKVAKAVFHVPGIAQVQSITRPLGTPLVHSSLAFVVSNQSAAQQQNLTY
QRDRADDALKQANELTKTINILKQQYVLQQQLAGTTHEETESFRDTLGTI
RDLRDKIANFDDFFRPVRSYFYWEKHCYDIPACFAFRSLFDAIDGIDQLT
EKFENLTASLDKLDALQPKLTALIPPQIESQQTNRDLTLANYATLSGIYA
QTAAAIDNATALGRAFDAAKNDDTFYLPPEVFNNPDFKRGLKLFLSPDGK
AARMIVTHEGDPATPEGISHIDPMAKAAHEALKGTPMAGAQIYLGGTAAT
YKDIQDGAKYDLMIVAFAALSLILLIMMIITRSLIAALVIVGTVALSLGA
SFGLSVLVWQYIFGIQLYWVVLALAVILLLAVGSDYNLLLISRFKEEIRA
GINTGIIRAMAGSGSVVTSAGVVFAVTMCAFVFSGFQVLGQIGTTIGLGL
LFDTLIVRSFMTPSVARLLGRWFWWPQRVRPRPASTMLRPYGSRPAVRQL
LLWEDDDPVAMSSGAR
379763238YP_005349635.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTWPELVGGGCDDDSMSSIASAEAVVVTASDRLEVLFGELAELAGQRNAI
DGRVVEIVAEIDRDGLCGVTGARSVPALVAWKLGCSSANAHTLAAIAARL
EEFPRCTAGLREGRLSADQVGVIAARAGEGSDEHYAELAAVATVSQLRTA
VKLEPRPEPEPRSESESESESESEPRPEIEPERSITTTAIEWGACYRIML
GHLDAAKFDAALASHREALIAEWKHDQANGAGSSDQRPPLPSTVDALMRL
VEAGWDAEAARRPHGQHTTVVAHLDVGRRVAGLHLGPLLSDAERRLLTCD
ATCEVWFEREGEVIGAGRTTRVINRRLRRALEYRDRSCVVPGCGASRGLH
AHHLWHWEDGGPTELANLVLVCPYHHRLHHRGVITLTGPADALTVTDEAG
RVLSPGSLARPPTGPPPAVPPCPGPTGERADWWWYDPFQPQPPPTNN
379763237YP_005349634.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MLAVPSYLLRIELVDRPGSLGSLAVALGSVGADILSLDVVERSSGYAIDD
LVIELPPGAMPDSLITAAESLSGVRVDSVRPHTGLLEAHRELELLDHIAA
AGDTASRLQVLANEAPRVLRVSWCTVLRSAGGELQRLAGSRGAPETKADT
APWLPLERAVPLDSSADWVPKAWRDMDMTMVAAPLGDPHTAVVLGRPGPE
FRPSEVARLGYLAGIVATMLR
379763236YP_005349633.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSQISRDEVAHLARLSRLALTDSELDSFAGQLDAILTHVSQVQAVDVTGV
EATDNPLKDVNVTRPDEPAPCLTQAEALAEAPSAVDGRFAVPQILGDSE
379763235YP_005349632.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MNEIIRSDAATLAARIAAKELSSVEVTQACLDQIEATDDRYHAFLHVAAD
EALGAAAVVDEAVAAGERLPSPLAGVPLALKDVFTTVDMPTTCGSKILEG
WRAPYDATVTSRLRAAGIPILGKTNMDEFAMGSSTENSAYGPTRNPWNVD
RVPGGSGGGSAAALAAFQAPLAIGTDTGGSIRQPAALTATVGVKPTYGTV
SRYGLVACASSLDQGGPCARTVLDTALLHQVIAGHDTRDSTSVDAAVPDV
VGAARAGAAGDLKGVRVGVVKQLRGEGYQPGVLTSFEAAVEQLTALGAEV
SEVDCPHFEYALSAYYLILPSEVSSNLARFDAMRYGLRIGDDGSHSAEEV
MALTRAAGFGPEVKRRIMIGTYALSAGYYDAYYNQAQKVRTLIARDLDEA
YRSVDVVVSPATPTTAFGLGEKVDDPLAMYLFDLCTLPLNLAGHCGMSVP
SGLSPDDDLPVGLQIMAPALADDRLYRVGAAYEAARGPLPAAI
379763234YP_005349631.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MRIGVLTGGGDCPGLNAVIRAVVRTCDSRYGSSVVGFQDGWRGLLENRRV
QLHNDDRNDRLLAKGGTMLGTARVNPDKLRAGLNQVKQTLDDNGIDVLIP
IGGEGTLTAAHWLSEENVPVVGVPKTIDNDIDCTDVTFGHDTALTVATEA
IDRLHSTAESHQRVMLVEVMGRHAGWIALNAGLASGAHMTLIPEQPFDVE
EVCRLVKRRFQRGDSHFICVVAEGAKPIPGSIALREGGIDEFGHEKFTGV
AAQLGAEVEKRINKDVRVTVLGHVQRGGTPTAYDRVLATRFGVNAADAAH
AGEYGQMVSLRGQDIGRVPLADAVRQLKLVPDSRYDDAAAFFG
379763233YP_005349630.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MGHRGRRRAGVGAPAGRARVVGCRARWARRSDGMLNDSATLTTVAHTPV
379763232YP_005349629.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MLGETALDRFDHPETDARLNWRGLIHRVTGIDLGPGKNAAYETELRERIR
ATVGSAFPIAVLNLKGGVGKTAVVEALGSTFAAVRNDRVLALDIDAGDLA
ERHGRHNPHSMADLLRGGPATSYEDIRALTYMNGFGLEVLGLPDYASTDW
RLERRDVLRAFSMLRNQYSVVLVDCVKALNSSVMEAVLPESRALVVVTST
SIDAIRKTHTTLEWLCHNGYQRLMASTVLAVNHVEPAKVEGVAVTELDRL
SARVAATVVLPFDRHVHEGRKIALDRMSKESRRSYLEMAAVLAGMFPGRG
GERARDHH
379763231YP_005349628.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSVAASADLMEYDDVIARFDPVLGLEVHVELSTVTKMFCGCTTAFGAEPN
TQVCPVCLGLPGSLPVLNQTAVESAIRIGLALNCEIVPWCRFARKNYFYP
DMPKNYQISQYDEPIAINGYLEAPLEDGSTWRVEIERAHMEEDTGKLTHI
GSETGRIHGATTSLIDYNRAGVPLIEIVTKPIVGAGDRAPQIARAYVTAL
RDLLRALDVSDVRMDQGSMRCDANVSLKPTGQAEFGTRTETKNVNSLKSV
EVAVRYEMQRQAAVLASGGQITQETRHFHEAGYTSPGRVKETAEDYRYFP
EPDLEPVAPSRELVERLRQTIPELPWLSRKRIQEEWGISDEVMRDLVNAG
AIELVTATIEHGASSEQARAWWGNFLMQKANEANVALDELAITPAQVAAV
VALVDEGKLSTKLARQVVEGVLAGEGEPEEVMSARGLALVRDDSVTQAAV
DEALAANPDVAEKIRGGKVAAAGVIVGAVMKATRGQADAARVRELVLAAC
GQG
379763230YP_005349627.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MRRGFAALCALVLVTSGCARFNDAQSQPFTTAPELKPQPSSTPPPPPPLP
PTPFPKACPAPGVMQGCLESTSGLIMGPDSKTALVAERTTGAVKEISVSA
EPKVKMVIPVDPSGDGGLMDIVLSPTYTQDRLMYAYVSTPTDNRVIRIAD
GDIPKDILTGIPKGATGNTGALIFTSPTTLVVLTGDAGNPAMAADPNSLA
GKVLRIEQPTTVGQAPPTTALSGVGSGGGLCTDPVDGSLYVADRTPTADR
LQRITKTSDVSTVWTWPDKPGVAGCAAMDGTVLVNLINTKLTVAVRLAPT
TGAVTGEPDVVRKDTHAHAWALRMSPDGNVWGATVNKTAGDAEKLDDVVF
PLFPQGGGFPRNNDDKT
379763229YP_005349626.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTSQPNDADWQRPGESPESTPGRPASARLVDPEDDLTPVGYPGDFNPSTG
TTTVIPYGAAAAMAGSGASGYNLLEHQEPLPYVQPHSAARHAAPESTDID
DDEHDDRLHDVGRRGTQHLGLLVLRVGLGVVLGAHGLQKLFGWWGGSGVT
GFRNSLSDVGYQHADILAYVSAGGELVAGVLLVLGLFTPLAAAGALAFLI
NGLLATVSARPHTHTFSYFLPEGHEYQITLIAVAAAVILCGPGRYGLDAR
RGWAHRPFIGSFVALLAGIAAGIGVWVALNGVNPIG
379763228YP_005349625.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MIKLSPIAHLAVGFLALGLLIPVMLWPPSAPLLIIPVVLSAMIVRLRTVA
DDRGVTVRTLLGSQTVRWDDIDGLRFHRGSWARARLKSGAELRLPAVSFS
TLPELTAASAGRVPNPYQ
379763227YP_005349624.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSAPTRRPAPDTPGAADIATDAVKPAAKSANGKPKRIGPEQLTGAQSVIR
SLEELDVDVIFGIPGGAVLPVYDPLFDSKKLRHVLVRHEQGAGHAASGYA
HATGKVGVCMATSGPGATNLVTALADAQMDSIPVVAVTGQVGRTLIGTDA
FQEADISGITMPITKHNFLVRSGNEIPQVLAEAFHIASSGRPGAVLVDIP
KDVLQGQCTFSWPPRIDLPGYKPTVKPHNRQIREAAKLIAAARKPVLYVG
GGVIRGDATEQLAELAELTGIPVVTTLMARGAFPDSHRQHMGMPGMHGTV
AAVAALQRSDLLIALGTRFDDRVTGKLDTFAPEAKVIHADIDPAEIGKNR
HADVPIVGDVKAVIAELVEQLRHDGVPGKIDMTEWWAYLDGVRSTYPLSY
GPQSDGSLGPEYVIEKLGQIAGPDAIYVAGVGQHQMWAAQFISYEKPRTW
LNSGGLGTMGFAIPAAMGAKMARPDAEVWAIDGDGCFQMTNQELATCAIE
GVPIKVALINNGNLGMVRQWQTLFYEERYSQTDLATHSHRIPDFVKLAEA
LGCVGLRCEREEDVADVIEQARAINDRPVVIDFIVGADAQVWPMVAAGTS
NDEIQAARGIRPLFDDESEGHA
379763226YP_005349623.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MLVEDKPGVLARVAALFSRRGFNIESLAVGATEQKDMSRMTIVVSAEETP
LEQITKQLNKLINVIKIVELDDDNSVSRELAMIKVRADAGTRSQVIEAVN
LFRAKVIDVSTEALTIEATGDRGKIEALLRILEPFGIREIVQSGVVSLSR
GPRGIGTAK
379763225YP_005349622.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MFYDDDADLTIIQGRKVGVIGYGSQGHAHSLSLRDSGVQVKVGLKEGSKS
RPKVSEQGLDVDTPAEVAKWADVIMLLAPDTAQADIFKNDIEPNLKPGDA
LFFGHGLNIHFDLIKPPADVTIAMVAPKGPGHLVRRQFVDGKGVPCLIAV
DQDPSGKGEALALSYAKAIGGTRAGVIKTTFKDETETDLFGEQAVLCGGT
EELVKTGFDVMVEAGYPPEMAYFEVLHELKLIVDLMYEGGIARMNYSVSD
TAEFGGYLSGPRVIDAGTKDRMREILRDIQNGDFVKKLVANVEGGNKQLE
QLRKENAEHPIEVTGKKLRDLMSWVDRPITETA
379763224YP_005349621.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTKLAIIYYSATGHGTTMAQRVAAAAESAGADVRLRHVAETQDPASFAHN
PAWTANYEATKDLPVATGDDIVWADAVIFGSPTRFGSPAAQLRAFLDSLG
GLWAQGKLADKVYAGFTSSNTVHGGQETTLLSLYITLMHFGGIIVPPGYT
DACKFVDGNPYGVSLVTTHDNINEFDEPTDKALEHLARRVVETADRLASS
379763223YP_005349620.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MDVTIVGSGPNGLTAAVICARAGLKVQVVEAQPTFGGGARTATDPDSAGV
VHDICSAVHPLALASPFFMEFDLPARGVQLAVPEISYANPLPGRPAAIAY
RDLDRTCAELEGGASFRRLLGPLVERSDDVVALLLGDKRSVPNSVPSAWR
LGVRMLAQGTPAWGSLTGEDARALFTGVAAHIISRMPSLTAAGAGMMLAT
LAHSVGWPIPVGGSQAITDALIADLRAHGGELTAGTEVTSPPGGVVAFDT
APTALLRIYGDSLPRRYAKALRRYTFGPGVAKVDFVLADEIPWADPRLRK
APTLHLGGTRAQMARAEAEIAAGRHAQWPMVLAASPHVADPGRIDSNGRR
PFWSYAHVPSGSTVDPTEAVTAVVERFAPGFRDVVVAARAVPAARLCDHN
ANYVGGDIGMGGNSAWRAIAGPTPRLNPWRTPIPKVYLCSAATPPGGGVH
GMAGYYAARTLLRREFGIGMPKLAP
379763222YP_005349619.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MNLPVVLIADKLAESTVAALGDQVEVRWVDGPDREKLLAAVPEADALLVR
SATTVDAEVLAAAPKLKIVARAGVGLDNVDVDAATERGVLVVNAPTSNIH
SAAEHALALLLSAARQIPAADASLREHTWKRSSFSGTEIFGKTVGVVGLG
RIGQLVAQRLSAFGTHLIAYDPYVSPARAAQLGIELLTLDELLARADFIS
VHLPKTPETAGLIGKDALAKTKPGVVIVNAARGGLVDEAALADAVRSGHV
RAAGLDVFSKEPCTDSPLFELPQVVVTPHLGASTEEAQDRAGTDVAASVK
LALAGEFVPDAVNVGGGVVNEEVAPWLDLVRKLGVLAATLSDGPPVSLSV
QVRGELASEDVEVLKLSALRGLFSAVVEGPVTFVNAPALAEERGITAEIG
TASESPNHRSVVDVRAVAHDGSAVNVAGTLSGPQLVEKIVQINGRNFDLR
ARGINLVINYVDQPGALGKIGTLLGSAGVNIQAAQLSEDAEGPGATILLR
LDRDVPGDVRAEIGAAVGANKLEVVDLS
379763221YP_005349618.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MKLAVIEGDGIGPEVVAEAVKVLDAVLPGVEKTSYDLGARRYHATGELLP
DSAVDELRAHDAILLGAIGDPSVPSGVLERGLLLRLRFELDHHINLRPGR
LYPGVNSPLAGNPDIDFVVVREGTEGPYTGTGGAIRVGTPNEVATEVSQN
TAFGVRRVVADAFERAQRRRKHLTLVHKTNVLTFAGRLWSRIVAEVGRDY
PDVEVAYQHIDAATIFMVTDPGRFDVIVTDNLFGDIITDLSAAVCGGIGL
AASGNIDATRTNPSMFEPVHGSAPDIAGQGIADPTAAIMSVALLLAHLGE
DDAAARVDRAVERHLATRGSERLATREVGERIAAGL
379763220YP_005349617.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MQTTSTRRWVMLGTGLIATLSATVFINGIAFLIPALNDVRGINLAEAALL
SAMPSFGMVVTLIAWGYILDIVGERIVLTAGLALTAAAALIAAAVPESML
TEGIALFGGGMAAASANTASGRLVTGWFPPQQRGLAMGIRQTAQPLGIAL
AALVLPELGERNISVALLFPAAVCAVSAVLCAVWVRDPARPERSTADKAE
LASPYRGTTVLWRIHFASALLMVPQTVVLTFMLVWLMKNQHWSIATAGVL
VSFSQLLSALGRIAVGRWSDRLGSRMRPIRIIAMAAAVVMVLLAIADHAH
SAMAVTLMVAASVITVLDNGLAFTAIPEVAGRFWSGRAMGAQNTTQRLTA
AVGPPVFGEMIDATGYPLAFAVCALFPLLALPVVPSEARSRAAARD
379763219YP_005349616.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAGQAMTSNGTRPAAKFPGGMQAWGMQTDSTDTPEIGAGVRWSIMVVSLL
ATASSFLFINGVAFLIPSLRVRGVRLDEAALLASMPSWGMVVTLVLWGYV
LDRVGERVVMATGSALTAAAAYAAASAHSLVLMSVYLFLGGMAAASCNTA
GGRLVSAWFPPQQRGLAMGIRQTAQPLGIALGAMVIPELAEHGPQHGLRF
AALACAVGAIASVIGIVDPPRKPRASASHQELASPYRKSLTLWRIHAVAG
LMMMPQTVTVTFMLVWLIRNLHWSVTAAGGLVTLSQLLGALGRVAVGRLS
DRVGSRMRPVRYIAAVAVLALLLLAWADYMNSRWQAGLMVVIAVISVLDN
GLEATAITEFAGPYWSGRALGIQNTTQRMMAAAGPPLFGALIAAAKYPPA
WLLCALFPLAAVPLVPTRLLPPGLETRARRQTVRRVRWWRAIRSHAMPNR
PERRLPQRSGENY
379763218YP_005349615.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MRLGRIASPDGVAFVSIEGELDDPAEMIAREIAEHPFGTPNFTGRSWPLA
DVRLLAPILASKVVCVGKNYTDHIAEMKDMTGPAPAEPVIFLKPNTAIIG
PNVPIRLPANASPVHFEGELAVVIGRPCKDVSAAQAADNILGYTIGNDVS
ARDQQKADGQWTRAKGHDTFCPVGPWIVTDLKPLDPGDLELRTEVNGEVK
QHSRTSLLIHDIGSIVEWISAVMTLLPGDIILTGTPAGVGPIEDGDTVSI
TIEGIGTLTNPVLRKGKS
379763217YP_005349614.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MVRTALFNWAYARHTGGTFVFRIEDTDAQRDSEESYLALLDALRWLGLDW
DEGPEVGGPYGPYRQSLRGEIYRDVVAKLVEAGEAYYAFSTPEEVEARHL
AAGRNPKLGYDNFDRQLTDSQRAAFLAEGRQPVVRLRMPDGDLSWDDLVR
GTTTFAAGSVPDFALTRANGDPLYTLVNPCDDALMKITHVLRGEDLLPST
SRQLALYQALIRIGVAERTPQFAHLPTVLGEGTKKLSKRDPQSNLFAHRD
RGFIPEGLLNYLALLGWAIADDHDVFSLDEMVAAFDVVDVNSNPARFDQK
KADALNAEHIRMLTVEDFTARLRDYFGVHGHRLELDDAGFATAADLVQTR
IVVLGDAWDLLKFLNDDEYAIDPKAAAKELGPDSATVLDAALGALDGVAD
WTTPQIEAALKAALIDELGLKPRKAFGPIRVGATGTTVSPPLFESLELLG
RDRSVRRLRAARATIG
379763216YP_005349613.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MGTNQRASIVMSEDEIADFVVKSRTGTLATVGPDGQPHLTAMWYAVVDGE
IWLETKAKSQKAVNLKRDPRVSFLIEDGHTYDTLRGVSFEGVAEIVDDPD
VSHRVGVSVWERYTGPYTEDMKPFVEQMMNKRVCVRIVARRARSWDHRKL
GLAPMPVGGSTAPAVLGNDQ
379763215YP_005349612.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MGVLHSVAQSPCGLAELCERTGLPRATAYRLAAALEVHRLLARDDEGRWR
LGPAVTELAAHVNDPLLAASSAVLPLLRETTGESVQLYRREGTDRVCVAA
LEPAAGLRDTVPVGARLPMTAGSGAKVLLAHSDAATQKAVLATAKFTERT
LAEVRRRGWAQSVAEREPGVASVSAPVRDGRGTVVAAISVSGPIDRIGRR
PGARWAADLLSAADAMARRL
379763214YP_005349611.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MGSDAGAAAKPRTLAEKVWDDHVVVSGGASGQGAPDLIYIDLHLVHEVTS
PQAFDGLRLAGRPVRRPDLTLATEDHNVPTIDIDKPIADPVSRTQVETLR
RNCAEFGVRLYPMGNLEQGIVHVVGPQLGLTQPGMTIVCGDSHTSTHGAF
GALAMGIGTSEVEHVLATQTLPLRPFKTMAVNVDGKLPPGVTAKDIILAL
IAKIGTGGGQGHVIEYRGSAIESLSMEGRMTVCNMSIEAGARAGMVAPDA
TTYEFLCDRPHAPKGAQWDAAMRYWQQLHTDPGAEFDTEVYLDAESLSPF
VTWGTNPGQGVPLAAAVPDPELMADDGERQAAEKALAYMDLRPGTPMRDI
AVDAVFVGSCTNGRIEDLRAVADILRGRKIAPGVRMLVVPGSMRVRAQAE
DEGLGEVFTAAGAEWRQAGCSMCLGMNPDQLAPGERCAATSNRNFEGRQG
KGGRTHLVSPAVAAATAVRGTLSAPADLS
379763213YP_005349610.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSMEAFHTHTGIGVPLRRSNVDTDQIIPAVYLKRVTRTGFEDGLFASWRS
DPSFVLNLSPFDRGSVLVAGPDFGTGSSREHAVWALMDYGFRVVISSRFG
DIFRGNAGKAGLLAAEVSQDGVELLWKLIEQSPGLEITANLQDRNITAGT
TVLPFKIDDHTAWRLLEGLDDIALTLRKLDEIESFEAAYPDWKPRTLSTS
379763212YP_005349609.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MLTQKLNTDRRQATAAVENVVDTIVRAVHKGDSVTITGFGVFEQRRRAAR
VARNPRTGETVKVKPTSVPAFRPGAQFKAVVSGAQRLPSDGPAVKRGVVG
GTGAAKKTAAKKAPAKKAAAKKAPAKKAAAKKAPAKKAAVKKAPAKKAAV
KKAPARKAATKAPAKKTAAKKAPARKAATKAPAKKAASKSTARKAPAKKT
TARRGRR
379763211YP_005349608.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MPPSSSSSARRSGSRIVHAAGAVLWRPGDADTADHDVEIAVIHRPRYDDW
SLPKGKVDPGETAPVAAVREVYEETGQHAVLGRRLNAVSYPIDAGVKKVS
YWSARAVGGEFVPGDEVDRLLWLPAAEAMRKLDYAQDRKVLRHFNKKPAD
TQTVLVVRHATAGRKSRFSGDDTKRPLDKRGRAQAKALVPQLLAFGASRV
YAADRVRCHQTVEPLAEELGSTVHNEPTLTEEAYAKNAKRGRHRMLDIAG
EHGTPVVCTQGKVIPDLIAWWCARDGVRPDKSRNHKGSTWVLSLSGGRLV
AADHLGGALAANVRA
379763210YP_005349607.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MMSDDRRVTEIEAEARPDENLWHSGDSAVAAPPAATPTAMTDLPDERYLN
RELSWLDFNARVLALADDNSLPLLERAKFLAIFASNLDEFYMVRVAGLKR
RDEMGLSVRSADGLTPRKQLALIGEQTQRIATRHARVFLDSVRPALAEEG
IHIVTWADLDQAERDELSAYFTEQVFPVLTPLAVDPAHPFPFVSGLSLNL
AVMVRQPEDGGQHFARVKVPNNVDRFVELAAPRSGRDSAAGEARSIVRYL
PLEELIAAFLPLLFPGMEIVEHHAFRITRNADMEVEEDRDEDLLQALERE
LARRRFGPPVRLEIADDMTEGMLELLLRELDVHPGDVIEVPGLLDLSSLW
QIYDLDRPALKDPAFVPDTHPAFADRESPKSIFATLREGDVLVHHPYDSF
STSVQRFIQQAAADPNVLAIKQTLYRTSGDSPIVRALIEAAEAGKQAVAL
VEIKARFDEQANIRWARALEQAGVHVVYGLVGLKTHCKTCLVVRREGSAI
RRYCHIGTGNYNSKTARLYEDVGLLTAAPDIGADLTDLFNSLTGYSRKVS
YRNLLVAPHGIRTGIIERVEREIAAHRERGDGRIRLKMNALVDEQVIDAL
YRASQAGVRVEVVVRGICALRPGAQGYSENIVVRSILGRFLEHSRIIHFR
NINEFWIGSADMMHRNLDRRVEVLAQVKDPKLTAQLDELFESALDPSTRC
WELGSDGQWTASPQEGHTVRDHQVSLMERHRSP
379763209YP_005349606.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MLPVVIASAAVAGRHYRPSPGAARTGIIRRWADVRFPDIDRS
379763208YP_005349605.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSGIRADGAGDVALIIAVKRLAAAKTRLAPVFSARTRESVVLAMLMDTLT
AAGRVESLGSITVITPDDAAAAAAAELGADVLVDPTPEGHPDPLNNAIAT
AARAVATSFSNVVALQGDLPALQTQELAEAVAAARQHRRSFVADRLATGT
AALFAFGGPLDPRFGSDSSARHRSSGAIELTGAWPGLRCDVDTPTDLAAA
RRLGVGAATARAIAAH
379763207YP_005349604.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTSTHAGSTGAVTVMGAGAWGTALAKVLVEAGGPETQVTLWARRPELAER
INATRSNPDYLPGTSLPPGIRATADAAEALQNASTVLLGVPAQTMRSNLE
RWTPLLREGATLVSLAKGIELGTLMRMSQVIVAVTGVDPAHVAVISGPNL
ASEIAGCQPAATVVASGDSGRAVALQRMLNSGYFRPYTNSDVVGTEIGGA
CKNVIALACGMAAGVGLGENTAAAIITRGLAEIMRLGIALGAKGATLAGL
AGVGDLVATCSSPHSRNRSFGERLGRGATVESILSGTPDGGDGHVVEGVT
SCESVLALAASYDVEMPLTDAVHRVCHKGLSVDEAMALLLGRRTKPE
379763206YP_005349603.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MNASDRSTPHPGSGGGERARVAVVFGGRSNEHAISCVSAGSILRNLDPER
FEVVAIGITPEGSWVLTDGDPAALAITDRRLPEVTAESGTELALPADPRR
GGQLVALPPGAGEVLASVDVVFPVLHGPYGEDGTIQGLLELAGVPYVGAG
VLASAAGMDKEFTKKLFAAEGLPVGDYAVLRPSRARLRPEECQRLGLPVF
VKPARGGSSIGVSRVASWDQLDAAVAAARRHDPKVIVEAAIVGRELECGV
LEMPDGTVEASALGEIRVAGVRGREDSFYDFATKYLDDAAELDVPAKVDD
EIADTVRQLAVRAFKAIDCQGLARVDFFLTEDGPVLNEINTMPGFTTISM
YPRMWAASGVDYPTLLATMVETALARGVGLR
379763205YP_005349602.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MMWGQEVRAVATESDADGGPPRAVIIVAVALAVTTIGVILAIAATREAPP
QPVAVAGVPAPQADSPACRALMDALPQRLGDYQRAALEQPEPVGAAAWRS
GRGADPVVLRCGLDRPGEFVVGSPIQVVDRVQWFQVRSDQQSAGDAGRST
WYAVDRGVYVALTLPTGSGPAPIQRLSEVIAQRIPAGPISPGPAR
379763204YP_005349601.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MGGVRDESTLRQLGEFAVIDRLVAGRRQPAAVVLGPGDDAALVAAGDGRT
VVSTDMLVQDRHFRLDWSTPHDIGRKAIAQNAADIEAMGARPTAFVVAFG
APGETPAAAVDALVDGMWDEAQRVGAGIAGGDLVSCPQWVISVTVLGDLG
GREPVRRSGATPGSLVAVAGDLGRSAAGFALWHNDIGGFDELRRRHVVPE
PPYGQGAAAAAGGAQAMIDVSDGLIADLRHVADASGVGVDLSTAALAADR
DALAAAAAAAGADPWPWVLGGGEDHALVACFAGPAPAGWRIIGRVLDGPA
RVLVDDQEWSGHAGWQSY
379763203YP_005349600.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTARPLSELVEPGWANALQPVAGQVAQMGQFLRDEIAAGRRYLPAGPNVL
RAFTYPFDQVRVLIVGQDPYPTPGHAVGLSFSVAPEVRPLPRSLANIFQE
YTTDLGHPPPSCGDLTPWAQRGVLLLNRVLTVRPSNPASHRGKGWETVTE
CAIRALTARSLPLVAILWGRDASTLKPILAQGNCVAIESPHPSPLSASRG
FFGSRPFSRANELLAGMGADAIDWRLP
379763202YP_005349599.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAAALNEMTALRANRRGGPEQLVIERAPVPVAAAGEALVAVHAAAITFDE
LTWEETWTRDGVSRTPVIPSHEVSGVVSAVADDVTDFVPGDEVYGLIAFD
RDGAAADFVAVPAADLAAKPSTVSHVVAAALPLAGLTALQALVDHAAVQP
KESVLVHGGAGGVGLLTVQLAALLGARVTATVRSDTANLLRGCGAQRVID
TRTEAFDEAGAAYDVVVDTVGGQTLERSYGVLRRGGRLVTLSAPPPDGRA
DEFGVSATFFIVTPNRDQLAELAALVDSDRLHVAIAQTFPLDEGREAFES
RERGGRAGKTVLVVRD
379763201YP_005349598.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MARWLITGCSTGFGREIARAALEAGHSVVVTARRAEAVQDLADEFGDRAL
AVALDVTDTGQVAAAVAAADEAFGGIDVLVNNAGHGYLSAVEEGEDAEVR
KLFDVNYFGAVDMIKAVLPAMRARGSGHIINISSMTGLVANPPNAYYSST
KFALEAVTEALATEVRPLGIKVTAVEPGAFRTDWATRSMKESGAPITDYA
DVAARKDLIKQFADHLPGDPRKVAEAVLMLAKLDDPPLRLLLGRDVLKAM
RDKIAALSASIDEWEAVTKDVNFPAS
379763200YP_005349597.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MPEDPVATASQHEQELAALELIEHPTVKAAYRTVAETWLGRAKASDAMRE
RFDGAFAEVMFSAAMWSSNQDKLRPKVSCITRLAHPVNGRRIPGSRWGID
NPDSVYRVIPISGDERYEIHGRVGEHRMTENYFTLWDANMGTVDVLNGRT
MRVDSDGSFTITVDSEPANGRPNHVRSTPAAHEFYIRDVLLDWGRDDPNH
LEVQRLGAPASTPARTLDEQAEATAAMMDYFANFTGKLSHGVYKMPANQF
NLAWSADKIGAMRNQVYVMGRFDLGPDEAFVVDLNDGGAEYFTVPLSNVW
GTTLELVDRTGSLNKAQSVPNQDGAYTYVISPVDPGVANWIDSDGLREAI
LTLRMAEFGENGPREDLGARGRVVKLDRLDAEVPHLARVSPQQRAAQLAE
RRKGYLRRLPEGTI
379763199YP_005349596.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MPSPSVFEPAAVLADAQRKEGLTDWGPGEFEEPLTVLLRDYARADLNAIG
AHILRSGIVHSLRMRLRTQEWIRRHPEILDERVAAPIVVVGMMRSGTTLL
QRLLAADPRFVCAYGWEVVEVAPRLNRPFTGVDPRIAISQAREAKSRELA
PELFSIHPMYATEAEEEIVFLADAFLSHVPESGAHLPHYRTWLDDQDFSP
AYGYLHRMLQFLQWQKSQRGLAGQRWVLKSPAHLGYLGLLRAQFPDLHVV
HMHRHPRTTIASGASLNATLHAMHADVVDAHRVGAQWLARMGWTNDRAMT
TRDGWSDDGERVTDIGFDDAVADPIGQVARVYDAIGLPLTAEAEDAMRRW
LRERPREAARPPYGLENYGLLPEQVDERFTLYNKRFARYIGGTAHA
379763198YP_005349595.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSDSATEITNLIYTYAQLLDGGDLDGVARLFEHGRICGVEDGPPETVFAG
SARVREMYEMATRIYEDGTPKTKHNTTNVQLYIDEAQGTATSTSYYCVTQ
ATPDLPLQVIVTGHYKDTFHRVDGAWCFDSRTMFVDQVGDVSHHLKF
379763197YP_005349594.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTLPWTPSRLGNLTGKRVIVTGATNGVGLGTSRALAHAGAHVILAVRNTE
LGEQRAAEISANGGGATSVLKLDLADLSSVRAFAGLIDEPVDILINNAGA
LTDRRTETVDGFEMTLGTNLLGPFALTNLLLPKVRSQIINVGSDAHRSAT
LHLDDLHLRRHKWTRLGAYAQSKLAVMLWGLELDRRLRAAASPLVTQLTH
PGWVASNLSNLGDSPLMSLAHKGVKAVADRLANDIDEGAAPTLYCISEPI
PPGSYVGVSGRFGLRGGPVLIGRTQLACDYDTAARLVAFAERETGTKLEI
379763196YP_005349593.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MGEFDNVVAVVTGAARGQGRSHAVALAEQGADIIAVDICADLEAIPYALG
TEAELAETVQLVGSAGRKAVPVIADVRDLAGLRAGVQAGIDELGEVDVVI
ANAGVVAIGVTEPDAEPVFNTIVDTNLKGVWHTMLATVPSIVRKGVGGSV
VLVSSSQGLTGRGGDGSAAMFAYAASKHGVVGLMRSAANAYAPHKIRVNS
VHPSGVATPMILNDFVVNRMTENPNPAVSQMLLPGVPLVEARDVTEAVLW
LAGPRSRYVTGVSIPVDAGHVVM
379763195YP_005349592.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MCDICGKGPGFGKSVSHSHRRTSRRWDPNVQTVHVARPGGNKQRLNVCTS
CIKAGKVVRG
379763194YP_005349591.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MRGVVARAENAAGPADVESGRGSPAGVRRLVLRLRRVAAAYLVVAALGSV
AIGSTSVNCPTAVGGQDGIGQGGPGPRASGPAPADATWWWQPRPPRPAVQ
EAAAVRGGIQLRQVAFDGRGVWPDGPDAIRGYLEEALTRVGVTEASARGH
WIEGMMTIADHESQFHSGAINLSDSNAYGPSQLDGGPLHATRGPWQVMPD
TFAAFHQPGTSNSAWDPVAAACASMNYQMSRYGVSRDGSNQRALVGQANP
GIRQGY
379763193YP_005349590.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MGQLGTADTSQLRLLDAMTLRDWAHTAVSDLITHIDEINRLNVFPVADSD
TGANMLFTMRSALAELNAQGGSGCAARAAAALSAGALNGARGNSGVILSQ
ILRGLADVTATAASDAGGDLPHIDAVVLGDALQRGVELVITSMGGEEVPG
TIVSVLRAAATAVQQCARAGDGLAPAVIAAGDAAVVALEKTPEQLDVLAD
AGAVDAGGRGLLVLLDALRTTITGQAPARAVYELAPRAQRTEAPAPRPAP
QFEVMYRLDGCEPAAADALRDRLEDLGDSVGIASAPSSAQRTYSVHVHTD
DAGAAVEAGLTAGRLSRIVISALSSGAPGLPAGGWTRERAVLAVVDGDGA
AELFAGEGASVLQRDPAAHDPTTNISAHQLMRAVVDTGAAQVMVLPNGYV
AAEELVAGCTAAIGWGIDVVPIPTGSMVQGLAALAVHETGRQAVDDGYTM
ARAAGAARHGSVRIATESALTWAGRCHPGDGLGIAGDEVLIVAADAVGAA
IGLLDLLLASGGDLVTVLLGAGIETDGDVGAVGDILEEHMHDHHPGTELV
TYRTGHHGDALLIGVE
379763192YP_005349589.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MVSLSDRLDYAVGGKVVELLDEVFGIRTVNDLLRHYPRSYTEGASRWDAD
DERPPAGEHITIVDTITDTETFPMKKTPKKVCHRITLGSGRNKVTATFFN
ANYIKKDLTTGTKVMLSGEVGFFRNVMQLTHPAFLLLDTPDGKNRGTVSL
KSIANASHATTGEDIADAYQRHFFPIYAASAKLQSWTIFATVRQVLDVLD
PVPDPLPEDLRAKFGLVSEDQALRDIHLAESEPRRQQARERLTFDEAVGL
QWALVARRHGELSESGPPAPPRSDGLAAELLGRLPFELTAGQRDVLGVLS
EGLASNRPLNRLLQGEVGSGKTIVSVLAMLQMVDAGYQCALLAPTEVLAA
QHLRSIRDVLGPLAMAGQLGGADRATRVALLSGSMTAAQKKQIRSEIAGG
EVGIVVGTHALLQDAVEFDNLGMVVVDEQHRFGVEQRDQLRAKARPGVTP
HLLVMTATPIPRTVALTVYGDLETSTLRELPRGRQPITSNVIFVKDKPTW
LGRAWQRISEEVAAGRQAYVVAPRIDEDDDPGAQEQNAKAPETAEGLYAR
LRSGELAHLRLGLMHGRLSGDEKDAVMAAFRAGEIDVLVCTTVIEVGVDV
PNATVMLVMDADRFGISQLHQLRGRIGRGRHPSLCLFASWSAPDSPAGRR
LRAVAGTLDGFALADLDLKERREGDVLGRNQSGRAITLRLLSLADHLEYI
EAAREFCVRTYSEDPSDPGLAVLAARFTDTDRIEYLDKS
379763191YP_005349588.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MNRKVLLWLAAAAALAVVVAYQTVGTSASRHSAEYAARADVPTVLPGVDV
LAGIAVVPVRLHRYDYLRAAFGDAWDDDNDAPLGHNGCDTRDDILNRDLV
DKTYVSIKRCPDAVATGTLHDPYTNKTIAFARGPKVGESVQIDHIVPLAY
AWDMGAYGWPAPERLRFANDPANLLAVDGPANQDKGDSPPGQWMPPNGAF
ACQYAMQFIAVLRGYALPVDAASTGVLRQAAASCPAG
379763190YP_005349587.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MPALGLGVAELSDDETERAVSAALEIGCRLIDTAAAYGNEAAVGRAIAAS
GIPRAELFVTTKLATSDQGFKGAMDACTASLERLGLDYVDLYLIHWPAPS
LGNYVNSFGGMIQSRGDGQARSIGVSNFTEEHLTTVIDLTFVTPAVNQIE
LHPLLNQEALRKTNAEHNVVTQSYTPLALGKLIDNPTVSSIAGEYGKTAS
QVLLRWNLQLGNAVVFRSAKEEHIATNMDVFDFELAAEHMDAINGLNDGT
RLRPDPDTYEGS
379763189YP_005349586.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MVRDCAPSRVPPSREKINGVRRRVRGAAFEIEHVEVARNP
379763188YP_005349585.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MHTAAQRASVPLASRIQGAVTSAGVKVIPWIPTAVRRGLVRGRSVIIDGN
TLDPTLQLMLSGLRAVGIDGLVVGDDPAASRAQMHDSTVGFPGPQIHVEV
TELSLPGPAGDIGARHYRPADGAAAPLLVFYHGGGWSIGDLDTHDALCRL
TCRDAGVHVLSIDYRLAPEHPAPAAIEDAYAAFTWAYEHAGELGAAPGRI
AVGGDSAGGNLAAVVSQLARDEGGPAPVLQWLIYPRTDFTAKTRSLSLFS
RGFLLTKRDIDWFESQYLRRSELDRTDPRVSPALAESLAGLAPALIAVAG
FDPLRDEGEAYAEALRAAGTAVDLRYLGSLTHGFANMFQLGGDSMVATSE
LISALRAHLSRV
379763187YP_005349584.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MKSASGGRSGRLVQIGGTAFVVIFAVVLVFYIVTSNHKKPAATGAGDTVR
VTSSKLVTQPGTNNPKAVVTFYEDFLCPACGNFERTFGPTVSRLIDVGAI
AADYSMVSILDSSRNHNYSSRAANAARCVADESLDAFRRFHTALFTTDIQ
PSETGKSFPDNARLIELAREAGAAGKVPDCINSGKYLDKVTGEAAAAQIK
ATPTIKINGEDYDPSTPDALVSKIKEIVGNIPGIDGAVAPAAM
379763186YP_005349583.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTGAVSTESADPSADPTPAPVPAPSAWWLLIAGAIGLVASMTLTVEKIDI
LLDPSYVPSCNINPILSCGSVMMTPQASLLGFPNPLLGLVAFTVVIVTGL
LALTKVVLPQWYWLGLTAGVLAGAMFVHWLIFQSLYRIGALCPYCMVVWA
VTMSLLVVVASIAYRPALQARQAGPAWVVYQWRWSIAALWFTAVFLLCMA
RFWDYWSTLL
379763185YP_005349582.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTRIIGGVAGGRRIAVPPRGTRPTTDRVRESLFNILTARRELRGLAVLDL
YAGSGALGLEALSRGAASALFVESDPRTASVIARNIDTLGLPGATLRRGA
VAAVLSAGTASPVDLVLADPPYDVAAAEVEAVLAALIAHGWVREGAVAVV
ERAAGGAPLRWPAGWSVWPQRVYGDTRLELAERV
379763184YP_005349581.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTLGHIDVFERASAQFDEVVVAILTNPAKKGMFDLDERIAMINESTTHLP
NLRVEAGQGLVVDFVRSRGMTAIVKGLRTGTDFEYELQMAQMNKHVAGVD
TFFVATAPRYSFVSSSLAKEVAMLGGDVSELLPEAVNRRLREKRAGRS
379763183YP_005349580.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTSATARTPLFFGSDLQDTFRRGVIDPFRSLGVALRARSHRVPAQRPATP
HRCRLVNDVAAQRLRRQTVSLRTDRHAFRASDG
379763182YP_005349579.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTVDNLFDVPEAATNLIALLADEGVAHFFINPGTDSAPIQEALAAARAAG
TPSPRAVLCVHESVALAAAIGHHMASGRPQAVMVHVDAGTLNLGCQLHNA
QRNGTPVVMFAGRTPYSSAPEVRGHRDAYIHWQQEQLDQPAVVRNYAKWH
MEVPRGRELAPIVRRAFQVAQSSPSGPAYVMLPREALMEPGSRVLPRRLP
PAIPPGPDPGALGRLAGILVAGQRVVIVACRTAAEPGAAVVLARIAELLG
APVIDQGDRANLPFGHPLHVVGDAGPLETADTVLLLDSEVPWVPAQLAPP
ADAHVVQIDADPVKAGMPLWSYPVEIALTADTRVTLVLLEQTLLRLATDE
LREKWSARRRAAESDVAQRRREAARRAASDRPADAPDAMLAALGAALPHD
AVVVQEAVTNRPAVARQVQRPPGQFFDTGAPALGWALGGAFGVKLARPQA
PVVAICGDGSFNFGVPTAALWSAHRHDAPFVTVVLNNHSYLASKLPVMEL
YRPGISMRENDFPETRLTPDTDYAALARACGGSGRSVTTPAEMREAIGWA
LAEADEGRCTVLDVQLPQP
379763181YP_005349578.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MMTVLSAIGHALTLAGSMTWEILWALIVGFTLSAVVQAVVRRSTIVALMG
DDRPRTLAVSAGLGAASSSCSYAAVALARSLFRKGADFTAAMAFEIGSTN
LVAELGIILALLMGWQFTAAEFVGGPLMIVVLAALFRLFVRSRLVDAARE
QAEKGIAGSMEGHAAMDMSVKGEGSFWRRLFSPAGFTSVSHVFVMEWLAI
LRDLILGLLIAGAVAAWVPEKFWQSFFLVDHPVWSALWGPLVGPVVAIVS
FVCSIGNVPLAAVLWNGGISFGGVIAFIYADLLILPILNIYRKYYGTKMM
LTLLGTFYAAMVVAGYLVELIFGTTHLIPAQRNATVLEASISWNYTTLLN
IAFGVLAIVLVARFITSGGLPMLRMMGGSPDADRSGHAH
379763180YP_005349577.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MYRVFEALDELSAIVEEARGVPMTAGCVVPRGDVLELIDDIKDAIPGELD
DAQDVLDARDSMLQDAKTHSESMVESATTESESMLNHARAEADRLLSDAK
AQADRMVSEARQHSERMVGEAREESMRIATAAKRDYEASVGRAQAEADRL
LENGNISYEKAVQEGIKEQQRLVSQNSVVEAANAEATRLIDSAHAEADRL
RGECDIYVDNKLAEFEEFLNGTLRSVGRGRHQLRTAAGTHDYAVR
379763179YP_005349576.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTFDITRLGRRPGAMVTVRNTVPTPARIGLDMIAIEAGAPLELDLQVQSV
SEGVLVTGTVTAPTAGECARCLTPLDGTVQVRLTELFAYPDSTTEATTEE
DEVGHIVDDTIDLEQSIVDAVGLELPFSPVCTPDCPGLCPECGVPLAAEP
GHQHDRIDPRWVKLAGMFDPEADESRGER
379763178YP_005349575.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSSRQALLDALGVELPDELLSLALTHRSYAYEHGGLPTNERLEFLGDAVL
GLTITDELYHRHPDRSEGDLAKLRASVVNTQALADVGRKLCEGGLGVHLL
LGRGEANTGGADKSSILADGMESLLGAIYLEQGIDVAREVILRLFGPLLD
AAPTLGAGLDWKTSLQELTAARSMGAPSYVVTSTGPDHDKEFTAVVVVAD
TEYGSGVGRSKKEAEQKAAAATWKALEALDTVPGS
379763177YP_005349574.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MPELPEVEVVRRGLHAHVVGKTITAVRVHHPRAVRRHEAGAADLTARLLN
DRITGTDRRGKYLWLLLDSDAALVVHLGMSGQMLLGAVPRADHVRISALL
DDGTVLSFADQRTFGGWMLADLVEVDGSVVPEPVAHLARDPLDPRFDADA
VVKVLRRKHSEIKRQLLDQQVVSGIGNIYADEALWRAKVHGARIADALTR
KQLTAVLDAAADVMRDALAKGGTSFDSLYVNVNGESGYFDRSLDAYGREG
QGCRRCGAVMRREKFMNRSSFYCPKCQPRPRV
379763176YP_005349573.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MATVVAFHAHPDDEVVLTGGTLARASAAGHRVVVVTATDGRVHNEDGNRL
GELRSSASILGAQRVECLGYADSGYGPLFYPDPPGRTRFGRADLDEAAGR
LAAILRDERADLLLSYQPNGGYGHRDHVQVHHVGKRAAELAAIPRVLEVT
MPREMLLRVSDLAHLLRLPGPYERDIVRGAYAPRATITHRVNVFRFARQK
RDAFAAHRSQIGSSGLGARLFGLLMRLPPQVFGALFSHEWFVDPALPTGT
LRRDIFE
379763175YP_005349572.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAELWVERTGTRRYTGYSSRGAQVLVGSEDVDGVFTPGELLKIALAACSG
MSSDMPLARRLGDDYKAVIRVSGAADREQERYPLLEETLELDLSGLAEDE
KERLRVVVNRAIDQVCTVGRTLQSGTAVNFEVSDVGS
379763174YP_005349571.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSDPDARLTAWVHGNVQGVGFRWWTRCRALELGLTGYAANQADGRVLVVA
QGPREAGEKLLELLRGGASWPAQPGRVDKVVADWSQPQERFEGFVER
379763173YP_005349570.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MYLKSLTLKGFKSFASPTTLRFEPGITAVVGPNGSGKSNVVDALAWVMGE
QGAKTLRGGKMEDVIFAGTSSRAPLGRAEVTVTIDNSDNALPIEYSEVSI
TRRMFRDGASEYEINGSSCRLMDVQELLSDSGIGREMHVIVGQGKLDEIL
QSRPEDRRAFIEEAAGVLKHRKRKEKALRKLDAMSANLARLTDLTTELRR
QLKPLGRQAEVARRAQTIQADLRDARLRLAADDLVNRKGEREAIFEAEAA
MRREHDEASARLAVASEELTAHETAVGELSGRAESVQHTWFALSALAERV
AATVRIASERAQHLDVEPVAAGDTDPDALEAEAEQVAIAEQRLLAELAAA
RTRLDGARAELAEREREAAEADRAHMAAVRAEADRREGLARLAGQVETMR
ARVESIDDSVARLSERIEAAAARAQQAKAEFETVQGRVGELDQGEMGLDE
HHERTVAALRLADARVAELQSAERDAERQVASLRARIDALAVGLERKDGA
AWLTQNHSGTGLLGPMAKLVKVRSGYEAALAAVLGSAADALAAESFGAAR
SAVAALKQADGGRAALVLGDWPADHPAPQAAPAGALWALDLIDAPERLRG
AITAMLSGVAVVDDLDRALALVAEHPRLRAVTLDGDLVGAGWVSGGSDRK
LSTLEVTSEIDKAGDELTAAEAQVAQLSAALSGALTEQAARQDSAEQALA
ALNESDSAISGMYEQLGRLGQEARTSEDEWSRLLRQREELEAGRTQTVAE
VTELETRLRNAQETQQAPAEEPVDRQQIAAATENARSVEVEARLAVRTAE
ERANAVRGRADSLRRAAAAEREARVRAQQAREARLRAAAVAAAVADSGRL
LAQRLNGVVDSASKIRDALAAERQQRATAMAAVRDEVNALGARVAALTDS
LHRDEVANAQAALRIEQLEQMVLEQFGMAPEDLIAEYGPQNELPPTDLEM
AEYEQAKERGEQVFAPAPIPYDRATQERRAKRAERELAELGRVNPLALEE
FAALEERYNFLSTQLEDVKAARKDLLGVVDEVDARILQVFSEAYADVERE
FTEVFTVLFPGGEGRLRLTDPGDMLTTGIEVEARPPGKKVTRLSLLSGGE
KALTAVAMLVAIFRARPSPFYIMDEVEAALDDTNLRRLISLFELLRARSQ
LIIITHQKPTMEVADALYGVTMQGDGITAVISQRMRGQQVEQLVTT
379763172YP_005349569.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSQGLWIALAVLIALVVLVALVLGLLRYRRRRISFSTRAEPGAIDRSGGY
TASSGITFSQTPTVVPPERLDTTGLPGVGDDATIPRDAPRRTISDVDLPE
PETVAPPPIPAAPPEPETPAPETPAPETPAAPEIEEIAPPEGRLERLRGR
LARSQSAFGRSMLGLIGGGDLDEDAWQDVEDTLLVADLGPVVAESVIAQL
RARLAGSDVRTEADAKAVLRDVLIKELQPGMDRSIRALPHADHPSVLLVV
GVNGTGKTTTVGKLARVLVADGRRVVLGAADTFRAAAADQLQTWASRVGA
EVVRGAEGADPASVAFDAVDKGIAAGVDVVLIDTAGRLHTKVGLMDELDK
VKRVVTRRAAVDEVLLVLDATIGQNGLAQARVFAEVVEITGAVLTKLDGT
AKGGIVFRVQQELGVPVKLVGLGEGPDDLAPFEPAAFVDALLG
379763171YP_005349568.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MLGQPNTGDTAWMLASSALVLLMTPGLAFFYGGMVRARSVLNMLMMSISA
MGVVTVLWVLYGYSIAFGDDVGNFMGKPTSYWGLKGLIGVNAVAADPSKG
TAATDIPLAGTLPATVFVAFQLMFAIITVALISGAVSDRLKFGAWLVFAG
LWATFVYFPVAHWVFAFDGFASEHGGWIANKLHAIDFAGGTAVHINSGVA
GLMLAIVLGKRRGWPTTLFRPHNLPFVMLGAGLLWFGWYGFNAGSATSSN
GVAGTTFVTTTVATATAMLGWMLTERIRDGKATTLGAASGIVAGLVAITP
SCSSVNVLGALVVGLVAGVLCALAVGLKFKLGFDDSLDVVGVHLVGGLAG
TLLVGLLAAPESPAINGVVGVSKGLFYGGGWAQLERQAIGAFSVLAYSGV
VTLILALILKYTIGLRLNPEAEATGIDEAEHAESGYDFAVATGSVLPPRV
AVADTRNGVKEDRVGDKVEAEQS
379763170YP_005349567.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MKLITAIVKPFTLDDVKTSLEDAGVLGMTVSEIQGYGRQKGHTEVYRGAE
YSVDFVPKVRIEVVVDDSIVDKVVDSIVRAARTGKIGDGKVWVSPVETIV
RVRTGERGTDAL
379763169YP_005349566.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAASRRQLLSEGSKLHAAELRHAWLDLHESWLMAKAAEIGIDDDSGFAIV
GIGGLGRHELLPYSDLDLMLLHDNKSDDVLGKVADGLWYPLWDANVRLDH
SVRTVSGALGVANADMIAALGMLDARHIAGDARLSEELIAGARRQWRSAI
RSRMDELVAMTQARWERCGRIAQRAEPDLKSGRGALRDVQLLDALGVAQL
IDRHGMARPESPGGSLDDAHLTLLDVRTELHRVSGRGRDQLLAQYGDELS
AALHIGDRFDLARKLSDAGRTIAYHAETGLRTAENALPRRGVSALVRRPK
RRPLDEGVVEYGGEIVLARDARPDTDVGLVLRVAAASADTGLPIGAATLS
RLAAGAPEMPVPWPREALDDLLVVLSAGPTTVATIEALDRTGLWGRLLPE
WDAIRDLPPRDVAHKWTVDRHVIETAVNAAPLATRVARPDLLALGALLHD
IGKGRGVDHSVLGAGLALDIGPRLGISPADSETLAQLVRHHLLLPVVATR
SDLNDPKTIERVSKSLGGDPLLLEVLHALTEADSKATGPGVWSEWKASLI
EELVRRCRLVMAGEPLPEAEPTAPQYLSLAAQRAVHVEIKPSGGERLDVV
MAAPDQRGLVSKAAAVLALNSLRIHSASASTDAGFAVVEFVVSPLFGSPP
EAGLLRQQFTGALAGDVDVLGTLEKRDSDAAGAASTRAGEVQVGVPVTRS
TAPPRILWVDTATAGQLIVEVRAMDRLGLLAMLTRALERAGTDIVWAKVN
TFGSTAADVFCVTAASGGQAGRDAVEQSLLAALGGPAVEVLEEPVGD
379763168YP_005349565.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MDYVIHYVESLTRSVTFYRDVIGLQVRIEGDGYVEFETANTKFSLFERSK
LPQLIGREGGDPPCGEIGFLVDDVDSEAERLRHLGVEILTGPVDRPWRER
TLHIADPDGHVIEFAQKLR
379763167YP_005349564.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTEQKVIEQWLEGCAVQRIMFRDGLVLNFEDYNELVITAPMRLTLPAIET
SPAEVIAIDPNHPAGQLRPLFDFAGSSCTSAVWSDTGDLHLEFSDDHKID
VPCNDNAIAWELYSKHHGYAACLAHGELRVVRLDTARADGDR
379763166YP_005349563.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSMPASSIQARTDTDHGDHSGTAVLRGWQRRALVKYLAGQPRDFLAVATP
GSGKTTFALRVAAELLGQRAVEQVTVVVPTEHLKVQWAQAAARHGIALDP
RFSNANPRIAPEYHGVMVTYAQVAAHPTLHRVRTEQRKTLVVFDEIHHGG
DAKTWGDAIREAFDDATRRLALTGTPFRSDDSPIPFVTYEAGPDGIRRSQ
ADHTYGYTDALADGVVRPVVFLAYSGEARWRDSAGEEHAARLGEPLSAEQ
TARAWRTALDPAGEWMPAVITAADLRLRQLRTHVPDAGGMIIASDQTAAR
AYATLLTKLTGEAPTLVLSDDPGSSARISEFAASTSRWLVAVRMVSEGVD
VPRLSVGIYATSASTPLFFAQAIGRFVRSRRPGEIASIFVPSVPNLLQLA
SELEAQRNHVLGEPHRESEGDPLDGDPATKTQDEKSDLDKGFTSLGADAE
LDQLIFDGSSFGTAAPAGSDEEADYLGIPGLLDAEQMRALLHQRQDEQLQ
RRARLHQETGSPGAVESPSATVHGQLRELRRELNALVSIAHHRTGKPHGW
IHNELRRRCGGPPIAAASREQLRARIDAVRRLNAETS
379763165YP_005349562.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MLELIDKGSCTAEHPVPLLFVHGGWHGAWCWEHFQDFFADAGYRTVAVSL
RGHGTSPTAKPLRKVSIADYIEDVRSVADDLGGAPILIGHSLGGFVIQRY
LEERSAPAAVLVGSVPPQGVLKMALRVWRRRPSMTMEAWNDPTLLKFLAT
PALAREYLFCADTPEDIVEACRQQAGAESVRAAMTDPMVRRVRTRRVTTP
ILVLGAEHDGFVSPGDVRATARAYGTEPEFFSMGHNMMLEPGWADVAERI
RDWLQTHEAVTHAR
379763164YP_005349561.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MFESLSDRLTGALAGLRGKGRLTDADIEATTREIRLALLEADVSLPVVRA
FVTRIKDRAKGAEVSGALNPAQQVVKIVNEELIGILGGQTRQLAFAKTPP
TVVMLAGLQGSGKTSLAGKLAAWLRGQGHTPLLVACDLQRPAAVNQLQVV
GERAGVPVFAPHPGESPGSGPGDPVAVAAAGIAEANAKHFDVVIVDTAGR
LGIDDELMAQAAAIRDAIDPDEVLFVLDAMIGQDAVTTAEAFREGVGFTG
VVLTKLDGDARGGAALSVREVTGVPILFASTGEKLEDFDVFHPDRMSSRI
LGMGDVLSLIEQAEQVFDAEQAEAAAVKIGTGELTLEDFLEQMLAIRKMG
PIGNLLGMLPGAGQMKDALAQVDDRQLDRLQAIIRGMTPAERADPKIINA
SRRLRIANGSGVTVSEVNQLVDRFFEARKMMSSMLGGMGIPGMGRKSATR
KSKGAKGKAGKKAKKGGRGPTPPKARNPLAAGMPAGFPDLSQMPEGLNEL
PPGLADFDLSKLKFPGKS
379763163YP_005349560.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MRLHVRGVGLPDETEIQLWIVDGRISTEPIAGADTVFDGGWIVPGLVDAH
CHVGLGHHGEIPLDEAIAQAETERDVGALLLRDCGSPTDTRSLDDRDDMP
RIIRAGRHLARPKRYAAGFSRELEDEWQLPDAVAEEARRGDGWIKLVGDW
IDRGAGDLAPLWSDDVLAAAIEAAHAHGARVTAHVFSEDALPGLINAGID
CIEHGTGLDDDTIELMASRGTVLVPTLVNVLENFPGIAEAAAKYPAYAAH
MRDLHARGPSRIAAAREAGVQIYAGSDAGTMVAHGRIADEVEALKGIGMS
PTQALGAACWDARRWLGRPGLDHGASADLLCFARDPRSGPAVLNNPDLIM
LRGKIFRSPA
379763162YP_005349559.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAYDVIIRDGLWFDGTGAAPLTRTLGIRDGVVVAVSAEALDETGCPEVIE
AAGKWVVPGFLDVHTHYDAEVLLDPGLRESVRHGVTTVLLGNCSLSTVYA
DSEDAADLFSRVEAVPREYVFGALSSGRTWSTAAEYVKAIDALPLGPNVG
SLLGHSDLRTAVLGLERATDPTIRPTDDELKKMAALLDEALDAGLLGMSG
MDAAIDKLDGERFRSRALPSTFATWRERRKLIKVLRKRGRILQSAPNLQN
PILSLMFFLTSSRIFGRGKGVRMSMLVSADAKSMPLAVHTFGLGTRVLNT
LLRSSVRFQHLPVPFELYSDGIDLPVFEEFGAGTAALHLRDQLQRNELLA
DEAYRRRFRREFDRIKLGPSLWHRDFHDAVIVECPDASLIGKSFGAIADE
RGLHPLDAFLDVLVENGERNVRWTTIVANHRPKQLDKLAADPSIHMGFSD
AGAHLRNMAFYNFALRMLKRTQDAHRAGAPFLSIQQAVHRLTGELAEWFG
IDAGTLRVGDRADFVVIDPAGLDESVDRYHEEAVPFYGGLRRMVNRNDHA
VVATGVGGVVVFGGGRFRDGYGQTVTSGRYLRAGERARRPQGALTQSA
379763161YP_005349558.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MARTQQQRRQETVGRLLDACIATIIEVGYARASAAVITKRAGVSVGALFR
HFDTMGDFMAATASEVLRRQLESFTKGVAEIPADRPALEAALGILRDITS
GPANAVIYELLVAARTDEKLRETLQHELGQYAAKIHDAARALPGAERFPE
DTFPVFVALMTNVFDGAAVVEGVLPQPDIAAQRIPVLMALLTAALPD
379763160YP_005349557.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MGSVSGMAAALLAVVAFGAPVPLSRADSSQPIGSIPIPDGPAQTWIIADL
DSGQVLAGRDQNVAHPPASTIKTLLAQVVLDSVSLDSTVVADVADTQVEC
NCVGIKPGRTYTARQLLDGLLLVSGNDAANTLAHMLGGPDVTVAKMNAKA
ASLGATNTHAATPSGLDGPGGSGSSTAHDLAVIFRAAMANPVFAQITAEP
SAMFPGDNGDRLITNQDELLQRYPGAIGGKTGFTNAARKTFVGAAARGGR
RLVIAMMYGLVKEGGPSYWDQAATLFDWGFAQSPQAGIGSL
379763159YP_005349556.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MLSLAEISDRLEIQQLLVDYSTAIDNRRFDDLDRVFTPDAYIDYTALGGI
EGHYPEVKKWLAEVLPNFPVYAHMLGNFSVRIDGDTASSRVICFNPMVLG
GDNEQVLFCGLWYDDEFARTPEGWRMTRRVETKVFQKVM
379763158YP_005349555.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAVKIKLTRLGKIRNPQYRIAVADARTRRDGRSIEVIGRYHPKEDPSFIE
IDSERAQYWLSVGAQPTEPVLKLLKITGDWQKFKGLPGAEGRLKVKPAKP
SKLELFNAALAEAEGGPTTEAAKPKKKSPAKKTAKAAEGESKAESEGAAQ
TAETKPAEAPAEGGEQAESTTES
379763157YP_005349554.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSTVVVDAVEHLVRGIVDNPDDVRVDMVTSRRGRTVEVHVHPDDLGKVIG
RGGRTATALRTLVAGIGGRGIRVDVVDTDQ
379763156YP_005349553.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MELTVGRVVKAHGIGGEIVVEIRTDDPDARFAPGNTLRGKASRGGGERDF
VVESAREHGGRLLVRLAGVTDRDAADALRGTLFVVDSDDLPPIDEADTYY
DHELEGLHVRTITGHDVGVVAEVLHTAAGELLAVRRESGEALVPFVTAIV
TSVSLDDGTIEIDPPEGLLDL
379763155YP_005349552.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MRIDVVTIFPAYLDPLRQSLPGKAIQSGLVDLAVHDLRRWTHDVHRSVDD
APYGGGPGMVMKAPVWGDALDEICSGETLLVVPTPAGALFTQATAARWSA
EKHLAFACGRYEGIDQRVIEDAGRRMRVEEVSIGDYVLPGGESAAVVMIE
AVLRLLDGVLGNPASRQDDSHSPALDRRLEGPSYTRPPTWRGLQVPEVLL
SGDHARIAAWRREISLQRTRERRPELLDPED
379763154YP_005349551.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MRVRPLTLLTATAAVTLLVAAGSEALVQAKVYSLPINAPVRVIPQRPAPA
PPQSAALMLEAATPPQEPQPPQALPGAGSAPLQERVHQATEEAAASGAAL
SVAILDRRTHQLVSNGNGQVVGTASVAKLFIADDLLLHQAEGKAALSAED
RQALDIMLQSSDDGAAERFWGQGGGSAIISEVAARYGLASTTPPSDGRWW
NTMSSVTDLIRYYEMLLDGSGGLPADQAKIIVNDLAQSTPNGVDGYPQRF
GIPDGLYAEPVAVKQGWMCCIGSDWMHLSTGVIGADRRYIMVVQSLQASD
DATARDTITRAVKTIFPEGRIDAVARGL
379763153YP_005349550.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MNRLDFVDQASLRDDIPVFGPGDTINVHVKVIEGAKERIQVFKGVVIRRQ
GGGIRETFTVRKESYGVGVERTFPVHSPNIDHIEVVTRGDVRRAKLYYLR
ELRGKKAKIKEKR
379763152YP_005349549.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTDTADSSNPQSHAGDSDPKVSTRNPETRPDDAAAADGPVPEPGPADQAS
EPAGAKHSTLREFALLAVIAVVLYYVMLTFVARPYLIPSESMEPTLHGCT
GCVGDRIMVDKISYRFSAPSPGDVIVFKGPPPWNLGYKSIRSNNTVLRWM
QNALSFIGFVPPDENDLVKRVIAVGGQTVACRAETGLTVDGKPLKEPYLD
RNTMAADPSVYPCLGSEFGPVAVPAGRLWVMGDNRTHSADSRAHCTSVPA
EALKGVLCTGDPTTGTVPVSNVIGKARFIVWPPSRWGGVESVNPQQTR
379763151YP_005349548.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MATTWPPRTVIRKSSGLRTLESALYRNGLGPVAGVDEVGRGACAGPLVVA
ACVLGPGRMESLAALDDSKKLTEAAREKLFPLIRRYALAYHVVFIPPAEV
DRRGVHVANIEGMRRAVAGLSVRPGYVLSDGFRVPGLAVPSLPVIGGDAV
AACIAAASVLAKVSRDRLMVAMEADHPGYGFALHKGYSTPAHSTALARLG
PCPEHRYSFINVRRVANGSGTRLVADCDPDPPLQRDGYR
379763150YP_005349547.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSAEDLEKYETEMELSLYREYKDIVGQFSYVVETERRFYLANSVEMTPRN
ADGEVYFELRLSDAWVWDMYRPARFVKQVRVVTFKDVNIEEVEKPELRLP
E
379763149YP_005349546.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MADNAKARAVAPPTGGEKADPSTVFAALAEIIYRGSDANEMYAAICVAAT
LAIRGCDHASLMVRENDRYVTVGASDRLAQQVDELERRAGDGPCIDAIEE
ETPQIDPDLTTPSLWPKLAAVLVAETPVRGAMGFRLLVDKRKGAALNLFS
DTPNMFDAESAGRAAVLAAFASVAINAVAKGEDAASLRRGLLSNREIGKA
VGMLMLLHDMSEDDAFDLLRRHSQALNIKLAEVARAVIEQRGQLPALAEN
QLPPNA
379763148YP_005349545.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MGVTVAVTGPTGEIGISAVTALEREPAVDAIIGMARRPFDPSSRGWLKTT
YQRGDILDREAVDAVVAQADVVIHLAFIIMGSRDESARVNLQGTRNVFEA
TVAAERPRRLVYTSSVAAYGYHADNPVPLTEDVPVRGSAEHYYSAQKATC
EAMLADITRDSPLEVFVLRPCVVAGPNATALADAMPWNQLPGPIRAVVKA
LKAVPLLKPVVPDPGVGLQLVHHDDVASAIALAATAPAPPGAYNIAGDGV
VSVADVAKALGARSVRVPAVAASAASAAISRVPLMPAMLEWLHTARTSMV
MDTTKAKTQLGWRPLYSSAQALAALASAV
379763147YP_005349544.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSGPAAVDYDEHAVTVTPRKREAAGVRAVMVSLQRGFEQMGALRTAAVLA
RLNQRNGFDCPGCAWPEEHGGRKLAEFCENGAKAVAEEATKRTVTPEFFA
RHSVAELSAKPEYWLSQQGRLTHPMVLRPGDDHYRPIGWDAAYRLIADQL
GALDSPDEAVFYTSGRTSNEAAFCYQLLVRSFGTNNLPDCSNMCHESSGS
ALTESIGIGKGSVTVEDVELADLIVIAGQNPGTNHPRMLSVLEKAKANGA
NIIAVNPLPEAGLIRFKDPQKVHGVVGHGIPIADEFVQIRLGGDMALFAG
LGRLLLEADDRAPGTVIDTAFVDAHCAGFDEYRRRTLDIDLDDVFAATGI
ERRQLDRVADMLMASRRTVVCWAMGLTQHAHAVATIGEITNLLLLRGMIG
KPGAGVCPVRGHSNVQGDRTMGIWEQMPEEFLAALDDRFGIATPRKHGYD
TVAAIRAMRDGRAKVFVGMGGNFASATPDTVVTEAALRNCALTVQISTKL
NRSHLVHGNTALILPTLGRTDRDVRGGRKQVVSVEDSMSMVHLSRGSLHP
PSDQVRSEVEIVCRLARTLLGAAHPVPWESFAADYDTIRDAIAAVVPGCA
DYNRKVRAPDGFQLPHPPRDTREFHTSTGRANFAVNPLQWVPVPEGRLVL
QTIRSHDQYNTTIYGLDDRYRGVKGGRRVVFINPADIDALGLTPGGRVDL
VSEWTDAEGRLQERRAKDFLVVAYSTPVGNAASYYPETNPLVPLDHTAAK
SNTPVSKAVVIRVEPAAGGETA
379763146YP_005349543.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MGHVTSRRRVTHLTAEKAITRPETLVVEEPLEIRVDGAAVTVTMRTPGAD
IELAQGFLLTEGVIGGRDDIHSIRYCAGRDDDGANTYNVLDVTLAPGVPK
PDLDVTRNFYTTSSCGVCGKASLDAVRLSSRFTPGADPATVAPATLKAMP
DQLRSAQKVFESTGGLHAAALFGVDGTMLVVREDVGRHNAVDKVIGWALE
HRRVPLAASVLLVSGRASFELTQKAVMAGIPVLAAVSAPSSLAVSLAEES
GITLVAFLREDSMNIYTRADRIA
379763145YP_005349542.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MARMTTEMTMTRIQLGAMGEALAVDHLTRAGLRILHRNWRCRYGELDIIA
CDRAGTAVFVEVKTRTGDGYGGLAHAVTPRKVRRLRRLAGLWLAGQDRRW
AAIRIDVIGVRVGRRRTPEITHLQGVG
379763144YP_005349541.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MALGRAFSVAVRGVDGEIVEIEADITSGLPGVHLVGLPDAALQESRDRVR
AAVTNCGNDWPMARLTLALSPATLPKMGSVYDIALAAAVLSAQRKNPWDR
LEKTVLLGELSLDGRVRPVRGVLPAVLAAKRDGWPAVVVPADNLAEASLV
DGIDVWGVRTLGQLKKWLGGTGALHNRVNPDRTPEEPVVDLVDVVGQTQA
RFAVEVAAAGAHHLMLTGPPGVGKTMLAQRLPGLLPPLSESESLEVTAIH
SVAGLLSGDTPLITRAPFVAPHHSSSVAALVGGGSGMARPGAVSRAHRGV
LFLDECAEIRVSALEALRTPLEDGEIRLARRDGVACYPARFQLVLAANLC
PCAPADPRDCMCPAATKRRYLGKLSGPLLDRVDLRVQMDPVRATAFSGRD
GESTAQVRQRVAAARAAAAQRWQPHGFRTNAEVSGTLLRRKFRPSKAAME
PLQRALDRGLISIRGLDRTLRVAWSLADLAGRTSPGLDEVAAALSFRQPG
TQR
379763143YP_005349540.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSAPTGRQRALRAWAYLSRVAEPPCAGLAALARRVGPVEAAERVRRGAVD
DVLARHTEARRDIDTSAADLEAIARRGGRLITPDDDEWPVLAFAAFGGAE
ARRRGGPPMVLWAQGPARLDEVAQRAAAVVGTRASTAYGEQMAAELAADL
AQRDVAVVSGGAYGIDGAAHRAVLDCDGITVAVLAGGLDVPYPAGHTALL
HRIGQHGLLFTEYAPGVRPARHRFLTRNRLVAAVSGAAVVVEAGLRSGAA
NTAAWARALGRVVAAVPGPVTSSASAGCHALLRDGAELVTRAEHIVELIG
HIGELAPDEPRPVTPLDGLSEAERRVYEALPGRGAATVDEIAVASGLVPE
QVLGPLAMLELAGLVQRQDGLWRIVRATAGHAASTPRLV
379763142YP_005349539.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAGRPLQCFEVVGTEQLTPHMVRVVLRGKNFDAFVPSKFTDSYVKLAFVA
DDVDVAGLPEPLTLDSFAGLPPEKRPTVRTLTVRHVDVEARQIALDIVVH
GEHGTAGQWAATAQPGQPIYLMGPGGAYTPDPAADWHLLAGDESALPAIA
AALEALPPSAVGKAFIEVAGPEDEIPLTAPDGVEVHWVYRGGRADLVPED
RAGDHAPLIEAVTSAPWLPGQVHVFIHGEAQAVMHNLRPYIRKERGVDAK
WASSISGYWRRGRTEETFRQWKKELAQSESEAEAANSSA
379763141YP_005349538.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAFADYQNEIYFKGLGGIAPALPMAFAELEARAERAMSPSVWSYVAGGAG
DERTQRANREAFDRWGLIPRMFVGAADRDLSVQMFGLTLPSPVFMAPIGV
IGICAQDGHGDLATARAAAKTGVPMVVSTLTADPMEDVAAQFGDTPGFFQ
LYTPKDRDLAASLVRRAEAAGFQGIIVTLDTWIPGWRPRDLSTANFPQLR
GLCLSNYTSDPIFRAGLQRPPEEDPQGTVLQWITTFGNPLTWDDLEWLRS
LTDLPLIIKGICHPDDARRAKDGGVDGIYCSTHGGRQANGGLPALDCLPG
VVEAADGLPVLFDSGVRSGADVVKALALGATAVGIGRPYAYGLALGGDDG
IVHVLRSILAEADLIMAVDGYPTLKDLTPDTLRRVG
379763140YP_005349537.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MQAILEEFDEYLDLQCLRSAHTRRAYLGDLRSLLAFAAERGVGLDGLSLP
LLRSWLSAAAAAGVARTTLARRTSAVKAFTAWAVRRGLLDTDPAARLQVP
KAHRTLPAVLRQDQALDALAAAKSGAQQGEPMALRDRLIVEMLYATGIRV
SELCGLDIDDVDTRHRLVRVLGKGNKQRSVPFGAPAAEALDAWLADGRPA
LVNAASGPALLLGARGRRIDVRQARTVVHQTVAAVDGAPDMGPHGLRHSA
ATHLLEGGADLRVVQELLGHSSLATTQLYTHVAVSRLRAVHDQAHPRA
379763139YP_005349536.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MRWMALTLGAALVSAVPAAADDDRLDWPLRPPPAVTRAFDAPVQDWHPGH
RGVDLAGAAGQPVYAAGAATVVFAGLLAGRPVVSLAHPGGLRTSYEPVWA
AVRAGQSVAAGTVIGTLMAGHPGCRVAACLHWGAMWGPASGAHYVDPLGL
LRSTPIRLKPLRPPGDAAQHG
379763138YP_005349535.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSVVAWHRVKPGPGACCDAGPVRKIRSGPPGTRLRSPRGTGDAMRTREVS
PRTSCDQQFTPVRRVLLPRFPRRRRRPQCRCGRVAWPGGPR
379763137YP_005349534.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MKQLLDSGTHFGHQTRRWNPKMKRFIFTDRNGIYIIDLQQTLTFIDQAYE
FVKETVAHGGTVLFVGTKKQAQESVAAEATRVGMPYVNQRWLGGMLTNFS
TVHKRLQRLKELEAMEQTGGFEGRTKKEILMLTREKNKLDRSLGGIRDMA
KVPSAIWVVDTNKEHIAVGEARKLGIPVIAILDTNCDPDEVDYPIPGNDD
AIRSAALLTKVIASAVAEGLQARAGVGRGDGKPEAEAAEPLPEWEQELLA
SAAASAPTDAAAGTPEPTTTESS
379763136YP_005349533.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MANFTAADVKRLRELTGAGMLDCKNALAESDGDFDKAVEALRIKGAKDVG
KRAERATAEGLVATQGGALIELNSETDFVAKNAEFQALADQIVAAAVSSK
AADVDALKASSIDQTSGTKTVEQAIAELSAKIGEKLELRRVANFDGTVEA
YLHRRAADLPPAVGVLVEYQGSDKEAAHAVALQIAALKARYLSRDDVPED
VVASERRIAEETAKAEGKPEQALPKIVEGRLNGFFKDAVLLEQPSVSDSK
KTVKALLDDAGVTVTRFVRFEVGQA
379763135YP_005349532.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MRHVHAFGDDALGDLDAVGLAEAIRSGRVGRAEAVEAAIARTEAVDPALN
GLAYAGFRQARAAAEQAADGYFSGVPTFIKDNVDVAGQPTMHGTDAWTRR
DAVADSVFTKLYLATGMTSLGKTQLSEFGFSASAEHPRLGPVRNPWDTEY
SAGASSSGSGAFVAAGVVPIAHANDGGGSIRIPASCNGLVGLKPSRGRLP
LDAVLRRMPVGVVVNGVVTRSVRDTAAFYREAERIWRNPKLAPVGDVTGP
GRQRLRIAVLTRSIQRECSPAVRELTLKSAGLLEELGHRVEHVDEPPVAA
SFVDDFVLYWGFLALAQVRGGRHMFGETFDRAKLDCLTLGLMRHTGRHLH
RLPAAIMRLRGARRRTARFYGTYDAVLTPTLADETPRIGFLAPTDYQQVI
NRLIEWVSFTPLHNVTGEPAISLPLAQSAHGMPVGMMLSTGMGQESLLLE
LAYELEEARPWARIQAG
379763134YP_005349531.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MVDMNQDDAPLGYLLYRVGTVLRPEVAAVLSPLDLALPEFVCLRILSMHP
GMSSAELSRHAGVTPQAMNTVLRKLEDVGAVERPSSVSSGRALPANLTGA
GRALLKRAEAAVRGADARILSKLTETQQREFKRMLEKLGSDEQA
379763133YP_005349530.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MPKTTKGGAPKKSELPSTLRRSDAKAQRTFAKSHDAAADQYGSEERAHRV
AYAAVKHSFEKVGDHWEPKEKKGPSDERAERGGLRPSGESAEGVDANASK
KHLLDVARRLEVPGRSTMNKAELVDAIKKHNRRVRGR
379763132YP_005349529.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSEPDSVIHNLRDTLNNEPGLADRLERSLQKARGRAESELNPELYEALEW
PRDIGEYEAYLKRFLRWVPHESDADAWKNEKRQAQEVSDRMAHFYFLVDQ
GDEPAQGSGVFREWLTDFARQWGNFLDTPESFSPEALQSFIDNAPEYRIH
ESLVDGVPNAPSGWLTANQFIAREINGGLRPIAEPTTNLVVTSPADCKYQ
HAYDIAADSSIPATTVKNEKYGNIKQLIEGSQYSESFARGTFVHYMLPVH
AYHRYHLPVAGLVEESFRINGKVFMRVGLEEHEFASSDSASSGYEFSQTR
GVVTVDTSQSDCGDIGIVAVIPVGMAHVSSVVLTAVPGKHMAKGEEFGYF
QFGGSDIIILFQEGVDPQLDTSEEFRLVGSPVARCAAPRNPQ
379763131YP_005349528.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAGLLGRLWLTAWHKVLSSPLLTLNGYVAFDLPRTVTALGTSLLMGLVAV
HAYLAATRPGLPLYFWVYLAALIAACLAVAAAMAFAAKPLVPQAGWYAGS
LVCAAFLVIYLVSRFVSLPGLVAVTGRWDLAPGTFAMAFAGAFIAVHTTV
LSGINVAYPQRQNWRD
379763130YP_005349527.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MLDYPAWLRIDHWLNVLFLTLVIRSGIEILSTHPKLYWHDDSRPGSEWAR
FTVKEMPVNKLYDTLDEEEDYSSLFSLPGHKKLGMGRHWHFFSVIGWILV
GLSYYILLFATGQWHRYWPASWSIFGEAWNDVVTYMSFNLPPLLPGEPLD
AIQKLTYAGVIFVLAPFQILTGAAQSPAIEAAFPWYVRMWGGRQWARSLH
FLGLIAFVVFIVIHLSMIFFWSWGQLTASMIFGSVRNIGWATALSLVIIA
AIVAVHVAATVWSLRRPVQVRRVLGAVVTRARKILLRPLNSRQNYPERMT
SKEHRVNGKPPTSAEYKVMAVHNFVDWRVRVGGLVENPVTLDLDALRGLA
EQQSQRVMHNCVQGWTSIGQWSGIPLAQLADHVRPLPQAKYICFLTMQDT
GRDEPSAEGEGQFYEVIDLELAYKPQTLLAYEMNGKPLPIKHGAPLRLRV
ETQVGFKMAKWINQIEFIDDYSGIGHGLGGWREDNVHYDKDVEI
379763129YP_005349526.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MPDPSATRPELIDLQSVERERVSELVAVKGGHCAGCGGRDFAVGHALYLG
FLFLDEDDDAFMVALTCRNDDCPAPRTGIVLAANEFLSDYREISDVEDIA
SRARARQASATWGGSGYR
379763128YP_005349525.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSTTARRPEPIGIDDDFELLEEQIAALKELARLDDVPEGQAYDFGIRWGA
ALAGRFRRLVHYSCLGVLDEPAERRFQSLCDDLRSVSELIERFDLARPRF
TDTPSHPTLR
379763127YP_005349524.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MATIDAALHDPVWSYHDHELLGLTDDHRLAAIGYAGPGTAHTRLSAPMGS
GRNLQISQKDDRHVFVPQPERGKVAVVDIATLRPVAEIDAGPAPSYLAED
AGMRVLLALAADGSSVTPVDQYGFRKLPTATYAGDPADTIDGSNRGRQIE
YHLYGASGIRYYKGPTSPPEERGSLPMAVAVWAGDGTQVTRSYVAGRDDK
VLYAVDSRRGGDGLEVLARTELSSPIRYLGTDDTRIYAATDRDVTVLETA
SFTGFPNGTIRVIRTLDYRAGLPSGPVASAPLSGMAIGPKRVYLTLRGQP
HVISVAKPRL
379763126YP_005349523.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MVATLTAGALSSEDPGAEHPATATTPEAAATDHRRNLRR
379763125YP_005349522.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MGFTAQQQSVPGVQAQMDPIPDCGENTYQGSGKLLGKKAIITGGDSGIGR
AVAIAFAREGADVLIAYLNEDDDARDVARYVTNAGRKCVLVPGDLSDAAH
CRAVVDRAVQELGGVDILVNNAAYQMMRKSLDEISDEEWDYTFRLNVGAY
FYLAKAALPYLNAGSSIIGSSSVNSDSPNPTLAPYAATKAAIANFSASLA
QLLGEKGIRVNSVAPGPIWTPLIPSTMPPDSVESFGDNVPLGRAGQPAEL
APLYVLLASDDASYISGARVAVTGGRPIL
379763124YP_005349521.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSLEKPARANAGAASRFTIRDGLGRRPERPDRRRPAAPGPATPRYGWTDC
RGPCPPVRA
379763123YP_005349520.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MKVTKTAIKTVAAAGIAAAGVFAAAPALASPPPNIQGFGTSEQLVDGALI
TNYTVSNLQPSNVTIPGYTPKGTLYQADISARSEAGLVTPMVNDFIARGP
NGQNYRVIDKVGTPNGLSPAPIPQGSESTGTLYFDVTGAPPNGVVYNDGM
QDVLIWTSNMEGGSASGTINSPAPGAPNSPAPGAPPAPAPSA
379763122YP_005349519.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MRKQAQRNAERTRAAMDERRSEHSGGLSGWVAERAGRWDLSGQDEAALQR
QKYLWNVLVDYWFRMEIDGWENIPEAPPALLVGIHSGAPFVWDAWTVGLQ
WWRRFGQDRPLHGTAHDALMAIPLFGRYFRSMGVLPAAPDAIATALAEGR
DVALWPGGEVDSLRPWTERDRANLAGRTGFVKMAIRAGVPIVPIATVGGA
DAMPVLIRGDRLSKALQLDRLLRLKVFPLAISLPWGIAPAALPQLPLPAK
IRTRFMPAVELDHDPARADDEEYIDRKYHEVQDSIQEGMDALARKRAFPF
FG
379763121YP_005349518.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSLDRSMDIVVLTDEADFESALPDLTTFALPARVALTAHTDGHCATADVA
IVDARSNMPAAQAVSRRLAAQNPATAVVALVRPADCAAVDTDGNFDDVML
PGTGADELRARLRLAVGRRRGTADGILKFGDLRLHPASFTASLDGHDLTL
TLTEFRLLSFLVLHAGQAFTRTRLMREACGYDSNSRARTVDVHIRRLRAK
LGTRHEFVIGTVRGVGYRAPTPPQPEWVLADPALTPTRAT
379763120YP_005349517.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MKGVVEDVKGKAKEAVGAVAGRDDLTREGQAQQDKAEAQRDAAKKEAEAE
AARGGAEAAEERQKSNQ
379763119YP_005349516.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MLLKLGGEMFGGGQVGLDPDVVALVAQQIAEVVRGGVQVAVVIGGGNFFR
GAQLQQRGMERTRSDYMGMLGTVMNSLALQDFLEKEGIVTRVQTAITMGQ
VAEPYLPLRAVRHLEKGRVVIFGAGMGLPYFSTDTTAAQRALEIGAEVVL
MAKAVDGVFSADPRQYPEAELITAISHREVIDRGLRVADATAFSLCMDNG
MPILVFNLLTNGNIARAVAGEKIGTLVTT
379763118YP_005349515.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MIDEALFDAEEKMEKAVAVARDDLSTIRTGRANPGMFSRIVIDYYGAATP
ITQLASINVPEARLVVIKPYEASQVGAIETAIRNSDLGVNPTNDGTLIRV
AVPQLTEERRRELVKQAKSKGEDAKVSVRNIRRKAMEELHRIRKDGEAGE
DEVARAEKDLDKTTHQYTTQIEELVKHKEGELLEV
379763117YP_005349514.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MPPPAKKTSRAGRDLRAAIAVGAGIGGALVVTLVFAPRFWVPIVAMAILV
ATHEVVRRLREAGFVIPVIPLLAGGQLTVWLTWPFHAAGALAGFGVTVVA
CLFWRLFMQDNRTPPEPAGGSPSPSYLRDASATIFLAAWVPLFASFAALL
VYPADGAGRVFCLMITVVASDVGGYAVGVLFGKHPMVPAISPKKSWEGLA
GSLVLGITAATLTATFLAGKPPWVGALLGLVLVLTCTLGDLVESQIKRDL
GIKDMGRLLPGHGGLMDRLDGVLPSAVAAWTVLTLVP
379763116YP_005349513.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTDTGQVMVQQLVFSEPRPGKPPRHLADLDADGRAAAVAELGLPAFRAKQ
LAHQYYGRLIADPRQMTDLPAGLRDAIADTMFPILLTAVSEVACDAGETR
KTLWRALDGVTVESVLMRYPQRNTVCISSQAGCGMACPFCATGQGGLSRN
LSTAEILEQVRAAAAVLRDDFGPPSQRLSNVVFMGMGEPLANYARVVAAV
RRIIAAPPHGFGISARSVTVSTVGLAPAIRKLADEGLAVTLALSLHAPDD
ELRDTLVPVNNRWKIAEALDAARYYADVTGRRVSVEYALIRDVNDQPWRA
DLLGQRLHRALGPLVHVNLIPLNPTPGSEWDASPKAVEREFVRRVRAKGV
SCTVRDTRGREISAACGQLAFENR
379763115YP_005349512.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MRIRLSALNKAFAAAMVVAAMMVGVASGPRAQAADDRLQFTATTLSGAPF
SGASLQGKPAVLWFWTPWCPYCNAEAPGVSQVAAANPGVAFVGIAAHADV
GAMQGFVSKYNLNFTNLNDTDGAIWARYNVPWQPAYVFYRADGSSTFVNN
PTSAMSQQELSDRVSALRS
379763114YP_005349511.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MDQGLVGLAFAAGLVAALNPCGFAMLPAYLLLVVRGRRPDERSGVAATGR
ALAATVGMALGFLTVFGVFGALTVSAATTVQRYLPYATALVGVVLIVLGA
WLLSGRELSALASRPLGPRWAPTVRLGSMYGYGISYAVASLSCTIGPFLA
VTAAGLRGGSIVTGVAIYLSYSAGLTLVVGVLAVAAATASTAMVDRLRRI
LPFVNRIGGALLVLVGLYVAYYGSYEVRLFGANANPRDAVITAVGRLQGA
TAGWVHQHGIWPWLVAVLALAVVVIGGAWHRRVKRQGKRGAAT
379763113YP_005349510.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MADVVAAQHRQQQPEDAQADDVPGPVIDPAPTPRRRRHLDGVDAGEVFDL
GTGHGESLSDRIGLLNPNSGIRPRRGRGRIVAPVRAGRHNEWVTNPTTDG
QTPGRVRVLVLGSTGSIGTQALDVIAANPDRFEVVGLAAGGANLDTLLHQ
RAATGVTNIAVADEAAARRAGDIPFAGPEAVTRLVQETEADVVLNALVGA
LGLRPTLAALESGARLALANKESLIAGGPLVLKAAKPGQIVPVDSEHSAL
AQCLRGGTPDEVAKLVLTASGGPFRGWTAAQLEDVTPEQAGAHPTWSMGP
MNTLNSASLVNKGLELIETHLLFGLPYDRIEVVVHPQSIVHSMVTFVDGS
TLAQASPPDMRLPIALALGWPRRVPGAAASCDFSTASSWEFEPLDNDVFP
AVELARHAGQTGGCMTAVYNAANEEAAQAFLAGRIGFGAIVKTIADVLHA
ADQWAVSPANVDEVLDAQRWARERAQRVVAQAQPANLSVKASGAV
379763112YP_005349509.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MMFVIGIVLFALAILISVALHECGHMWVARATGMKVRRYFVGFGPTLWST
RRGETEYGLKAVPLGGFCDIAGMTSVEELAPDETDRAMFKQAVWKRVAVL
FAGPAANFVICLVLLYGIALVWGLPDLHPPTKAVVGETACVAPEVAPGKI
ADCTGPGPAALAGIRPGDVIVKVGDTPVSTFEEMAAAIRKVHGNTPIVAE
RDGTAITTYVNVTPTQRYLTTGPDGQGAQPQASTVGAIGVGAVRTGPTHY
GVLSAIPGSLAFAGDLTVEVGKALVTIPTKVGALVHAIGGGQRDPQTPMS
VVGASIIGGDTVDHGLWVAFWFFLAQLNLILGAINLVPLLPFDGGHIGIA
MFEKVRNLIRSARGMVAAAPVNYLKLMPATYVVLVFVVGYMLLTVTADLV
NPIRLFQ
379763111YP_005349508.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSVGLGMPDAPAPTLAPRRKTRQLMVRDVGVGSDHPISVQSMCTTKTHDV
NTTLQQIAELTAAGCDIVRVACPRQEDADALAEIARHSQIPVIADIHFQP
KYIFAAIDAGCAAVRVNPGNIKEFDGRVGEVAKAAGAAGIPIRIGVNAGS
LDKRFLQKYGKATPEALVESALWEASLFEEHGFGDIKISVKHNDPVVMVA
AYEQLAERCDYPLHLGVTEAGPAFQGTIKSAVAFGALLSRGIGDTIRVSL
SAPPVEEVKVGIQILESLNLRPRGLEIVSCPSCGRAQVDVYTLANAVSAG
LDGLDVPLRVAVMGCVVNGPGEAREADLGVASGNGKGQIFVRGEVIKTVP
EAQIVETLIEEAMRLAAEMGGDHGPDTTSSGSPVVTVS
379763110YP_005349507.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSAPPLFRLVGERRVSVVRDAAAVWRVLEDDPVASCMVAARVADHGIDPN
SIGGELWTLRGAEQSLCFAGANLIPLRGAPADLSAFADEAMRGTRRCSSL
VGRADLVMPMWERLEGAWGPARDVRDRQPLLALSTHPSCDIDTAVRQVRP
EELDAYLVAAVDMFIGEVGVDPRIGDGGRGYRRRVASLISAGRAWARFEH
GQVVFKAEVGSQSPGVGQIQGVWVHPEWRGLGLGTAGTATVAAVIVGSGR
TASLYVNDFNAVARAAYARVGFAEIGTFATVLLD
379763109YP_005349506.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAAPQFTPQLITSAPMVTRTTAASSVSGLLLVAVIALSGCTPRPDGPGPA
AEKFFRALAVGDTATAAQLSDSPNEAREALNAAWSGLQATHLDAQVLNAK
YAEDTGTVGYRFAWHLPKNRVWSYDGQLRMARDEGRWRVRWTTTALHAKL
GEHQTFALRADRPRRASVNELGGSDVLVPGYVYHYTLDATQAGPALFGTA
HAVVDVLHPFNDTLNDPQLLAEQASSTPHPVDLGVTLHPDDNDKVFPAIG
RLPGIVVTPQPEMLPTDPHFAPAVVAAVKKAVVDQLDGEAGWRVVSVNQN
GVEVEVLHEVEGSPAPSVSLTMDRAVQNAAQHAVDTRGGKAMIVVIKPST
GEILAIAQNAGADADGLPATTGLFPPGSTFKMVTAGAAVERDMATPNTML
GCPGRLDIGHRTVPNYGGFDLGVVPMSRAFASSCNTTFAELSSKMPPRGL
TQAASRYGLGLDYQIDGITTVTGSVPPTVDLAERTEDGFGQGKVLASPFG
MALVAATVAAGKTPVPQLIAGRQTAVQGDATPISPKMIDALRPMMRLVVT
NGTAKEIAGCGEVYGKTGEAEFPGGSHSWFAGYRGDLAFAALIVGGGSSE
YAVRMTKVMLESLPPDFLA
379763108YP_005349505.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTDTGGDMVTLRVSDADRNGTMRRLHNAVALGLIDIDEFEQRSSQVSYAR
TRGELDHLVGDLPGPGAIVTSAADRVELRGWAGSLKRHGEWTVPTRLALV
RRLGSVELDLTKARFAGPVVVVELDMRFGSVEIRLPDGASASIDDVEVYV
GSASDRRKDPPGEGRPHVVLTGRVVCGSVIIRGPRRSLLRRQRV
379763107YP_005349504.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MPGSVPRPEYAWKPTVHEGSEPWVQTPEVIEKMRVAGQIAARALVEAGKA
VAPGVTTDELDRIAHEYMVDHGAYPSTLGYKGFPKSCCTSLNEVICHGIP
DSTVIEDGDIVNIDVTAYIDGVHGDTNATFLAGDVAEEHRLLVERTREAT
MRAINAVKPGRALSVVGRVIESYANRFGYNVVRDFTGHGIGTTFHNGLVV
LHYDQPSVSTVMQPGMTFTIEPMINLGGLDYEIWDDGWTVVTKDRKWTAQ
FEHTLLVTDTGVEILTLP
379763106YP_005349503.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSGALLVAGTSSDAGKSVVVAALCRLLARRGTRVAPFKAQNMSNNSVVTV
EGGEIGRAQAIQARAAGLEPSVRFNPVLLKPGSDRTSQLVIKGRVTDSVS
AKSYVQHRDRLASVVLDELACLRDEFDAVICEGAGSPAEINLRATDLANM
GLARAAGLPVVLVGDIDRGGLLAHLFGTVAVLEPDDQALISGFIVNKFRG
DPALLEPGLRQLQAMTGRPTYGVLPYAEELWLDAEDSLSVVAHRVIGTPA
PPRGDEWLRVAAVRLPRISNSTDVEALACEPGVVVRWVADPAGAADADLI
VVPGSKATVADLSWLRERGLAEAIVSHARAGKPVLGICGGFQMLCRRIDD
AVESGAGEVPGLGLLDADIAFDPAKTLRRWRCGIDGPLGGYEIHHGRIAR
CAEQTWFAAGTDPQPQGVVRGAIFGTHWHGVLDNDDFRRAWLTRVADAAG
RGGFVVDDDTNVAARRDAQLDLAADLLAAHLDVDAVLGLLRGPPPARPHL
ASLLRP
379763105YP_005349502.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSSMMTTLEGFPVPVVVAGPETGVVVVILGDEERAPAAYDAVCERLHTAS
LRTVVIGFDPRLTPKSVIGILDALGIGWAVVMGDRAGGDLAWELTATRLG
RFVGLVVIDRGHPRAGDRDGAIRDGHCPPVEIGTTVLVSSPAARSVAQAS
QQYVYADYRVVHLGRRTVQESTAQLAAEIILRTSTW
379763104YP_005349501.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MASDDDAVTDPMLSLSALRQLVAAGAVDTVIVAFADMQGRLVGKRVAAQL
FVDEVATRGAECCDYLLAVDVDMNTVDGYAMSSWDTGYGDTVLRPDLSTL
RRIPWLPGTALVIADVGWADGSPVAVSPRAILRRQLDRLARRGWSADAAT
ELEFMVFDETYRQAWAGGYRGLTPASDYNIDYAIAASSRMEPLLRDIRNG
MTGAGLQFEAVKGECNRGQQEIGFRYAEALVTCDNHVIYKNGAKEIADQH
GKSLTFMAKYDEREGNSCHIHLSLRDPQGGAVFADPARPHGMSSTFCSFV
AGLLATLREFTVFYAPNINSYKRFADGSFAPTAVAWGLDNRTCALRVVGH
GPNTRVECRVPGGDVNPYLAVAAIVAGGLYGVERGLEPPEPYAGNAYHAP
GVERLPATLAEAASAFERSTLAREVFGDDVVAHYLNNARVELAAFNAAVT
DWERTRGFERL
379763103YP_005349500.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MGLTTYLERVQTGIWDIPAGYLPTDYFEGVIQAGGIAVLLPPQPADAEVV
GAVLDGVHALVITGGYDLDPASYGQQPHPTTDEPRTDRDAWEFALLRAAL
HRGLPVLGICRGTQVLNVALGGTLHQHLPDVLGHCGHRAGDGVFTRVPVR
TVAGTRAAALVGETVDAPCYHHQAIDRVGDGLVVSATDPDGVVEALELPG
DRFVLGVQWHPEQSLEDLRLFAAIVDAARAYAGR
379763102YP_005349499.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MVATQLINPATEEVLRSVEHADAAAVDDAVGRARAAQRRWARLSPAERAS
GLRAFAAAVDAHLDELAALEVANSGHPIGSAEWEAGHVRDVLTYYSASPE
RLSGKQIPVSGGLDVTFNEPLGVVGVIAPWNFPMPIACWGFAPALAAGNA
VLVKPAEATPLTTIRLGELAADAGLDPDLLQVLPGPGPVVGERFVTHPDI
AKIVFTGSTEVGKRVLAVAAARVKRVTLELGGKSANIVFADCDLERAAAT
APAGVFDNAGQDCCARSRILVQRSVYDRFMELLEPAVKGVVVGDPASRGT
EMGPLVSAAHRARVASYVPDGAPVAFRGTAPSGRGFWFPPTVLTPQRTDR
TVTEEIFGPVVTVLAFDDEQDAVTLANDTAYGLSGSIWTNDLSRALRVSR
AVEAGNLSVNSHSSVRYNTPFGGFKQSGLGRELGPDAPLGFTETKNVFIA
IGED
379763101YP_005349498.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAVDLTQRLAGRVAVVTGAGGGIGLASARRMRAEGATVVVADVDHDAGAA
AADELSGLFVPTDVADEDAVNALFDTAAQAYGRVDIAFNNAGISPPDDDV
IENTELPAWQRVQDVNLKSVYLCCRAALRHMVPARRGSIINTASFVAVLG
SATSQISYTASKGGVLAMSRELGVQFARQGIRVNALCPGPVNTPLLQELF
AKDPERAARRLVHVPVGRFADPGEIAAAVAFLASDDASFITASTFLVDGG
ISSAYVTPL
379763100YP_005349497.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MKDAPNVFEHQPHRPPPAEAVMDFATLPPEINSALMYSGPGAGSMVAAAA
AWDKLAARLCTAAADYRAVTAKLAAQWEGPAPSALREAARYVDWLDANAA
RSQEAAVQLGAAAGAHEAAFAATVPPPAIAGNRARRTALVSANWLGQHSA
AIADVDTDYDAMWARNAGAMYAYADAAAGAATLAPFTPPPSDAGARADSW
LLKAAPDVISAGRRVMSAIPGALEHLSSASRTTFEASLSSVTPSLSKLNS
LTAPSDFAIGHLNSMNKAAALRTLFPRPAAVDGVNARVGRGVSLGALSVP
RSWTTAASAAQGLGGDRRAKAPAWSGPVGAAVRAESRRPS
379763099YP_005349496.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MLFRVGGQTRRWRPATAIVAALGVFIALIAGSSLRPQFAASSLPEPAAWS
GPAAGVGAHALPRGLHSAVGRPAPAAWESPAPADNTNKKPFHSMWMTKER
PQTWNRSSAQVALSPAPTTFGPVRAAPDHAQSRSPAIIATDRDTLTRLCI
ARV
379763098YP_005349495.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MPGSLRDVLPAAAALLGVPGAVDTLAVTERAGSDRIDRVLVVLVDGLGWH
LLPQLAGGAPLLASVLGGATGRLTRLECTFPSTTPTSLVSLGTGAAPGEH
GVLGFTLRVPGTETVLNHVRWRDDPSPAVWQPVPTWFQRLKEAGVSARAV
LPALFLGSGLTEAAYRGAEFRPAGPADDYAQLVVDDLRSAPGLVYGYTAE
LDTAAHVFGVGSEQWHAAAASVDTLLSRLLEALPPNAALLVTADHGGLNV
PPEARIDLDADARLARGVRVVAGEPRVRYLHTEPGAAPDVRAAWAEVLGG
RATVYSREQAVGTGMFGPVAAPHLERLGDVVVVCSGDTAVLASAHEPPEA
SRLIGFHGGASPAEMAIPLIVFRP
379763097YP_005349494.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MCPAPGGPLDLVQHHRADVVSLLAERGRIGEPIVGVCFDGTGNGGDETIW
GGEILALGARSRQFVRVGHLRPVPMPGGDAAVREPWRMALSQLWTADIDW
TPDLAPVAAATDDALRLVRSQLETGTGCVPCSSMGRLFDAVASLLGVRHR
IDYEGQAAVELEALAESAGCDPGRPRPSLPLAVRPNGVIDPVPMVQTMVA
ALYAGTPRAVLAATFHLAVADAVADVVARVAGDTRLVGLTGGVFQNVLLT
RACRDLLQRNGFEVLTHRTVPPNGGGPSPGQAVVSVLTAREGATR
379763096YP_005349493.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTARILVAGIGNSFLGDDGFGSEVVRNAELPQDDPMVQVIDYGIRGMHLA
YDLLEEWDTLVLVDAVPSRGHPGTLHVFQADHETPSRTSGLDGHSMDPAA
VFASLRALGGRPPYTVVVGCEAGSVQEGIGLTEPVAKAVPRAARAVEEIV
AALHGAALPAAEDGY
379763095YP_005349492.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MASTEIDRRPSRVTRLLGALTTAEWWRLAAMLASIVALHLLGWLTLVFLV
APAQYSLGGKAFGVGIGLTAYTLGMRHAFDADHIAAIDNTTRKLMNDGQR
PLAVGFFFSLGHSTVVFALALLLAGGVKTVVGPVEDDSSTLHHYTGLIGT
SVSGVFLYAIALLNLIVLAGILRVFARLRRGEFDPETDGAELERQLQSRG
LMNRVLGRLTKSITKSWHCYPIGLLFGLGFDTATEIALLVLAGTSAAAGL
PWYAIICLPVLFAAGMCLLDTIDGSFMNFAYGWAFSNPVRKIYYNITITA
LSVAVALLIGSVELLVLFADQFGWRGAFWTWIGGLDLNAVGYVVVGMFVV
TWAVALLVWRYGRIEEKWGPTDLGAESAT
379763094YP_005349491.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]METYDVAIIGTGSGNSILDERFADKRVAICEQGTFGGTCLNVGCIPTKMF
VYAAEVAQSIREAARYGIDARIERVRWDDIVSRVFGRIDPIGVSGEDYRN
AAPNIDVYKQHTRFGAVQPDGRYLLRTDAGDEFTADQVVIAAGARAVVPP
AILECGATYHTSDTIMRIPELPEHLVIVGGGFVAAEFAHTFSSLGSRVTL
VVRGSTLLRHLDDVVGERFTRIAASKWELHTHRNVVGAENQGSGVAVQLD
DGRTVNADALLVATGRVPNGDLLDAEQAGVTVTDGLVVVDEYQRTTARGV
FALGDVSSSYQLKHVANHEARVVQHNLLCDWDDTEALAATDHRYVPAAVF
TDPQIASVGLTENQAIAQGFKISVKIQNYGDVAYGWAAEDTTGIVKLVAE
RGTGRLLGAHIMGDQASSIIQPLIQAMSFGLTALQTARGQYWIHPALAEV
VENALLGLH
379763093YP_005349490.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MPDVLPGYWQRTIALGRDPAGEGDIVATLIRRGPAQAGPAGRAVLAVHGY
TDYFFHTELADHFAARGFAFYALDLHKCGRSRRDGQTPHFVTDLANYDTE
LEHALDVVRAQARDVLVYGHSAGGLIVSLWLDRLRRRNPDAHADIGGLVL
NSPFLDLPGPAILRHSATVALLGGLSRVRSKGVARSPGEGGYGTTLHRDY
GGQFDYNLQWKPVGGFPITFGWLHAVRRGQARLHRGLDVGVPNLILRSDH
SVRETADPEPMRCGDAVLDVTQIARWAGCVGNRSTIVPVVDAKHDVFLSL
EGPRDVAYRELDLWLDEYLPTNNSDAPASFGRG
379763092YP_005349489.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MLVGAGIMSATLGALLRRLQPEWSLTFVERLDAVAAESSSPWNNAGTGHS
ALCELNYTPQRADGSIDISKAVRINEQFQVTRQFWAHAVENGILTDRSFL
TRIPHASFVRGARRVDYLRRRRDALAANPLFAGIELIEDPGEFARRLPLM
AAHRDFSTPTALNWAAHGTDVDFGALSRQLVGFCVRGGATALFGHEVRNL
TRGSDGGWTVSIRNRRTGQKRRCHAKFVFVGAGGDALPLLQKSGISEVRG
FAGFPIGGRFLRADKPALTAAHRAKVYGAPAPGAPPLGALHLDLRYVNDK
PWLVFGPYAGWSPKFLKRGHFTDLPRSVKPHNLASLLGVGATQLTLLGYL
LGQLRLSEPDRLRMLREFAPTAAGSDWELTVAGQRVQVIRRDRRKGGVLD
FDTTVVGAADGSIAGLLGGSPGASTAVPIMLDVLQRCFANRFQSWLPALK
EMVPSLGASLSDEPALYDEVFSWGTKVLGLDVND
379763091YP_005349488.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTEALRRIWAKDLDAQTLYELLKLRVEVFVVEQAIPYPELDGRDLLAETR
HFWLETADGEVICTLRLMEEHAGGEKAFRIGRLCTKRSARGQGHTTRLLR
AALAEVGDYPCRINAQTYLADMYAQHGFVRDGDDFVDDGVPHVPMLRPGS
GLAAKP
379763090YP_005349487.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MRPYPFSAIVGHDQLRLALLLCAVRPEIGGALIRGEKGTAKSTAVRGLAA
LLCAATGSDSGLVEMPLGATEDRVIGSLDLQRVLRDGEHAFSPGLLARAH
GGVLYVDEVNLLHDHLVDVLLDAAAMGRVHIERDGISHSHEARFVLIGTM
NPEEGELRPQLLDRFGLTVDVHASRDVDVRVQVIRQRMAYEADPDGFAER
YAAADAELARRIAAARALVDDVVLPDNELRRIAALCAAFDVDGMRADLVV
ARTAVAHAAWRGAPAVEEQDIRVAAELALPHRRRRDPFDDPGIDRDQLDE
ALARAGSEPDPEPDPPGGGQTPDTEQAGPQRDSGDSTTGKPPKSKPSAPP
SKTFRTRALRVPGVGEGAPGRRSRARNAGGSVIAATDGDDTSCGGHGLHV
FATLLSAAERAGAGPLRPGPDDVRRAVREGREGNLVIFVVDASGSMAARD
RMAAVSGATLSLLRDAYQRRDKVAVITFRHQQAQLLLPPTSSAHIAGRRL
ARFDTGGKTPLAEGLLAARELIVREKARDRARRALVVVLTDGRATAGPDP
LGRTRSAAARLVAEGAAAVVVDCETSFVRLGLAEQLARQLGAPAVRLEQL
HADSLTRAVRDVA
379763089YP_005349486.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MPQGVPVQVPDDGLTTRARRHTPVLAVHTGAGKGKSTAAFGMALRAWNAG
LSVAVFQFVKSAKWKVGEEAAFAALGDVHEQHGAGAPVEWHKMGAGWSWT
RKAGSDTDHAAAAADGWAEIARRLADQRHDFYVLDEFTYPLKWGWVDVHE
VVEVLAARPGHQHVVITGRDAPRPLIDAADLVTEMTKLKHPMDAGRKGQK
GIEW
379763088YP_005349485.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MVIAAPSSGSGKTTVATGLIGALRRAGHTVAPFKVGPDFIDPGYHGLAAG
RPGRNLDPVLVGEGLIGPLYAHGAAGADIAVIEGVMGLFDGRIGPSAATP
AAGSTAHVARLLGAPVVLVIDARGQSQSIAALLHGFSTFDTATRVTGVIL
NRVGSTRHEQVLRQACEQAGVPVLGAIPRAAELELPTRYLGLVTAVEYGR
RARQAVDAMTALVAAHVDLASVIAVARAPAAGQPWDPAAAVGESARRRAT
VAVAAGKAFSFGYAEHPELLAAAGADVVAFDPLSDALPDGSDAVLLPGGF
PEQFTAELSANEVVRRQIKELAAAGAPVHAECAGLIYLATELDGHPMCGV
LAGRARFTPQLTLAYRDAVAVADSPLYTAGQRAVGHEFHRTAVTFSDSYQ
PAWMYRAPDADDADDAGGAVRDGVVHGGVHASYLHTHPAAAPEAVARFVA
HAARRAGSRT
379763087YP_005349484.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTESAYLVGLRLTGKKVVVVGGGTVAQRRLPLLIASGADVHVISRSATRS
VEAMTGITLALREYRDGDLDGAWYAIAATDDPRVNEAVVAEAASRQIFCV
RADIAVEGTAVTPASFSYAGLSVGVLAGGEHRRSAAIRSAIREALQTGVI
TPEGPVGSDAVKGGVALIGGGPGDPELITVRGRRLLAQADVVVADRLAPP
ELLAELPPHVEVIDAAKIPYGRAMAQDAINDVMIERARAGSFVVRLKGGD
PFVFARGYEEVLACAEAGIPVTVVPGVTSAIGVPALAGVPVTHRAINHEF
VVVSGHLPPGHPESLVNWDALAAMSGTIVLLMAVERIELFAEALLAGGRP
ADTPVLVVQHGTTAAQHTLRATLADTPEKIRAEGIRPPAIIVIGAVAAFG
V
379763086YP_005349483.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MRTAETAAKPPAETASNRISKYYPAWLPSRRFIAAVIAIGGMQLLATMDS
TVAIVALPKIQNELSLSDAGRSWVITAYVLTFGGLMLLGGRLGDTIGRKR
TFIVGVALFTISSVLCAVAWDEATMVIARLSQGVGSAIASPTGLALVATT
FPKGPARNFATAVFAAMTAVGSVMGLVVGGALTEVSWRLAFLVNVPIGLV
MMYLARTALRETNRERMKLDATGAMLATLTCTAAVFAFSMGPEKGWVSIT
TIGSGVVAMLAGLGFIIVERTAENPVVPFDLFRDRNRLVTFTAIFLAGGL
MFSLTVCIGLYVQDILGYSALHAGVGFIPFVIAMGIGLGISSQLVSRFSP
RVLTIGGGILLFWAMLYGWAFMHRGVAYFPNLVLPIVVGGIGIGMAVVPL
TLSAIAGVGFDQIGPVSAVTLMLQSLGGPLVLAVIQAVITSRTLYLGGTT
GPVKNMNDAQLQALDHGYTYGLLWVAGVAVIVGGAALLIGYTPDQVAHAQ
EVKEAMDAGEL
379763085YP_005349482.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MITRMSQLFLRTLRDDPADAEVASHKLLIRAGYIRPVAPGLYSWLPLGLR
VLRRIEGIVREEMNAIGGQEILFPALLPRAPYEATNRWTEYGDSVFRLKD
RRGNDYLLGPTHEELFTLTVKGEYSSYKDFPVLLYQIQNKYRDEARPRAG
ILRVREFLMKDSYSFDVDDAGLKAAYHAHREAYQRIFARLQVRYVIVSAV
SGAMGGSASEEFLAESPVGEDTFVRCLESGYAANVEAVVTARPEAQPIDG
LPEAVVHDTGDTPTIATLVDWANTADLGRTVTAADTLKNVLLKVREPGGD
WELLAIGLPGDREVDDKRLGAALEPAEYAMLDDADFAKYPFLVKGYIGPK
ALRDNGVRYLVDPRVVDGTSWITGADEPGRHVVGLVAGRDFTADGTIEAA
EVRDGDPSPDGAGPLVSARGIEVAHIFQLGRKYTDAFTADVLGEDGKPVR
LTMGSYGLGVSRMVAVIAEQHHDELGLRWPSSVAPFDVHLVIANKDDRAR
TGATELAGELDRLGVDVLLDDRQASPGVKFKDAELLGVPWIVVVGRGWAD
GVVELRDRFGGQTRELATGASLASDIAAALETG
379763084YP_005349481.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSSGKDADNAALSDALAIEHSTIYGYGIVSAMSPPSVNGMVVEALEQHRQ
RRDDVIAMLTARKVTAPVAAAGYQLPLVVGSPADAARLAARMENDGAGAW
RVVAEHAETAEDRAFASTALVQSAVMAARWNRVLGAWPITTSFPGGND
379763083YP_005349480.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAALGVVSACGKSAPKPPPVEQLLGPLDQARHDSALASAAASAVGNPPQV
AAALTVVASQRAAHARALSTEIARAAGKLAAPSSSETPSPSQAEPAGPPP
PPPPVADVINALHASADSAARLVGTESGYRAGLLASIAASCTASYTVALV
PGGPSI
379763082YP_005349479.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTTGLPSQTQVIELLDAEFARAGYEIEDVVIDARTRPPRITVIADGDDGL
DLDTAATLSRSASALLDDLDTIGDHYVLEVSSPGVDRPLTSAKHFRRARG
RKVDVTLSDGSTLTGRIGETNEDAVALVVRTGRDWAIREISLGDVVKAVV
QVEFSPPADAELALAKRGAGEERC
379763081YP_005349478.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MNIDMAALHAIEVDRGISVNELLETIKSALLTAYRHTEGHQNDARIEIDR
KTGVVRVIARETDEDDNVISEWDDTPEGFGRIAATTARQVMLQRFRDAEN
ERTYGEFSTREGEIVAGVIQRDSRANARGLVVVRMGTETKASEGVIPAAE
QVPGESYEHGNRVRCYVIGVTRGAREPLITLSRTHPNLVRKLFSLEVPEI
ADESVEIVAVAREAGHRSKIAVKSNLPGLNAKGACIGPMGQRVRNVMSEL
SGEKIDIIDYDEDPARFVANALSPAKVVSVSIIDPSARAARVVVPDFQLS
LAIGKEGQNARLAARLTGWRIDIRGDSPGGHPENEPEHGATHGMAHDR
379763080YP_005349477.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAVELLRVVAVPTGNGEFAVIVDTGSRLPGRGAWLHPVPHCAQQAIRRRA
FTKALRITGSPDTSAVVEHIESLSAPDRPATEQVAKNMSTP
379763079YP_005349476.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAKELGVTSKEVLARLNDQGEFVKSASSTVEAPVARRLRESFGGGKPAAE
KAPAKAAKGDAKASAKAPDKSLDAALDNAINKPAGNGEATATPAQPGGAA
PAAAAQASGAAPSDAPARPGPAPARPSEPSPGQPKPPAPGLVPHPGMTPD
PRPGPIPKPRAPRVGNNPFSSAQPVDRPIARPAAPRPGAPRPGAPRPGAS
PGNMPPRPAGAAGQGRPPRPGAPRPGGGRPGGPGGRDGGGGNYRGGGGGV
GAPPGGGGGFRGRPGGGGGRPGQRGGAAGAFGRPGGAPRRGRKSKRAKRA
EYENMQAPVVGGVRLPHGNGETIRLARGASLSDFADKINANPASLVQALF
NLGEMVTATQSVGDETLELLGSEMNYVVQVVSPEDEDRELLESFDLTYGE
DEGTEEDLQTRPPVVTVMGHVDHGKTRLLDTIRKANVREAEAGGITQHIG
AYQVSVEHDGDERPITFIDTPGHEAFTAMRARGAKATDIAILVVAADDGV
MPQTVEAINHAQAADVPIVVAVNKIDVEGADPAKIRGQLTEYGLVAEDFG
GETMFVDISAKQGTNIDALLEAVLLTADAALDLRANPDMEAQGVAIEAHL
DRGRGPVATVLVQRGTLRVGDSVVAGDAYGRVRRMVDEHGDDVEEALPSR
PVQVIGFTSVPGAGDNLLVVDEDRIARQIADKRSARKRNALAARSRKRIS
LEDLDSALKETSQLNLILKGDNAGTVEALEEALMGIQIDDEVALRVIDRG
VGGITETNVNLASASDAVIIGFNVRAEGKATELANREGVEIRYYSVIYQA
IDEIEKALRGMLKPIYEENQLGRAEIRAIFRSSKVGIIAGCMISSGVVRR
NAKARLLRDNVVVTENLTINSLRREKDDVTEVREGFECGMTLGYSDIKEG
DIIESYELVQKERS
379763078YP_005349475.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MADPARARRLAKRINTIVASAIEFEIKDPGLDGVTIVDAKVTADLHDATV
FYTVMGRTLDDEPDYGAAAAALERAKGALRTMVGAGTGVRFTPTLTFTRD
TTSDNVQRMDELLARARAADADLARVRSGAKPAGEADPYRDSGSGAEPGL
DGSIGDDDQREY
379763077YP_005349474.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MGARVDAPAAVDLLSDAATVAVIAHVHPDADTIGAGLALGLVLDKCGKRV
EVSFAEPAGLPESLASLPGRHLLVSPDAMRRDVDLVVTVDVPSVKRLGAL
SELAVSGAEVLVIDHHASNDMFGTANFVDVSADSTTMMIADILDAWGKPI
DSDVAHCIYAGLTTDTGSFRWASARALRLAARLVDAGVDNAAISRTLMDT
HPFGWLPLLSRVLASAQLVPGAAGGRGLVYAVVGHQDWSGSRPEEVESIV
DIVRTTQQAEVAAVFKEVAPGQWSVSMRAKAEVDLATVASAFGGGGHRLA
AGYSTTGPIEDAVAALRTALG
379763076YP_005349473.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTEPDRPDAGGRRIAGLALPALGVLAAEPLYLLFDTAVVGRLGALSLAGL
AIGGLLLSLVGSDLTFLSYGTTARSARHFGAGNRSSAVTEGVQATWLALG
LGALVVIAVQTAAVPLVSVIAGGKVGGEAIAAAALPWLRIAIFGAPAILV
SLAGNGWMRGVQDTVRPLRYVVAGFGLSALLCPLLVYGWLGLPRLGLAGS
AVANLAGQWLAAVLFGRALLAERAPLRLDRAVLRAQLVMGRDLVVRTLAF
QACFVSAGAVAARFGASALAAHQVVLQLWEFLALVLDSLAIAAQALVGAA
LGAGDAAHAKSVARRVTLFSAAAAALLAALCAVGFSALPRLFTDDRSVLA
AIGVPWWFLVAQLPFAGIVFALDGVLLGAGDAAFMRTATVISALVGFLPL
IWLSLVFGWGLAGIWTGLTTFVLLRLVFVGARAISGRWAATTGR
379763075YP_005349472.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MMRAVVGISRALACLALAASAIAAGGPLAAAQPPPKFPNLDGYTAVPAEG
YLSTGASPRIAFSAPYALVCDFYGGPAPAPQPSQDIKCKGDMSGMDDVPI
PGGHPRPGDCVVGSVDFKGPGYQLSRMSYSGCDGNPPALPTGAKLLAAGQ
KLTYLNVTCAVGADNLVACLDTTSGDHGFVVQRSGSWAF
379763074YP_005349471.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTDEILLIDTEERVRTLTLNRPQSRNALSSALRDRFFGALADAETDDDVD
VVIVTGADPVFCAGLDLKELGGSSALPDISPRWPAMTKPVIGAINGAAVT
GGLELALYCDILIASENARFADTHARVGLLPTWGLSVRLPQKVGIGLARR
MSMTGDYLSAADALRAGLVTEAVPHERLLGAARQVAASIVGNNQDAVRAL
LASYHRIDDAQTGAGLWQEAMAARQFRTSGDDIAANREAVLQRGRAQVR
379763073YP_005349470.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MCRNITELRGLQPAATAEEIAAAARQYVRKVSGITHPSAVNAEAFEQAVA
EVTETTTRLLGRLAPRRQPPKTVPPLRRPEVVARLAGAT
379763072YP_005349469.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTVTATMPALKEWSAAVHALLDGRQRVLLRKGGTGEKRFDLAAREFLLFP
TVAHSHAERVRTEHRDLLEPAAADSTDDELVIRAAAKVVAAVAVERPDGL
AAIEDLHIWTPESVRADRLDFRPKHKLAVLVVSVIPLAEPARIARTPEYA
GCKSWVELPVHAPLAAPVHDDPALDAVAARVRDAVG
379763071YP_005349468.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSITSIRPAQPTLHTLNHLGGKALGRLLGLPPATTDYTVERVRVPMRDGV
ALVADHYTPATPVGTLLVRSPYGRGFPFTLIFGALYAARGYHVVLQSVRG
TFGSGGVFEPMADEIADGADTVAWLREQPWFTGSFATIGMSYLGFTQWAL
LQDPPPELSTAVIAVGPHDFNESTWGTGSFAVNDFLGWSDMVAHQEDPVR
ARAALRQLQTRRKVPRAAAATPLGEAARALLGTGAPWFESWAEHSDPGDP
FWNALRCNEALDRVQVPVLLIGGWQDLFIRQTLRQYAHLHGRGVDVALTV
GPWTHTQLLTTGLATCARETLDWLGTHLGEAPARRPSPVRVYVTGVGRGQ
GWRSLPAWPPVTTERALYLRPGGYLGETAPTLKGLSPATFRYDPADPTPT
IGGPMLSANGGYRDDGRLASRADVLAFTSATLTQDLYAYGTPVVELAHGA
DNPHVDLFVRVSEVDPKGRSRNVSEAYRRLATAAKTKSEKVVRLELDGIA
HRFRAGSRIRVLIAGSWSPRYAHNLGGDEPVLTARRATPVTHSVRYGRSR
LVLPVGPAELSADGIADAGGDGV
379763070YP_005349467.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MFANVRLMGALGALLTAAIGGTVGVLSGSPSLPGGGDRPVELRSTAQPME
TTMKSPIVATTDPRPFDACEDIPFDVVQRLGLGFTPPEHEDGLRCHFDAG
NYQVAVEPIIWRTYEASLPADAVETTIAGHRAAQYWVLKPTYHNSYWFYS
CMVVFKTSYGVLQQALYYSTVYSDPEVDCMQTNLQRANDLAPYYKF
379763069YP_005349466.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAGHRSGQDSTNGGQPTLWAVSDLHTGHLGNKPVTESLHPSSPDDWLIVA
GDVAERTDEIRWALDLLRRRFAEVIWVPGNHELWTTTRDPVQVFGKARYD
YLVNMCDEMGVITPEHPFPVWTERGGPATIVPMFLLYDYSFLPEGATSKA
EGLTIARDRNVVATDEFLLSPEPYPTREAWCRERLEITRARLEELDWMTP
TVLVNHFPLVRDPCDALFYPEFSLWCGTTKTADWHTRYNAVCSVYGHLHI
PRTTWYDDVRFEEVSVGYPREWRRRKPPSWLRQVLPDPQYAPGDLNDFGG
HFEITPEMRQQATQFRERLRQRQSR
379763068YP_005349465.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTGEHTLVSSVLPATDGLAYSEVYSDPPDLAPLPEEEPLIARSVAKRRNE
FITVRHCARIALGELGLPPVPILKGEKGEPCWPDGVVGSLTHCTGYRGAV
VGRTDALRSVGIDAEPHDVLPDGVLNAISLPAERTEIPAHLSGDLHWDRI
LFCAKEATYKAWFPLTKRWLGFEDAHIAFESDGPGAATGRFVSRILIDPA
ALSGPPLTELAGRWSVERGLVLTAIVL
379763067YP_005349464.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSGPGIVVVDKPPAMTSHDVVGRCRRIFSTRRVGHAGTLDPMATGVLVIG
VERATKILGLLSASSKSYAATIRLGQSTSTDDAEGEPVRSVPAGHLTAEA
IGTAVEGLRGDIAQVPSTVSAIKVGGKRAYRLAREGHAVELEARPVRIDR
FDVRDIRPGPHGVDVLDVDVEVDCSSGTYIRALARDLGAALGVGGHLTAL
RRTRAGRFGLDQAYSLDELAERPRLSYSLDEACLLIFPRRQLSAGEADAA
ANGRSLPAAGIDGVYAACDPDGRVVALLRDEGARTKSVVVVRPATMQSGT
D
379763066YP_005349463.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSNKMSNKVYVIGVGMTKFEKPGRREGWDYPDMARESGTNALADAGIAYH
EVQQGYVGYVAGDSTSGQRALYELGMTGIPVVNVNNNCSTGSTALFLAAQ
AIRGGIVDCAIALGFEKMQPGSLGGGAQDRESPMGKHVKAMAAIDEFTMP
VAPWMFGAAGREHMKQYGSTAEHFAKIGYKNHKHSVNNPFAQFQESYTLE
DILAARMISDPLTKLQCSPTSDGSGAAILASESFVDSHGLAGQAVEIVGQ
AMTTDFASTFDGSAKNLIGYDMNVQAAQQVYDQSGLGPQDFQVIELHDCF
SANELLLYEALGLCGPGEAPKLIDNNDTTYGGRWVVNPSGGLISKGHPLG
ATGLAQCAELTWQLRGTAEARQVDNVSAALQHNIGLGGAAVVTAYQRAER
379763065YP_005349462.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MIEWSDTDLMVRDAVRQFVDKEIRPHLDELETGAMSPYPIARKLFSQFGL
DAMAAESVKKMLDRERSGERQSDGEASGFGGGAQGSMIAVLVSEIARVSI
GLLSTASVSLGLGAATIMSRGTLAQKERWLPELMTLEKIAAWAITEPDSG
SDAFGGMKTYVKRDGADYILNGQKTFITNGPCADVLVVYAKLDEGDADPT
KVDKRNRPVLVFVLDAGMPGLTQGKPFKKMGMMSSPTGELFFDNVRLSPD
RLLGESEQHTDGDGRDSARANFAAERIGIAMMALGIIDECHRLCVDYAKS
RTLWGKNIGQFQLIQLKLAKMEIARMNVQNMVFHTIERQQAGKPLTLAEA
SAIKLYSSEAATEVAMEAVQLFGGNGYMAEYRVEQLARDAKSLMIYAGSN
EVQITHIAKGLLAD
379763064YP_005349461.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSADEERGGLTAVGQDYLKAIWNAQEWSPDKVSTKMLAEKIGVSASTASE
SIRKLAEQGLVDHEKYGAVTLTEAGRRAALEMVRRHRLLETFLVNELGYA
WDEVHDEAEVLEHAVSDRLVSRIDAKLGFPQRDPHGDPIPATDGQVPTPP
ARQLWACGDGDAGTVARISDADPEMLRYFTDVGINLDSRLRVLTRREFAG
MISVAIESGDGDETTVDLGSPAARAIWVTA
379763063YP_005349460.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MLTIGVFDGVHRGHAELIAHAVKAGRARSVPTVLMTFDPHPMEVVYPGSH
PAQLTTLTRRAELVEELGIDVFLVMPFTTDFMKLTPDRYVHELLVENLHV
VEVVVGENFTFGKKATGNVETLRRAGDRFGFAVESMSLLSEHHSNETVTF
SSTYIRSCVDAGDVVAATEALGRPHRVEGVVVRGHGRGAELGFPTANVAP
PMYSAIPADGVYAAWFTVLGHGPVTGTVIPGERYQAAVSVGTNPTFSGRT
RTVEAFVLDTDADLYGQHVALDFVGRIRGQHKFGSVEELIVAMGEDTERA
RTILSTQD
379763062YP_005349459.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MPVTGVEHDPDNLTLTITADFAAPVHRIWQVYADPRQLEKVWGPPSHPAT
VVDHSLTPGGRTTYFMTGPDGEKYAGYWEITAVDEPTSFSFLDGFADLDF
NPNPGLPVSRNVYTFTEHDGGTRATYVSAFESAEALQQVLDMGVVEGSSS
AINQIDDLVAS
379763061YP_005349458.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MDEEDRVDALFHALADRTRRDIMRRTLAGEHSVSTLARKYDMSFAAVQKH
VVVLEKAGLVTKRRSGREQLASGDVTAVRSVASMLAELELLWRDRIARID
ELISSDSTKED
379763060YP_005349457.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MALTAEQKKEILGTYGLHDTDTGSPEAQVALLTKRIADLTEHLKVHKHDH
HSRRGLLLLVGRRRRLLKYVAQIDVERYRSLVERLGLRR
379763059YP_005349456.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MFEATATIDNGSFGTRTIRFETGRLAQQAAGAVVAYLDDENMLLSATTAS
KSPKEHFDFFPLTVDVEERMYAAGRIPGSFFRREGRPSTDAILTCRLIDR
PLRPSFVSGLRNEIQVVVTVMSLDPNDLYDVLAINAASASTQLSGLPFSG
PIGGVRVALIDGQWVAFPTVEQLERAVFDMVVAGRIVGGGAAEKDIAIMM
VEAEATENVIELVEGGAQAPTETVVAEGLEAAKPFIATLCTAQEELAGAA
AKPVGEFPTFPDYQEDVYYSVASVATDELAKALTIGGKAERDARTDELKA
EVLARLAETYEGREKEVSAAFRSLTKKLVRQRILTDHFRIDGRGITDIRA
LSAEVAVVPRAHGSALFQRGETQILGVTTLDMVKMAQQIDSLGPETSKRY
MHHYNFPPFSTGETGRVGSPKRREIGHGALAERALIPVLPGVEDFPYAIR
QVSEALGSNGSTSMGSVCASTLSLLNAGVPLKAPVAGIAMGLVSDDVEID
GRTERRFVTLTDILGAEDAFGDMDFKCAGTKDFVTALQLDTKLDGIPSQV
LAGALGQAKDARLTILEVMAEAIDAPDEMSPYAPRVTTIKVPVDKIGEVI
GPKGKVINGITEETGAQISIEDDGTVFVGATDGPSAQAAIDRINAIANPQ
LPTVGERFLGTVVKTTDFGAFVSLLPGRDGLVHISKLGKGKRIAKVEDVV
NVGDKLRVEIADIDKRGKISLVLVEDDNSAPADAPAAAPADAAS
379763058YP_005349455.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MPRADSGKRAADPALRRGNHTAAADPHAALRRTTLPGGLRVVTEYLPAVR
SASVGVWVGVGSRDEGATVAGAAHFLEHLLFKSTPSRTAVDIAQAMDAVG
GELNAFTAKEHTCYYAHVLDSDLALAVDLVADVVLNGRCAAEDVELERDV
VLEEIAMRDDDPEDALGDMFLGALFGDHPVGRPVIGTARSVTSMTRSQLH
SFHVRRYTPERMVVAVAGNVDHDEVVALVREHFGPHLVRGRAPIAPRKGA
GRVNGRPGLALGHRDAEQTHVSLGVRTPGRGWQHRWALSVLNTALGGGLS
SRLFQEVRELRGLAYSVYSTVDIFADSGALSVYAACQPERFAEVMEVTGA
VLDAVARDGITEAECRIAKGSLRGGLVLGLEDSGSRMSRLGRSELNYGKH
RSIEHTLRQIDQVTVDEVNAVARRLLGQRYGAAVLGPYATKRSLPQQLRA
MVG
379763057YP_005349454.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MVLGFWDIAVPIVGAPMAGGPGTPALAAAVSNAGGLGFVPGGYLTAERFA
DDIAAARKATTGPLGVNLFVPQPSVADWVALDYYAAELEEIADHYQVEVG
HPRYGDDDGWEQKLEVVADVRPELVSFTFGVPPPDVIRRLGALGLLVMVT
VTSAYEAGVAVAAGADSLVVQGPAAGGHRGTFAPDMEPANESLHQLIDRI
RNTHDIPIIAAGGLGTADEIGAALRRGAVAAQVGTALLLADEAGTNPAHR
TALKNPLFATTVVTRAFSGRYARGLENDFTRMLDHVAPLGYPEVNQMTSP
IREAAAALEDPNGIPLWAGAAFKHASAGPAADIIAGLVATD
379763056YP_005349453.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MRVGVPTETKTNEFRVAITPAGVAELVRRGHDVLVQTGAGEGSAIADSEF
KAAGAQLADTAEQVWGDADLLLKVKEPVPAEYELLRRNQILFTYLHLAAS
RACTEALLASGTTSIAYETVQTADGTLPLLAPMSEVAGRLSAQVGAYHLM
RTHGGRGVLMGGVPGVKPADVVVIGAGTAGYNAARVANGMGAMVSVLDVN
INKLRLLDAEFGGQVRTRYSSAYDLEGTVKRADLVIGAVLRPGAKAPSLV
SNSLVAQMKPGGVLVDISIDQGGCFEDSRPTTHDDPTFAVHDTLFYCVAN
MPSAVPKTSTVALTNATMPYVLALAERGWRAACRSDHALAKGLSTHDGAL
LSGQVAADLGLPCTDPACVLG
379763055YP_005349452.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTAPCVSATVQIDARPDVVYRLITHLPTLASLAEEAVAMQWRKGEAVAPG
AVFAGHNENRGRRWSTRCTVTDAEPGRRFAFDVRYSILPVARWQYDIVAA
DGGCEVTESTWDRRPGWFRKVAGKATGVSDRVAANTEHIRLTLQRLKQRA
ETE
379763054YP_005349451.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTRRDPAVAVVGAGMSGLCVAIALLRSGITDVTIFEKADEVGGTWRDNTY
PGLTCDIPSRVYQYTFATNPHWSHMFSPGGEIQDYFRKIADRFGLRDRIR
FGTEITDARFENGRWSLRIAAGEQCAADFLITATGVLHHPRMPSIAGLDD
FGGHVFHSACWDHSVELAGRRIAIVGNGSTGVQLVCGLAGVAGRVVLFQR
TPQWVLKLPNPRYTRLAGITRNRFPWLDRVAYRGYSMVFDLFAVGLTKPG
VRRKIMGALCRASLREVRDPELRRALTPDYTPMCKRLVMSGGFYRAMQRD
DVDLVTAGIDHVERRGIVTDDGVLHDVDIIVLATGFDTHAFFRPMRLIGR
DGIAADDVWRDGPRAYQTVAMPGFPNFFMMLGPHSPVGNLALTTVAESQA
DHILGWIQRWRRGEFDTVEPTRSATDSFNARLRAAMPNTVWTTGCDSWYL
NKDGVPEVWPFTPAAHRAMLANTDPGSYDLRPVAP
379763053YP_005349450.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MLTVDDQAAGPHDASLDHERLVLEARDVHFDWAALPFHYVPGEPFSTHVL
NVLHLLLPAGEEFFVDVFKKTLPLIKDDQLRLDVQGFIGQEAVHSQAHAG
VLAHFAARGIDLTPYTGQIKWLFDKLLGPRPRWSERRQHSWLLEQVSMVS
AIEHYTAILGEWILNSPAHDAIGTDPVMLDMLRWHGAEEVEHKAVAFDTM
KHLRAGYWRQVRAQLVVSPAMLLLWIRGVRFLYSLDPHLPPGAKPRWRDY
FAAARRGLVPGPLRFVRAIGNYYRPGFHPSQLGGLGLAVDYLAVSPAARA
SH
379763052YP_005349449.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MGTTSRITASDGVTLAVHRYTDIDPARPTILAIHGFPDNHHVWDGVAGEL
AGRPYNFVAYDVRGAGESSSPAEPSGYRFAQLVSDIEAVIDSLGVERVHL
LGHDWGSIQAWAAVTDDSVMPKVASFTSISGPHLQYAGAFLRSARTPRAV
AQVARQLISSGYIGFFLCPGVPELSFRSRVGVKVIEALERIGRSSTRSQR
HDTRRSLTDYVNGLNLYRQNMPAPMLAPGPQLPETSVAVQTLVPRRDVFV
TPALQRFTGAIPQGARVIAIEGGHWVVTSRPDVVARLTAEWVDRTVAGAP
PAVESRGERGEVRGKLALVTGAGAGIGRATAVELARRGARKIVLADRDRA
AADQTADAVRAACAEAAVYQVDVSDEAAMNDLATQVRNEHGVVDILVNNA
GIGMAGRFLETSSANWENIMGVNVGGVISGSRAFGAQMVERGEGGTIINV
ASAAAFLPSKSMVAYSTTKAAVLALSESLRADFADEGISVTAVCPGFVNT
NIAKSTIYAGMSAEQQERARGKADAAYRRRNFTPEATAKAIVKAVKTGPA
VLPIAAESRIGYAMRRISPGAVRLFARLDIRQT
379763051YP_005349448.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MPESIWASRPADLYGRRAHDRFGSLLWGVRAVFEGFASVSRWEPSRVKPV
QRTLTAVVTQRELVAPDVVALTLADPDGGLLPSWTPGGHIDVLLPSGRRR
QYSLCGPPGRRTDYRIAVRCIAGGGGGSIEMHEAFGVGDTCEFEGPRNAF
YLGTAERDVLFVIGGIGVTPILPMIRAAAQRGIDWRAIYTGRSREYMPLL
DEVVSVDPDRVTVWADDEHGRFPSVAELLAGAGPATAVYVCGPSAMLEAV
RIARDQYAGAPLHYERFSPAPVVDGVPFELELARSRRVLAVPANRTALDV
MLDRDPTTPYSCRQGFCGTCRVKVLAGQVDHRGRASPGDDGMLVCVSRAG
GDRVVIDA
379763050YP_005349447.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MLEAALRSLASGEPGSVSANRIAKDIGATWGAVQYQFGDTDGFWAAVLHR
TAERRAATFSTLSAPISPDAPLRERVGAIIDTLYTGLASADSRAIENLRA
ALPRDPDELERLYPRTAAELFSWGKSWLETCQQAFAGLAVDPDRVREVAA
LIPGAMRGLVSERQLGSYADLDMARRGLTNALAAYLEPSRP
379763049YP_005349446.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAKPPLSMKPTGWFQVAWSDEIGVGDVHKMKYFDSEMVAWRAESGQLTVM
NAYCEHLGAHLGYGGTVVGEVLQCPFHGWQWSAEGRNVCIPYQDRPNRGR
RMRTYPVVERNASVYIWHDVERREPYFEPPDVFAAFEDGSTADDYYPQQR
LYRETLEMHPQYVLENGVDFAHFKFVHKTPIVPVFTRHDFAEPVSYVDFT
ITFEGDDAQLIEDVNSGVQAINGGLGIAVTKSWGMIDNRTISAITPVDER
TSDVRFMVYIGRAPGGDSERAERKAAEFGQEVIRQFTQDIEIWQHQRYSD
PPALAPDEYEGFTAIRQWAKQFYPEAFVSQEGLAQ
379763048YP_005349445.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSTAPIRVFQVGSGNVGSEMIRRIATQPDLELIGVHAYSPEKVGTDTGEF
AGVGTNGVKFTGTIEEIIAAKPDVLTFHGVFPDEDLYLHVLEAGIDIVTT
ADWITGWHRDTNHPHPSGKPVSKLLADACEKGGATFYGTGMNPGLNQILG
VVCSADVADIENITTIESVDVSCHHSKDTWIEVGYGQPVDDPDIPSKLEK
YTRVFADSVYMMADCFDLTLDEVTFSYELGACTKDVDLGWYTLPKGSLGG
NYIKYQGMVDGVPRVETHLEWQMTPHTEPSWNIKGCYITQIKGDPCIYNK
HMIFPKPGVDLSNPDSFASIGMTVTGMPALAAIKSVIAAPPGLITSADLP
LRGFAGRFKK
379763047YP_005349444.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MVEMTITATSHYFFQFDQRYMFAGYGGGNDAPQPATMAVDYQRLNKMPPL
ESGGLHDGQTAHGFVGFAMPTGGELYITINDPSQPAPYTEAAWIVHT
379763046YP_005349443.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MKAMRVGVLGAKGKVGSTMVAAVQAAEDLTLSAEVDAGDPLSLLTDGGTE
AVIDFTHPDVVMGNLEFLIGNGIHAVVGTTGFTAERLQQVRAWLAENPKT
SVLIAPNFAIGAVLSMHFARQAAPFFDSAEVIELHHPHKADAPSGTATRT
AKLIAESRKGLPPNPDATSTSLPGARGADVDGIPVHSVRLAGLVAHQEIL
FGTEGETLSIRHDSLDRTSFVPGVLLAVRRITEHPGLTVGLEPLLNLQ
379763045YP_005349442.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTKALRTQLLVAFMCVALLVYFALLGRVAVAMIASGRAAAVGLGLAVLVM
PVIGLWAMVATLRAGLAHQRLARLIAADGMELDTSDLPRRPSGRIQRDAA
DALFATVRTEVEDHPDDWRRWYRLARAYDYAGDRRRAREAMKTAVNLQGD
HE
379763044YP_005349441.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSKTLLIVHHTPSPHTHEMFEAVVSGATDPEIEGVEVLRRPALTVSPAEM
LAADGYLLGTPANLGYISGALKHAFDCSYYQLLDSTRGRPFGLYLHGNEG
TEGAERAVDTITTGLGWSKAAETVVVSGKPGKEQLQACWELGATVAAQLM
DYA
379763043YP_005349440.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MIAVTNDSAIMPEAFFTVDGDSYVPGAMTQGPWGAAMGGQIVGGLLGWGI
EQSGVDPDLQPARFTVDLLRPALMSPVQIRTSVLREGRRIKLVDGELVQN
GTVVARASALFLRRGDHPDGRVWSFPVEMPPLPTSSDGFPEAMPFLIWGY
GATRDGSPGIAAGEWEQSDSQKFAWARIFRPMVQGHPLTPFTRLAFVGDI
TSSLTHWGTGGLRYINADYTVTASRLPDGEFLGLAAQSHYGTAGVATGAA
TLFDRHGPLGTSSALALAQPADAFKPTYA
379763042YP_005349439.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MIEIARDHNPFPTVGVSRGRDGVPRYDELPATLLDMLAEHVDNRPGSEAL
VELGGGRLTYRQLWDRAARVAGGLRAEGIKRGDRVAVRYPAGIDWVLAFW
GVVMAGGIAVAVNMRSAQPEVDFVLSDSGAGLDLAPDSPLPEGPPYVSEQ
LGRTDVAALFYTSGTTGHPKGVPTTHEAFLTNTENAIRCLQQPRDLGEGM
RTLISVPLFHVTGCNSQLLAAARLGGASVIMPTLNLDALIAALGAERVSV
LVTVPAIYSLLLRHKGFAGTDVSGIRWVGYGGAPIAPSLVRTVKNAFGHA
TVFNGYGMTETASLMTVLPDGEAVEHADSVGYAVPSVDLGLIPLGDEPGV
GELVTRGANVTAGYWNRPEATATTFADGWLHTGDVVRVDDAGRVHLIDRL
KDIINRGGENVSSVEVEAVLLGAPHVADACVLGVADDVMGEKVGAVLFGG
DDDIDVPAVLEHCRGRLADFKVPQYVTVVDTALPRNAGGKLLKARLREQV
RWGEPLR
379763041YP_005349438.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSASLLVANRGEIALRIIRTATELGMRTIAVYAGDDAQSPHVHAADEAIG
LPGSGPRAYLDQSAVLAVAKSSGADLIHPGYGFLSENAEFADACAAGGLT
FVGPDPGVLGLLGHKTAARGAALAAGVPVLPATDGASSVGDVKAFFAAQQ
GGIMLKALAGGGGRGMRKVHRANQIDDAYQRCAAEAQLGFGEPALYAEAL
LDDARHIEVQVVAAPAGHQTHALAVGDRDCSIQRRYQKLVEIAPAQGLSD
ELRRALHQAAVRLCARVGLRGLATVEFLVTGEDFVFLEVNPRIQVEHTVT
EETTGLDLVAVQLAIAGGASFYGLGLPAGIASDGLEVIGEPAAQRGIAIQ
LRVNAETFGPDFSVLASAGTLTAFTPPSGPGVRVDTYGRPGLVVSPQYDS
LLAKVIVHVRGTSWPAALRKAGTALSEFGIEGIHTNIGFLRELLRADRVE
SGWVSTDFVDQKLRELARAAQSHEQEPPPAEVELYPDEDALRAQLAGTVV
EVAPEGAQYAAGSQLVVLEAMKMQHVLVAPDALRTVRTLVTPGQVVGTGD
PLLIFTRTDAGDRGESARAATDLDRPRADLDEVTRRHALTLDEGRAAAVA
KRHQQGRRTARENIADLVDPGSFVEYGALAIAAQRSRRSEEDLIANTPAD
GLVAGLATIGAERFGRAAAEAVVVSYDYTVLAGTQGMRNHAKTDRAFDLA
ARKRLPVVLFAEGGGGRPGDTDVGGAAGLDVPTFRMLAGLRGEVPLVSIV
SGRCFAGNAALAGVCDVIIATPDANIGMGGPAMIEGGGLGVYPPEAIGPI
GVQRRNGVVGLVARDEAHAVALAKQYLSYFQGSLGEWEAPDPRLARHVVP
QNRLRAYDVHRAIESIVDVGSVLQLRADYGVGIVTALVRVEGVPYGLIAN
STHHLGGAIDAEAADKAGDFLALCESFGLPVISLCDTPGFMVGPDAETQA
AVRRFGRMFVLGARLTVPLGMIILRKAYGLGAMAMAGGSFRAPQFTIAWP
TGEIGGMGLEGAVRLGYSKELAAVDDPAERQSLFDRLVAAAYEHGKALRA
ATTFELDDVIDPSASRAWITRLSGG
379763040YP_005349437.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MKPLVVAGAVAAAIAAAPAAVADVSVAGPAPTHITFKQDPGGGGCDANGN
CGSGGQFEGPGGGPGGQGCVPGVGCGSGGQFAGPGGVPGGTGCLPGVGCG
SGHG
379763039YP_005349436.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSKTSRIRFGGKRRKANDMTSQDLTGRTAIITGASRGIGLSIAQQLAAAG
ANVVLTARKQEAADEAAAQVGERAVGVGAHAVDEEAARRCVDMTLERFGT
LDILVNNAGTNPAYGALIDQDHARFTKIFDVNLWAPLLWTSLAVKSWMGE
HGGSIVNTASIGGMHQSPAMGMYNATKAALIHVTKQLALELSPRVRVNAI
CPGVVRTRLAEALWKDHEDPLASSIALGRIGEPIDVAAAVAFLVSDAASW
ITGETMVIDGGLLLGAAQGFRSAPGGGQ
379763038YP_005349435.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MNAFDAAELDARVQALLDEHDPKDGDAREFLGAQYDAGLAWVHLPRGFGG
LDLPRTAQERVDARLAAAGAPVGGTPKNYIGMGMAAPTIAAFGTDEQKRK
FLRPLFTGEQIYCQLFSEPGAGSDLAGVSTRAVRDGDEWIVNGQKVWTSQ
AQHAHMAILVARTDPAVPKHAGLTYFLCDMTQPGVEIRPLRQITGEAEFN
EVFLTDVRVPDANRLGPEGGGWRVATTTLNNERVAIGSRAGAPREGGHIG
KVADAWRAEPALRDPAMHDQLMRLWVEAEVFRLAGERLRQQAATGQPGPE
GAGMKVAFAKLAQAISGFEIELHGESGLYYDDWTMRRPETVDLVGRGPGY
RYLRARGNSIEGGTSEILRNTISERILGLPGEHRVDKDAAWKDLPR
379763037YP_005349434.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MLTGDLLYSDTEEALRAGVRQLFAERCPPESVAGVYDAQPQDFSGVWRTL
ATELGVAGLLVPESLGGAGASAREAAVVMEEIGRAVAPVPFLSSAVLATV
ALLRAGDTRTVSALAQGELTAALVVPLTTAPGDPVTGVSGGPGGLSGSVT
AVAGAGEADVLVVPVTGPDGLELHTVDRAAAGVQVSPLLALDMTRPLAAV
TFSGAPSSKVGAGDGPVADAVLTGAALLASEQLGVAQWCFDTTLDYARQR
RQFGRTIGSYQAIKHRLADLWFDVGAAAAAARYAADTCARADDDAAAAAA
IAQAYCSDIAVHAAEECIQLHGGIGMTWEYPAHLYLKRAKSDQLAFGTGY
RHRARLAELVNLPPT
379763036YP_005349433.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MPNITDVVTTPDGTCPVHLFTPDGPESQVPWPGVVMYPDAGGVRGTFEEM
AAKLAGFGYAVLLPDVYYRTADWAPFDMATVFNDQSERGRLFSMIGSVTP
DRMAADATAFFDYLAARPEVSGERFGVCGYCMGGRTSLIVAGRVPDRVAA
AASFHGGGLVTDTDDSPHLLADRMSATVYVGGAQNDASFTADHAEQLDKA
LTAAGVEHTIEWYSAGHGFAVPDNAPYDPAAAERHWDAMTEVFAAAFPR
379763035YP_005349432.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MPIPTPYEDLLRLVLDEGTAKSDRTGTGTRSLFGRQLRYDLSAGFPLLTT
KKVHLKSVVYELLWFLRGDSNVAWLHEHGVTIWDEWASDTGDLGPIYGVQ
WRSWPTPTGEHVDQISAALDLLRTDPNSRRIIVSAWNVGEIPQMALPPCH
AFFQFYVADGRLSCQLYQRSADLFLGVPFNIASYALLTHMMAAQSGLSVG
EFVWTGGDCHIYDNHVEQVRLQLSREPRPYPELVLGERDSIFDYTYDDVV
VRNYDPHPAIKAPVAV
379763034YP_005349431.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MGLVWAQSTSGVIGRGGGIPWNVPEDLARFKEVTIGHTVVMGRRTWDSLP
AKVRPLPGRRNVVLSREDGFAADGAQVVGSLDAAFARAEGEPAVWVIGGG
QVYLAALPYATRCEVTEIELDLRRDDDDALAPALDDTWVGETGEWQASRS
GLRYRFHSYRR
379763033YP_005349430.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MKTFSRKFMGYDASAVDAHIEMLTTKQQLLLDDVESLRARLQESGEQTAA
LRKEVAALTDTSPSPHAMQKRMAKMLQRAVDEVAEMQAEARAEADALIAA
AEAEAEAAERKRDEVLADMAAQQKALEAEYEQTKEKLDAELAEMRAETQA
AIDEARRNAERECERLLGDAKQGADHYRDKARRAVDEATAQRIEILEQLM
GVYRDLDRVPAALEAAYQEQKNPSEDGALAPVDGKVRAS
379763032YP_005349429.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSTRRLSAAQARRIAVAAQGFTEPRPGGEITRAHLKRLISRIQVLQLDSV
SVAVRAHYAPVFSRLGPYDRDVLDRAAWGPRSSRLLAEYWAHEAALMAVE
DWPLLRWRMRQYRHGRWGTHIVKANPRLAEKVVAAVAELGPSTAGQIEAH
LAVGPRGPRGSWWGSRSDTKWVAEALFSAGVLTTATRVGFARHYDLVERV
LPAAVLAREVDDDEALRELTLRAATALGMGTEADIRDYFRLSAAQVKPAI
AQLLAAGDIERVDVDGWSAPAYLLAGRTVPRADRGTALLCPFDPLIFFRP
RVERLFEFHYRIEIYTPAAKRQYGYYVWPLLMDGRLVARVDLKADRPADS
LRVVGAFAEPDTPKARVAAALAGELRSMASWLGLGGFSVSGRGDLAADLR
AIS
379763031YP_005349428.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MGAVAEIAPLRVQLIAKTEFLAPPDVPWSTDADGGPALVEFAGRACYQSW
SKPNPKTATNAGYIKHIIDVGHFSVLEHASVSFYITGLSRSCTHELIRHR
HFSYSQLSQRYVPETDSHVVVPPGMEDDPELRQILAAAADASRATYTELL
AKLEEKFADQPNAVLRRKQARQAARAVLPNATETRIVVTGNYRAWRHFIA
MRASEHADVEIRRLAIECLRQLAGAAPAVFADFEISALADGTEVATSPLA
TEA
379763030YP_005349427.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSTAGFDAPARLGTVLTAMVTPFRPDGSLDTATAAHLANHLIDAGCDGLV
VSGTTGESPTTTDDEKRELLRVVLEAVGDRARVIAGAGTYDTAHSVRLAK
ACAAEGAHGLLVVTPYYSKPPQSGLIAHFTTVADATELPVVLYDIPPRSV
IPIQPETIRALSAHPNIVGIKDAKADLHSGGQIITETGLAYYSGDDALNL
PWLAMGATGFISVISHVAANQLREMLSAFNSGDIATARKINSTVAPLCDA
MARLGGVTLSKAGLRLQGIDVGDPRLPQMPATPEQIDALAADMRAASVLR
379763029YP_005349426.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MRVTALGGISEIGRNMTVFEHLGRLLIIDCGVMFPTHDEPGVDLILPDLR
HIEDRLDDIEALVLTHAHEDHIGGIPFLLKLRPDIPVVGSRFTLALVAAK
CREHRLKPVFVEVAEGQKSTHGVFECQYFAVNHSIPDALAIAVHTGAGTV
LHTGDIKLDQLPLDGRPTDLPGMSRLGDAGVDLFLCDSTNAEHPGVGPSE
SEVGPTLHRLIRGAEGRVIVACFASNVDRVQQIIDAAVALGRRVSFVGRS
MVRNMGIARELGFLRVADSDVIDIGAAEMMPPERVVLITTGTQGEPMSAL
SRMSRGEHRSITLTAGDLVVLASSLIPGNEEAVYGVIDELAKIGARVVTN
AQARVHVSGHAYAGELLFLYNGIRPRHVMPVHGTWRMLRANSKLAARTGV
PEESILLAENGVSVDLVAGKAAIAGAVPVGKMFVDGLINGDVGDITLGER
LILSSGFVAVTVVVARGTGRPVVPPQLHSRGFSEDPKALEPAVRRVEAEL
EALAAENITDPSRIAQGVRRTVGKWVGETYRRQPMIVPTVIEV
379763028YP_005349425.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MARNPVAQTAFGPMVLAAVEQNEPPGRRLVDDDFAELFLPTPLRWLVGAT
RFAPVRRLMIRGSEFTGPGLWANLACRKRFIADKLTESLDDIDAVVILGA
GLDTRAYLLTRRVRIPVFEVDLPVNIARKFKTVRRVLGEPPLSVRLVALN
LEHDDLLTALAEHGYRTDYRVFFICEGVTQYLTEATVRRTLEGLRAAAPG
SRLVFTYVRRDFIDGTNRYGTRTLYRNVRQRRQLWHFGLQPDDAAAFVGE
YGWRLVEQAGPDELAERYVAPTGRKLKASQLEWSAYAEKI
379763027YP_005349424.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAPSSEGPLKGKVAFITGAARGQGRAHAVRLAADGADIIAVDLCDQIASV
PYSLATPEDLAATVKLVEDTGARIVASRGDVRDRESLSAALQAGLDVFGR
LDIVVANAGIAPMQSGDDGWHDVIDVNLTGVYHTIKAAIPTMVKQGTGGS
IVLISSSAGLAGVGSPDAGSVGYAAAKHGVVGLMRVYANLLAGQMIRVNS
IHPSGVETPMINNEFTREWLAKMAAATDTPGAMGNAMPVEVLDVEDVANA
VAWLVSDQARYITGVTLPVDAGFLNK
379763026YP_005349423.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MPVVVVATMTVKPESVDTVRDILTRAVEEVHDEPGCQLYSLHHSGETFVF
IEQWADEEALKAHSTAPAIGKMFSAAGEHLDGAPDIKMLQTISAGDPAKG
QLRP
379763025YP_005349422.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAARGTGGAARSIGRARDIDPGHRRDGIALLLLGFSVVVAASSWFHAAGP
VGAWIDTLVRTFIGAGVLALPVVTAAVGVTLMRTEPDPEVRPRLILGASL
ITLSVLGLRHLWSGSPGDPEARRRAAGFIGFAIGGPLADGLTPWIAAPLL
FIGFMFGLLLLTGTTIREVPVVMRNLFHTRFVDEDYDDEPYDYADEFDDA
EPDDYPDDASSEPAPWSPDDDAQAALQDDIPTVPEPALQPGSEPGAARGR
KRGRSADKQDTIELDRVVEGPYVLPSLSLLVAGDPPKKRSAANTVMADAI
TEVLTQFKVDAAVTGCTRGPTVTRYEVELGPGVKVEKITALQKNIAYAVA
TESVRMLAPIPGKSAVGIEVPNTDREMVRLADVLTAPSTRRDHHPLVIGL
GKDIEGDFISANLAKMPHLLVAGSTGSGKSSFVNSMLISLLARATPEEVR
MILIDPKMVELTPYEGIPHLITPIITQPKKAAAALAWLVEEMEQRYQDMQ
ASRVRHIDDFNEKVRSGAITAPLGSQREYRPYPYVVAIVDELADLMMTAP
RDVEDAIVRITQKARAAGIHLVLATQRPSVDVVTGLIKTNVPSRLAFATS
SLTDSRVILDQAGAEKLIGMGDGLFLPMGAGKPIRLQGAFITDEEIQAVV
TACKDQAEPEYTEGVTAAKPTGERTDVDPDIGDDMDVFLQAVELVVSSQF
GSTSMLQRKLRVGFAKAGRLMDLMETRGIVGPSEGSKAREVLIKPDELAG
TLALIRGGADADGGDPNPD
379763024YP_005349421.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MPILLAVSTSPQGYRPLVRRARTSDVPAIKQLVDTYAGKILLEKNLVTLY
EAVQEFWVAEHEGRVVGCGALHVLWADLGEVRTVAVNPAMTGHGIGHAIV
DRLLEVARELALKRLFVLTFETEFFARHGFTEIEGTPVTAEVFEEMCRSY
DIGVAEFLDLSYVKPNILGNSRMLLVL
379763023YP_005349420.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MDLCSRLTVSASGTATLVNGYSVAVSGQPQTGPVVGRANIANLANTLTLL
RLVLVPVFLLALFAGDGQEPGFRVVAFLIFAVACITDRLDGLLARNYGMA
TEFGAFVDPIADKTLVGSALIGLSMLGELPWWVTVVILVREFGVTVLRLA
VIRRGVIPASWGGKLKTVVQVLAIGLFVLPLGGPFRVAAAVVMGAAIVLT
VITGIDYVVSTVRELRRTNG
379763022YP_005349419.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MPRRADWTKEGGMPPLVREVIGDVLREARTTQGRTLREVSDSARVSLGYL
SEVERGRKEPSSELLNAICDALDVPLSSVLTDAGERMAGQERAHERAPAD
AAAGSSIDVSTKVVIPPVATLALA
379763021YP_005349418.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MANPFVKAWKYLTALFNAKIDEHADPKVQIQQAIEEAQRTHQALTQQAAQ
VIGNQRQLEMRLNRQLADVEKLQVNVRQALTLADQATAAGDAAKATEYNN
AAEAFAAQLVTAEQSVEDLKTLHDQALNAAGQAKKAVEQNAMVLQQKIAE
RTKLLSQLEQAKMQEQVSASLQSMSDLAAPGNVPSLDEVRDKIERRYANA
IGAAELAQGSVQGRMLEVEQAGVQMAGHSRLEQIRASMRGEALPTGGTPA
AGTTPATPAPAESAGGAVSEKPLGQ
379763020YP_005349417.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAVNAPRPRLWRALLHRGLATAADVSDRVARKISAAADPRARQLRRRRRA
LRWGLIFAAGCAFWAVVTILLAAWGWFALLLEITGGVAVVMAIPATLLLL
RYRWLRSEPLPVPRTTTARRLPPPGSAARPAMYALGASERGFFSLVAVLE
RGAMLPTAEIRDLTAAATKTSAAMASTAAQVVSMERAAQASEQSRSYLVP
TINAFTAQLSAGVRQYNEMVTAAAQLVSSANGDGLTESQRYRAELAGATD
RLLGWAQAFDELGGLRGAG
379763019YP_005349416.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MINRDAARTRPNFWQFVRYCCGGRLPDSMRDWVRNDLAGKGASARMMRRV
AVPAVVVLAPFWLIPTTLDVHLSMTLPILIPFVYFSHALNKVWRRHMLAV
HDLDPELVDELARKRDARMHQSYIERYGPRPED
379763018YP_005349415.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTELTGTTVANTRTVEGFLNALQDADYEAADAALADDLVYENVGLPTIHG
RARAMKLFRQMEGRAAFEVKIHRIAADGGAVLTERTDALIFGPLRLQFWV
CGVFEVHNGRITLWRDYFDFFDMLKATARGLAALVVPSLKAAF
379763017YP_005349414.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MNPMRVAVVAGPDPGHSFPAIALCRRFAEAGDEPTLFTGAEWIDTARGAG
IDTVALDGLVATDDDVDAGARIHRRAARMAVLNVPALRDLAPDLVVSDVI
TAGGGMAAELLGIPWIELNPHPLYLPSKGLPPIGSGLAPGTGIRGRLRDA
AMRALTARSWRAGLRQRAAVRTEIGLPAADPGPLRRLIATLPACEVPRPD
WPPEAVLVGPLHFEPTDRALDIPAGSGPVVVVAPSTASTGTEGLAEVALA
CLIPGDTLPPGARVVVSRLGGAELTVPPWAVAGLGSQAELLTHADVVICG
GGHGMVAKTLLAGVPLVAVPGGGDQWEIANRIVRQGSARLVRPLSADALV
AAVNDVLAAPGYRAAARRAAASIADVADPVAVCHDALAVAG
379763016YP_005349413.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MITAVTAGALLAGPVFGAGVARADSPEEQQACQLMDDPAAAEQGLAPAEY
AFMRLRATMSAQHARDTMSLAVQEDCPNHIIDLPASWR
379763015YP_005349412.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MFTGVRLTEFHERVVLRFGSTYGSSVLVDHVLTGFDGRTAAQAIEEGIEP
RDVWRALCVDFDVPHEQW
379763014YP_005349411.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MWPTMAPTSAPSLRALALVCSLKKSPAPSSSDLLADQLLDQLRGAGVQGE
KVRCVDLALLPGVEADMGPGDEWPAVLTKIKAADIVIVSTPTWVGHMSSV
AQRVLERLDAELSDTDDAGRPAMVGKVALAAVVGNEDGAHKIVADLFQAL
NDIGFSIAAQGCTYWNGEAMQGTDYTDLDDVPDAVAFATANATRNAVHLA
TVLRQNPYPAYE
379763013YP_005349410.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MDISTELAETASYGGFFALTVGGDAAGWHPVTQSYTDGCADLIDATARRY
RTTDLRIGASLVHLGHATRLWSPVLACAIGHGVLPRLDDLQRADDGAQLR
LPRPVGMPADSPDALYRAVVSEHMRPLAAGLRVKLAPALLAGNIASALVG
AARALLTARPDLRRAITETTRSLLDTGVLAGSGVITGPRLGFRRRSCCLF
YRLPDGSLCGDCVLHRTPR
379763012YP_005349409.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAQAPDREKALELAMAQIEKSYGKGSVMRLGDEMRQPISVIPTGSIALDV
ALGIGGLPRGRVVEIYGPESSGKTTVALHAVANAQAAGGVAAFIDAEHAL
DPEYAKKLGVDTDSLLVSQPDTGEQALEIADMLIRSGALDILVIDSVAAL
VPRAELEGEMGDSHVGLQARLMSQALRKMTGALNNSGTTAIFINQLREKI
GVMFGSPETTTGGKALKFYASVRMDVRRIETLKDGTNAVGNRTRVKIVKN
KVSPPFKQAEFDILYGRGISREGSLIDMGVDQGFIRKSGSWFTYEGEQLG
QGKENARTFLMENDEVANEIEKKIKEKLGIGAVVTDDLSDDSVLPAPVDF
379763011YP_005349408.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTASCPPPSISDPSREEQARALCLRLLTARARTRAELRGRLAKRGYPDDV
SERVLDRLASVGLIDDTDFAQQWVRSRRAHAGKSKRALAAELHTKGVDNE
VITTVLAGIDAGAERDRAEQLVRSKLRRETLSDDDARVTRRLVGMLARRG
YSQNLACEVVFAELAAERERRRV
379763010YP_005349407.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTSTVREAVARGAAPARTYQVRTYGCQMNVHDSERLAGLLEAAGYQRAAE
DADADVVVFNTCAVRENADNKLYGNLSHLAPRKRDDPEMQIAVGGCLAQK
DRDALLRKAPWVDVVFGTHNIGSLPTLLERARHNKVAQVEIAEALQEFPS
SLPSARESAYAAWVSISVGCNNSCTFCIVPSLRGKEVDRSPDDILAEVAS
LVDDGVLEVTLLGQNVNAYGVSFADPALPRDRGAFARLLRACGDIDGLER
VRFTSPHPAEFTDDVIEAMAQTPNVCPALHMPLQSGSDRVLRAMRRSYRA
ERYLGIIDRVRAAMPHAAITTDLIVGFPGETEEDFAATLDVVRRARFSAA
FTFQYSKRPGTPAADLDGQLPKAVVQERYERLVALQEEISLQGNQALVGQ
TVELLVATGEGRKDTATARMSGRARDGRLVHFAVGDAARGSADTRPRPGD
VITTVVTGAAPHHLIADAGILTHRRTRAGDAHAAGRRPRGIGLGMPAVGP
PAGPAQPLGCAR
379763009YP_005349406.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MKKDDTQLGALRTEIEAAERRVARGIDPGPRGFFVSILVFVLLGSFILPH
TGDVRGWDVLFGSHGAGAAAVALPSRVFAWLALVFGVGFSMLALVTRRWA
LAWVALAGSAIAGAAGMLAIWSRQTVAAGHPGPGWGLIVAWITVLLLIYH
WARVVWQRTIVQLAAEEQRRRAASQQQSTSLLDDLDRPRDDPGSGTGSGG
GS
379763008YP_005349405.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MVPPPPSDPHQFGRVDDDGTVWLISAAGERIVGSWQAGDREAAFAHFGRR
FDDLATEVTLMEERLASGTGDARKIKAHASELAETLPTAAVLGDIDALAT
RLASIAEHAEATVAADRSRREEHRAAQTARKEALAAEAEELAATSTQWKA
AGDRLRAILDEWKTITGLDRKVDDALWKRYSAAREAFNRRRGAHFAELDR
ERSGIRQAKERLCERAEELSDSTDWTATSAEFRKLLTEWKAAGRATREVD
DALWRRFKAAQDVFFTARNAATAEKDAEFRANATAKEALLAEAEKLDTSN
HDAARAALRSIVEKWDAIGKVPRERTAELERRLRAVEKKVRDAGEADWSD
PQAQARAEQFQARAEQYEQQAQKAAAAGRAKEAEEANANAEQWRQWAQAA
VEALSRKS
379763007YP_005349404.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSKVDVAALIALCAALASAIGDVIRQRSAHEITDKQVGHLELFRMSLRDA
RWWLGGMAAVTNYSLQAAALAWGSVVMVTALQVTALLFALPIYARLAHHR
VKPREWIWALVLAAGLAVVIIVGDPESGHQRAPLQTWIIVALVMAPLLVG
CVVAARIWSGSPFAAVLLAVVAGSSLALFAVLTKGIVEMSEHGVARVLTS
PEFVPWLLVALAGMIFQQSAFRAGTLTASLPTMTVAKPVVAGLLGVLVLG
ETVNASGAESFVLVAAVSVVIVATIALARGEAAAVDRTESGGGAPRRKRA
RDASAEESLGPYGECLVVADGPRC
379763006YP_005349403.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MLSAIAIVPSAPVLVPELAGAAAAEVADLVAATLAAAALLPKRWVIIGTG
PADEEFGPDAAGTFAGFGVDVRVRLSPQDGDEPEPLALPVCALLGGWVRG
RAQPQASARVRVYRGDHGATAALRRGRELRTEIDRLPEPIGVLVVADGAN
TLTPSAPGGHHPDNAPAQEALNDALADGDVAALTRLPPQILGRVAFQVLA
GLAEPGPRSAKELYRGAPYGVGYFAGAWQL
379763005YP_005349402.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTVAVRPLAIIGPTGTGKSQLALDIAERLGAQIVNADAMQLYRGMDIGTA
KLPVDARRGIPHHQLDVLDVTETATVARYQQAAAADIEAIAAAGAVPIIV
GGSMLYIQSLLDDWSFPATDPAVRARWERRLGEVGVGELHAELARRDPAA
AASILPTDARRTVRALEVVELTGRPFAASAPRIGAPRWDTAIIGLDCDTT
ILDDRLAKRTDAMFDQGLVGEVTALLEHGLRDGVTASRALGYAQVIAALD
DGGGPDRLREAREQTFVGTRRYVRRQRSWFRRDHRVQWLNADDRAGLVDG
AVRAWRHVS
379763004YP_005349401.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MKFAKGHGTQNDFVVLPDPAAELSLTGPRVAALCDRRRGLGADGVLRVTT
AGAAAAAGVLDRLPDGVAADDWYMDYRNADGSIAQMCGNGVRVFAHYLRA
SGLEDRDDFVVGSLAGPRPVTVHRVDGTTADISVDMGKANTLGPGDAVLG
GRRFSGVAIDVGNPHLACVDPDLTVDALAALDVAAPVSFDPAQFPDGVNV
EILTAPDAGAVHMRVHERGVGETRSCGTGTVAAAVAALAGTGADTGTLTV
RVPGGEVVVTITDATSYLRGPSVLVAHGEISEEWWRAQ
379763003YP_005349400.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTHPEFRDHAVTEPSTGELALEDRSALRRVAGLSTELADVTEVEYRQLRL
ERVVLVGVWTDGTAADSQASMAELAALAETAGSQVLEGLIQRRDKPDPST
YIGSGKAAELREVVLATGADTVICDGELSPAQLTALEKAVKVKVIDRTAL
ILDIFAQHATSREGKAQVSLAQMEYMLPRLRGWGESMSRQAGGRAGGSGG
GVGLRGPGETKIETDRRRIRERMAKLRREIKDMKQVRDTQRSRRLHSDVP
SIAIVGYTNAGKSSLLNALTGAGVLVQDALFATLEPTTRRAEFDEGRSFV
LTDTVGFVRHLPTQLVEAFRSTLEEVVDADLLVHVVDGSDVNPLAQINAV
RQVVTDVIADHDGAPPPELLVVNKVDAASDLALAKLRHALPGAVFVSART
GEGIDALRRRIAELAVPADTAVDVVIPYHRGDLVARLHADGRVQHEEHDA
EGTRIKARVPVALAGRLREFAAR
379763002YP_005349399.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MVYVGLQKSPSPEVYSMSSAIKYQRTLFEPEHDLFRESYRAFLERHVAPY
HDEWEKAKIVDRGVWLEAGKQGFLGMAVPEEYGGGGNPDFRYNTIITEET
TAGRYSGIGFGLHNDIVAPYLLALATEEQKQRWLPKFCTGELITAIAMTE
PGTGSDLQGIKTRAVKQGDHYVLNGSKTFITNGINSDLVIVVAQTDPDKG
AQGFSLLAVERGMEGFERGRHLDKIGLDAQDTAELSFTDVKVPAENLLGQ
EGMGFIYLMQNLPQERISIAIMAAAAMEQVLEQTLQYTKERKAFGKPIGS
FQNSRFVLAELATEATVVRMMVDEFVRLHLDHKLTAEQAAMAKWYCTEKQ
VHLIDRCLQLHGGYGYMREYPVARAYLDARVQTIYGGTTEIMKEIIGRSL
GV
379763001YP_005349398.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MRKLIGSALVSLTTTALAAVLLAPVATASPIGDAEAAMMAAWEKAGGDTS
PLGPRKGDVYPAGEGFALDFDGGKMFFTPATGAKFAYGPILEKYEMLGGP
AGSDLGFPAISEVPGLAGPDSRVITFSATDKPVIFWTPEHGPYVVRGAIN
SAWDKLGSSGGVLGVPVGDETYNGEVSSQKFSGGQVSWNRQTKQFTTEPP
GLADQLKGLQVAIDPTAAINMAWRAAGGPNGPLGAKQGGQTPIGGDGIVQ
NFAGGKVFFTPATGANALETDILAKYESLGGPVGSGLGFPVTNETDGGIG
PSSRICTFSAADKPVIFRTAEHGAFVVRGAMKAAWDKLRGPAGKLGAPVG
DQAVDGDVISQQFTGGKISWNRAKNTFSTDPANLAPLLSGLQVSGQNQPS
SSAMPSHANKFGWHSWWWLAAIPVLVLLVVVAWALFGWRRRRSGADGAAG
YASDQGYDAPWGPEDPDLATEHFAPGGPREPERPTDAAATARVSWQRQAP
SESDYGVEQEDPDAIDTDSIPVVSEEMLAEADYPDAEADYTDYTDAVPEV
AEAETADDAAYVDADYADAGYPEDEYADDEYPDVAVAHTPPDADAVTGAL
ETAAPEDEYPDVAVPEAEVEPEDDVAAEPDVSGAAEAGAVGAGAAGAFVA
AQRSGGRHAAADDAEDGSENGLAGPDGRPTIHLPLDDPYQAPDGYPIKAS
ARYGLYYTPGSDLYQDTLPEIWLSSEEVALANGFTRAD
379763000YP_005349397.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MGDSNDTSPNTGPAAADGRLHSVDSALTERQRTILNVIRASVTSRGYPPS
IREIGDAVGLTSTSSVAHQLRTLERKGYLRRDPNRPRAVDVRGADDDVAA
PATEVAGSDALPEPTFVPVLGRIAAGGPILAEEAVEDVFPLPRELVGEGT
LFLLKVVGDSMVEAAICDGDWVVVRQQNVADNGDIVAAMLDGEATVKTFK
RAGGQVWLMPHNPAFDPIPGNDATVLGKVVTVIRKV
379762999YP_005349396.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTVIHTLAPRTSSLRRPVNGPVQGVRYGRDGLARSRRPAPSRPAGAPTRY
YGTGVAMSVAPHRRRAVTWATTVGLALAAGAITLWLGLVANVGQALNGDS
TNSAAPVPNRLAVVRVDAGESLQDVAHRVAPDAPAAAVADRIRELNDLNS
PTLVAGQTLIAPIG
379762998YP_005349395.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MIDSRETDEGQAIRRRRSCPECGKRFTTVETAVLAVVKRSGVTEPFSREK
VISGVRRACQGRQVDDDALNLLAQQVEDTVRAVASPEVPSHEVGLAILGP
LRDLDEVAYLRFASVYRSFESADDFEREIQALREHRGVATPG
379762997YP_005349394.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MHPDLAALAPLLGTWVGQGAGKYPTIPPFDYLEEVTFAHVGKPFLAYAQK
TKAVADGKPLHAETGYLRVPQPGHVELVLAHPSGITEIEVGTYSVTGDLI
DMQMSTTTVGLTPTAKEVTGLGRCFRIDGDELSYTVQMGAVGQPLQDHLA
AVLHRQR
379762996YP_005349393.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MGIDVTVLRVFTDADGNFGNPLGVVDAAEVGVADRQRVATQLGYSETVFV
DRPAAGSATAHATIYTPRTELPFAGHPTVGASWWLRENGRPINTLQIPAG
IVQVGYDEHHTRISARAEWAPEFALHEFASADDVLAADPTDFPDDTAHYL
WAWTDRAAGALRVRMFAANLGVAEDEATGSAAMRITDYLSQNLRITQGNG
SVIETTWSAEGWVAVAGRVVNDGVRQLD
379762995YP_005349392.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTERKRKNRLRPVREVTAPTLEFRTIHGYRRAYRIAGSGPAILLIHGIGD
NSTTWNAVQAKLAQRFTVIAPDLLGHGRSDKPRADYSIAAYANGMRDLLS
VLDIERATIVGHSLGGGVAMQFAYQFPHLVERLILVGAGGVTKDVNFVLR
WASLPMGSEAIALLRLPLVLPAVQVVGRVLGAALGSTGLGRDLPNVLRIL
DDLPEPTASAAFSRTLRAVVDWRGQIVTMLDRCYLTEAIPVQIVWGTKDV
VVPVRHAWMAHAAMPGSRLEIFEGSGHFPFHDDPARFIEVVERFMDSTAP
AEYDQAALRGLLRTGGGERAVSGPAPTRVAVLNAMGSDERSAT
379762994YP_005349391.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MDHHRDPGDQYQQGQPGMYELELPAPQLSTSDGRGPVLVHALEGFSDAGH
AIRLAASHLKAVLDTELVASFAIDELLDYRSRRPLMTFKTDHFTNYDDPE
LSLYALRDTVGTPFLLLAGMEPDLKWERFITAVRLLAERLNVRQTIGLGT
VPMAVPHTRPTTMTAHSNNPELIANFQPWIAEIQVPGSASNLLEYRMAQH
GHEVVGFTVHVPHYLTQTDYPAAAQALLEQVAKTASLELPLTALTEAAEV
IRAKIDEQVEASAEVAQVVAALERQYDAFIDAQENRSLLSRDEDLPSGDE
LGAEFERFLAQQAEKKFDDDDQA
379762993YP_005349390.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MMKAMRIPILVLCSVVGVATSLTSCHRPVEQVSGAPVSAPRTGGPVQRLS
QPEQKAVAGPVEPDRRIGAIFIDGGPLHVCTGSVVHSKGGDLIMTAAHCL
AGASLITFVPGFAGDAAPAPTDMWKADAVYLDPRWVASKDPHADYAIARV
SNDTGASVESRAGLALTLGVTPPPGSRVTVLGYPVGVGGEPIGCQGSTSV
SDSGFPALACEGLVDGTSGAPWVSGTTLTGLIGGLERGGCAPDISYSAPF
DAQTAELLARAEVGGPGDPVPGDLQDAC
379762992YP_005349389.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MGSAQEYDMVVIGSGPGGQKAAIASAKLGKSVAIVERGQMIGGVCVQTGT
IPSKTLREAVLYLTGMSQRELYGASYRVKEKITPADLLARTQHVIGKEVD
VVRNQLMRNRIDLLIGHGRFVDPHTIEVEDPSRREKVTISGKYIVIATGT
RPARPSGVEFDEERVLDSDGILDLKTLPASMVVVGAGVIGIEYASMFAAL
GTKVTVVEKRGDMLDFCDPEVVEALKFHLRDLAVTFRFGEEVTAVDVGSA
GTVTTLASGKQIPAETVMYSAGRQGQTDHLDLHHAELEADNRGRIFVDDY
FQTKVPHIYAVGDVIGFPALAATSMEQGRLAAYHAFGEACDGITELQPIG
IYSIPEVSYVGATEVELTKDAVPYEVGVARYRELARGQIAGDSYGMLKLL
VSTEDLKLLGVHIFGTSATEMVHIGQAVMGCGGTVDYLVDAVFNYPTFSE
AYKVAALDVMNKVRALNQFRR
379762991YP_005349388.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTTHAQPDFELSRPGALIAALPAVLGFIPENSLVLVSLEDRHLGSVMRVD
LSEELFGRVGHLAEVAAAARPEAVIAVIVDADGAHCPSCNDEYRQLCEAL
AESLSQHDIELWATHVVDRVALGGRWHCVEGCGSSGLVEDPSASPLAAAA
VLEGRRLYPRRADLQAVIAPDDPARSAALAGAVGRHAARRRAAHRAHPVR
CTRGDVEGAMAAAARVASGESLSDAELAALGCALSDSQVRDILYALAVGE
GADDVESLWAVLARTLPPPWRVEALVLLAFSAYARGDGPLAGVSLQEALR
CEPEHRMAGMLDTALSSGLRPEDIRDLALTGYRLAKQFGVRLPPRRPFGR
RAG
379762990YP_005349387.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MNDLVDTTEMYLRTIYDLEEEGVTPLRARIAERLDQSGPTVSQTVSRMER
DGLLHVAGDRHLELTDKGRALAVAVMRKHRLAERLLVDVIGVPWEEVHAE
ACRWEHVMSEEVERRLVKVLNHPTTSPFGNPIPGLLDLGVGPESGAEEAI
LVRLTELPPGSPVAVVVRQLTEHVQGDTDLITRLKDAGVVPNARVTVETG
PAGVTIVIPGHENVTLPHEMAHAVKVEKV
379762989YP_005349386.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MANASTSRFDGDLDAQSPAADLVRVYLNGIGKTALLNAAGEVELAKRIEA
GLYAEHLLETRKRLGENRKRDLEAVVRDGKAARRHLLEANLRLVVSLAKR
YTGRGMPLLDLIQEGNLGLIRAMEKFDYTKGFKFSTYATWWIRQAITRGM
ADQSRTIRLPVHLVEQVNKLARIKREMHQNLGREATDEELAAESGIPVDK
INDLLEHSRDPVSLDMPVGSEEEAPLGDFIEDAEAMSAENAVIAELLHTD
IRSVLATLDEREHQVIRLRFGLDDGQPRTLDQIGKLFGLSRERVRQIERD
VMSKLRNGERADRLRSYAS
379762988YP_005349385.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MKHGSDAGFDGSFDDFAGHKGRPVLITAAEPSYEEQHRARVRKYLTLMAF
RIPALILAALAYGAWHNGLISLAIVAVSIPLPWMAVLIANDRPPRRPDEP
RRFDNARRRTPLFPRAERPALEAPRHPQPGWPPDPRGGIDDG
379762987YP_005349384.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MQTQTIERTETDERVDDGTGSDTPKYFHYVKKDKIAESAVLGNHVVALCG
EVFPVTKAAKPGSPVCPECKQIYDRLKKG
379762986YP_005349383.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSDQVAKPSRHHIWRITLRALSKSWDDSIFSESAQAGFWSALSLPPLLLG
MLGTMAYVAPLFGPDMLPNILRQLLSTAHSVFSPSVVNEIIEPTVRDIAS
NARGEVVSLGFIISLWAGSSAISAFVDSVVEAHDQTPLRHPVRQRFFALF
LYVVMLVVVVATAPLVVVGPRKVEEHIPLGLSNVLRYGYYPALIIGLTLG
VMILYRVALPEPLPSHRLILGAMLATTVFVTATLGLRFYLRWITSTGYTY
GALSTPIAFLLFAFFGGFAIMLGAELNAAVQEEFPAPTTHAHRVRTWLFS
RSPALKKTVETLASPIANPATQQRDTAPAKPPG
379762985YP_005349382.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MRAKLPSGLELLFCQHHANEHEAKLTELDAVLEVSGS
379762984YP_005349381.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MVSSGSEFESVVGYSRAVRVGPHVAVAGTTGTGPAGDIAAQTRDALRRID
IALQQAGASLTDVIRTRLYVTDISRWREVGAVHEEVFGAIRPVATMVEVS
ALIAPELLVEIEADAYVDSPVTGGKAPSAPGG
379762983YP_005349380.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MKRTATKSASSPAKRPAAKAANGSAPAKRAAKTTARSTKSDAAEPAKKTR
AKGAEAKGRGTKAAKGGPADPDALDSDGAVEDLDNEPDLEAEPGEDLDID
SDLSLDDLEEDVASEDAEVESGDSEVGDDEEAPAPAAAAEPAADEDDEIA
EPTEKDKASGDFVWDEDESEALRQARKDAELTASADSVRAYLKQIGKVAL
LNAEEEVELAKRIEAGLYATQLMTEMTERGDKLPAAQRRDMQWICRDGDR
AKNHLLEANLRLVVSLAKRYTGRGMAFLDLIQEGNLGLIRAVEKFDYTKG
YKFSTYATWWIRQAITRAMADQARTIRIPVHMVEVINKLGRIQRELLQDL
GREPTPEELAKEMDITPEKVLEIQQYAREPISLDQTIGDEGDSQLGDFIE
DSEAVVAVDAVSFTLLQDQLQSVLETLSEREAGVVRLRFGLTDGQPRTLD
EIGQVYGVTRERIRQIESKTMSKLRHPSRSQVLRDYLD
379762982YP_005349379.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTSTDSTTDTPGAAPADGTHERRGFGIDVGGSGIKGGIVDMDTGLLIGER
VKLLTPQPATPSAVAKTIAAVVNEFGWTGPLGVTYPGVVTHGVVQTAANV
DKSWIGVNARDIISAELDGQDVTVLNDADAAGLAEEHYGAGRNQTGLVIL
LTFGTGIGSAVIHNGTLIPNTEFGHLEVGGKEAEKQAASSVKEKKGWSYE
KWTKHVTEVLVSIENAMWPDLFIAGGGISRKADKWLPLLENRTPVVAAAL
LNTAGIVGAAMAATSDVTH
379762981YP_005349378.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MIQSDDELVRLRSVAETVATEAAAFVRRRRAEVFGAEPAGVTGPDSGAVR
TKSTPTDPVTVVDTETERLLRDRLAELRPGDPILGEEGGGPTDPAGTPPG
SVTWVLDPIDGTVNFVYGVPAYAVSVAAQVNGESVAGAVADVVADRVYSA
ASGLGAHVSDGQGTQPLQCAAVEDVSMALLGTGFGYSRQRRAAQAALLAR
MLPVVRDVRRIGSAALDLCMVASGRLDAYYEHGLKVWDRAAGALIATEAG
ARVVLPAHDATGAGLVLAAAPGIADELLAVLERFNGLDPILD
379762980YP_005349377.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MVTQITEGTAFDKHGRPFRRRNPKPAIVVVILLAVATAVVWTVALTRPAK
VHEAVVCNPPPQATGSASAQLGEQVSRSAMMDVAPAKLADTKVRVLNASG
RGGQAGDVAGAMKDLGFAQPTAANDPLYAGTRLACQGQIRFGTAGQATAA
AVWLVAPCTELFNDSRADDSVDLALGTDFSALAHNDDIDAVLATLRPGAT
EPSDPTLLAKIHASSC
379762979YP_005349376.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MPTDYDAPRRTETDDVSEDSLEELKARRNEAASAVVDVDESESAENFELP
GADLSGEELSVRVVPKQADEFTCSSCFLVQHRSRLASEKNGVMICTDCAA
379762978YP_005349375.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSDTRVAPHNVRYRERLWVPWWWWPPALALAGILAFEFNMGVTRHSSWWP
YAALFAVAAAALLWLGRVEIRVTANPSAPGEVELWAGPAHLPVTAIARSA
QVAPSAKSAALGRQLDPAAYVLHRAWVAPMILIVLDDPDDPTPYWLVSCR
HPERVLSALTT
379762977YP_005349374.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSTSLAIVRLDPELPLPARAHEGDAGIDLYSAEDVKLEPGRRALVRTGVA
VAIPFGMVGLVHPRSGLAARVGLSIVNSPGTIDAGYRGEIKVALINLDPT
EPIVVHRGDRIAQLLVQRVELVELVEVSSFDEAGLAETSRGDGGHGSSGG
HASL
379762976YP_005349373.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAAFGKRSRKDDSASAADARADEAVTPGADEPAAEELEGPFDIEDFDDPA
VAELARLDLGSVLIPMPEAGQLQVELTETGVPSAVWVVTPNGRFTIAAYA
APKTGGLWREVAGELAESLRNDSAQVSIKDGPWGREVVGTATGVVRFIGV
DGYRWMIRCVINGAHETMEALEQEARAALADTVVRRGDTPLPVRTPLAVQ
LPEPMAQQLREAAAAQQAAQQADAQQSEDQQAPADQPAARRSADGSAMQQ
LRTTTGG
379762975YP_005349372.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MVVDLNGVTTVLLPGTGSDDDYVQRAFSGPLAHVGAVLMNPPPRPDRLID
GYLAALDAAACEGPIAVGGVSIGAAVAAAWALAHPDRTVAVLAALPAWAG
APGEAPAALAARYSASRLRADGLAATTTQMRASSPPWLADELTRSWGAQW
PHLPDAMEEAADYVAPSCDELAGLAAPLAVAAAVDDPIHPLQAGLDWVAA
APRAALRTVTLDQIGADPAALGAACLAALAELG
379762974YP_005349371.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAMGAQGYLRRLTRRLTEDPEQRDSEELSDEVASTGAQRAIDCERGQEVT
MVGTLRSVECNGRACAGGVRAELFDGSDTVTLVWLGQRRIPGIDSGRTLR
VRGRLGKLENGTKAIYNPHYEIQR
379762973YP_005349370.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTVPEGLGGATPPAREPGSSEQTTSRISPERLLAQAGGVSGVIYSSLPVV
VFVIVSSVSGLVPAIAAALGVAALVLLWRLIRRDSPQPALSGFFGVALCA
LIAYVLGESKGYFLLGIWMSLVWAVVVAASVAIRRPLVGYAWSWATGRGD
GWRSVPKAVLAFDIASLGWVLVFTSRFVVQGLLYDADRTGWLAAARIGMG
WPLTVLAALATYAAIKSAQRAIAAGAELAPRSVGD
379762972YP_005349369.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MKVAVAGAGAVGRSVTRELIGNGHDVTLIERNPDHVDVDAIPAAHWRLGD
ACELTLLESVHMQEFDVVVAATGDDKANVVLSLLAKTEFAVPRVVARVND
PRNEWLFTDAWGVDVAVSTPRMLASLIEEAVAVGDLVRLMEFRKGQANLV
EITLPDDTPWGGKPVRKLQLPRDTSLVTILRGPRVIVPEEDEPLEGGDEL
LFVAVAEAEEDLQKLLLG
379762971YP_005349368.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MGCGRVGSSVADGLSRIGHDVAVIDRDSTAFNRLSPEYAGERVLGQGFDR
DVLLRAGIEEADAFAAVSSGDNSNIISARLARETFGVKRVVARIYDAKRA
EVYERLGIPTIATVPWTTDRLLNALLRETETAKWRDPTGTVAVSEVVLHE
DWIGHRVTDLEQATGARVAFLIRFGAGVLPEPKSVIQAGDQVYVAAISGR
AAEAVAIAALPPSEDL
379762970YP_005349367.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MLIGRPFRSDRLSHTLLPKRIALPVFASDALSSVAYAPEEVFLMLSVAGV
SAYALTPWIGLAVAAVMLVVVASYRQNVHAYPSGGGDYEVVTTNLGETAG
LVVASALMVDYVLTVAVSTASAMANIGSAIPIVAEHKVFFCVASILLVMA
LNLRGVRESGVAFAIPTYAFIIGVLVMIGWGLFRIFVLGDPLRAESAGFQ
MHAEHGQVVGFALAFLVARSFSSGCAALTGVEAISNGVPAFQKPKSRNAA
TTLLMLGAIAVTLLMGIIVLAQKIGVQLVEDPATQLSGTPKGYYQKTLVT
QLAQAVFGGFHLGFLLIATVTALILVLAANTAFNGFPVLGSILAQHSYLP
RQLHTRGDRLAFSNGILFLSGVAVLAIVAFRGEVTALIQLYIVGVFISFT
LSQIGMVRHWTRLLRTETDPGVRRKMMRSRVVNTVGLLSTGAVLLVVLVT
KFVAGAWIALFAMSLLFGMMKMIHRHYNTVNRELAQQAEDEEDAVLPSRN
HAVVLVSKLHLPTRRALAYARATRPDVLEAVTVSVDDAETRELVRKWEAS
DISVPLKVIASPYREITRPVLEYVKRAREESPRTVVTVFIPEYVVGHWWE
QVLHNQSALRLKGRLLFMPGVMVTSVPWQLSSSERRKTLQPHVAPGDARR
GIFD
379762969YP_005349366.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSPAVGELTLTTGAPANGGSCVAHHEGRVVFVRYALPGERVRVRVTADRG
SYWHAEVVEVVEPADGRTASLCPIAGVGGAGCCDLAFAAPEVARALKAEV
VANQLERLGGHRWSGEAEPLSSRPTGWRTRVRLDVGADHRPGFHRYHSDD
LVTDLRCAQLPDGMLDGIAETEWPPAAQLHVAVDDDGARHVVRTLRQGRR
TATKVMEGRYEAVQRVAGRTWQVPVTAFWQAHRDAAATYSALVADWAAAG
TGMSAWDLYGGAGVFAAALGEAVGASGRVLSVDTSRGSTRAARSALADLS
QVQIVTDSVRRALAAQREGASTADVAVLDPPRAGAGREIIDLLAAAGVPR
VVHIGCEAASFARDIGIYLGHGYAVEKIKVFDAFPLTHHVECVALLTRGD
379762968YP_005349365.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSFIAILVFVVAYVLIASDRVNKTFVALAGAAIVVTLPIIRSDDVFYSHE
TGIDWDVIFLLLGMMIIVSVLRQTGVFEYVAIWSAKRARGSPLRVMILLA
LVTAIASALLDNVTTVLLVAPVTLLVCERLAINAAPFLMAEVFASNVGGA
ATLVGDPPNIIIASRAGLTFNDFLVHLAPIVVIVLGVLMVLLPRLFPGAF
SVDPDRVADVMSLEEKEAIRDPRLLVTCGIVLLAVFTAFIAHSPLHMEPS
MVALLGAGILVVASRLKPSDYLSSVEWDTLLFFAGLFIMVGALVKTGVVK
ELARVLISASGGNTLAATMIILVASAVISGVVDNVPYAATMAPVVADLVP
ALTDHANPGALWWSLALGTDFGGNLTAIGASANIVMLGIAHRSDNPISFW
EFTRKGALVTAVSIALAALYVWLRYFVMA
379762967YP_005349364.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MRAEQIAEDFPVVSIDADALEAARMLAEHRLPGLLVTDGSGRPYAVLPAS
QVVRFIVPRYVQDDPSLAGVLNESTADRCAEKLSGKKVRDVLPDHLVDVP
PAHADDTIIEVAALMARLRSPLVAVVKDGGLVGVITASRVLAAALKT
379762966YP_005349363.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MLEQIRGPADLQHLSAHQLRELAAEIREFLIHKVAATGGHLGPNLGVVEL
TLALHRVFDSPHDPIIFDTGHQAYVHKMLTGRSHEFQTLRKKGGLSGYPS
RAESEHDWVESSHASAALSYADGLAKAFELSGHRNRHVVAVVGDGALTGG
MCWEALNNIAASGRPVIIVVNDNGRSYAPTIGGVADHLATLRLQPVYEQA
LERGRDALRALPLVGRLAYRVMHSVKAGIKDSLSPQLLFTDLGLKYVGPV
DGHDERAVEAALRHARGFGRPVIVHVVTRKGMGYAPAEDDEAEQMHSCGV
IDPLTGQATSVPGPGWTATFSDALIGYARKRRDIVAITAAMPGPTGLTPF
GQQFPDRLFDVGIAEQHAMTSAAGLAMGGMHPVVAIYSTFLNRAFDQIMM
DVALHRLPVTMVLDRAGITGSDGASHNGMWDLSMLGIVPGMRAAAPRDAT
RLREELGEALEVDDGPTALRFPKGDVGEDIPAIERRGSGISGVDVLAVPA
GGCNHDVLLVGVGAFARMALAVAKRLQDQGIGVTVIDPRWVLPVSDNLLD
LAARHKLVVTCEDNGVNGGVGSAVSAALRRAEIDVPCRDVGLPQRFYEHA
SRGELLADLALTDQDVARRITGWVAALGSSEAEAEIREHLD
379762965YP_005349362.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MGEPSPDGPGSSAPGGTEPAPTPLPRPTEGVPPISVSVYEIEAAAERLDR
GRGPFAVDAERASGFRYSNRAYLIQIRRAGSGTVLIDPVSHGRDPLEALR
PVAEVLGTDEWILHSADQDLPCLAEVGMRPPALYDTELAGRLAGFERVNL
ATMVERLLGFGLAKGHGAADWSKRPLPAEWLNYAALDVELLIELRAAIAE
VLAGQGKTDWAAQEFDYLRDTGSKDPGAAARRDRWRRTSGIHRVRDKRGL
AAVRELWLTRDQIAQRRDIAPRRILPDSAIIDAALANPTTVEELVALPVF
GGRNQRRSAATWLAALEAARQNKNPPVDAEPPNGPPPPARWSRRKPEAAA
RLEAARAALSEVSERVHVPTENLVSPDLVRRLCWDWEAAPDPFEAVEAFL
RAGQARPWQRELVDPVLARALQAEGTESAG
379762964YP_005349361.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTSSEPAPFREAVAAMNAVAVRPEIELGPIRPPQRLAPHSYALGAEVKHP
DREIIPERSDGDAFGRLILLYDPEGADAWDGTIRMVAYIQADLDPSEAVD
PLLPEVAWSWLVEALESRMEHVVALGGTVTATTSVRYGDISGPPRAHQLE
LRASWTATSPAVGAHVEAFCEVLEHAAGLPPAGVTDLSSRSRA
379762963YP_005349360.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MPVSQPPANYDEFPSLRCELGENGVLTLVLDSPGLNSVGPQMHRDLADIW
PVIDRDPAVRVVLVRGEGKAFSSGGSFDLIAETIGEYEGRIRIMREARDL
VHNMINCDTPVVSAIRGPAVGAGLVVALLADISVAGRTAKLIDGHTKLGV
AAGDHAAICWPLLVGMAKAKYYLLTCETLLGEEAERIGLVSTCVDDDDVL
STATRIAENLAQGAQNAIQWTKRSLNHWYRMMGPTFETSVGLEFLSFSGP
DVQEGLAAHREKRPARFTGGSAT
379762962YP_005349359.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MWFMRQAGRSLPEYRALRAQHDMLSACFDAELVCEITLQPVRRHDVDAAI
LFSDIVVPLLGAGIDLDIVAGVGPVIESPVRTAADVAAIKPLERQRVQPI
SNAVSLLVSALGDVPLIGFAGAPFTLASYLIEGGPSRHHARTKAMMLADP
DSWHALMEKLTDITVGFLRVQLDAGVDAIQVFDSWAGTLSLANYRAYVQP
HSARIFAALAEYGVPMTHFGVGTAELLGAMSEVGATVVGVDWRTSLADAA
ARVEPGTALQGNLDPVVLLAGWPVVERAARAVVDDGRRAVDAGAAGHVFN
LGHGVLPETDPAVLTDLVSLVHSL
379762961YP_005349358.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSLGDDAAITLFDPGERLGGILRTELVGGAPMDLGAEAFVLRRPELPALL
DELNLTGHQLVSTGARPLIYSGQRLRPLPTGTIVGIPSSAASVAGLVDEA
TVARIDAEPSRPLEWVAGSDPAVADLVGDRFGDQVVARSVDPLLSGVYAG
SAATIGLRAAAPTVAAALDRGAASLTDAVGRVVPPATGAPVFGALDGGYR
VLVEELAARARPRWVRAAASRLERADAGWAVFDDTGARWGADAVILAVPV
HESCRLLGGIAPRSVAAAGRIASASSVVLALAVPADTAFPDCSGVLVATG
ERLRAKAITLSSRKWGARADVQLLRLSFGRFGDHVAASTSDDELLAWALG
DVAAVFGLDIDPVDVRVQRWIDAMPQYGPGHADLVAEVRAGLPPTLAVAG
SYLDGIGVPACVGAAGRAAEDVIRAIGGPDAQVAR
379762960YP_005349357.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAKLDYDSLNSQIRYLMFSVFSVEPGELGEERDDVIDEASTFLKQQEERG
VVVRGLYDVAGMRADADFMIWTHAERVEALQATYADFRRTTALGRASSPV
WSSVALHRPAEFNKSHIPAFLAGEEPGNYICVYPFVRSYEWYLLPDEERR
RMLAEHGMAAREYKDVRANTVPAFALGDYEWILAFEAPELHRIVDLMREL
RATDARRHTREETPFFTGPRVAVEQLVKALP
379762959YP_005349356.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTAPFDPTDPTRFEQMYRDDRTSHGLPTATPWDIGGPQPVVQQLVALGAI
KGEVLDPGTGPGHHAIYYASKGYSATGIDGSPGAIERARANAEKAGVSVN
FEVADATKLDGFDGHFDTVVDCAFYHTFSTEPELRRSYAEALRRATRPGA
RLYMFEFGEHNINGFKMLRSLSESDFRDVLPDAGWDITYLGTTTYQVNIS
AESIELMAARNPDMADEAAKLLERFRAMEPWLDGSRVYAPFWEVHATRAD
379762958YP_005349355.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTSPDVSRPKLQLTDDEWRQKLTPEEFHVLRQAGTERPFTGEYTDTKTEG
VYQCRACGAELFRSTEKFESHCGWPSFFDPAKSDAVILRPDHSMGTTRTE
VLCANCHSHLGHVFAGEGYPTPTDQRYCINSVCLRLVPSGA
379762957YP_005349354.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MYGALVTAAESIRTGSRERLLTAFRPRTGAPSVASILRSALWPIAILSVL
HRSIVITTNGNITDDFKPVYRAVVNFRRGWDIYNEHFDYVDPHYLYPPGG
TLLMAPFGYLPEYPSRYLFILINTVAILAAWYLLLRMFNYTLSSVAAPAL
LLAMFCTETVTNTLVFTNINGCVLLAEMLFLRWLLDGRIGRQWWAGVAIG
LTLTLKPVLLPLLLLPVLNRQWRALVPAFVIPVVVNAAAWPLVSDPMDFV
TRTVPYFLGTRDYFNSSIEGNGVYFGLPTWLIVFLRILFTLLAIGALWLL
YRHYRTRDPRFWLTNSAGVLLLWSFLVSSLAQGYYSMMLFPFLMTVVLPN
SLIRNWPAWLGIYGFMTLDRWLLFNWMRWGRALEYLKITYGWSLLLIVVF
TVLYFRYLDAKAENRLDDGIDPAWLMTERQRATVDA
379762956YP_005349353.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MVGMSRPYTCATILVAVTALLAGCVPGLAANPRFATNSGARPQGAATSKP
APTGPPPIAAPKNDLAWHDCTSRVFADAAVPAAAGVQLDCATYDSDLDPV
NGGGGSLSIGVVRARTNKTPHDAGPLVFTTGSDLPSSAQLPVWLSRAGAD
VLAAHPIVAVDRRGIGMSSPIDCRDKFDRQEMRDQSQFQTGDDPVANLSE
VANTATTNCTDAIAPGASAYDDAHAASDIERLRSTWDVPALALIGIGNGA
QVALAYAGSRPDKVARLVLDSPVALGTNAEAAAEQQVKGQQAALDAFAAQ
CIAVNCALGPDPKGAVSALLADARAGRGPGGASVAQVANAITVALGFPSG
GRVNATTDLANALAAARSGDTNGLNNLINHANTVQDSDGQFVNVCSDAVN
RPTPDRVRELFVAWGKLYPQFGTVAALNMVKCVHWPTGSPPPSPKTLKVD
VLLLGVQNDPIVGTDGVAATAASIINANAASKRVMWQGIGHGASIYSGCA
VAPLNGYLSSGKLPNTDTYCPA
379762955YP_005349352.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MPETPLSLLGSVRDLEDGELPRLYGYPEQDATWVRANFITSVDGGATSGG
SSGAMGGPGDRFIFNLLRELADVIVVGAGTVRIEGYSGAQLSAAQRQHRQ
ARGQSEVPPLAIVTKSGHLNRDMAVFTRTEVPPLVLTCAAATAQTRRLLS
GVCEVVDCSAGDPEKVDEAALLAALGARGLRRILTEGGPMLLGSLIDRDM
LDELCLTIAPYIVGGQARRIAAGPGQLLTGMRCAHVLTDDAGYLYTRYVR
A
379762954YP_005349351.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MHGSTSAGVSGAVARLVDRHPTVSPERLIAQLRPPPTFADVSFATYQPDP
AEPTQAAAVLACQDFCRQATQRRAGRRKLLGRRQVLPGVGLYLDGGFGVG
KTHLLASAYYELPGDGPGGSKGGTPDGPPPKAFATFGELTQLAGVFGFAE
CVDLLGTYTAVCIDEFELDDPGNTTLIARLLSSLVERGVSVAATSNTLPE
QLGEGRFAAQDFLREINTLASIFTTVRIEGPDYRHRGLPPAPQPLSDEQV
AARAARVDGATLDDFDALCAHLATMHPSRYLTLIEGVRAVFVTGVHGIDD
QNVALRLVSLTDRLYDAGIPVVASGAKLDTIFSEEMLAGGYRKKYLRATS
RLLALTAAASPAREP
379762953YP_005349350.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MESLIRTVHVAAADSGAAAELAAVAGLTFPLACPPTAAPENIAAFVAANL
SAERFADYLADPHRAVLTAAHDGRIIGYAMLIREPGAAELSKIYVLPAYH
GGGVSTALMDRALATAGEWRARRVWLGVNQANQRAQRFYAKSGFRISGTR
TFRLGAGLEHDYVMVRELG
379762952YP_005349349.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAKMRRWLVSVSAALVAAASATAVVPAPPAGAGDAPIGHIGDTLRVDNGT
FIADVTVSGVAPCDPPPGFGYTREGTYKGFPGSTVERADVTIRAIRVPNP
YIMATIFSFNGVTPNADAYKPRASDAPDALDNVIVNAPNGAIVRGEVYWD
AYRDPVSTVVLLDKKTGYHLAQWNL
379762951YP_005349348.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSEPIRIAYPIRLDELITAIKTTHPDVLDQLTDAVLAAEHLGEIADHLIG
HFVDQARRSGASWTDIGKSMGVTKQAAQKRFVPRAEATTLDPEQGFARFT
PRARGAVVAAQNAAHEAGNGEITPDHLLIGVLADAAALATVLLRLQKIDT
EALRDAAAASIAALRVEDQPPELIPFSGPARKALELTVREALRLGHNYVG
TEHQLLALLELEAASSTPGPLHRCGVDKDRVEADLIAALDSLGGGKSVAP
DGGGDA
379762950YP_005349347.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MKLMLALSGLAVTIGLAVPAHADPVDGVDGTDEAFIASLRAAGITFADSD
KAVGAGKWVCDTVGQGTQMPDVVKTLLSKNSALSEGKANQFAAIAASTYC
PGAITSTTNTP
379762949YP_005349346.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MRFLLGLCSAAAALGLAVPAHADVDNDQDFLKDLRDAGITYQDAGNAITI
GKSVCELLDDGQSDAKIVTDLRNQNPAFQGASAAKFTFLSAAHYCPKYIT
GEDRGPKPDGAAGN
379762948YP_005349345.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MHAINGVRDPAAGFPLDTAADDAGERRQANRAVAVSAAGLALTGLVELVI
ALLSGSVALLGDALHNLSDVSTSALVFVGFRASRKVPTERYPYGYERAED
LAGIGVALVIWGSAVVAGFESVTKLLRHGGTGYVGWGIAAAVVGVAGNQL
VARYKLVVGKRIRSATMVADAKHSWLDALSSAGAVLGLIGVALGWGWADA
VAGIVVTGFICHVGWEVTADIAHRLLDGVDPDIITTAEAVAASVPGVTHA
HARARWTGRTLRVEVEGFLNADTSLGASDQIGRSVAAALAPRIPEMQSFT
WTARAA
379762947YP_005349344.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MMETRPLNSLEMEIVFLEVSARDALVRVPVAFMLLPKTVRPWRDQPSKPE
QDK
379762946YP_005349343.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTATASSPTLSGALLIGGERITAASGGTYRHVYPGTGLPNASIPLAGRSE
VDRAVDSAWDAHRQWMSYPVDRRRDLLFALADVVRDHFAELSELNVHDYG
VPIAVAGNSVLTERFLRYYAGYVDKSHGASTPVAGAFDVNIVEREPYGVV
GVLAPWNGPLVVVGAAVAPALAAGNAVILKPSEVASLAPLRFGELCLEAG
LPPGLVNVLPAGPKGGDALVRHPGVRKIHFTGGQATAQKVLQAASHNLTP
VTAELGGKSAYLVFADADLDMAAVIAAHQGPITQAGQSCACASRILVHAS
VYTAFVEKLAAAVRAAKVGDPLQPDVMLGPVVSEAAAERILGVIDQAVSE
KAGDLITGGRRLGGELASGYFIEPTIFANVDNRSALAQTETFGPVASVMP
FGDEDEAVRIANDSRYGLNAFVATSDLERAHRVARRLEAGSVWVNRHSDI
APQGPYGGYKQSGFGRTGGVEGLYDFLQVKNIRIGMS
379762945YP_005349342.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTDDGSRHERGLRTFAEVMTVDPPGDRGPFTAGLIDFVFGEVWSRPGLSR
RDRRFVTLACVAAADAQAPLEQHVYAALNSGDLTITEMRETVLHFAVYAG
WPKASRFNIAVDQEWARIAEERGEAPPPPEPLLPLVTTSDPEQRLQGGEA
SFKEINCLPFAPMRDNPYSGAGILNFVFGEMWLRPGLGMKERRLITVACV
AFQDAEIPIISHVYAALKSGDVSFEEMDELALQFAAYYGCAKADYLNQVI
AEQKQRVTAENRADPAPVG
379762944YP_005349341.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTTNDATGRVAGKRILITGAARGMGRSHAVRLAEEGADCVLIDICSTPAG
LEYPLATEDDLNETANLVEKHGRRAITAVVDVRDEAAMKAAVDAAAGELG
GLDGAVANAGVLTVGTWDTTTAEQWRLVVDVNLIGAWNTCAAALPHLVAR
GGGSLVNISSSAGIKGTPLHVPYTASKHGIVGMTLALANELAAQNIRVNT
VHPTGVATGMAPPTMHTLIAEQRPDLVPIFLNALPAPLIEAADVSNAVLY
LLSDESRYVTGLELKVDAGVTIR
379762943YP_005349340.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MGSLDGKVAFITGVARGQGRSHAVRLAREGANIIGIDICADIPANGYPMA
SRQELDETVALVEEAGGKMLGTVADVRDFEQVKTAMDSGVEHFGRLDIVL
ANAGIAPLAFRELSIEEELAQWRAVTGVNLDGAYHTAWAAVPHLLSGNRG
GVIIFTSSTAGIKGFGGLQGGGLGYAASKHGIVGLMRTLANALAPLNIRV
NTVHPTAVNTMMATNDDMTDFLEKNPGAGPHLQNPMPVGMLEPEDVSAAI
AYLVSDEAKYVTGVTFPVDAGFCNKV
379762942YP_005349339.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MDSASGPRVDPILDIVVEMLDTEGYEAVQLREVARRARVSLATIYKRYPT
RDELIVAALEGWMDANRYARLPSLIEDLPGDSIYVDLMHVMRTIFEPWES
HPLMLRSYFQARSGPGGKRLIQRGVDAVVPVAKAILAQADPGFAKDLELI
LPGVVYGFLTRFAQGEIDVTEIVPGIERTVFWLTAAQG
379762941YP_005349338.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAHLKAGFAKWSAACAIALATGALAGAAPAAADDDADDAFLAGLDRGGIT
MFDDDDAIATAHAVCSSIETNPNVSMLAIKLTKQTPMSAKQSGYFIGLSV
ASYCPEYKDDVDPSMGWLIPPPIL
379762940YP_005349337.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MRSIIAVVVAFGCALISAPAAAADDDFVALAVSVGSGRAAGWGTGGSQDQ
ANQIALAHCTAEAGDVCEVVAGTRNGCASVAFDRSGRFQGGSGPDTTASN
ADALAKLGAPNGRIKASHCSS
379762939YP_005349336.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSWTRYDGRALADVSLDGEALHAELEDYIRVDNPHLTDVRLERATASEPF
DAESRKRWYEVTYLAEDPEDTA
379762938YP_005349335.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MGGNAGRLYRFDLEALVPIAGKIGPTVAEVRTPLEDTGYRAPAAFGYRPF
EGGLALKRLAPQRH
379762937YP_005349334.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAPRPSPQTERVVNLFEQLAGDGSRGMTLAEVSRHLSVHKASCHSMLSEL
LRAGWLLRDPVRKTYHLGPALVRLGREAAGRYPALVLARSAMAELSAATG
AHCVAFSVSEDYSTVVDQVRSRRGGGHPMPIGTQFPHRPPYGASTVAWAG
PEVRERWLAALPDDVRDRYREAITNARRRGYAVGLHLLPDLRLQELALIV
RSAEVRSTRLSRLAQELTDELIHQEEWFPIDLDADRTYEVSHIDSPILGP
GSRIALMLSLVPSAEPMSGAAVTGLGAQLASATRRLSAALNDESG
379762936YP_005349333.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTMTTMEDLRGKVAVVTGGAGGIGRAMGRRFGREGMRVVLADVLAEPLEE
ATRALADEGFEAAGVLTDVTDYSSVESLAKEAVSRFGAVHVVCNNAGTGG
VSEGYMWEHDLADWRWGIDVNVLGVIHGIKAFVPLLLEQGEGHVVNTCSG
NGGFAPIARGAMGGPATAVYPMTKAAVLCLTESLYTHLEMTGKGVRAHVL
FPGGFLNTGIWESWRHRPQRYAATQQRRTPEQTLDKVVARFAAAGAHVEF
TPLETVADQVVDGIRADRFWMMGPPTPADQVVSAKAASILSRGAPDYLVD
VLGRSAGKD
379762935YP_005349332.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MNTNVIRYGPRPPEAQVDHEIDATKAPIATEAVTVTYLTDPEIVAAVLPR
PLQPAAEPLVRIQLQRVRIEGMAPFGSAVFSVTARHGEVEGDYPLFMPQS
TEQSVTGGRETFGEPKKLARIEVERDGDRVTATVDRLGYALIRLSGQITG
PAELPPDQVNTEFYFKFLRAPDGSGITDPHLVYGEYHRHYELLENIDGTL
ELGESPLDPVADIVVRQVRSITWCRRRTVQVGRIAARVPQEWLLPYVHQR
YDDVALLAAPRPEPARA
379762934YP_005349331.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MDRYTVISADCHAGADLLAYREYLDPQYRDEFDGWAKTYVNPFGDLTEPE
AERNWNSDRRNADLDSEGIAGEVIYPNTVPPFFPQASLAAPPPETARELE
LRWAGLRAHNRWLADFCSLSPERRAGVGQILLPDIDEAIAEVAQIAKLGL
RGGVLLPGIAPGTGIPALYAEHWEPLWAACAEAGLVVNHHGGNAGPSPTD
GWGSSFAVWVYETHWWAHRALWHLIFSGALDRHPDLTVVFTEQGAGWIPA
TLDSLDVAAARYGRENSAIARFAGPTAGSLSLKPSQFWARQCYVGASFMR
PVECAERHRIGVDRIMWGSDYPHYEGTAPYTREALRHTFSRVPAEEVAAI
LGGNAAAVYGFDLEVLAPLVERIGPTVAEVAEPLDTVPADARSTVFEPDP
IRAW
379762933YP_005349330.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MNPYIIISADTHAELPTERYREYVDPEYREDFEAYLAEKTAAAQAGGFID
EEFAQEWFSEHGDGIAGGWDVGLRDRELDGDGVVGEVIFPDADAVTGVAG
APFGAGLGQSGDLDPGRAMAGARAHNRWLAELCSHSPERRAGVAVVPILA
DVDAAVAEITRAAESGLRGGILIPARWVGYPPYHDRRYDKVWAACQDLQM
PIHTHSGPAPQEEYGGHLGIYVTEVRWWGARPLWFALWSGVFERFPGLRW
GVTECGAFWANDLLWLMDTRYLREHSAKKMSHLMEGDLTMPPSAYFDRNC
FIGATTTERRELARRYEIGVSNILWGNDFPHPEGTWPHTRNWLRRSFWDI
PVEETRQMLGLAAAEVYNFDLGALASLAERIGPTPEDLGQDDAVSIPKWE
AARQVGRHWLTDTEPIPDLVQN
379762932YP_005349329.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MPLKRVDELKPGDRIRMKVGHATVVATEPLDDDRTMLTFTYGTKAPADSS
LTVDVLDDDDWGW
379762931YP_005349328.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MPAGTCIPSQLHGIIDRHAMNAHCCSGVNGLGPAQGGVPAVPHIGSAAAG
GDAANMATAIIGAMAAMNVVTKRRVRCMATSNL
379762930YP_005349327.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MQLKWLSVADLIARAGGDPWAINQSLQAGSPAQISSLAEAFHGAGRHTAE
ADHAFEQARKRFDAAWNHQNGDHPINDSAEVQRVIKSLGAQSEQLPKIGS
DLENIAAALAEAQKAGAQRISTLEHALQGLDHIIDAAQHDLQYGHPDAKT
QAFLKKLIDDATADAADDVRDALGDLESTRDGYSATLQNCLGNLRTDGYD
PNILAPVDADTQIPPTSTNPEDVNRWWTSLTPQQRQRFMAEHPDRIGNLN
GVPILARNDANLTVMNQDLDRVRGIASRNGVSVDDVLRDPAKFGLSATDV
TRYQNANETKLGLDHDAGDPLHPKPVYLFAYDPTAFGGKGRAAIAIGNPD
TAKNTAVIVPGTSSSVKGGWLHDGHNDAINLFEQANAADPHNPTAVIAWM
GYDAPNGFDDVQRISTPALARAGSASLAQDVNGLWATHLGAGQHVTVLGH
SYGSTTVADAFAMHNMHANDAVLLGCPGTDMARSAEQFHLDGGHVFVGDA
STDPVGMLGHLDGASKKLFGENFFGTNPSLGTDPAVDGFGSVRFRAEVPG
SDGINPHDHSYYYHRGSEALYGMSDIVSGHGDQLQADGMTADHRNSLGGV
QVRIPGLPPVTIGPHTPAVIDPEWERSPGSITDNHVFDAQHHH
379762929YP_005349326.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSDDQTKAQVIEPAKQIVAAAKLEGVSGAFSFASCNDQGDPPFQGTVTLS
FLIHGDPDTYFQQVRAAMIAQGWNEGAPRGQHYHGASLNKDGVAASISYM
PSDHAYGQIILDGQCRNMGNHKGEGQWTNINDQLAAR
379762928YP_005349325.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MGMFGIGDMLGLFSIGIFMSFIMEAQQSFDWAAGGSAFIMEQQSDLAKRR
379762927YP_005349324.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MVRGQGRKAQKRGAFGTAHKLPSGRYRAMYFGPDGRRYKADKTFLTEKDA
RGWLSLRQAEIIRKAWVPPEADEQPAPKLTFETYSQTWMAQRDLKDRTRE
HYEKLLEDHIRPMFGSWPIGSITVDDVRVWHTKMGTKTPTLRAHCYGLLR
TIMGTALSDGKIRVNPCQVRGAGSARRVHKIRPASLDEIATITEEMPEQY
RAMVLLAAWCALRFGELTELRRKDITIVEPTDEQLANAAAAGEAAPEAYG
IVRVERAVVRVDEGFQVTTPKSDAGRRDVEIPPHLLPAIKYHLEKFVEPG
KDELLFPAAQGGHLAPASLYRQFYKARSAARRDDLRWHDLRHSGAVLAAA
TGATLAELMARLGHSTPQAAMRYQHAAQGRDRQIAKLLSKLVTNSGS
379762926YP_005349323.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MASTTTSRRRYVKIAEAARYLQVTDRTVRQMIADGRLTAYRAGQRLVRLD
LNEIDAAMKPFGGAA
379762925YP_005349322.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MLATGRTPVLPIEVRRALWRRGGADRELAELLHEACGEAIA
379762924YP_005349321.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTNTDTDESWEAADAAREAAALFDERAVTAAWLDQQTFPPLEWIVEGILP
EGMGLLAAPPKAGKSWMVANIGLACAAGGSAIAAIPVKQRPVLYLALEDG
HRRLQSRFRTLMEGQELPADLEVVTRASSTESLVIIDEFLRRNQHKAPLV
IIDTLGKVKPPKASWEDSYQADYRIGGDCPAFS
379762923YP_005349320.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MMYPLVLDLADDGVPVTVTCRVLGFSTQAFYKWRKAPLSQRDWDDAHLIN
AARDIHADDPAFGYRFIADELPGRGIFASENRVARLCSQERIWSVFAKKR
GLNRRSGPPVHDDLVQRQFSAQAANQVWLADITEHRTDEGKLYLCAIKDV
YSNRIVGYSMDSRMKSSLAVAALDHAVALRSPAATIVHSDRGSQFRSRKF
VHALSHNGLHGSMGRVGACGDNAAMESFFALLQRNVLDRRRWSTRAELRL
AIVSWIERTYHRRRRQRALGRLTPIEFELLHTQAATAA
379762922YP_005349319.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSSLWPGKGEAPLRQIAKDFGISEACLHRWLKIADREDGANRLSPAAVSE
DVSAQLREAHKRIKLLEQEAEVMRRAVGYLSRDANPK
379762921YP_005349318.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MHVVASKYDPETRARAVRLVLDHRDDYPSEWAAITAVSQRLGMTAETLRS
WIRRHQVDEGERDGVSSDAAAQIRALKRRNAELEQTIEILKAATSFFVRE
SDPRNRR
379762920YP_005349317.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MLSEHGMPIAPRTFHAWATRAPSKRALWDATITQILAGCYEPDEQGRRKP
ESLYGSLKMWAHLQREGIPVAKSTVERLMRKNGWQGVRRCKKVRTTIPDP
AAVRPPDLVDRQFAVPAPNLLLVADFTYVKLVTGIFVYVAFVIDAYAGAI
LGWEASASKHTRFVESAIRQAAALRRRQGHPIDGAIHHSDAGSQYTSVRF
GETLSLSGIRPSVGSVGDAYDNALAETTIGLYKNECVRADSPFRRGKLNT
VGDVEYITADYVAWYNQQRLMHRLGRIPPAEAETRYYSQLVTDQSAGSQN
PEGA
379762919YP_005349316.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MKLGMVQIAALNEICFISWPYRPAPISEIAAAKTQVSDQSAWIAAE
379762918YP_005349315.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MKSLVSGLFRVNPKKTAYHSVMGITDARDYVIGDDVEVDDVDLGQEAVYV
NGVRLTNERVEQMAAESVALARSREAKA
379762917YP_005349314.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MKLLYDAEGAAELLSTTPKRISELRRAGVLGAVLDGKKYKFTADELQRYV
DRLPAYEPGQRTSCI
379762916YP_005349313.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTEEVGLMDLTALELELFATLLTPAHRRVLAGRLPTVGDRDRPVLRLVRD
EVTL
379762915YP_005349312.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MNRVSKVTLTTELPIPAETAAALARKPELMRHVLSPVLRIYRLDVPERIE
VGTQGSARFWWFGVIPAWTHHLTIKRLEPTEIYTNEHGGPVRTWNHRLTF
EPIDERSCRYTDEIETDDGLNGVLTRAFVRLMFRHRHRRWRKLAHILR
379762914YP_005349311.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAQNPSTPPNTPRPPEGDWLGTPYLRFERQGPIAVCTIDRPDARNALSPA
MYFGIRYAVGRLNEDPDLAGLVLTGTGDVFAPGGDMGGGGGEDNWITFGS
ALGMDVTPFDAVRTSAKPIVSAVNGLCQGGGFQIALCSDLSVVSDRATFR
VPELFRGYADTYYSQMLTRVIGPVRTRDLMFTGRVLTAVEALDWGLVSRV
VPHEGLLDAAKDLLAQCCRTAPRARGVIKSSIDSYLGLYDRIGMTSSLSD
AEAIEGFRSFKERRSPDWVHPELRVEGRL
379762913YP_005349310.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MDARRRDCAISVLGGPTTVIDIAGRRIVMDPTFDPPGVHAYLTKLTGPAV
SAEALGPVDAVLVSHDQHPDNFDDDGRRMALAAPLLLTHPGAAGRLGPPA
VGLAPWESHELGGGTGSLTAQAVPAVHGPADGQRDDGGHINCEVTGFVLS
GPGLPTVYLSGDNASMSAVKDVADRVGQVDIAVLFAGAASVPTKERGRPL
TLTAARAAAAAEVLGAKAVIPAHVDGWAHFSEGVDEFVAAFDQAGISSLL
KVAPHGDWIEL
379762912YP_005349309.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MPQTDTAETLAGIVERHALQRPEAIAIRYGERQWSWADWSSRIRRAAGVL
RDAGIERGQCVAFLDKNHPACLEVLIAGASIGVVTTVVNWRVIGDELVHV
LADSGARVLLVGAELRAAAEAAAERVPGLERIIEVGEEYESLLAAASPAE
ADAGLDPNETALVIYSSGTTGRPKGVLLSQRALVNHAANLAPAFPFADGD
ANLVAMPLFHVGGIGYALFGIRSGAPTFLTREPDAATLIGAVRAGATHAF
FVPPVIARFLQAGEAATAAIAGLRYIVYGAAPMPLPLLHRALATWPDTKF
VQVYGQTELCGAVTALSDADHRDSARPELQLSAGKAVLGCEIRIVDPETG
ASLPPGQSGEVWVRSNQNMTGYLNRPEATAETITADDWVRTGDVGRLDAD
EYVYIEDRLKDMIITGGENVYGPEVESVLIEHPAVADAAVIGVPDDFWGE
SVKAIVVPDGEADPAGIIEFCRQHLAGFKCPRTVDFVSELPRNASGKILK
TQLREPFWRDRSRGI
379762911YP_005349308.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MVVLAGPHACVGIALASGEAIAIAQGVSVTPAPGWTLGNRGPNWVALNNA
DTSAQMRITVKHAGGTDAAAVLQADIDQYVSGASAILTGVNRLTAPDVTP
LQGPNFQQQASLNYTAGVVNPQGTIPVIGTFTELLNTSNGRSAFIDFRQG
SGATTQAAGDGGMMVGSME
379762910YP_005349307.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MVNPDRARSRTFVVTGAASGIGLATARRLLAEGGTVVGADLAAPPDDLGP
RFTFVPADVTDEAAIAAVLDAVPGRLDGLFHAAGVAGGGPVHLLDRAEWD
RVIGINLTGTFLVAKAALARMIDQPCAEGERGSIVTVASVEGLEGTAGGS
SYNAAKGGVVLLTKNIALDYGPSGIRANVICPGFIETPMAHSVFSIPGME
GPLASITKEHALQRLGQPEEIAAMAAFLLSPDASFVSGQALAVDGGYTAG
RDHGVVELFGFPS
379762909YP_005349306.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSGGLTPDQAIEAIRGAGGARPGCRALHAKGTLYRGTFTAARDAVMLSRA
SHLDGSPVPALIRFSNGSGNPKQRDGRPGVRGMAVKFTLPDGSTTDVSTQ
TARLFVSSTPDGFIDLLKAMRPGLTTPLRMGKHLLTHPGLLGRLPILREA
NRIPASYATTEYHGLHAFRWIAADSSARFVRYHLVPIAAEEYLSVSDAHG
KDPDFLTDELATRLDGGPVRFDFRVQIAGPTDSTVDPSSAWQSTQIVTVG
SLQITGLDTEREHGGDIVVFDPMRVTDGIEPSDDPVLHFRTLAYSASVKL
RTGVERGAEAPPA
379762908YP_005349305.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MFLICLAGLAAGAINALVGSGTLITFPTLVALGFPPVTATMSNATGLVAG
SVSATWGYRAELRGQWDRLRWQLPASLAGATLGAYLLLHLPEKVFAEIVP
VLLVLALALVVIGPRIQAWTARRAAQAGRSPEHVPPGRMATLVLGTFAVG
VYGGYFTAAQGILLVGLMGALLPESVQRMNAAKNLLALVVNVVAAVAYTA
AAFDRISWPAAGLIAAGSLVGGLLGARYGRRLSGSALRAIIVVVGLIGLY
RLLAVA
379762907YP_005349304.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSGHPTVGAEEEFLLVDPRTGEPSPRNADVAAEAERRGVALQLELSSCQV
ETSSDVAASAAELGAELRRLRRTAAQAAQAVGVQLLACGLPPATPHAFPV
TDTPRYRRIGDEFGMIAHEQGICGCHVHVQVPDRAAAIHVSNWLRPWLPS
LLALSANSRVYRNADSGYASWRSVLWRRWPAAGAPPFFASPGEYDDAVRM
LVDTGVILDKDMVYWDVRPSVEFPTVEVRVADVPATVDETVLLATLIRAA
VMTALDSPDDARRLPPGALRAAYWKAAHDGLSGRTLDLIHGRGAVPAREQ
LGALVQRVRPALESLGEYGHVVRELDRVATRGNGAMRQLRAWRQRGEVAD
VIAEAAAATLS
379762906YP_005349303.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MLSTKLVYELGDPHSTLRATADRCGPAVLIYAGGEIDACNEHTWRHLVSE
AAGVVTAPGPFVVDVTGLEFMGCCAFAVLADEAKRCQKRGIDLRLVSCEP
IVARIIDACGLGGVLPIYPTVDSALSAAARW
379762905YP_005349302.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MLTAAYELFSRRGIRAVGTDEVIARAGVARATLYRHFATKNDLVLAVLQR
REELWTHGLIEEQSRQRGTTPEEQLLAIFDVMHDWFQLRDGYEGCSFINV
LLEVGPDHPAGQACITHIDHVRDIVRGRAIAAGLTDIEDFASSWHILMKG
AIILAAVGDLDAAKRARRMARALIDEHRPPLVADTSEAV
379762904YP_005349301.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MEPLLHSIPPLAVYVVVGGVVGIESLGIPLPGEIVLVTAALMSSHHDLAV
NPIGVGAAAVIGAVIGDSIGYAIGRRFGMPLFDRLGRRFPKHFGPGHVAL
AEKLFNRWGARAVFLGRFIALLRILAGPLAGALKMHYPRFLAANVSGAIC
WAGGTTALVYFAGIAAERWLERFSWIGLVVAVVAGLTAAILLRERTSRAI
AELEAEHHSKTAEAATQADTV
379762903YP_005349300.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MPPKRERAARDVAAAAPADSLAPQYPIESVDNALRLLLLLGEQPQIRLSE
ATRYLGVASSTAHRLLAMLAYRGFVRQDPVSKAYLPGPSLTGVAFAIFGR
VDIARSAAPVLRGLSEQLRETVHVGMLDGASVRFVAAVEGPAAVRVASRL
GRTMPAHCTSTGKVMLAQLSPPELRALLPRERLERITAHSIASRAELEAE
LSDIRERGYATNREESEEGVASVAVPIPARAPGLRLALNAAAPQHGLDPS
RYPAVAAALVNAAKEIGDLLG
379762902YP_005349299.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTDRLERQRTLVAQGCRVAAARGLVDGILGHLSQRVDDERLLVRCRSDAD
DGVAFTRPSDIRLVRFDGSAGAPGELDGYRVPNELPIHVETMLADPRHTA
VAHLHPPAVVAADLAGITIRPIYGAYDIPGAWLARGGVPVYERAVLIRDS
RLGKEMVAAMRGAPVVICRGHGITSAAATVPQAVLQAISLDALARMALRV
RAAGGALRDIDDADWEDLPDLGPALTAEAAWRHEVARLPSGPASSPA
379762901YP_005349298.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTGWLEGKRALVVGAGSGIGRAILDAFRSEGAKVAALERVPEKCAALRAQ
LPDVPVTEGDATAYDANERAVTAAVDAFGGLDTLVNCVGIFDFYRGIGDI
DPPDLPGAFDEMFRTNVLSHMQSVKAAIPALRHAKGASIVLTESASSFYP
GRGGALYVASKFAVRGLVSALAHELAPGIRVNGVAPGGTLNTDLRGLASL
GLGDTRLDDRPGRAREVADRTPLHVALTGEDHAFSYVFLASDRSRGITGE
TVRPDGGFGLGATKPDPKGTEP
379762900YP_005349297.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSDEPITIANEFTEVVVRRIDTRNGSRLLISAPRSGESITLDALEVEALT
WQNPRTLAAMVGNSHAPLLPDDPEERDDGLA
379762899YP_005349296.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MRKPLPFSDTRHLEAHQFLVDEAYLLDAQRYEAWLDTLTDDVRYTMPVRV
TAARGAGFDASPFPEPGMAHFDEDKYSLTQRVARMGTEHVWAEDPPSRLR
HFITNVRTFECDDSEDVVVESAELLFRSRGDVNEAALLSCGREDLLRRCG
DRFKLARRTILADESVLRMQNLAVFL
379762898YP_005349295.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAHRDGGLLEVFENVRRGMIPAHIYNDKELFALEKERLFGRAWTFVGHES
EIPHDGDYVVRRVLDDSFIITRDSAGEVRALFNMCLHRGMQVCRAEMGNA
SNFRCPYHGWTYRNDGRLTGLPFHREAYGGDEGFAKDQTLLPAPNFASYN
GLLFISLDPNAEPLEDFLGDFKFYLDYYTKQSAGGVEVRGPQRWRIKANW
KIGAENFAGDMYHTPHTHASIVEIGLFREPKAQKRKDGATYWAHRGGGTT
YKLPPGGFEERMRYVGYPAEMIGRIKGVWTPQQQRVVGEDGFMISAATCF
PNLSFVHNWPKVRDRDDEVLPFISIRLWQPISENETEVCSWFAVDSAAPP
QYKQDSYKAYLMCFGSTGMFEQDDVENWVSLTTTAGGSMARRLLLNSRMG
LLADDRPVVEPLAPNAFHGPGRAQVGYNEHNQRALLTMWADYLQGAGA
379762897YP_005349294.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MQQVGSKVLAAIGRQEWMDRPSYRFEHLLSFAYNGLGGARNTVTNALNGV
WLGHPVHPPLASLTSGALGTTVALDVLSVLPGQPASEVVDASRFASRALG
VGILASLGSAVTGVTDWQHTHEEDRRVGAVHGLLNVAATALYMQSWWDRR
KGRHGRGIVLTALGYGITVAGSYLGGALVFDSGIGIDQSGPRLRTSTWTP
VLPASSLNGKPVRVEVDGVGLVVCQTTPGEVAAYGEFCPHLAAPMADGWM
DRGRLVCPWHGSWFAAESGEVVRGPAAAPLPCYEARLVDGVVEVRGEQQP
APGGAVGIAKGGAN
379762896YP_005349293.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MNAYDVLKEHHIVLKGLGRKVSEAPLNSEERHALFDDMLIELDIHFRIED
DLYYPALRAATKLIAVAHAEHRQVVDQLSVLLKTPQSAPGYEDEWNSFKT
VLEAHADEEERDMIPAPPQVKITDAELEELGNKMAATIEQYRGSAVHRLR
TKGRAALIRAL
379762895YP_005349292.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MDAGCVASQADITAEIARIAAQYPGGAGAGPAHDQPLLDYPPYSSTTLRH
PKHPLVAVDPEGIELWAPCFGHQDVDPLDADLTAGHPGEPIGERVAVTGR
VVDEGGRPVAGQLVEIWQANAAGRYRHQRDQHPAPLDPNFTGAGRCLTGP
DGSYRFLTVKPGPYPWRNHRNAWRPAHIHFSVFGTAFTQRLVTQMYFPGD
PLFELDPIFQSILDPAARQRLIARYDHDLTQPEYATGYRWDIVLTGGAPT
PTEGAHD
379762894YP_005349291.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MPYPGDSELVDDGHPQAIRLHGTVYDGGDAAVPDALVELWQPDTAGRIAR
QAGSLRRSHASIASAALAPGAAGRRHRDPSFTGWGRCATDDAGRYAFTTL
TPGSVIDGRPPFFALTVFARGLLNRLFTRAYLPGADPDADPLLAAVPAER
LETLLCVAENDGAAYRFDIHLQGLAETVFLAYRADAR
379762893YP_005349290.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTNLLWPGDHRAGEHMTDGALLGSMVAVESAWLSALAGAGLTAAECVGVE
LRNLVTHDDCEALAASAEDGGNPVIPLVNLLRERAEPAVAPWIHRGLTSQ
DVLDTGLMLATRAVADDLITQLREQISALSELVTRHRATPMVARTLTQHA
APTTFGAKAAAWLNGVVDAFDRMAALTTPVQIGGAAGTLAATTELAALLT
GGSDPAGVAAGVAADTATALGLAPRAPWHTARAPITGAADAFVGCTDCWG
RIASDIVTLARPEIAELSEPTADNRGGSSSMPHKRNPVLSILIRRAALSA
PPLAATLHTAAALADDERPDGAWHAEWDTLRTLGRRTVVAGSQTAELLTG
LTVHTQRMAENLDAADVLGEQQAIAELVGKDPSPTYFGAADRLIDDSLGR
AARALAQR
379762892YP_005349289.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MNSPKWMVHWPQRRPTATIYQLTDRLHRGHVARVPAHQITATVSAWLADL
GADSPLVDELERAVCGGDWAAAHALSECLSIEIAVAD
379762891YP_005349288.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MGASPPSLTDSDLDALASDFLQSHYLGAIYADWSPDRRLDMFLRRRGLAR
VANDGDLSHNVLQRIMSRAGRASLARH
379762890YP_005349287.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MPGQRAGSELPLPASRRDDSAVAGHWLLARLGKRVLRPGGVELTRTLLSR
AELGGADVVELAPGLGRTATEIVARGPRSYVGAEGDPDAANMVRGVLSDL
GAQNAAVRVADAAETGLPDASSDVVVGEAMLTMQGDAAKQAIVAEAARVL
RPGGRYAIHELALIPDTVSEEVSTEIRQGLARSIKVNARPLTIAEWSKLL
AEHGLVVDNVATAPMALLQPRRLVSDEGLFGALRFARNVLLHRDARKRVL
AMRRTFRKHRKQLAAVAIVAHKPAASATG
379762889YP_005349286.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTYAIGKPCVDVMDRACVDECPVDCIYEGGRALYIHPDECVDCGACEPVC
PVEAIYYEDDLPEDLQPHLADNAAFFAETLPGRDEPLGSPGGAAKVGPLG
VDTPLVAGQPSAAHSDGA
379762888YP_005349285.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MKTQRTQKTQKAQKARQLEKLPEVQGSVAGESAGRRRAVMRLLRASPEPM
SIAGIADELGVHPNTVRFHLDSLVTDGQVEHVELDRKGPGRPPLMFRAVR
QMDRGGTRHYRLLAEILTMAFATERDPGPKALAAGRAWGRKVDAELHPRP
DAPANAEEVIARLIEVLDELGFAPERRVVDGEQQVGLRHCPFLELAENRS
SVVCPVHLGLMQGAVETWGAPVSVDRLDSFVEPDLCLAHLTLQGAAK
379762887YP_005349284.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTTGTAIAVALTFVWLGMVLAISFLEAPLKFRAPNVTLQIGLGIGRLVFR
ALNTVEVAFALVIGAIVIAGPTPAGVIAAVGVAVAALAVQLVAVRPALTR
RTDRVLSGSDGPRSRAHYGYVALEAVKVAGLIAAGILLLSG
379762886YP_005349283.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MDSVSLTDLASEKLAEAKQSHSGRAAHTIHGGHSHELRQTVLALLADHDL
SEHDSPGEATLQVLRGRVRLTTGGDAWEGKAGEYLAIPPERHALHAIEDS
VVLLTVLKTIPSAH
379762885YP_005349282.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MLSTPWATSFGLRAPIVNAPMGGVAGGRLAAAVTAAGGLGMVGMGSVATR
ELLAEQLRGVDGQFGIGLVDWVMRNEAGLLEDALAARPALLSVSFGTDWS
WVAKAHDAGIPTVTQVYDSDGARRAVDAGVDILVARGSEGGGHGEVKLGL
LPLLDAVLDAVTVPVLAAGGVASARSLAAVLAAGASGAWVGTRLSACPEA
LTGDAGRRALVAATETDTAVTRVFDVAKGLPWPARFPSRVLANEFVEHWT
GHEEALDPAACEELATAIAAGDCRIAPVDAGQGVGMIRDDASVREVIDEM
CTGAARLLSGWGTSERA
379762884YP_005349281.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MDDRKHLQRDAAGIGALADPVRHRLYQFVCDQPAPVTRDQAADAVGIPHH
QAKFHLDRLTAEGLLETGFARVTGRSGPGAGRTAKLYRRAGRDIAVSLPQ
REYELAGRLMATAIARSAGTGEPVTSVLNRVAHDYGRAIGARAGARAPAD
AAGALRRAVELLSRHGYEPRYGDGEVELANCPFHALAQEQTELACTMNHA
LISGVADALAPHGPNARLCPGPDRCCVVLAPGRA
379762883YP_005349280.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSTNQVSATPTLAEQLRDPAYSAYLALRTVFTIAPIVFGLDKFFNLLTHP
HHWSMYLAGWIDDLVPGTADQCMYLVGIIEIVAGVVVAVAPRLGAWVVAA
WLAGIIIDLVTGPGFYDVALRDFGLFVGAIALARLAQGVHSGSIGRGIAA
R
379762882YP_005349279.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MDLRALEELPLTYREVGATAAGDLPAGYDHQHAERQIGTGRQRFEQAADA
VLRWGMQRGSGLRVQASSEIAVVDAVVVVRMGFLPAPCRVVYVVDEPDIR
GFGYGTLPGHPESGEERFVVRYDPITSAVHAEVSAFSRPATWWSKAGGPV
VRVAQRLIAKRYLRAV
379762881YP_005349278.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTAQNSKTVAGASGTFTLGGDLTINRLGFGAMRLTAKGVWGPPDDRDECV
RVLRRAVELGVNFIDTADSYGPYFSEEIIHEALHPYDGLVIATKAGLLRT
GPDIWIPLGNPSYLRQECELSLRRLGVDTIDLFQLHRIDKNFPLEDQVGE
LLTLKNEGKIRHIGLSEINVDQLGAAQKITEIVSVQNMYNLSARDAEPLL
DAVTEQGIGFIPWFPLAAGPLAAPDGPLQRIAAEHDATPSQLALAWLLKR
SPVMLPIPGTSKVAHLEENVAAAQITLSDDEFETLSAAGARQTG
379762880YP_005349277.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MRAPVGQYGVVVAEHQRHPGGGFNPPEPTTKGGPDYGRFIDAVRALQDHA
RAADAPDEVITEAADLLEKVSALLAPYDADEWASPSGRRMDLPMRGNILT
IPMAARKGADGRVHGEARFARFHLGRNGAVHGGALGMLFDSILGLSAAVL
TGNPRQRTAYLKIDYRHIVPVEKELQFDAGVDRVDGRKIFVSGRLTDGDR
LLTEADALFVRLKPGQP
379762879YP_005349276.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MLSGRFGAEQGRRAVAHKSGKMDPMGAQTGLTLLLGAVAVIVLVNWISER
TGLPSAPLLVLVGIGYALVPGPNISLEPDVVMTCILPPLLFNAALESSLV
GIRRNLRTVISLSVVLVLLTAASVGIAFGLLVSGATLAVGMVLGAAVAPT
DPVAALAVARKEGLPLNIVTLIEGEGLLNDATALTTLSVAITVARGAAFS
VPSAIREFALAALGGLAVGMVFAYFRRLLRRWRHDVLTANAISLATPFVT
YLVAEELSASGVLAVVVCGLIVGHDSPRLESGASRLQTRAVWRLVNFLLE
GLVFLLIGHQLPAILDDLGGYDLSTIVVAVSVTVAVVLVVRPLWLLLTQS
LPRPLRTRLGNVSGSADADDADDANDANDANDANDANEPDGPDGPAEPDT
GRRPNRTSERLSGREVLVLSWAGTRGVVSLAAIFTVPFVTDSSAPFPDRD
LLLFCTLVVVLVTLIGQGITFGPLVRALGLRADATDELRLRNRARAAAVQ
AALDRLDSLDQQDDVDVDPRVIDGVRQQLSARLERYQHRLDLLSDAAEAP
AAPRYEAAVAIRRIAIDAQRDELVRWRDAGMLPDQSLRAIERELDHEEST
LPMRTRRARRRTQRT
379762878YP_005349275.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTVPAHAASGADGSDPQAPIRVPAGTTAAAAVRDAGLPGRGAPDGVVVVR
DAEGKLRDLSWAPAADAEVIPVAANTDDGRSVIRHSAAHVLAQAVQELFP
QAKLGIGPPITDGFYYDFDVPEPFTPEDLAALEKRMRQIVKEGQLFERRV
YESKDQARAELAGEPYKLELVDDKSGDPSVMEVGGDELTAYDNLNPRTRE
RVWGDLCRGPHIPTTRHIPAFKLTRSSAAYWRGDQNNASLQRIYGTAWES
QEALERHLTLIEEAQRRDHRKLGTELDLFSFPDEIGSGLAVFHPKGGIVR
RELEEYSRRKHIAAGYEFVNTPHITKADLFHTSGHLDWYAEGMYPPMHLD
AEYDDDGTVRKPGQDYYLKPMNCPMHTLIFRSRGRSYRELPLRLFEFGTV
YRYEKSGVVHGLTRARGFTMDDAHIFCAREQLHAELASLLRFILELLGDY
GLEDFYLELSTKDPEKFVGSDAMWEESTKALADVAAESGLQLVPDPGGAA
FYGPKISVQARDALGRSWQMSTIQVDFNFPERFELEYTAADGSRQRPVMI
HRALFGSIERFFGILTEHYAGAFPAWLAPVQVVGIPVADDHVDYLNDVAA
QLRSHGVRVEVDASDDRMAKKIVNHTNQRVPFMLLAGDRDVAAGAVSFRF
GDRTQINGVPRDGAVDAIVKWIADRENAAPTAELVKVAAGE
379762877YP_005349274.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSERERAEPRTDDTILDRGVGEEDHLQRLWTPYRMTYLAEAPMKRDNGKT
EQPFTDIPQLTDEDGLVVARGELVYAVLNLYPYNPGHLMVVPYRRVSELE
DLTDPESAELMSFIQKAIRVIKNVSRPHGFNVGLNLGTSAGGSLAEHLHV
HVVPRWGGDANFITIIGGSKVIPQLLRETRQLLATEWTKQR
379762876YP_005349273.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MPFLSRAAFARLTTPTAKACLRLGLTPDVVTILGTVVAVAGALIFFPMGK
LFIGTLVVWFFVLFDMLDGAMAREQGGGTRFGAVLDATCDRVSDGAVFCG
LLWWIAFGLHDKPLAVATLICLVTSQVISYIKARAEASGLRGDGGIIERP
ERLIIVLVGAGISDFPFVAWPPALPVAMWLLAAASVVTCAQRLRTVRTSP
GATDRGSVAP
379762875YP_005349272.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MIPTPPGMNALTAPSRLASRVAGRLSGIGADWAYASGWLAVRAMPEFAAR
NAFGAAARYAARGGGPDQLRKNLARVLRVPPSDVPDSLMRASVASYARYW
REAFRLPGMDLAAVGRQLHDSVQGRDHIEAALSGGRGAVIALPHSGNWDM
AGVWLAQTHGTFTTVAERLKPESLYRRFIAYREGLGFEVLPLSGGERPPF
DVLCDRLRDNRVVCLMAERDLTRTGVQVDFFGEPTRMPAGPAKLAIATGA
ALLAAHCWFEGQGWGVAIHPALDCTGGDVGAITQLLADHFEKNIAARPED
WHMMQPQWLADLSENKQARLRDA
379762874YP_005349271.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MRIGMICPYSFDVPGGVQSHVLQLAEVMRARGHDVSVLAPASPHAVLPDY
VVSAGKAVPIPYNGSVARLRFGPATHRKVKKWLAEGDFDVLHLHEPNAPS
LSMLALNIAEGPIVATFHTSTTKSLTLTVFQGILRPMHEKIVGRIAVSDL
ARRWQMEALGTDAVEIPNGVDVGSFATAPLLDGYPRPGKTVLFLGRYDEP
RKGVGVLLDALPRLVERFADVQLLIVGRGDEDELRAQAGEFVNNIRFLGQ
VDDAGKASAMRSADVYCAPNLGGESFGIVLVEAMAAGTPVVASDLDAFRR
VLAGGDVGRLVPVGDGAALADALIAVLEDDVLAERYVAAGAAAVRRYDWS
VVASQILRVYETVAATGAKVEVAG
379762873YP_005349270.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTWLIVAIAVLVAVLGVFGAWAYRTANRLDRLHVRYDLSWQALDGALARR
AVVARAVAIDAYGGASEGRRLAALADAAEGAPRPARETCENELSAALAAV
NPASLPAGLIAELADAEARVLLARRFHNDAVRDTLALAERPLVRLFHLGG
TAGLPSYFEIVERPHALAHGDHGVLNHRTSARVVLLDESGAVLLLRGSDP
ALGEPAPKWWFTVGGEVQQGERLAEAAARELAEETGLRVAPADMVGPVWR
RDQVFEFNGSLIDSEEFYFVYRTRRFEPSRTGRTELERSYIHGHRWCDAA
DIAQLVAAGETVYPMQLSGLLTDAAALAGGRAPGPLLSIR
379762872YP_005349269.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MVEGDQAVTSAHPPDGNGRTGTARVKRGMAEMLKGGVIMDVVTPEQAKIA
EGAGAVAVMALERVPADIRAQGGVSRMSDPDMIEGIISAVTIPVMAKARI
GHFVEAQILQSLGVDYVDESEVLTPADYTHHIDKWKFTVPFVCGATNLGE
ALRRINEGAAMIRSKGEAGTGDVSNATTHMRAIGGEIRRLTSLSEDELYV
AAKELQAPYELVVEVARAGKLPVTMFTAGGIATPADAAMMMQLGAEGVFV
GSGIFKSGDPAQRAAAIVKATTFYDDPDVLAKVSRGLGEAMVGINVEQIA
QPHRLAERGW
379762871YP_005349268.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAIEEILDLEQLEVNIYRGSIFSPESGFLQRTFGGHVAGQSLVSAVRTVD
PRYQVHSLHGYFLRPGDAKERTVFIVERTRDGGSFATRRVNAIQHGEIIF
SMGASFQTDQEGIHHQDPMPPAPPPDGLPGLDSVKVFDDAGFKQFAEWDV
CIVPRERLQLTPGKAAQQQVWFRHRDPLPDDPVLHICALAYMSDLTLLGS
AQVTHLDVREHLQVASLDHAMWFMRAFRADEWLLYDQSSPSANGGRALCQ
GKIFTQSGEMVAAVMQEGLTRFKRGYHQ
379762870YP_005349267.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSAPRIGVLALQGDTREHLAALREAGAESMPVRRRGELEAVDGLVIPGGE
STTMSHLLGDLGLLEPLRGLLADGLPAYGACAGMILLASEILDAGAGGRE
ALPLRAIDMTVRRNAFGRQVDSFEGDIDFAGLDDPVRAVFIRAPWVERVG
DGVEVLASAAGHVVAVRQGRKLATAFHPEVTGDRRIHHMFVDMVTG
379762869YP_005349266.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MLMTGQPQLLSVQRRYWELIASGVSSEDAGVAVGVSATCGGKWFRRFGGV
NPRWLAPQGQKRPRLSADEREQIMIGTAQGESIRSMAARLGRAPSTVMRE
IANNGVMRG
379762868YP_005349265.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MGRYRSRYRFGARRAGVDAKSGYSARIAQLRSEQRARRPKIGKLGRCPAL
RDQVQAWLVKKYSPEQIAGMLATTYSDRPEMQVSHETIYKALYVQGRGEL
RRELTKCLRTGRALRKPRARVGARSGCGRIPGMVNISERPAEAADRAVPG
HWEGDLILGKNQHSQIGTLVERSTGFVQLLHLPARRDPETVADAMIATIK
TLPQALRRSLTWDQGHEMLRHARISIDAGIDIYFCDPHSPWQRGSNENTN
GLLRQYFPKGTDLSVHSADYLAEVAAELNERPRKRFGWDSPAQVLNRLLS
NPPQTTVATKP
379762867YP_005349264.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSGHSKWATTKHQKAVKDARRGKEFARLIKNIEVAARTGGGDPAGNPTLY
DAIQKAKKTSVPNDNIERARKRGAGEEAGGADYQTIMYEGYGPNGVAVLI
ECLTDNRNRAAGEVRVAVTRNGGNMADPGSVSYLFTRKGVVTLEKNGLTE
DDVLTAVLDAGAEDVNDLGESFEIISEPTDLVAVRTALQDAGIDYESAEA
SFQPSVSVPVDVEGARKVFKLVDALEDSDDVQNVWTNVDLSDEVLAALEQ
E
379762866YP_005349263.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSSVDVATAPAAPSAAASGRWRALLLAAVAACAACGIIYELALLTLSASL
DGGGIVATSLIVAGYIAALGVGALLVKPLLAHAAITFIAVEALLGVIGGL
SAAALYMVFAFLDGSVGSTWVLAVSTALIGGLVGAEVPLLMTLLQSGRVT
GAADAGRTLANLNAADYLGALLGGLVWPFLLLPQLGMIRGAAATGMINLA
AAAVVALFLLRHVVSTRQLLLALCALAAALGLLATLLLRSADVETTSRQR
LYADPIVAYRHTPYQEIVVTRRGNDTRLYLDGGLQFSTRDEYRYTESLVY
PAVGKGARSVLVLGGGDGLVARELLRLPGVSKIVQVELDPAVIDIARTTL
RGANGGSLDNPRVAVVTQDAMNWLRGPDLDRFDAIIVDLPDPDTPVLGRL
YSAEFYALAARALAPGGLMAVQAGSPFSTPTAYWRTVSTIRAAGYAVTPY
HVHVPTFGDWGFALAQRADTAPTPTVPPDAPPLRFLNQQVLQAACVFSGD
VAPRPVEPSTLDNPRIVEDMRHGYD
379762865YP_005349262.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MYLAVEIGTVDINPVLKGAVATILYFVVGMGVLLVGFYVVDVLTPGKLRH
LVFIDRRPNAVIVAGAMYIALTVVIITAIANSYSQLGQGLLGVAVYGLMG
VILLGIALLTMHLLIPGSFHEHIDEQVLHPGSFAVALILLAVGGVTAAAV
S
379762864YP_005349261.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSRTRLFVISGLLAAGAVVCLITGIILLQKNIASYVAGHYHEYAHDVNGR
RYQCSGSPRQAADTLAAYAHPEARADNGNTEYLRYANNIVIVGPDGTYPC
SIRVESLSAGYSHGAFIFLGPGFTPGSPSGGSGGSPGGPGGTK
379762863YP_005349260.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTPADVSGQRLGLALNAPVPAPLATCRLDHPCGAGALLLGVLGASHVVAV
EHAAGRFSEEISCTARNLGADLPERTDAPGYRLQSRTDARDEADFRRLAH
DLRGRCARQAGWLGGTFPGDDAALTVLAAEPDGAGWRWRTWHLYPGRPAG
SGGTVVHTASRWQP
379762862YP_005349259.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MGSLLVVLAIVLFIASIVVLVIALRRPKRPAERAGRPDPLASDAMPQFGP
RQLGPGAIVSYGGTDYIVRGSVTFREGPFVWCEHLLEGGDQPIWFSVEED
DGRLELAMWITRKDVPLRPGDPYVVDGAMFHETERGRASYTTEGTTGLPA
GGEMEFVDCTNEDETVLLSFERWAPDMPWEVSTGKAVSPGELTVYAAPPP
SPA
379762861YP_005349258.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MRVMGVDPGLTRCGLSVVESGRGRTVVALDVDVVRTPSDAPLAERLLTIS
DAVEHWLATHEPDVVAVERVFSQLNVSTVMGTAQAGGVVALAAAKRGIDV
HFHTPSEVKAAVTGNGAADKAQVTAMVTRILALQAKPTPADAADALALAI
CHCWRAPMIARMAAAEALAAQQRQKYKAKLKAAR
379762860YP_005349257.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MIAAVRGEVLEVALDHAVIEAAGVGYRVNATPSTLSTLRTGTEARLITAM
IVREDSMTLYGFTDTDTRDLFLTLLSVSGVGPRLAMATLAVHDAGALRQA
LHDGDVAALTRVPGIGKRSAERMVLELRDKVGAAGAGAAPAGAALNGHAV
RGPVVEALVGLGFAVKQAEEATDKVLAAEQDATTSGALRAALSLLGKSR
379762859YP_005349256.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTPAEEDWSDRDVSGALAPGEGDIDVSLRPRSLREFIGQPRVREQLQLVI
EGAKNRGGTPDHILLSGPPGLGKTSLAMIIAAELGSSLRLTSGPALERAG
DLAAMLSNLVEHDVLFIDEIHRIARPAEEMLYLAMEDFRVDVVVGKGPGA
TSIPLEVAPFTLVGATTRSGALTGPLRDRFGFTAHMDFYEPAELERVLAR
SAGILGIELGGDAAEEIARRSRGTPRIANRLLRRVRDFAEVRADGVITRD
VAKSALAVYDVDELGLDRLDRAVLSALTRSFGGGPVGVSTLAVAVGEEAT
TVEEVCEPFLVRAGMVARTPRGRVATAQAWTHLGMAPPAGAAGLGQPGLF
E
379762858YP_005349255.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MKEIEMRNRRHDYERPRALYMPRTRGALTGLLLILLGAWGALVPFFGPNI
DWAYATDPAWTWTAAKGWLEVLPGVAAAVGGLLVLLSGNRANAVFGGWLA
VLGGAWFVVGRAFAPTLGIGDVGQPAAAADLKRALLEVTYFTGLGALIVF
LGGAAVARLAVRHARDVVVTQPAPAAGDAAVPAAQPAMYDETGGMAPART
DAVPADAAPRERGGHGLFHRRPGGLFHRHHAGV
379762857YP_005349254.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MITTALLFAALAALLHVYIFVMESLTWTSPRTRATFGTTPAEAETTKLLA
FNQGFYNLFLAIVTGIGIAVIALGHTTVGAALVFAGIGSMAAAAVVLLVS
APDKARAALAQGTFPAMAIVLLLLGLQQ
379762856YP_005349253.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MKYAEDGRTSALSMPRSRGAVSGLLLVILGAWGALIPFVGPHFNFAYTPD
RNWAWSTARGWLEVAPGAATALGGLLLIVAGNRVAAMLGGWLAVLAGAWF
VVGGDVAPLLGIGSAGDPIAATDRKRAVLEVTYFSGLGALIIFIGGVVLA
RTAVRLARDVQPLAPATTGTPAVEPYRDSVYEQPAEVSSGALTKPRASSD
PEPKRGWRRHRAGAGSGGNAAYLRWPHPQQ
379762855YP_005349252.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSTAIHDEHLDRRIEELIANDPQFAAARPDPAITAATEAPGLRLPQIIRT
VLDGYADRPALAQRVVEFVTDAKTGRTTAELLPRFETITYGELGERVSAL
GRAWAGDAVRPGDRVCVLGFNSVDYATIDIALGTIGAVSVPLQTSAAISS
LQPIVAETEPSLIASSVNQLPDAVELILAGDHVPGKLVVFDYQPQVDDQR
EAVEAAAARLADSGVAVEALADVLRRGKDLPAVEPPASDEDSLALLIYTS
GSTGAPKGAMYPQSNVGKMWRRGSKNWFGESAASITLNFMPMSHVMGRGI
LYGTLGNGGTAYFAARSDLSTLLEDLELVRPTEMNFVPRIWETLYGEFQR
QVERRLADGDAGPEARETVEAAVLEEQRQYLLGGRFIFAMTGSAPTSPEL
KAWAESLLQMHLMDGYGSTEAGMVLFDGEIQRPPVIDYKLVDVPDLGYFS
TDRPHPRGELLLRTENMFPGYYKRAETTANVFDEDGYYRTGDVFAEIAPD
RLVYVDRRNNVLKLAQGEFVTLAKLEAVFGNSPLIRQIYVYGNSSQPYLL
AVVVPTEEALADNDLESLKPKIADSLQKVAKETGLQSYEVPRDFIIETTP
FTLENGLLTGIRKLAWPKLKAHYGDRLEQMYAELAAGQANELAELRRSGA
AAPVAQTVSRAAAALLGAAAGDLSADAHFTDLGGDSLSALTFGNLLREIF
DVDVPVGVIVSPANDLAGIAAYIEAERQGSKRPTFAAVHGRGATMVHASD
LTLDKFLDEATLAAAPSLPKPATEVRTVLLTGATGFLGRYLALDWLERMD
MVDGKVIALVRARTDEEARARLDKTFDSGDPKLLAHYQRLAADHLEVIAG
DKGEANLGLDPQTWQRLAEEVDVIVDPAALVNHVLPYSELFGPNALGTAE
LIRIALTSKQKPYTYVSTIGVGDQIQPGEFVENADIRQISATREINDGYA
NGYGNSKWAGEVLLREAHDLCGLPVTVFRCDMILADTTYAGQLNLPDMFT
RLMLSLVATGIAPGSFYELDTDGNRQRVHYDGLPVEFIAAAISTLGTQIT
DSDTGFQTYHVMNPYDDGIGLDEYIDWLIEAGYSIERIADYSEWLRRFET
SLRALPDRQRQYSLLPLLHNYQKPEKPINGSMAPTDVFRAAVQEAKIGPD
KDIPHVSAPVIVKYITDLELLGLL
379762854YP_005349251.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MVAGLEQTRQLVTEIPGPLSLELSKRRAAAVSHAVNVSVPVFVARAGGGI
IEDVDGNRLIDLGSGIAVTTIGNSAPRVVDAVRAQVAEFTHTCFMVTPYE
SYVAVAETLNRITPGSGEKRSVLFNSGAEAVENAVKVARAYTRKSAVVAF
NHAYHGRTNLTMALTAKSMPYKAGFGPFAPEVYRAPLSYPYRDGLIDKEL
ATDGEKAAARAIRVIDSQIGADNLAALLIEPIQGEGGFIVPAEGFLPTLL
EWCRRNDVVFIADEVQTGFARSGAMFACEHEGIEPDLICTAKAIADGLPL
SAVTGRANIMDAPHVGGLGGTFGGNPLACAAALATIETIESDGLVERAQQ
LERLITEPLLRLQAGDDRIGDVRGRGAMIAIELVKSGTAEPDKELTQKLT
VAAQAAGVIVLTCGMFGNIIRLLPPLTIGDELLAEGIEILSGLLRDL
379762853YP_005349250.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSRHVESLSSLPPASIGRTAAAGDGPRPARLNGHTGP
379762852YP_005349249.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MESLILFLPFLLIMGGFMYFASRRQKRAMQATIDLHESLSPGDRVHTTSG
LQATVVAITDDTVDLEISPGVVTTWMKLAIRDRILPDDDEDLVDGDEPAD
EGSVAKDS
379762851YP_005349248.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MASSSAPVHPARYLSVFLVLLIGVYLLVFLTGDKRAAPKLGIDLQGGTRV
TLTARTPDGSRPSREALAQAQQIIGARVNGLGVSGSEVVVDGDNLIITVP
GNDGNEARNLGQTARLYIRPVLNSMPAQSAEPKPPAHQPAPGQPAPAEPA
PAEPGPSGQPAPGQPAPPPAGQPAPGGKPGAQPRPYPQDPPPAPTPAPPA
PAPGAPAPAPATPAPGAPPAEQPASPDPRKDLAERIADEKKWRQSTRQGI
QFLALQFQATRCDKEDILAGNDDPTQPLITCSTDHKVAYLLGPSIISGDQ
IQDATSSQNQRGIGYVVDLQFKSAAANTWADFTAAHIGTQTAFTLDSQVV
SAPMIQEAIPGGRTQISGGDPPFTAATAKQLANVLKYGSLPLSFESSEAQ
TVSATLGLTSLRAGLIAGAIGLVLVLLYSLLYYRVLGLLTALSLAASGAM
VFAILVILGRQINYTLDLAGIAGLIIGIGTTADSFVVFFERIKDEIREGR
SFRSAVPRGWTRARKTIVSGNAVTFLAAAVLYALAIGQVKGFAFTLGLTT
ILDLVVVFLVTWPLVYLASKSPTLAKPAYNGLGAIQQVARERRGSSQVTT
GRG
379762850YP_005349247.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MMASNDATEITETSAGTTELTASAAGTAGAPHHSFLSRLYTGTGAFEVVG
RRRLWFGISGAIVAVALLSIVLRGFSFGIDFNGGTTVSMPANGTHGTVHT
SQVQDVFRKTLGNDAESVVVVGNGAAATVQIRSETLSNDQTTKLRNALFD
AFGPKGPDGKPSKQAISDSAVSETWGDQITMKALFALVVFLALVGVYITV
RYERYMTLAAIAAMFFDLAVTAGVYSLVGFEVTPATVIGLLTILGFSLYD
TVIVFDKVEENTHGFQHKPKRTFAEEANLAINQTFMRSINTSLIGVLPVL
ALMVVAVWLLGVGTLKDLALVQLIGIIVGTYSSIFFATPLLVSMRERTEL
VRTHTRRVLRRRAGGARAGAENAPDADDVADVPDEDAKADAAESASRPSG
PSKPAPSKPAPGARPVRPTGTRRPTGKRNVGRR
379762849YP_005349246.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MATRYRGTGADGALTGRHNIALWISAGLTVALVAGFVVTACAGSAASEVD
YVVDGPLGTYNTNTVAGAASAGAQAFARTLTGFSYHGPGGQIVADRDFGT
VSVVGGTPLVLDYQIADNAVYSDGKPLTCDDIVLAWAAQSGRFPEFDAAT
QGGYIDIANVECIPGQKKARVSFVPDRGVVDYNQLFTATSLMPSHVIADQ
LNVDVTAALLSHNAPLVQQIAKLWNTIWDLKPGVDLKRFPSSGPYKIGSV
LEGGAVVLVANDRWWGPRAITKRITVWPQGPDIQDRVNNRTVDVVDVAAG
SSGTLATPDNYERSDAPSDGIEQLFFAPQGPLAAPKARRAVALCTPRDAL
AHDAGTPIANSRLSPAGDDAVTAADGAAEAGPFGKADPVAARNALGGAPL
AVRIGYQGPNARLAVNVGVITKSCAAAGITVTGVTLDSSGPRALRDGKID
ALLASTGGATGSGSTGSSALDAYALHTGNGNNLSGYSNPQVDSAIGALAV
SADAAERVRLLAETAPILWGDMPTLPLYRQQRTLLMSKKMYAVSNNPTRW
GVGWNMDRWALVQ
379762848YP_005349245.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAELIASLTRKVADFPKPGIQFKDLTPVFADATAMTAITGAVAELASGAD
LVAGIEARGFLVAAAVADRLGTGVLAIRKAGKLPPPVHAERYDLEYGTAT
LEIPGEGIDLRGRNVVIVDDVLATGGTLAASARLLERAGANVVAAAVLFE
LGGLGGRDAVAPLPVHSLMCE
379762847YP_005349244.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MADDNSASQALDAPTKVTEPPAITQPMEAPEPPTESLKTSSSASRRVRAR
LARRMTAQRSTLNPVLEPLVAVHREIYPKANVSMLQRAFEVADQRHATQL
RHSGDPYITHPLAVATILAELGMDTTTLVAALLHDTVEDTGYTLDALSEE
FGEEVGHLVDGVTKLDRVVLGSAAEGETIRKMITAMARDPRVLVIKVADR
LHNMRTMRFLPPEKQARKARETLEVIAPLAHRLGMASVKWELEDLSFAIL
HPKKYEEIVRLVAGRAPSRDTYLAKVRAEIVSTLGASKIKATVEGRPKHY
WSIYQKMIVKGRDFDDIHDLVGIRILCDEIRDCYAAVGVVHSLWQPMAGR
FKDYIAQPRYGVYQSLHTTVVGPEGKPLEVQIRTRDMHRTAEYGIAAHWR
YKEAKGRNGVPHPHAAAEIDDMAWMRQLLDWQREAADPGEFLESLRYDLA
VQEIFVFTPKGDVITLPTGSTPVDFAYAVHTEVGHRCIGARVNGRLVALE
RKLENGEVVEVFTSKAANAGPSRDWQQFVVSPRAKAKIRQWFAKERREEA
LEAGKDAMAREVRRGGLPLQRLVNGETLSAVARELHYLDVSALYTAIGEG
HVSARHVVQRLLAELGGIDQAEEDLAERSTPTTMLRRPRSSDDVGVSVPG
APGVLTKLAKCCTPVPGDQIMGFVTRGGGVSVHRTDCTNAASLQQQSERI
IEVHWAPSPSSVFLVAIQVEALDRHRLLSDVTRVLADEKVNILSASVTTS
GDRVAISRFTFEMGDPKHLGHLLNVVRNVEGVYDVYRVTSAA
379762846YP_005349243.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MPTNEQRRANAKRKLERQLERRAKQAKTRRIVLIAAGSIVAVAVVVAVVL
TIVNTKHEHKSNTAATTTSSSSPESTTPAGPAPSAPPLPAFKPSAEVGAN
CQYPATPEPAAKQVKPPRTGKVPTDPAQVSVSMVTNQGHIGLMLANNESP
CTVNSFASLVGQKYFDNTKCHRLTTSPGLGVLQCGDPKGEGTGGPGYQFA
NEYPTDQYPPNDPKAQEPVLYPRGTLAMANAGPGTNGSQFFMVYKDSQLP
PQYTVFGTIQPDGLATLDKIAKAGVAGGGEDGAPATEVTITSVLLD
379762845YP_005349242.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MGSVLITGFPAGMLQCNCYVLAERPGTDAVIVDPGQRAMAPLRRILDENR
LTPAAVLLTHGHIDHMWSAQKVSDTYGCPTYIHPEDRFMLKDPIYGLGPR
LAQLVAGAFWREPKQVVELDRDGDKLDLGSVTVNVDHTPGHTRGSVVFRV
TGDKDLVFTGDTLFERSVGRTDLFGGSGRDLLTSIVDKLLVLDDATVVLP
GHGNATTIGAERRLNPFLEGL
379762844YP_005349241.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAEFSAPKGVPDYVPPDSAQFVAVRDGLLGAARRAGYGDIELPIFEDTAL
FARGVGESTDVVSKEMYTFADRGDRSVTLRPEGTAGVVRAVIEHGLDRGA
LPVKLCYAGPFFRYERPQAGRYRQLQQVGVEAIGVDDPALDAEVIAVADA
GFRSLGLDGFRLEITSLGDDSCRPAYRELLQEFLFGLSLDDETRRRAEIN
PLRVLDDKRPEVRAMTADAPVLLDHLSDAAKQHFDTVLAHLDALGVPYVI
NPRMVRGLDYYTKTTFEFVHDGLGAQSGIGGGGRYDGLMRELGGQDLSGI
GFGLGVDRTLLALRAEGKSVGTAARCEVFGVPLSEQAKLRLAVLAGQLRS
AGVRVDLAYGDRGLKGAMRAADRSGARVALVLGDRDIEAGTVGVKDLGTG
EQSAVASETVVADVLARLGR
379762843YP_005349240.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MFDEVRRRAVIAELDELVERCHPSSTRESAALLEHLGVVARVENRAAAAQ
LVAIGELFAYRLSRCAESEEWAVDTEAAVAAEVGAQLRIGQGLAASRVRY
ARAMRERLPLVGAVFGAGDIDYRMFQTIVFRTDLITDLEVLRSVDAVLAA
NVGRWPSLSQGRLAAQVDKVVAKADVDAVRRRQERAAGRQVWMADMGDGL
AHLEATLYAPDAHALDRRLDGLAATVCAHDPRTREQRRADALGALAADAD
RLGCRCGRADCAAGGRAAGPVTVHVIGEHAVLEGRASTPGAEVGAEGLIP
PEVLAELAASATLVPLTHPGDAAPEPGYVPSRALADFVRCRDLTCRWPGC
DRPATACDVDHTIPYAAGGPTHASNLKALCRTHHLVKTFWGWQEKQLPDG
TLIFTSPAGHTYVTTPGSALLFPSLCAATGAIAAPEADPPPNHCAQRTAM
MPQRRRTRTQDRATRIAAERKHNRTARLAERPSYAWYSESTHAVGDGEPP
PF
379762842YP_005349239.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MLHSMVLASSDPVAAGFILRGIKGIFVAIGSIIAAIVCGVIAMMKGRNPL
GWGILGLFFSILTLIVVIVIPSKK
379762841YP_005349238.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTERIETSRTIAAPASDIFAVLCDPQGHVAIDSSGMLQDADGDPVRGVGD
RFVVHMDRESLNDFPQLGKYDVTVEIKQFEQDRLIAWTVLGQIQPPIGHV
YGYALAPAEDASATVVTSFYDWSDIDPKWREAEIFPILSEGALRATLGIL
DRTVRRGYPRGILL
379762840YP_005349237.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MRLIHVAAAVGIPVVVLMGASPAGAETGAVGYAQCVGGDTKPPPPGVSAD
VWFPSVHVIDHDIISGVPAAEVVERLVNMGVNRDDAVRRVQCYLVNSPH
379762839YP_005349236.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MRWASQAVAVNGKPVEDGALPGLQRIGFVRSVRSPQFDGITFHEVLCKSA
LNKVPNASALPFRYTVNGYRGCSHACRYCFARPTHEYLELDCGNDFDTQV
VVKTNVAEVLRRELRRPSWQRETVALGTNTDPYQRAEGRYALMPGIIGAL
AESGTPLSILTKGTLLRRDLPLIADAAAQVPVSVAVSLAVGDAELHRDVE
PGTPTPQARLGLIGAITAAGLNCHVMVAPVLPYLTDSAEHLDALLGQIAA
AGAGSVTVFGLHLRSSTRGWFMSWLARSHPELVGRYRELYRRGAYLPQGY
RDMLRERAAPLIAKYRLAGDHRPFSQAVSAETPQPVQETLF
379762838YP_005349235.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSDDSEHAGISRRRLLTSSAASAVLGGVGVGGAALLWSQPAGPRGPAAWL
QSDRNGAPPIGGLHLQFGRDAATEVVVSWHTTDAVRNPRVLLGTPTSGFG
RTVAAETRTYRDAKSGTEVRVNHARLTDLTPDTDYVYAAVHDGAEPEQGT
VRTAPSGRKPLRFTSFGDQSTPALAKMPDGRYATDNIGSPAAADTTIAIE
RLGPLFNLVNGDLCYANLAQNRIRTWSNWFDNNTRSARHRPWMPAAGNHE
NELGNGPIGYGAYQTYFAVPDSGSSPQTRGLWYSFTAGSVRVISLANDDV
AYQDGGNSYVHGYSGGEQRRWLASELAASRSDPNIDWVVVCMHQTAISTA
DKTNGADLGIREEWLPLFDQYQVDLVLCGHEHHYERSHPVRGALGTDTRT
PIPVDTRSDLIDSTRGTVHLVIGGGGTSAPSNAMFFPEPRCRVVTGVGAF
DPGLRRKAPIYVLEDAPWSAFRDRDNPYGFAAFDVDPGRPGGNTSIKATH
YALRGPLGDMVVIDEFTLTKPRRDKS
379762837YP_005349234.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTNVRIATTGIAAATFAAAAAMIATPATSHADPAGHQVTYTITATGNLTG
NVRYMNSDPPSQAAFNSNSSQFLNTVQTAFTAGQPLVYNATLADPNQWAF
VNASGGCHWPDCDSSNMPQIQCQIAVDGQVVVTQSATTGVTCSTRPW
379762836YP_005349233.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTALLRAVRKQRGLTLEALAQQTGLTKSYLSKIERRRSTPSIAVALKVAK
ALDVDVGRLFSEEAAHEKITVERAASAEGERYRVLASSVLGKSMSPFVVR
PTERPADDPHPEHTGQEFLFVHAGTVELDYGDQTFTLGPGDSAYFDASIG
HQVRAVGAEPAEVVVVATRDASSR
379762835YP_005349232.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MASTFTDSKSDLMRRAAEQLTALQSKDAADAPLTTRQKLALTCRALFDAG
HDSGLAGQITARAERDGTYYTQRLGLGFDEITDANLLLVDEDLNVLEGDG
IANPANRFHSWIYRARPDVQCIVHTHAFHVAALSMLEVPLIVSHMDTTPL
YGDCAFLEKWPGVPVGNEEGEIISAALGDKKAVLLAHHGHVIAGASVEEA
CSLGILIERAAKLQLAAMAAGTVKELPEELAREAHDWTLSPQRSRANFAY
YARRALARHPDALTS
379762834YP_005349231.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAQTSEPKIHGIIAYPVTPFSGDGIDTKRLAALVDRLVSAGVHAIAPLGS
TGELAYLDEPEFDTVVDTTIATVAGRVPVVVGVSDVTTAKTIRRATYAQQ
AGADAVMILPVSYWKLTEREIFQHYRSISDAISIPIMAYNNPATSGVDMP
PELLVRMFESIDNVTMVKESTGDLTRMQRIAELSGNRLPFYNGSNPLVLD
ALKAGASGWCTAAPCLRPQPCIDLYEAVRANDLDTAQKLYDDLKPLLTFI
VAGGLATTVKAGLELLDFPVGDPRAPLLPLDEAGRGELKGLLA
379762833YP_005349230.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTFNEGMQIDTSAASSSGGGGMGMAVGGGGLGLIILLGALFLGVDPGRVM
NQPQTNTGGYSAPGFDLSQCKTGADANKYVQCRVVATGNSVDAVWHQLMP
GYTRPHVRLFSDQVSTGCGPATTDVGPFYCPADQTAYFDTSFFQDVLVKQ
LHSSNGAFAQEYVVAHEYGHHVQQLQGDLGRAQQGAKGAGGNGVRTELQA
DCYAGIWAHYAATVNQKDGTPFLNPLTDEDIRDALSAAASVGDDRIQKQA
TGRVNRESWTHGSAEQRQHWFTVGYQTGDPKQCDTFSAPDLG
379762832YP_005349229.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MFPCERVDVNFIESAPFAFRNSVDLAITPEQLFEVLSDAASWPRWAKVIT
KVTWTSPEPRGVGTTRVVEMRGGIVGNEEFLAWEPFTHMAFRFNECSTKS
VAAFAEDYRVEAIPGGCRLTWTMAQKPAGPAKLAMVVVGPLLNLALRRYL
RNLRSYTDSLATRQP
379762831YP_005349228.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MCGRTPRESIELRPDGADPIVVPGPVHTDPGEVSGPVDVVLLAVKATQND
QAAGWLARLCDVHTIVVVLQNGVEQVEQVQPHCPRSPVIPGIVWYSAETQ
PDGWVRLRGEAALVLPSGPSAETVAELLRGAGCRVDCDPDIITAGWRKLL
TNALAGFMALSRRRSGMFRRDDVAALSRRYLAECLAVARAEGARLPDGIA
DELTDLFRNAPEDMGTSILTDAENHRPMEWDVRNGVIIRKARAHGLATPI
SDVVVPLLAAASDGPG
379762830YP_005349227.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MLRSHAAGSLRSSDAGQQVTLAGWVARRRDHGGVIFIDLRDASGITQVVF
RAEDVLAQAHRLRAEFCVAVSGVVEIRPEGNANPEIATGEIEVNATALTV
LGESAPLPFQLDEPAGEELRLKYRYLDLRRDGPAEAIRLRSKVNAAARAV
LAQHDFVEIETPTITRSTPEGARDFLVPARLHPGSFYALPQSPQLFKQLL
MVAGMERYYQIARCYRDEDFRADRQPEFTQLDMEMSFVDAEDILAISEEI
LSALWALIGYQIPTPIPRISYAEAMRRFGSDKPDMRFGLELVDCTEFFKD
TTFRVFQAPYVGAVVMPGGASQPRRTLDGWQEWAKQRGHRGLAYVLIADD
GTLGGPVAKNLSDAERGGLAAHVGAEPGDCVFFSAGPPKPSRALLGAARG
EIAHRLGMIDPDAWAFVWVVDPPLFEPADDATAAGDVAVGSGAWTAVHHA
FTSPKPGHEDAIDTDPGNVLADAYDIVCNGNEIGGGSIRIHRRDIQERVF
AVMGLDHAEAEEKFGFLLEAFTFGAPPHGGIAFGWDRINALLSGVDSIRE
VIAFPKTGGGVDPLTDAPAPITAQQRKESGIDAKPEKVDRA
379762829YP_005349226.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTEHLPDTDTINAFNRAIVDEFRANGGKVGGQFEGANLLLLHTTGAKSGQ
PRVSPLAYFDIDGKLIVIGSFAGAPVSPAWVHNLRANPSARVEVGTDAFD
VTARELPTDERDDLFDKVTAAAPGFAEYQAKTSRVIPLFELIRT
379762828YP_005349225.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MGASRPAVPSRVLAAARAGGKRLRAVWFNLVQTSAAAGVSWYLTHDVLGH
PQPFFAPIAAAV
379762827YP_005349224.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSTSNVLRAQRAIQMMIGVTLGIGLGSAVQGLLGPGAVPIAIAAFIALGA
AVFIGGGFIGHGMMFANQTIVSAILVLALYHGGVGLERIFDALIGGAVAI
VFAVLLFPADPLALLRGARVGVLAVLHDVLARAADVAAGRKAAAPDWPLT
AVDRVHEQLSGLLEARTTARHVVAIAPRRWGLRDAVHAADHQAVHVALLA
GSVLQLARAVAPAPDVGPEPPAPHVHTVLVVLAAATALADRDAAGACAYT
ASARHHASQLPSGAGAKTQAILADAVGACIDDLQRVIDLRPV
379762826YP_005349223.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MATWDEVARIVGELALTSEPSPHDWRVGKKLLAWERPLRPSEREALARNG
PEPPRGDILGVRVSDEGVKFALIDDEPQTYFTTPHFDGYPAVLVNLAEIS
VRDLQELITEAWLTQAPRKLVQEFLADSR
379762825YP_005349222.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSEADAGSARRHRVTHRTEYRYSDVVTSSYGRGFLTPRDSLRQRRVAHRL
IIEPAPADSSTSTDTYGNISSYFHVTEPHSVLKVVSDSVVDVYPPAPGLY
AAGAAVQPWEDARPAGRIGALAAEFTLDLDPPEITDEVREYAAPSFTPGR
PLIEVLRDLASRIFTDFTYRSGSTTISTGVAEVLAAREGVCQDFARLAIA
CLRANGLAASYVSGYLATDPPPGKDRMIGIDATHAWAAVWTPQDPGQFEW
LGLDPTNDQMIDERYIVVGRGRDYADVPPLRGIIYTDSEHSVIDVAVDVV
PYSDPIEGDFSHA
379762824YP_005349221.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MRDFTCPNCGQRLTFENSTCLNCGSALGFSLEQMALLVISDGEATEHVGV
VPASEYQLCANLQVAECNWLVPVNTPRLLCASCALTAERPNDADAVGLAE
FARAEAAKRRLIAELHELKLPIVGRDKDPDYGLAFRLLSSAHENVMTGHQ
NGVITIDLAEGDDVHREQLRVEMDEPYRTLLGHFRHEIGHYYYYRLIAPY
RDRLERFNELFGDPDADYQAALDRHYSEGAPDGWQDHFVSSYATMHASED
WAETFAHYLHIRDALDTSAWCGLAAASATFDRPALGPSAFQTIIDMWLPL
SWSLNMVNRSMGHDDLYPFVLPAAVLEKMKFIHTVVDEATSESRGPASVA
G
379762823YP_005349220.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MCFSMTADLVVGAALVPVAVATLREVKHWREVPFALLPTVFSVHQFIEAA
VWPNDVVSPGMKHLAMLAYVFIALPLLPALVPWAILALEPSGARLRVAPF
AVLGTVVSVYLAVVVLTDPVTVTMGPHALQYQTGVRGGYVWAALYVIAVI
GPAVMSGYRSIVVFGIANLVGLSVVAVLYVHAFASLWCIYAATLSVLALV
HMVRRRRLPDPHRYHGVAAEREASPTG
379762822YP_005349219.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAFADMTFGTGAAPAGGRYDADRLLAAYRAARAQQALFDLRRGPASGYDE
FVDPDGNVRPAWAEVADAIAERGRAGLDRLRSVVRGLIDNDGITYTDVAP
GGRGQEPRPWQLDTLPLVLSAADWEVLEAGLLQRSRVLDAVLADLYGPRS
LLTDGVLPPELLFAHPGYVRAANGIEIPGRHQLFMHACDVSRRPDGAFVV
NGDRTQAPSGAGYALADRRVVAHAVPDLYERIAPRPTTPFAQALRLALID
AAPDDAQDPVVVVLSPGIYSETAFDQAYLATLLGFPLVESADLVVREGML
WMRSLGTLKRVDVVLRRVDADYTDPLDLRADSRLGVAGLVEAQHRGTVTV
VNTLGSGVLENPGLQRFLPAMAEHLLSETLLLPSPPAYWGGIASERSHLL
ANLGSLLVRSTVGAKTLVGPALSSPQLARLAAQVEAAPWQWVGQELPQFS
SAPTDHAGALSSAGVGIRLFTVAQRGGYAPMIGGIGYVLAPGDAAYALKT
VAAKDVWIRPTERARAEAVSPPSVEPPAKTAAGTWAVSSPRVLSDLFWIG
RYGERAESMARLLIVARDRFHVYRHHQHSEESECVPVLMAALGRITGTDT
AADGGGDHAEMIAVAPSTLWSLTVDPHRPGSLVQSVEGLALAARAVRDQM
SNDTWMVLAAVERALALDSEPPDSLAEADAALTRAQAQTLAGMLTLSGVA
AESMVRDVGWTMMDIGKRIERGLWLTALLRATLTVMRGAAAEQTVIESTL
VACESSVIYRRRTAGKVSVSAMVELMLFDAQNPRSLLYQLDRLRTDLGDL
PGSSGSSRPERLVDEIGTLLRRSHPAALERVGDDGRRAELADLLGAVHAE
LRNLADVITTTQLALPGGMQPLWGPDVRRVMPA
379762821YP_005349218.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSQPPEYPGPPDPQGGGQDPPGYPPPPGYGTPPPPPPGYGPPPGYGAPPP
GYGPPPGYGPPPGYGAPPPGYGGPPAPAFSIGDAFGWAWNAFSKNPVALI
VPALVYGILIGVASALVGLSQSVGTTTTGSDDDYFTFTANLNGGGMTLLI
LGYLVAYLVGAFAQAAFLSGCLDLADGRPVTVGSFFKPRNFGMVFLAALL
VGILTSIASALCFLPGLILGIFAQFTIPFAIDRSEQPIKALTSSFSTVTA
NFGNALLVWLVEVALFVVGALACGVGLLVAAPVASLIGIYAYRKFSGGQV
VAPQQAGYQPGPPPGPAPA
379762820YP_005349217.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSDGLFDLPGAPLPDDHGLGASSGSPLAVRMRPASLDEVVGQDHLLAPGS
PLRRLVEGSGVASAILYGPPGSGKTTLAALISQATGRRFEALSALSAGVK
DVRAVIEKARTALLHGEQTVLFIDEVHRFSKTQQDALLSAVENRVVLLVA
ATTENPSFSVVAPLLSRSLILQLRALSADDIRTVVQRAIDDPRGLGGQVA
VAPDAVDLLVRLAAGDARRALTALEVAAEAVPPDGELTVTAIEQSLDEAA
VRYDRDGDQHYDVISAFIKSVRGSDVDAALHYLARMLVAGEDPRFVARRL
MILASEDIGMADPTALQVAVAAAQTVALIGMPEAQLTLAHCTIHLATAPK
SNAVTTALGAAMADIRAGKAGRVPPHLRDGHYSGAEALGHAQGYKYSHDQ
PDGVAAQQYPPDELVGVDYYRPTARGFERDMAGRLERLRAIIRRKRGDKG
379762819YP_005349216.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MKTFSDEEMGQLLPTAKQYSVVILKRGPRFGDESSAQIIWEHGRRNFGLR
DDGVLAVVLPVTDESDVCGIGVFAATVDETAAIMADDPGVAAGVFVYQVH
ACRGFPGDALP
379762818YP_005349215.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MYARSTTIQAQPLSVDIGIAHVRDVVMPALKEIDGWLGLSLLVDRQSGTC
IATSSWETVEAMRGSAERVAPIRDRAALMFDGSARVEEWDIALLHRDHPS
RQGACVRATWLKVVPDQLSRSLDFYRMAVLPEMENLDGFCSASLLVDHPS
CRRAVTCSTFDSMDAMARNRDRATELRSRRVRELGAEVIDVGEFELAIAH
LRVPELV
379762817YP_005349214.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MYARSTTIQAQPSSIDAGIAHVRDEVMPALQGMPGCIGVSLLVDRRSGRC
IATSAWESDEAMRASGEAVTGIRDRAAEMFGGTTDVEQWEIAVLHRDHHA
PDGAGVRATWVMVPPETMDQGIEYYKSSVLPQLEGLDGFCSASLLIDRAS
GRGVSSATFDSIDEMERNREQATALKSSSMQEARAEELDECEFELALAHL
RVPELV
379762816YP_005349213.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MHTDVLDVDTSRRRIVDLTEAVRGFCWSRGDGLCNVFIPHATAGVAIIET
GAGSDDDLVDTLERLLPRDDRYRHAHGSEGHGADHVMPALVAPSVTVPVS
GGEPMLGTWQSIVLVDLNRDNPQRSVRLSFLEG
379762815YP_005349212.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MQTHEIRKRFLDHFVKAGHTEVPSASVILDDPNLLFVNAGMVQFVPYFLG
ARTPEYPTATSIQKCIRTPDIDEVGITTRHNTFFQMAGNFSFGDYFKRRA
IELAWTLLTNSVEQGGYGLDPERIWATVYFDDDEAVQLWKEIAGLPDERI
QRRGMADNYWSMGIPGPCGPSSEIYYDRGPEFGVEGGPIANEDRYIEIWN
LVFMQNERGEGTGKEDFEILGPLPRKNIDTGMGVERVAFILQGVHNVYET
DLLRPVIDAVAARAPRGYDAGNHDDDVRYRVIADHSRTAAILIGDGVTPG
NDGRGYVLRRLLRRVIRSAKLLDIEGPIVGDLMATVRDAMGPSYPELVAD
FDRIRRIAVAEETAFNRTLAAGSKLFDEVAGTTKASGAKAISGSDAFTLH
DTYGFPIELTLEMASEAGLQVDEVGFRELMAEQRRRAKADAAARKHAHAD
LSAYRELVDAGPTEFTGFDELTSEAKLLGIFVDGKRVPVVTHGTEGVDRV
ELVLDRTPLYAEAGGQIADEGTISGTGASGSARAAVTDVQKIAKTLWVHR
VNVESGEFVEGDTVIAAVDPQWRRGATQGHSGTHMVHAALRQVLGPNAVQ
AGSLNRPGYLRFDFNWQGALSDEQRTQIEEVTNQAVQADFEVHTFTEQLE
KAKAMGAIAMFGERYPDEVRVVEIGGPFSLELCGGTHVHNSAQIGPVTIL
GESSVGSGVRRVEAYVGLESFRHLAKERALMAGLASSLKVPSDEVPARVA
NLVERLKAAEKELERARLAGAKAAATDAAAGAERIGNVRVVAQRMTGGMT
AGDLRSLVGDIRGKLGGDPAVVALIADGEGGSVPYAVAANPAAQDLGLRA
NDLVKKLAAAVDGRGGGKADLAQGSGKDPTGIDAALAAIRSEITAIARVG
379762814YP_005349211.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MVSAQHRAPDRPGDPDQDPGRGRRLGVDVGSVRIGVACSDPDAILATPVE
TVRRDRSGKHLRRLAALAAELEAVEVVVGLPRTLADRTGPSAIDAIELAD
ALADRVAPTPVRLADERLTTVSAQRSLRAAGVRAKEQRAVIDQAAAVAIL
QSWLDQRRATLTGPGERADG
379762813YP_005349210.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MVDSARRERAEPEAVGPPRRRSSRTARNRAERGRRRRRTALRTALALVAV
IVVAGVFAGGKLWHAVFGPGDDYTGNGKRDIVIQIKDGDSTTMVGETLQN
EHVIKTVRAFVNAAHGNSKISSIQPGFYRMRTEIPAANAVTRLADPDSRV
GRLVIPEGRQLDDTTDMKTNVVNPGIFTLISRATCVDFDGSKRCVSVEDL
RAAATNSSPLALAVPPWATEPVGELGKDHRRIEGLIAPGTFNVDPSAPPE
TILSNLIGAGAVEYMKSGLVDTAQAMGLSPYDILVVASLVQQEARSQDFA
KVARVIYNRLHAHHTLEFDSTVNYPLDRREVATTDGDRAQKTPWNTYVSQ
GLPATAICSPGVDALNAAEHPEPGDWLYFVTIDGQGTTLFTKDYQQHLAN
IELAKHNGVLDSAR
379762812YP_005349209.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSSIPPADGDRKRGEAGRSGSPLGQASGAPRKAAVLGKPIAHSKSPQLHL
AAYRALGLTGWTYDRIECDADQLPGVVGGLGPEWVGVSVTMPGKFAALAF
ADERTERAERVGSANTLVRTPAGWRADNTDIDGVAGALGSTASGWALVCG
SGGTAPAAVAGLAQLGVGGITVVARNPGKAARLVELGHAMGVATRFCDLD
GGGLADEVASADVLVSTIPADVAARYAGTFAGIGVLLDAVYDPWPTPLAA
AVSAAGGRVISGVQMLLHQAFAQVEQFTGLPAPREAMACALEASD
379762811YP_005349208.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MRIAAGCLVLAWLAALSCYDIHQRRLPNALTLTGAAAILAVAGVAGRGWS
ALAGAAALTAIYLLVHWVAPGGMGAGDVKLAIGVGALTGCCGAGVWFLAA
FGAPLLTVLVGMVARIRGGARGGRTVPHGPSMCLASAAGIGLSLL
379762810YP_005349207.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MGQFLWYIPNTVEPGHRGDDTVDGWGSLDYSVELAQRAEQHGWDGALIGT
GWGRPDTFTVATAIAARTNRFAPLVAVRPGYWHPAHFASAAATLDRLNDG
RLLVNIVSGADDPAAYGDAEVDKSRRYDRTREFIRLLRRLWREDDVTHRG
EFYTVEHSSLQPRPLGAAEGRHPTLYFGGASAAAEQVAATDADVQLFWGE
PLDGIAERIDRLKSLSAKLGREHAPLEFGLRVTTLVRDTSEQAWRDAEAK
VATLAGTPTMQLLHDPKGSAGQRRLSDLAARGEVLDSCLYTTPSKYGGEG
AGTTWLVGSAAEVAAALRKYADLGVSHFVLSDTPYKSETVRLGDELLPLL
RPAVVGN
379762809YP_005349206.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MRLPGGDPTQHASHLPMAASESRFAQPAAAGNRCGDFHPP
379762808YP_005349205.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MGRVLRWITAGESHGRALVAVLEGMVAGVEVTSLDISEQLARRRLGYGRG
ARMAFERDAVSVLSGVRHGVTLGGPIAVEIGNTEWPKWETVMAPDPVDPG
ELADSARNAPLTRPRPGHADYAGMLKYGFDDARPVLERASARETAARVAA
ATVARSFLRQALGVEVLSHVIAIGPSAPYEGPPPGPGDLAAIDASPVRAY
DEAAEKAMIAEIEAAKKDGDTLGGVVEVVALGLPVGLGSFTSGDNRLDSQ
LAAAVMGIQAIKGVEIGDGFETARRRGSRAHDEMYPGPDGVVRSTNRAGG
LEGGMTNGQPLRVRAAMKPISTVPRALATVDMATGDEAVAIHQRSDVCAV
PAAGVVVEAMVALVLARAALQKFGGDSLAETRRNVEAYRRAVAERESPAA
RGTA
379762807YP_005349204.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAPKAVLIGLPGSGKSTIGRRLAKALDVGFLDTDAAIEQRTGRRIDEIFA
TDGEREFRRIEEDVVRAALADHDGVLSLGGGAVTSPGVREALAGHTVVYL
EISATEGVRRTGGNTVRPLLAGPDRADKYRALMAERSPLYRRAATIRVDT
NRRNPGAVVRYIVSRLQAPAGAAT
379762806YP_005349203.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MRAHDDPVTIEVAVDPPYPVIIGTGLLTELEELLGDRHKVAIVHQPVLAE
TAELIRSRLADKGVDAHRIEIPDAEDGKDLPVVGFLWEVLGRIGIGRKDA
LVSLGGGAATDVAGFAAATWLRGVDIVHVPTTLLGMVDAAVGGKTGINTD
AGKNLVGSFHQPRAVLVDLATLQTLPHNELVAGMAEIVKAGFIADPVILD
LIEADPKAAVDPSGEVLAELIRRAIAVKAEVVAADEKESELREILNYGHT
LGHAIERRERYEWRHGAAVSVGLVFAAELARLAGRLDDATTQRHRTILSA
LGLPVSYDADALPQLLEYMAGDKKSRAGVLRFVVLDGLAKPGRLAGPDPS
LLAAAYAGLAEAQS
379762805YP_005349202.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTTTVNVINGPNLGRLGRREPDVYGDTTHEQLAALIEREAAGLGLKAVVR
QSDNEAQLLDWIHAAADASEPVILNAGGLTHTSVALRDACAELSAPLIEV
HISNVHAREEFRRHSYLSPVATGVIVGLGVQGYLLALRYLAAAG
379762804YP_005349201.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MLRGLVYAAAMVVVRLFQGALINAWQTQAGLFSVVLLLLFVIGVAVWGVL
DGRADAIANPDPDRRGDLAMTWLLAGLVAGLLSGAVSWLIALVYTGLYTG
GLINEVTTFAAFTALCVFLPGIIGVTIGRWRVDRNPPPRRPGTDEERADT
DVFSAVRADDAPTGEIPAAGAQTEERTSAVATAEREGPTETMPTEESPTE
TIAKTEDDPKTEVIPSAREEPKKD
379762803YP_005349200.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MDALLVTDLVNVRYLSGFTGSNGALLVFADDRSPLLATDGRYRTQAAEQA
PDLEVAIERVLGRYLVGQAAAAGARKLGFESNVVTVDGFDALTGELNDRK
APTELVKAAGTVEALREVKDAGEVALLRLACEAADAALTDLVARGGLRPG
RTEREVSRELEALMLDHGADAISFETIVAAGPNSAIPHHRPTDAALAAGD
FVKIDFGALVGGYHSDMTRTFVLGKAADWQLEIYQLVADSQRAGREALRA
GADLRGVDAAARQVIADAGYGEQFSHSLGHGVGLEIHEAPGIGATSTGTL
LGESVVTVEPGVYLPGRGGVRIEDTLVVPEEGRAQAPELLTKFPKELAVL
S
379762802YP_005349199.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MDIVYFAVRLPFASGVTLRVPLLTMIKPLASHEEPSRVDGQHAHR
379762801YP_005349198.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MASTADFKNGLVLVIDGQLWQIVEFQHVKPGKGPAFVRTKLKNVLSGKVV
DKTYNAGVKVETATVDRRDTTYLYRDGSDFVFMDSQDYEQHPLPESLVGD
AARFLLEGLPVQVAFHNGAPLYIELPVSVEMEVTHTEPGLQGDRSSAGTK
PATVETGAEIQVPLFINTGDKLKVDTRDGSYLGRVNA
379762800YP_005349197.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MFEAEARGLSPAEVVDVRTGLAEANPEIAPLQPYTAAVARGVGEHAAHVD
DLISSHLQGWTLDRLPAVDRAILRVAVWELLYADDVPEPVAVDEAVQLAK
ELSTDDSPGFVNGVLGHVMLVTPQIRAAAQAVRGAAGSDAPGTAEDHGPQ
P
379762799YP_005349196.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTRLELRLVVAAVLAAAVVVGAVVCAAYGWTIVASVLSIFALGVGAWLYH
CVERVAVARRISTVRSAARPLQALLPVMAAIMGLTQGVVRALSDVTDLPA
RSRELPVLRWADARANRRMIEGDEPDR
379762798YP_005349195.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MIRYSTQPRRLRVSALAAVANPSYARVDTWNLLDDACRHLAEVDLAGLDK
THDVARVKRLMDRIAAYERYWLYPGAENLAVFRAHLESLSTVRLTEEVSL
AVRLLSEYGDRAGLFDTSAPLDDQELVAQAKQQHFYTVLLADDAPSTAPD
SLAECLRALRCPSDDVQFEILVVPSVEDAITAVALNGEIQAAIIRDDLPL
RSRDRLPLMNTLLGPNEDADGVIPDRANDWVECGEWIRELRPHIDLYLLT
DESIAAGDDSEPDVYDRTFYRLNDVTDLHSTVLAGLRNRYATPFFDALRA
YAAAPVGQFHALPVARGASIFNSRSLQDMGEFYGRNIFMAETSTTSGGLD
SLLDPHGNIKKAMDKAAKTWNADHTYFVTNGTSTANKIVVQSLTRPGDIV
LIDRNCHKSHHYGLVLAGAYPLYLDAYPLPQFAIYGAVSLRTIKQTLLDL
EAAGQLDRVRMLLLTNCTFDGVVYNPLQVMQEVLAIKPDICFLWDEAWYA
FATAVPWARQRTAMVAAEHLEHMLASPEYVEEYRKWAASMDGVDRSEWIE
RELMPDPASARVRVYATHSTHKSLSALRQASMIHVRDQDFNALTRDAFGE
AFLTHTSTSPNQQLLASLDLARRQVDIEGFQLVRQVYDMALVFRHRVRKD
RLISKWFRILDESDLVPEEFRESSVSSYREVRQGALAEWNEAWRSDQFVL
DATRVTLFVGATGMNGYDFREKILMERFGIQINKTSINSVLLIFTIGVTW
SSVHYLLDVLRRVAIDFDRTEKAASVADRALQQRHVEEITEDLPHLPDFS
EFDVAFRPVDECNFGDMRSAFYAGYEEADREHVLIGMAGRRLAEGKTLVS
TTFVVPYPPGFPVLVPGQVVSKEIVYFLAQLDVKEIHGYNPDLGLSVFTE
TALARMEAQRNAAAAAVGSVTAAFELPADASVASGMNGARNGAPAVPSVA
DNT
379762797YP_005349194.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAQPVPVGDVQGSRASRARRVADVLRQQIHADAYPDGLPAELDLAAEFSV
SRNTVREALTVLKHEGLIDRGPRVGTHVAQRKYDHGLDALLGLKETFKDL
GEVRNEVRAAMPVTAPPSVARRLRLKPGERAVFVERLRYLGDLPLSLDLT
YLAPDIGRQVLNHPLETDDLFALIEEVSGQRLGSAALALEAIPADAHSAA
TLQVPDGAALLMLERLTSLADGTPVDLEYIRMRGDRITMRGNLVRAETRS
NP
379762796YP_005349193.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTLINNTRADVPVTIDESLCIDGCTLCVEVCPLDALAINPDTGKAFMHVD
ECWYCGPCAARCPTGAVTVNMPYLLR
379762795YP_005349192.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MRRHAVWPASVMIAIAAFTSGCSLESLSQSSGVVNVVVGYQSKTINTVTA
GTLLRAQGYLEHRLADITTRTGTKYAVRWQDYDTGAPITAQMLAEKIDIG
SMGDYPMLINGSKTQANPLARTEIVSITGYNPKGALNMVVVTPDSRAKGL
ADLAGTKVSASVGSAGHGTLVRALGRAGVTGVEVLNQQPQVGASALESGQ
VQALSQFVAWPGLLVYQGKAKLLYDGAELNLPTLHGVVVRRSYASAHPEV
LGAFLQAQLDATDFLNDKPLQAARIVAKESGLPQEVVYLYNGPGGTSFDT
TLKPSLVEALKSDVPYLKSIGDFADLDVAKFVVDEPLRAVFTARGLDYAA
SRARTANPSALRGDPALASELWLDGADATQTVATPTALLQAVRDAVSHGA
KVRAAYVPDAELGTRWFADKAFWVKDGQNYLPFGTPAGANRYLAGHPRGV
AMDYQEALGGSV
379762794YP_005349191.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MVADQVLGVVSTPAVARPRRIAARWQSRLLRLASVAAAIGVWQLLTADKV
RLLLRFDTLPTVTEIVNALHRRLGTGEYWLDLAQSLIRILTGFGLAAVVG
VATGVLLGRSRLFADVFGPLVELARPIPAIAMVPVAILLFPTDEAGIVFI
TFLAAYFPIMVSTRHAVRALPTLWEDSVRTLGGGRWQVLTQVVLPGILPG
VFGGLSVGMGVAWICVISAEMISGRLGVGYRTWQDYTVLAYPRVFVGIIT
IGVLGFVTSAAVELVGRRVTRWLPRAQEGAR
379762793YP_005349190.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTATKTGMGLELDRVRLSYNGPAVIDDLSLVVRPGEILVLTGPSGCGKST
VLRALAGLLLPDGGRVLADGDPVETTSGDRGMVFQDNALLPWRTVRSNIE
LALRLRGAPRAGRRAAAERWIDELGLTGFGNYLPKSLSGGMRQRVQLARG
LAGAPRAVMMDEPFGALDTQTRAAMQRLLIDTWRTHPTTIVFVTHDVDEA
LALGDRIVVLGRAGEPVRASIEVPEPRSDRPQQELRAQIIAALNHAEVP
379762792YP_005349189.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MMQIPDPAAPVRLDCDVLVIGGGTAGTMAALSAAENGAQVLLLEKAHVRH
SGALAMGMDGVNNAVIPGKAEPEDYVAEITRANDGIVNQRTIYQTATRGF
AMVQRLERYGVKFEKNEHGEYAVRRVHRSGSYVLPMPEGKDVKKALYRVL
RQRSMREKIRIENRLMPVRVLVDGGRAVGAAALNTRSGEFVTVGAKAVIL
ATGACGRLGLPASGYLYGTYENPTNAGDGYSMAYHAGAELSGIECFQVNP
LIKDYNGPACAYVANPFGGYQVNAHGERFVDSDYWSGQMMAEVKSEIDSA
RGPIYLKVTHLSDETLTALENILHTTERPTRGTFHANRGHDYRTHDIEMH
ISEIGLCSGHSASGVWVDEQARTTVPGLYAAGDMACVPHNYMIGAFVFGD
LAGTHAASTLADVAAPQRLPQDQVREAHELIYRPLRHPDGPPQPQVEYKL
RRFVNDYVAPPKTAAKLSLAIRTFERMSEEIAEMGARNPHELMRAVEVSF
IRDCAEMAARSSHTRTESRWGLYHDRADLPGRDDAQWGYHLNLRKDAGGE
MVFLKRPVAPYFVPVPELDGLPPTDRTVYPVEEPPLIGGQAPATAVSRIA
PATTAFEPPSPRIAEVLALEEPTVADLARYLADSDPGVRRTAVATLTEHI
PDGYAPALLAALGDDDAAVRRTGADGIRELVEVLPEPEKAREYLDSADRV
VRAAALYVLAARRAGDSAHYRRALADADHRVRIEAVRALVSVDDVQGVVD
AADDENREVRIAAAAGLATLAAVAAPASRAVRGLVADTDPLVRAAGLAAL
GEIGCGQDDYAAVKQALRAPAWQVREGAARALAGAAADFAVPQLSEALSD
AHLDVRKAAVLSLTRWAAEPAARDALGIALKDSDADVRAYARRALEHDGS
LQNG
379762791YP_005349188.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MPEYPPDRINGPRLTLRLPTLDDAGPLYQRVARDPQVTKYLLWAPHPDVA
ATRRVITEKLNAAADEKTWVIELRHRGEVVGLASCRRTAAHSVEIGYCLG
RRWWGKGLMSEVLGMLLTALDADRDVYRVWATCSVDNERSARLLEHAGFF
LEGRLARHAVYPTMGPEPQDSLLYAKILR
379762790YP_005349187.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MNRSTLDGNAASVREVCDAGLLAGAVTVVWQRGELLQVNEIGYRDVDAGL
PMQRDTLFRIASMTKPVTVATIMSLVDEGKLTLKDPVVRWAPELAGVRVL
DDSHGPLDRTHPVNRAILIEDLLTHTSGLAYGFSVSGPIAKAYMRLPFNQ
GPDAWLAELAKLPLVHQPGERVTYSHSIDLLGVIASRIDGKPFHQVLDER
ILGPAGMTDTGFFVTAEARRRAATMYRLTNEHQLQHGVMGPPHLTPPSFC
NAGGGLWSSADDYLRFVRMLLGGGTIDGVRVLSEESVRLMRTDRLTDEQK
RHNFLGAPYWVGRGFGLNLSVVTDPAKSTPLFGPGGVGTFSWPGAYGTWW
QADPTADLILIYLIQNLPDLTVDAATAVAGNTSLAKLRTAQPRFVRNTYR
ALGL
379762789YP_005349186.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MQSTSFNDPSGEAEKEVKFRMGAAGDTRSGSDSRELMSAADVGRTISRIA
HQIIEKTALDGPDAPRVVLLGIPTRGVILAERLAGNIGEYSGVEVGHGAL
DITLYRDDLMQKPPRPLEATSIPAGGIDDALVILVDDVLYSGRSVRSALD
ALRDVGRPRVVQLAVLVDRGHRELPLRADYVGKNVPTSRTESVHVLFRES
DGDDGVVISR
379762788YP_005349185.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTRHLLAAGDLSLDDATAILDDADRFAQALVGREIKKLPTLRGRTIVTMF
YENSTRTRVSFEVAGKWMSADVINVSAAGSSVSKGESLRDTALTLRAAGA
DALIIRHPASGAAHLLAEWTCAGGDSGPSVINAGDGTHEHPTQALLDALT
IRQRLGGIEGRRVVIVGDVLHSRVARSNVMLLHTLGAEVVLVAPPTLLPV
GVDGWPVTVSNDFDAELPAADAVLMLRVQAERMNGGFFPSVREYSSLYGL
SDRRQAMLPGHAVVLHPGPMLRGMEIASSVADSSQSAVLQQVSNGVHVRM
AVLFHVLVGAESAGSEGAA
379762787YP_005349184.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSVLLRGVRLYGEGDRVDVLAEDGQIAEIGPGLKIPDSADVIDATGQVLL
PGFVDLHTHLREPGREYAEDIETGSAAAALGGYTAVFAMANTNPVADSPV
VTDHVWHRGQEVGLVDVHPVGAVTVGLAGKELTEMGMMAAGAAQVRMFSD
DGICVHDPLVMRRALEYATGLGVLVAQHAEEPRLTVGAVAHEGPTAARLG
LSGWPRAAEESIVARDALLARDAGARVHICHASTAGTVEIVKWAKDQGIS
ITAEVTPHHLMLDDSRLSSYDGRNRVNPPLREAADAVALRQALADGVIDC
VATDHAPHAEHEKCVEFSAARPGMLGLQTALSIVVQTMVIPGLLTWRGLA
RVMSENPARIVGLPDHGRPLEVGEPANLTVVDPDASWTVAGPDLASRSAN
TPYEAMTLPATVTATLLRGKVTCRDGKCPA
379762786YP_005349183.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MNSGTLAGSLIFAAVLVVVITVVIQLMMRSWQRRAQRQAELIGDLPQIPD
QVGAASITTRGHYCGSMMAPGWNERIAAGDLGYRSKAVLTRYAGGIMVER
LRAHPIWIPQDSITAIRMERGMAVRPARIGILAIRWRLPSGVEIDTGFRA
DHRHDYDPWLEERDGQENEVA
379762785YP_005349182.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MVLEDGRVFTGTPFGKIGQTLGEAVFSTGMSGYQETLTDPSYHRQIVVAT
APQIGNTGWNDEDAESRGDKIWVAGYAVRDPSPRPSNWRATGTLEDELIR
QHVVGIAGIDTRAVVRHLRTRGSMKAGVFSGDALADPDELLQRVRGQQSM
LGADLAGEVSTPDTYIVEPEGEPRFTVAALDLGIKTNTPRNFARRGIRTH
VLASSATYRQIADINPDGVFLSNGPGDPATADHIVAVTREVLGAGIPLFG
ICFGNQILGRALGLSTYKMVFGHRGINIPVIDHATGRVAVTAQNHGFALE
GEAGQSFDTPFGQAIVSHTCANDGVVEGVKLADGRAFSVQYHPEAAAGPH
DANYLFDQFIELMAAPNRGKGR
379762784YP_005349181.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MPRRADLRHVLVIGSGPIVIGQACEFDYSGTQACRVLRAEGLEVSLVNSN
PATIMTDPEYADHTYVEPITAAFVEKVIAQQAERGNKIDALLATLGGQTA
LNTAVALYENGALERHGVELIGADFDAIQRGEDRQMFKDIVAKVGGESAR
SRVCFTMEEVRETVEELGLPVVVRPSFTMGGLGSGMARSVEEVDRMAGAG
LAESPSANVLIEESIYGWKEFELELMRDGNDNVVVVCSIENFDPMGVHTG
DSVTVAPAMTLTDREYQRMRDLGIAILREVGVDTGGCNIQFAINPADGRL
IVIEMNPRVSRSSALASKATGFPIAKIAAKLAIGYTLDEIVNDITKETPA
CFEPTLDYVVVKAPRFAFEKFPGADPTLTTTMKSVGEAMSLGRNFIEALG
KVMRSLETSRTGFWTKPDPDGDVEEVLTRLRTPTEGRLYDIELALRLGAS
VERVAEASGVDPWFVAQIGELITLRAELIAAPVLDADLLRRGKHNGLSDR
QIAALRPELAGENGVRSLRERLGVHPVYKTVDTCAAEFEAKTPYHYSSYE
LDPAAETEVAPQTQKPKVLILGSGPNRIGQGIEFDYSCVHAATTLSQAGF
ETVMVNCNPETVSTDYDTADRLYFEPLTFEDVLEVFRAEQQSAGDGPGVV
GVIVQLGGQTPLGLAQRLADAGVPIVGTPPEAIDLAEDRGAFGDVLTAAG
LPAPKYGTATTFDQARRIAEDIGYPVLVRPSYVLGGRGMEIVYDEETLRG
YITRATELSPEHPVLVDRFLEDAVEIDVDALCDGTEVYIGGIMEHIEEAG
IHSGDSACALPPVTLGRSDIEKVRRATESIAHGIGVVGLLNVQYALKDDV
LYVLEANPRASRTVPFVSKATAIPLAKACARVMLGASISQLREEGLLAAS
GDGAHAALDAPIAVKEAVLPFHRFRRIDGAAIDSLLGPEMKSTGEVMGID
RDFGSAFAKSQTAAYGSLPARGTIFVSVANRDKRSLVFPVKRLADLGFRV
LATEGTAEMLRRNGIPCDEVRKHFEDPQPGRPAQSAVDVIKAGEVDMVIN
TPYGNSGPRIDGYEIRSAAVSVNIPCVTTVQGASAAVQGIEAGIRGDIGV
RSLQELHSQIGQGGLPGNGAR
379762783YP_005349180.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTGFGVRLSDAKAERGPLCVGIDPHPELLRAWGLPTTADGLAAFCDICIE
AFSGFAVVKPQVAFFEAYGAAGFAVLERTIAALRSAGVLVLADAKRGDIG
TTMAAYAAAWAGDSPLAADAVTATPYLGFGSLRPLLEAAAAHDRGVFVLA
ATSNPEGATVQRAAFDGRTVAQLVVDQAAVVNRSATPSGPGYVGVVVGAT
VLQAPDLSALGGPVLVPGLGVQGGRPEALAGLGGAEPGQLLPAVAREVLR
AGPGVAELRGAAERMLDAVAYLAV
379762782YP_005349179.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSNLRIRQAAELLGVSDDTVRRWINQGALEVSHDAAGRKVIASEDLARFS
RSNAPAPPADPLSIGSSARNRFVGLVTAVVSDKVMTQVEMQCGPFTVVSL
MSTEAAEELQLRPGSVAVAVVKATTVIVETAQPSTALASD
379762781YP_005349178.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MALPQLTDEQRAAALEKAAAARRARAELKDRLKRGGTNLTQVLKDAETDE
VLGKMKVSALLEALPKVGKVKAQEIMTELEIAPTRRLRGLGDRQRKALLE
KFGS
379762780YP_005349177.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MVVLSGPSAVGKSTVVRCLRERVPDLHFSVSATTRAPRPGEVDGVDYHFV
SPARFQQLIDEGALLEWAEIHAGLHRSGTLAEPVRDATARGFPVLIEVDL
AGARAVKRAMPEALTVFLAPPSWEDLEARLVGRGTETPEVMRRRLETARI
EMAARDDFDRVVVNRRLESACAELVSLLVGTAPDRHDPAGHTESQTTSNQ
D
379762779YP_005349176.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTIPQSDAALAAVPDRFDLSAGAPGAYDTPLGITNPPIDELLDRVSSKYA
LVIYAAKRARQINDYYNQLGEGILEYVGPLVEPGLQEKPLSIALREIHGD
LLEHTEGE
379762778YP_005349175.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MDRTRIPKRVVVGVSGGIAAYKACTVVRQLSEAGHSVRVIPTESALRFVG
AATFEALSGQPVHTGVFNDVPEVPHVQLGKQADLVVVAPATADLLARAVH
GRADDLLTATLLTARCPVLFAPAMHTEMWLHPATVDNVATLRRRGAVVLE
PAAGRLTGTDSGSGRLPEAEEITTLAHLLLERHDALPYDLAGCKMLVTAG
GTREPVDPVRFIGNRSSGKQGYAVARVAAQRGAEVTLIAGHTAGLIDPAG
VEVVHVSSAAQLGDAVSKRAPEADVLVMAAAVADFRPAHVAAAKIKKSAS
NETAPPTIELVRNDDVLAGAVRARAHGQLPNMRAIVGFAAETGDASGDVL
FHARAKLQRKGCDLLVVNAVGEGRAFEVDSNDGWLLASDGTESALQHGSK
TLMASRIVDAIAAFLHGDSG
379762777YP_005349174.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSEKGRLFTSESVTEGHPDKICDAISDSVLDALLAQDPRSRVAVETLVTT
GQVHVVGEVTTTAKEAFADITNTVRERILDIGYDSSDKGFDGASCGVNIG
IGAQSPDIAQGVDTAHETRVEGAADPLDAQGAGDQGLMFGYAINDTPERM
PLPIALAHRLSRRLTEVRKNGVLPYLRPDGKTQVTIEFEDDVPVRLDTVV
ISTQHAADIDLENTLTPDIREKVLNTVLNDLAHDTLDTSSTRLLVNPTGK
FVVGGPMGDAGLTGRKIIVDTYGGWARHGGGAFSGKDPSKVDRSAAYAMR
WVAKNIVAAGLAERVEVQVAYAIGKAAPVGLFIETFGTATVDPVKIEKIV
PEVFDLRPGAIIRDLDLLRPIYAQTAAYGHFGRTDVELPWEQLNKVDDLK
RAI
379762776YP_005349173.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAKEFDSIDESLRDFIREQAVFFVATAPSEGGRINMSPKGYCDTFAVLDE
RTVAYLDLFGSGVETIAHLRDNGRITVMFCSFTRNSRILRLFGTGRVIRP
DDAEFTDLITHFGDRHAGIRAIIVVDVERIADACGFAVPYYELVDERPVL
NAYHHKAPDEAYTRLINRNRRSIDGLPALDSDHPGPPR
379762775YP_005349172.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTERTFARMDGETPDYHTLIIGAGFSGIGAAINLDKAGLPDYLVLEAGDG
VGGTWHWNTYPGIAVDIPSFSYQFSFEQSRHWSRTYAPGRELKAYAEHCA
DKYGVRSRIRFNTKVQAADFDDERGLWRVQTDPGGEVTARFLISACGVLT
VPNLPDIDGVDSFAGVTMHTARWDHGQDLRGKRVAVIGTGASAVQVIPEI
APIVSSLTVFQRTPIWCFPKLDVPLPAPARWAMRIPGGKALQRLLSQAYV
ELTFPISAHYFTVIPLAKRMATLGRAYLRRQVRDPVVREQLTPRYAVGCK
RPGFHNGYLATFNRDNVRLITEPIDKITPDAVATTDGETHEIDVLILATG
FKVMDPDSVPTFAVTGSGGRSLSRFWDEHRLQAYEGVTVPGFPNLFTVFG
PYGYVGSSYFALIEAQTHHIVRCLKRAERLGATRVEVSEEANDRYFAEMM
RRRHRQIFWQDSCRLANSYYFDKNGDVPLRPGTTPEVYWRSRRFDLDDYR
FTG
379762774YP_005349171.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MPSLDNTADEKPAIDPILQKVLDAVPFRLSTEDGIAAARQRFRDLPRRPL
HPELRVEDRTIAGPAGPVAIRIYWPPSHSDGQTGAPVVLFFHGGGFVIGD
LDTHDGTARQHAVGADAIVVSVDYRLAPEHPYPGAVEDAWAATLWVAGHA
ADLHGDPGRMAVAGDSAGGTIAAAVAQRARDHGGPALKFQLLWYPSTMWD
ATLPSFAENATAPILDVRAVAEFSRWYAGEVDLSDPPSDMAPGRAKDLSN
LAPAYIGVAGYDPLRDDGIRYGELLAAAGVAAEVHNAETLVHGYLGYAGV
VPAATAALERGLAALRTALRG
379762773YP_005349170.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAGAWVVAGWVALGYGIYLTVLALRSPPGMELTGHWVLQPAFKASMAILL
MLAAAGHGCVRERRWLMPALLLSALGDWVLAIPWWTLSFEIGLAAFLLAH
MCFIGALLPLVPPLSWSSQAERPAALRIAAVVLMCLVSIALLVWFWPHLG
PDKLTLPVTVYIVVLTAMVCTALLAKMPTIWTAVGAVCFAASDSMIAISR
FILGNEALAVPIWWSYAAAQILITAGFFFGRELPGQDGGDAAPPAEG
379762772YP_005349169.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MEPIARVLPMLSVPHLDREFDYLVSAEQSDDAQPGVRVRVRFHGRLVDGF
VLERRADTDHPGKLGWLDRVVSAEPVLTPEIRRLVDAVAARYAGTRPDVL
RLAVPARHARVEREPAVSRDPPGPAIPDPVDPAGWDGYGRGAQFLAALAE
SRAARAVWQALPGEPWTDRFAEAAAQTVRAGRSALAIVPDQRDLDALWRA
ATTRIDEGSVVALSAGLGPAARYRRWLAALRGTARLVIGTRSAVFAPLSD
LGLVMVWADADDSLAEPRAPYPHAREVAMLRAHQARCAALIGGYARTAEA
HALVRSGWAHDIVAARPVVRARTPRVSALDDTGYADERDPAARTARIPSI
ALRAARSALQAGTPVLVQVPRRGYVPSLACARCRTIARCRHCTGPLSLQE
GGAALLCRWCGRIDPTRRCARCGSDAVRAVVVGARRTAEELGRAFPGTAV
ITSSGDGVVPEVAPGPALVVATPGAEPRASGGYGAALLLDPWALLGRQDL
RAAEDALWRWMSAAALVRARGDGGVVLVIAESSLPTVQSLIRWDPVGHAE
AELTARAEVGLPPSVHMAAIDGTPDAVTALLGEVRLAELEADLLGPVHLP
TGVRRPAGTPAGVAVTRMLVRVPRRQGLALAAALRRGVGVLSARQTHEPA
RVQIDPLHIG
379762771YP_005349168.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTADNATVDESLDVITDALLTASRLLMAISARSVGQVDETITIAQFRTLV
ILSNRGPVNLATLAGLLGVQPSATGRMVDRLVAAGLIDRLPHPTSRRELL
AALTTRGRDVVHQVTAHRRTEIAAIVAKMPPPERHGLVRALTAFTAAGGE
PDVHLDADIGL
379762770YP_005349167.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSTSTSKTTFPFPQGGLMTVDSTISDARVAATHRTVWALGDYALMAEEVM
APLGPALVEATGIGPGVRVLDVAAGSGNISLPAAAAGAAVVSTDLTPELL
LRSRDRAAAQGLTIDYREANAHALPFGDGEFDVVMSAIGVQFAPDQQRAA
GELVRVCRPGGTIGVISWTPEGFFGRMLATIRPYRPSLSHPVPPAALWGR
PGYVTALLGDRVGEITTARGMLAVDRFASAEDVHAYFKRHYGPTIEAYAN
IGHNRVLAAELDAQLVELAQQYLVDGTMGWEYLLLTATKWTD
379762769YP_005349166.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MRLVFAGTPEPALPALRRLIDSPRHDVIAVLTRPDAAAGRRGKPEPSPVA
REALDRGIPVLRPSRPNSAEFVAELSRLAPDCCAVVAYGALLRDDLLAVP
PRGWINLHFSLLPAWRGAAPVQAAIAAGDTITGASTFQIEPTLDSGPIYG
VVTETIRPTDTAGELLERLAISGAALLSTTLDGIADSTLTPRPQPAEGVS
VAPKITVEQARVRWDLPALVVERRIRAVTPNPGAWTVIGDLRVKLGPVDA
AVAPGSPEPLPPGAIHVDRKGVWVGTGSDPVRLGQIQPPGKKFMNAVDWA
RGARLDPAVRAT
379762768YP_005349165.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSAGRDGRQRNRPDRQPARPQRRPAQRDRRPARRPLDPARAAAFEVLRAV
SERDAYANLALPALLRERGITGRDAAFATELTYGACRSRGLLDAVIGAAA
GRAPQAIDPVLLDLLRLGAYQLLRTRVDAHAAVSTTVEQAGIEFDSARAG
FVNGVLRTISGRDEQSWVAELAPDPARDPIGHAAFVHAHPRWIAQAFADA
LGAAAGELDAVLASDDERPQVHLAARAGTLTAVELADAVGGTVGRYSPYA
VYLPGGDPGRLAPVRDGAALVQDEGSQLVARALTLAPVERDGGRWLDLCA
GPGGKTALLASLGAGSGAHVTAVEPAPRRADLVTENTRGLPVDVLRVDGR
HTDLEPAFDRVLVDVPCTGLGALRRRPEARWRRQPSDVPALAKLQRELLG
AAIALTRPGGVVLYATCSPHLAETVGVVADALRRHPVSALDTRPLFEPVD
HLGDGPYVQLWPHRHGTDAMFAAALRREAG
379762767YP_005349164.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MNRPARLSSLALMAGNTESSKGPLIAPSILSADFSRLADEAAAVTGADWL
HVDVMDNHFVPNLTLGLPVVESLLAATTIPMDCHLMIEDPDRWAPPYAEA
GAYNVTFHAEATQNPIAVARDIRAAGAKAGISVKPGTPLEPYLEILPQFD
TLLIMSVEPGFGGQSFIPEVLSKVRTARKLIDAGELTILVEIDGGINGDT
IEQAAEAGVDCFVAGSAVYGAADPATAIDALRRQAAAASPHWRR
379762766YP_005349163.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTVSPGDGLDAAMRLAIEQSTLVKGTTYPNPPVGAVILDAGGEVVGVGGT
EPAGGDHAEILALRRAGDLAAGGTVVVTLEPCNHYGKTPPCVNALLDAKV
ATVVYAVADPNPQAAGGARRLEEAGVAVRSGVLADEVARGPLREWLHKQR
TGLPHLTWKYASSVDGRSAAADGSSQWISSEASRLDLHRRRGACDAIVVG
TGTVLADDPALTARLPDGSLAARQPLRVVVGMREIPSEAKVLNDDSRTML
IRTHDPAEVLKAVSDRTDVLLEGGPTLAGAFLRAGAVDRILAYVAPTLLG
GPVTAVDDVGVSTIARALRWQFDGIDRVGHDVVLSLVPRSA
379762765YP_005349162.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTTQTGRRVAISAGSLAVLLGALDAYVVVTIMRDIMSDVHIPINQLQRIT
WIITMYLLGYIAAMPLLGRASDRFGRKLVLQVSLALFMVGSVVTALAGHW
GDFHLLVGGRTIQGVASGALLPVTLALGADLWAQRNRAGVLGGIGAAQEL
GSVLGPLYGIFIVFLFHDWRYVFWINVPLTLIAMVMIQFSLPSHERTETP
EKVDLVGGVLLAVALGLAVIGLYNPQPDGKQILPSYGLPLVIGAAVVGVL
FLLWERFSRTRLIEPAGVRFRPFLAALGASLFAGAALMVTLVDVELFGQG
VLGQTQTQAAGLLLWFLIALPIGAVLGGWIATRVGDRAVTFVGLLIAAYG
YWLIHYWRQDVMSQKHNILGLLNVPVLHADLLVAGFGLGLVIGPLTSAAL
RVVPSAQHGIASAAVVVARMTGMLIGVAALSAWGLYRFNQIVAGLTAAIP
PDATLLERIAAQGTMYLKAFAMMYGDIFAATVVICIAGALLGLLIGGRNE
HAEEPEIPEPQEVSLSER
379762764YP_005349161.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MQTRRRLSAVLASLTLATALIAGCSSGSKQSGAPLPDGTTLVKQSADATK
KVQSAHIALSIQGKIPGLPIKTLNGDLTTAPATAASGNATITLGGSDIDA
NFVVVDGTLYATLTPNKWSDFGKASDIYDVSVLLNPDSGLGNALANFSDA
KAEGRETIDGQSTIKVSGNVSADAVNKIVPQFNATQRVPSTVWIQESGDH
QLVRANLEKSSGNSAEVTLSKWGEQVQVTKPPVSS
379762763YP_005349160.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MFTGIVEELGEVTGRDVLSDAARLTIRGAVVTADAGHGDSIAVNGVCLTV
AELLPGGLFTADVMGETLNRSNLGALQVGSRVNLERAAAVNSRLGGHIVQ
GHVDGTGQIVARSPSEHWEVVRIEIPAEVARYVVEKGSITVDGISLTVSG
LGSDPRDWFEVSLIPTTRELTTLGQAPIGTQVNLEVDVIAKYVERLMSR
379762762YP_005349159.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MDSVERAVADIAAGKAVIVIDDEDRENEGDLIFAAEKATPEMVAFMVRYT
SGYLCVPLDGAICDRLGLLPMYAVNQDKHGTAYTVTVDAKDGVGTGISAS
DRATTMRLLANPISVADDFTRPGHVVPLRAKDGGVLRRPGHTEAAVDLAR
MAGLQPAGAICEIVSQKDEGSMAQTDELRVFADEHDLAMITIADLIEWRR
KHEKHIARIAEARIPTRHGEFRAIGYASIYEEVEHVALVRGEIAGPDSDG
DDVLVRVHSECLTGDVFGSRRCDCGPQLDAAMAMVAREGRGIVLYMRGHE
GRGIGLMHKLQAYQLQDAGEDTVDANLKLGLPADARDYGIGAQILVDLGV
RSMRLLTNNPAKRVGLDGYGLHIIERVPLPVRANAENIRYLMTKRDKMGH
DLAGLDDFHESVHLPGEFGGAL
379762761YP_005349158.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSPAEGVPEVPPLDASGLRLALVASTWHSEICDALLAGASKVASESGVDA
PTVVRVIGAIEIPVVAQELARNHDAVVALGVVIRGQTPHFEYVCDAVTQG
LTRVSLDTSTPVANGVLTTDTEQQALDRAGLPESAEDKGAQATLAALTTA
LTLRELRARS
379762760YP_005349157.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTEPPDRETWDAVLRPHRTPLFAYGAAVLIAGAHIVVGLLLKARSTGVVF
QTADQVAIAVLGLVIAGIVLLFARPRLRVGPSGVSVRNLLGDKLIEWPDV
VDVSFPVGHRWARIDLPDDEYIPVMAIQAVDKGRAVEAMDTVRALLTRYR
PDLPAS
379762759YP_005349156.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MMKRSWAKLAVTVGGLALASTAGAGVASASPDYGPMINTTCSYDQAMRAV
HAENPMAAQYLDQSPPNQQFLQQYLASSPDQRVNLLHAIEHNQGAQQALP
IFQQMMTDCTRY
379762758YP_005349155.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTMPIWAAFPPEVNSAALTTGPGPASLLNSETAWLNLSAEYDTAATELSE
LLAEVQAGTWQGPTAEKFVAAHVPYLAWLLQNSANATAAALEHDTVIAAY
NAAVAAMPTLAEIAANKALNASLIATNFLGVNTIPIAQNEFEYLQMWLRA
ATAMAMYEAVSQTAMTWVPPTAPPPPIQLANPPNQDAGGGANQLSWWVDR
VQMVAQELTTDLNQPGSNPSTAIHSLLTDPLLLKVPHWAGESLYTFIPQV
PQLTQLSVGLIVPFLPVAGAAGLAGLAGLAGVAPPAPTLPGAAAAPAPSH
TGAPVAMAPGLSAPAPAATPAAAPAPAPAATPASAAAPAAPPATAVAGFD
YPYVVGPPGIGAGANLPAGARSQQRSAEPGTAAAAIAPARREQARRRRRQ
RPGLIDPGRRHEYLDADPEPDAAGKTTATASDRGAGPLGFAGTARGPDAA
PVGLTTIGADSLDDGPRMPLLPSSWGPESEGAEPGQTDAP
379762757YP_005349154.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAAESSLAWLLRPVSVEAFLDEIWAIRHHHIQRGEPGYFDGLLPAADELL
EQMRAEPSAVRLVKGGQDRDPASYRRGDGSLDPDRAREGLADGYTIVLNG
LERYLRTVATLSHSLEVELNFPTRVNAYVTPPDATGFSPHYDPHDVLVLQ
IRGSKTWHVSTGAPVPPHEIESRKGVGTDGPAAATDVCLRAGDVLYLPRG
QVHSAETRSEPSVHLTIGLHAPTVLTLVTHALYALSLRDPRLHTRLSPRH
LDDAGARAGLEDLVHDTLRTVEGPDIVADGLGALEDVLVRRGRCPPVGRV
SDTAGIDARTLVRKHQPLYARVTRAADRVVLHFAQLSVAAALDHEAAMRF
LASSTEPFRVGELPSLSAPQQTGLVQTLLLNGFLARLSTD
379762756YP_005349153.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MEPGVYRFRDPHGRVIYVGKAKSLRSRLTSYFSDISGLHPRTRQMVTTAA
KVEWTVVNTEVEALQLEYNWIKEFDPRFNVRYRDDKSYPVLAVTLNEEFP
RLMVYRGPRRKGVRYFGPYSHAWAIRETLDLLTRVFPARTCSAGVFKRHR
QIDRPCLLGYIDKCSAPCIGRVSAEQHRQIVDDFCDFLSGKTDRFARELE
QQMNAAAERLDFERAARLRDDLGALKRAMEKQAVVLGDGTDADVVAFADD
DLEAAVQVFHVRGGRVRGQRGWIVEKSADPGDSGEEQLVEQFLTQFYGEQ
AELGGAADESVNPVPREVLVPCLPSNADELTSWLSGLRGSRVVLRVPRRG
DKRALAETVQRNAKEALQQHKLKRAGDFNARSAALQNIQEALGLSEAPLR
IECVDISHVQGTDVVGSLVVFEDGLPRKSDYRHFSIREAAGQGRSDDVAS
IAEVTRRRFARHLSEQNDPNMLSPEGKSRRFAYPPNLYVVDGGAPQVNAA
SAVLEGLGITDVAVIGLAKRLEEVWVPSEPDPVIMPRNSEGLYLLQRVRD
EAHRFAIAYHRSKRSKRMTASVLDSVPGLGEHRRKALVSHFGSIARLKEA
TVDQITAVPGIGVATATAVLEALRPEQAPDESRAAQ
379762755YP_005349152.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MDAPAGIDVVLVTGLSGAGRGTAAKVLEDLGWYVADNLPPQLITRMVDLG
MDAGSRITQLAVVMDVRSRGFTGDLDSVRTELATRNIAPRVVFMEASDDM
LVRRYEQNRRSHPLQGDQTLAEGIAAERRMLASVRATADLIIDTSTLSVR
GLRETIERAFGNDAGATTSVTVESFGFKYGLPMDADMVMDVRFLPNPHWV
DELRPRTGQDPAVRDYVLSQPGAAEFLDAYHRLLSLVVDGYRREGKRYMT
VAIGCTGGKHRSVAIAEQLMQLLNADHQLSVRVLHRDLGRE
379762754YP_005349151.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSEPFNRGIVALGGGHGLYATLSAARRLTPYVTAVVTVADDGGSSGRLRG
ELGVVPPGDLRMALAALASDSPHGRLWATILQHRFGGSGALAGHPIGNLM
LAGLSEVLADPVAALDELGRILGVKGRVLPMCPIALQIEADVSGLEGDPR
MFRVIRGQVAIATTPGKVRRVRLLPDHPPATRQAVDAIMAADLVVLGPGS
WFTSVIPHVLVPELAAALRATSARRALVLNLVAEPGETAGFSVERHLHVL
AQHAPGFTVHDIIIDADRVPSEREREQLRRTATLLHAEVHFADVSRPGTP
LHDPGKLAAALDGVRAARKGPEAAPATATADIRVDGAKPPPGGDGPAGSG
PRGDDSWR
379762753YP_005349150.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAMTTEVKDELSRLVVKSVSARRAEVTSLLRFAGGLHIVGGRVVVEAEVD
LGNVARRLRKDIFELYGYTAVVHVLSASGIRKSTRYVLRVANDGEALARQ
TGLLDNRGRPVRGLPAQVVGGSVGDAEAAWRGAFLAHGSLTEPGRSSALE
VSCPGPEAALALVGAARRLGVSAKAREVRGADRVVVRDGEAIGALLTRMG
AQDTRLVWEERRMRREVRATANRLANFDDANLRRSARAAVAAAARVERAL
EILGDTVPDHLASAGKLRVEHRQASLEELGRLADPPMTKDAVAGRIRRLL
SMADRKAKIEGIPDTESAVTPDLLEDA
379762752YP_005349149.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MKRLSSVDAAFWSAETAGWHMHVGALAICDPKECSEYSFARLRELIIERL
PELPQLRWRVTGAPFGLDRPWFVEDEDLDPDFHIRRIAVPAPGGRRELEE
LVGRLMSYKLDRARPLWEMWVIEGVEGGRIASLTKMHHAIVDGVSGAGLG
EILLDVTPEPRPPQQETVGSLVGLNIPGIERRAVGALINVGVKTPFRVAR
LVEQTVRQQIATLGVRSRPPRYFEAPKTRFNAPVSPHRRITGCRVELARA
KVIKDAYGVKLNDVVLALVAGAARDYLLKRGELPAKPLIAQIPVSTRTDE
NKDDVGNKVSSMTVSLATHIEDPGERLRSIHESTQNAKLMAKALSAHQIM
GLTETTPPGLLGLAARAYTASGLSRNLAPINLVVSNVPGPSFPLYMAGAK
LDSLVPLGPPVMDVALNITCFSYTDYLDFGFVTTPEVANDIDDMADRIEP
ALTDLEKAAARENSPN
379762751YP_005349148.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTLGNQQADGMSELRGLITPELRATLEAVEAKLGAPGMCNPLDDTPCVEG
TPSQEAIDRDTRSAAQRGHDALLAALRALLASGELGQHNGLPASIIVTTT
LAELEAAAGRALTGGGTILPMSEVIRLARHAHHYLAIFDKGKALALYHTK
RLASPGQRIVLYAKDRGCTAPGCTVSGYYCEVHHTTDYSTCHSTDINQLT
FACGPHHRMLDPGGWSTRKNFRGDTEWKPPPHLERGQPRTNTYHHPEKLL
HHEHDDDEADNPGAA
379762750YP_005349147.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSSGGIIDRDAISAAFDALDAAIEGVAGLSFDALAPRECLALLERCERAR
RRLPVAEHALINHLARQASIEELGGPLDQAIADRLRISHTEAARRVKDAA
DLGPRHGLTGEPLPPVLAATAAAQARGELGAAHVAVIRRFFRRLPGWIDP
ATRERSRPTWPVTPRITGPTNSTAWPTSWKIASIPTAFSPTRTAPVAAG
379762749YP_005349146.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MGVRDASAPARLGRLSAARGGAPSRARSRAPGRARSGAPGRPGAPADTVS
NIGNGY
379762748YP_005349145.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MRFTRMIRRPRPLMRATLELANAANGLRPLARKGYSTVLVFWFGWPASEV
PGVYFSASLLDVLRRGRRGDFAGRRGKVALALTAASWAILAVIKYRGVTT
PGPVLEAGLREQLGDDYEEALDKLPQTKPTRSGRRTLPLGNTVARRRYVE
KTNVVSYGPHGRANLADIWRRHDLPRDGKAPVLVQVPGGAWVIGMRRPQA
YPLMSHLAARGWVCVSIGYRVSPRHTWPDHIVDVKRALAWVKENISRYGG
DPNFVAITGGSAGGHLCSLAALTPNDPAFQPGFEEADTSVVAAVPVYGRY
DWFSTEGEGRREFVELLQKFVVKRKFSTHRDIYVDASPIRRMRADAPPFF
VLHGHDDSLIPVGEAQEFVEELRAVSKSPVAYAELPHAQHAFDIFSSPRA
HRSAEAVARFLSWVYATRPPQRD
379762747YP_005349144.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSETLGLIGTMRRAGLIAPMRPDRYVRIAAAMRREGMGMTSGFASAAQRC
PDRPGLIDERGSLTWRELDERCNALAAALQGLPSGQPRVIGIMCRNHRGF
VEALVAADRIGSDILLLNTSFAGPALADVVTREGVDAVIYDEEFTETVDR
ALTGTPDATRIVAWTDAEHERTVEGLIAARAGAQPKRTGRKGKMILLTSG
TTGTPKGAKQSGGNAGIGTLKAILDRTPWRAEEPIVIVAPMFHAWGFSQL
LLAASFACPVITRRKFDPEATLDLIDRHKATGLVVVPVMFDRIMDLPAEV
RRRYSGRSLRFAAASGSRMRPDVVTAFMDEFGDVIYNNYNATEAGMIATA
TPADLRAAPDTAGRPAGGTEIRILDPEFNELPAGEVGSIYVRNNTQFDGY
TSGSTKDFHAGFMSSGDVGYLDSAGRLFVVGRDDEMIVSGGENVYPIEVE
KALAAHPDVAEAAVIGVDDEQYGQRLAAFVVLEPGAGATPDALKQHVRDN
LANYKVPREIAVLDELPRSSTGKIVRAELRARVGG
379762746YP_005349143.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTDSDNADGGDIGKFDPVLTQRLMAVMRPVLKTYFRSEVHGLDSFPPGGA
LVVGNHSGGMFPMDVPIFSAHFYDKLGYDRPVYTLSHDILMTGPTADFFR
RTGYIRANRENAAVALRSGGVVIVFPGGDYDAYRPTLSENVIDFNGRKGY
VRTAIDAGVPIVPAVSIGGQETQLYLTRGTWLAERLGIKRLLRSAILPVS
FGFPFGLSAVIPPNLPLPTKIVTRVLEPIDIAGKFGEDPDIDEVDEYVRS
VMQEALTELAAKRRFPILG
379762745YP_005349142.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MGFMSPELPDVDRSTWPTLPRATRLQVVTRHWAEHGFGTPYAVYLLYLLK
IALYVAAPAAIISLTPGLGGLGRIGDWWTQPIVYQKVVIFTLLFEVTGLG
CGSGPLTGRFMPPIGGILYWLRPNTIRLPAWPGKVPFTRGDTRTAFDVAL
YAIVLIGGVWALLSPGHGGPVTTAGDVGLIDPVRVIPTIVALALLGLRDK
TVFLAARGEHYWLKLFVFFFPFTDQIAACKLIMLCLWWGAAVSKLNHHFP
YVVAVMTSNNALLRSRVFTPLKHLLYLDHVNDLRPSLLPKLMAHVGGTTA
EFVVPTVLVFFAADHPWRWFLIGFMVLFHLNIISNLPMGVPLEWNVFFIF
SLFYLFGHYGAVRATDLRSPVLLALVILAVVVVIVGNMFPEKISFLPAMR
YYAGNWATSVWCFRAGAEEKIDADIVKSSALVVNQLARLYDPETAEILAD
KIAAFRAMHVHGRALNGLLPRAIDDEADYKIREGEIVAGPLVGWNFGEGH
LHNEQLVEAVQRRCRFEDGDLRVIVLEGQPIHVQRQSYRILDAKTGLIEA
GYVDVKDMLTRQPWPEPGDDCPVHVIDDAHG
379762744YP_005349141.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MARSVVVGAGPNGLAAAIHLARHGVDVQVLEAGETVGGGARSAELTVPGV
IHDVCSAAHPMAVGSPFWEEIDLPSYGLTWKWPEVDCAHPLDDGTAGLLY
RSIDRTVAEMGADGRRWRLAVGDLAAGFDELCQDLMRPVLHVPHHPIRLA
AFGPRALLPATVLARWFRTERVRALYGGQAAHAYTRLDRPLTAAMALMFM
ASGHHYGWPVAAGGSGSIIAALAAVLAEHGAAITTGVTVTSRKDIPDADI
VMLDLTPAATLRLYGDAMPGRIKRSYRRYRQGSSAFKVDYAIEGHIPWTN
PDCGHAGTVHLGGTFAEIAHSERERSQGRMYRRPFIILGQQYLADPSRSA
GNINPIYAYAHVPFGYTGDATEIITDQIERFAPGFRDRVVATVSRGTADL
QAYNPNFIGGDIIGGANDGLQVILRPRVSVNPYATGVPGVYLCSQSTPPG
AGIHGLCGYHAAEAALGWLRKRRGD
379762743YP_005349140.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MDIEVTLQDRGGKEQRITLRTTLPGHPLLVAVAENPDITRALCDAKRELS
RQLEHQKSTHDPMNNRRLKRATIRHPD
379762742YP_005349139.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MMKRLTGLDGVTLHGETSVMPTHVMAVLFCDPEAHGAVTADAICKLLAQR
TATIPGFRQRLLTKPFGLGQPSWIEDPAFDVQSHLHCVRLAEPGTMRELT
TLIGELHGQPLNRDRPLWDAWVVQGLADGRLVVLIKFSHAITDGVGAVTS
MLPELMTVDADAEFAVAPERAEATMPGAATRVWDVIDEIAANTAVGIRIA
VRLGPVAVKSTIGTALRSVRQLLPGAGPQRSDGSDSEEDDSSPRTLLNAP
LTARRTVAFAGVAMDDVRAIAAAFDVTVNDVFLTATTSALRRWLASHDTV
PSHPLRTMMPISTRGVDGDASNSWSPVVVKLPVDLADPAQQLASIHDATS
RIKDGRRAVRPVNLADVIDLVPPVVIGWVMGVYTGLQLSRFHSPVAHVIA
SNVPGPSDEIYCAGAHVLGIHALAPLFEGSNLNITAVSYSSTLAVGIVAC
PDNVDDVASVATCIEDVVGELKIAADEKAGQSAGLSRPSEPEPTMNGTAT
TQFAGGEAGWPDRGLAPRNAGIAHFLE
379762741YP_005349138.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MLDYKGNSMAALTTFRTPYEIRLQLVTDTISAHSKVGNDAAVKLAVHVLA
ALNSIPEKVR
379762740YP_005349137.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSVRRFAVAACATSTRILGTPDLKEQDLPFQHSGRWGRNA
379762739YP_005349136.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MEEGTSTVPKRTTAAGDGLDASAANRPEHGMVSRSVVLQCALRLVDRDGV
DGLSMRRLSEAVGRDPTVIYRHVPNKAALLDGIAEIVLGKLRVDTADPDW
AEQLRAVAHDFRRLALEHPNVVPLLVTRPLATPLGQRPPGMLRPLEDVVA
LLTSVGFSGVDALHIYRVLFGYLYGHILTELQEVVERPEESDDVLRLGLH
RLAITEFPQVRALAPALGDYDGAAELDRALDVLFIGLAATVPAPRRSARK
RARK
379762738YP_005349135.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTVRVGINGFGRIGRNFYRALLAQQEQGTADIEVVAVNDLTDNASLAHLL
KFDSILGRLPHDVSLEGDDTIVVGNAKIKALEVKEGPAALPWGDLGVDVV
VESTGIFTNAAKAKGHLDAGAKKVIISAPATDEDITIVLGVNDDKYDGSQ
NIISNASCTTNCLGPLAKVLNDEFGIVKGLMTTIHAYTQDQNLQDGPHKD
LRRARAAALNIVPTSTGAAKAIGLVLPELKGKLDGYALRVPIPTGSVTDL
TAELKKSPTAEEINAAMKAAAEGPMKGILKYYDAPIVSSDIVTDPHSSIF
DSGLTKVIDDQAKVVSWYDNEWGYSNRLVDLVALVGKSL
379762737YP_005349134.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAVHTLKDLLGEGVSGRGVLVRSDLNVPLDDGKITDPGRITASVPTLKAL
VEAGAKVVVTAHLGRPKDGPDPKLSLAPVAAALSEQLGRHVQLAGDVVGT
DALARAEGLTDGDVLLLENIRFDARETSKDDAERLALARQLAELVGPTGA
FVSDGFGVVHRKQASVYDIATLLPHYAGTLVAEEIQVLQQLTSSTKRPYA
VVLGGSKVSDKLGVIESLATKADSIVIGGGMCFTFLAAQGFSVGKSLLET
EMVDTCRRLLDTYVDVLRLPVDIVVADKFAADATPQTVAADAIPDDLMGL
DIGPGSVKRFATLLSNAETVFWNGPMGVFEFPAFAAGTKGVAEAIATATG
KGAFSVVGGGDSAAAVRALGIPEGDFSHISTGGGASLEYLEGKTLPGVEV
LDRPQPTGGAA
379762736YP_005349133.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSRKPLIAGNWKMNLNHFEAIALVQKIAFALPDKYYDKVDVTVLPPFTDL
RSVQTLVDGDKLRLTYGGQDLSQHDAGAYTGEVSGAFLAKLGCTFVVVGH
SERRTYHHEDDTVVAAKTAAALKHELTPIVCIGEHLEVREAGNHVIHCEE
QLRGSLAGLSTEQIGKVVIAYEPVWAIGTGRVASAADAQEVCAAIRKELA
SLASPQVADSVRVLYGGSVNAKNVGELVAQDDIDGGLVGGASLDGEQFAT
LAAIAAGGPLP
379762735YP_005349132.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MQLALQITLVVTSILVVLLVLLHRAKGGGLSTLFGGGVQSSLSGSTVVEK
NLDRLTLFITGIWLVCIIGMALLIKYH
379762734YP_005349131.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MADASEAPEDTLEPIGAVQRTPVGRAATEPMRADIRLLGAILGDTVREQN
GREVFELVERARVESFRVRRSEIDRAELARMFYRIDIHQAIPVIRAFSHF
ALLANVAEDIHRERRRAVHVAAGEPPPDSTLAATYAKLDEAQLDSDTVAD
ALKGAVVAPVITAHPTETRRRTVFVTQHRINELMRLHAEGHAETDDGRNI
ELELRRQVLTLWQTALIRLSRLQITDEIEVGLRYYAAAFFKVIPQVNAEV
RDTLRARWPDADLFDEPMLQPGSWIGGDRDGNPNVTADVVRQATGSAAFT
ALAHYLAELTALEQELSMSARLVSVTPALTELAGGCAEKARADEPYRRAV
RVIRARLSATSAAILDRTPQQVLDLGLPPYETPAELGADLDTMDESLRGH
GSALLADDRLALLREGVRVFGFHLCGLDMRQNSDAHEEVICELLAWAGVH
PDYRSLPEDERVELLAAELGTRRPLVADDAQLSDLARGELDVVRAAAHAI
KRYGPSAVPNYVISMCRSVSDVLEAAILLKEAGLIDASGPEPYCPVGISP
LFETIDDLHNGATILHAMLELPIYRALVAARGETQEVMLGYSDSNKDGGY
LASSWAVYRAELALVEVARKTGIRLRLFHGRGGTVGRGGGPSYEAILAQP
PGAVNGSLRLTEQGEVIAAKYAEPRVAQRNLESLLAATLESTLLDVEGLG
DAAEPAYAVLDEVAVLAQRAYAELVHDTPGFVDYFMASTPVSEIGSLNIG
SRPTSRKPTESISDLRAIPWVLAWSQSRVMLPGWYGTGSAFEQWIAAGPQ
SEAERVSILHDLYQRWPFFRSVLSNLAQVLAKSDLGLAARYAELVDDEEL
RRRVFGKIVDEHGRTIAMHKLITGQDNLLADNPALARSVFNRFPYLEPLN
HLQVELLRRYRSGDDDELVQRGILLTMNGLASALRNSG
379762733YP_005349130.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MKSITFGKTGLEVSRLAFGTWAFSSDWGQADEDAAITMIQRARDLGINFF
DTAQQYGFGESERILGKALRDDFARARDELVIATKGGLRKTDTGLVRDAS
REYLRSGVESSLRALGVDYIDLYLVHWPDPTTPAAETGEALAELVSEGKI
RHVGVSNYDTTQIEELSATLPVEAVQPPYHLFRRDIESDLLPYCHAHDIG
VMVYGPLAHGLLTGTMKPDTSFADGDWRGKSPIFTGEDYLRNLKVVDDLS
HLAIDLGVTTSQLAIAWTLAQPGVHTAIMGAQHVTYLQDSAGAADVTLTD
ADLAAIEDIMKSATPVGGPAPEMHEKKAS
379762732YP_005349129.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MATLLLHHSAFAAHRTAPGHPERPDRYRAVEAALRQPRFDALVRETAEPA
ELAAARYVHSNRYVDALEAARPEHGYVYLDGGDTMMEPSTWETALRGVGA
TLRAVDRVLAGDVQNAFVACRPPGHHAESERAMGFCLFNNISIGARHAQR
KHGLMRVAIVDFDVHHGNGTQQIFYSDPNVLYASTHQMPLFPGTGAARET
GVGNIFNAPLAPGDGGAELRAAFADRILPALHAFSPELIIVSAGFDAHER
DPLGSLTMTTDDFAWVTRELMKSAEMLCDGRLVAVLEGGYDLQALADSVT
AHVGELVKG
379762731YP_005349128.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAVMADRTVRGGQERSRIKTLTQAALNADKTVEQVEDVLDGLSNTMKELS
SSLSALNATVERLEAGLDHLDGTMASLDDLAKRLIVLVEPVEAIVARIDE
MVKVGETMMSPLAITEHAVRGLLDRLRNRTAE
379762730YP_005349127.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSTSIEIFPDSQALVDAAATRLTDTIGKAVAARGRALVVLTGGGNGIGLL
RSLVDRPIEWSKVHLFWGDERYVPEDDDERNDKQARAALLDHVDIPSSQV
HPMPASDGEFGGDLAAAALAYEQLLAANAAPGQPVPSFDVHLLGMGPEGH
INSLFPDTPAVLETTRMVVSVDDSPKPPPQRITLTLPAIARSREVWLMVS
GAGKADAAAAAIGGAAPVSVPAAGAIGQEITLWLLDEDAASKLPSDPSGV
A
379762729YP_005349126.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAAALMIIDMPDATTTAVNKKLDELRERVGAVAMGRVLTLIIAPDSEEIL
EESLQAANDASHEHPSRIIVTMRGNPYADKPRLDAQLRAGGDTGASEVVV
LRLSGALSGHAASVVTPFLLPDIPVVAWWPDVAPAVPAQDPLGRLAIRRI
TDATNGVDPLAAIKSRLPGYTAGDTDLAWARITYWRALLTSAVDLTPHEP
IESALVSGLATEPALDVLAGWLASRIDGPVRRAVGELKIELTRSSETIVL
SRPQEGRTATLSRTSRPDALLPLARRETGECLAEDLRRLDPDEIYQTALE
GIEKVQYV
379762728YP_005349125.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MVIFGVTGDLARKKVMPAIYDLANRGLLPPSFSLVGFARRDWSTQDFGKV
VYEAVKEHCRTPFREENWERLAEGFRFVPGAFDDDEAFARLAETLDKLDA
ERGTGGNHAFYLAIPPKSFPVVCDQLHKSGLARPQGERWSRVVIEKPFGH
DLESAQALNQSVNAVFPEESVFRIDHYLGKETVRNILALRFANQLFDPIW
NAHYVDHVQITMAEDIGLGGRAGYYDGIGAARDVIQNHLMQLLALTAMEE
PVSFSPRALQAEKIKVLSATQLAEPLDETTSRGQYAAGWQGGEKVLGLLD
EEGFAKDSTTETFAAITLEVDTRRWAGVPFYLRTGKRLGRRVTEIALIFK
RAPHLPFDATMTDELGTNAMVIRVQPDEGVTLRFGSKVPGTAMEVRDVNM
DFSYGSAFAEESPEAYEQLILDVLLGEPSLFPVNEEVELAWQILDPVLDN
WAAGGKPEPYEAGTWGPDSAFEMLHRTGREWRRP
379762727YP_005349124.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MWLDDLSRERLRSGNLQELIDTKSVVGVTTNPSIFQKAFAEGDAYDSQIA
ELAERGADVDATIRTVTTDDVRNACDVLTREWENSDGVDGRVSIEVDPRL
AGDTDKTIAQAVELWKIVDRPNLFIKIPATEAGIPAITAVLAEGISVNVT
LIFSVERYRAVMDAYLAGMEKAREGGHDLSKIHSVASFFVSRVDTEVDKR
LEKIGSEDAKALLGQAGVANARLAYAAYQEVFEGGERYQALKAHGARVQR
PLWASTGVKNPDYSDTLYVTELVAPNTVNTMPEKTIDAVADHGVIKGDTV
TGTAADAQQVFDKLDQIGIDLSDVFVVLEDEGVEKFVDSWTELLEETQKQ
LGSASK
379762726YP_005349123.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTTLEEISTLTQPHLPDDWSELDSAAVDTIRVLAADAVQKVGNGHPGTAM
SLAPLAYTLFQRTMRHDPSDTYWLGRDRFVLSCGHSSLTLYLQLYLGGFG
LELSDIESLRTWGSKTPGHPEFRHTKGVEITTGPLGQGLASAVGMAMAAR
YERGLFDPDAAPGTSPFDHFIYVIASDGDIEEGVTSEASSLAAVQQLGNL
IVFYDHNQISIEDDTNIALCEDTAARYEAYGWHVQRVEGGENVVGIEEAI
AAAQAVTDRPSFIELRTIIGYPAPKLMNTGKAHGAALGDEEVAAVKQILG
FDPDKNFEVRDEVIAHTRKLVDRGKEAHEKWQADFDAWVQREPDRKALLD
RLTAEELPDGWDADIPHWEPGSKELATRAASGKVLSAVGPKLPELWGGSA
DLAGSNNTTMDGVKSFGPPSISTKDYTADWYGRTLHFGVREHAMGAILSG
IVLHGPTRAYGGTFLQFSDYMRPAVRLASLMDIDTIYVWTHDSIGLGEDG
PTHQPIEHLAALRAIPKLSVVRPADANETAHAWRTILARGNGSGPVGLIL
TRQGVPVLEGTSAEGVARGGYILGSDGEEAGQDPDVVLIATGSEVQLAVK
AQKLLADKDIVARVVSMPCVEWFESQPDDYRDSVLPPSVSARVAVEAGVA
QSWHKLVGDTGKIVSIEHYGESADYKTLFREFGFTAEAVAAAAEQVVDN
379762725YP_005349122.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MREGRLLQSRISGTRGRQVRKLRARRKPLTFSSENWEKSAGTDPRAGHRR
HSVYHRL
379762724YP_005349121.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MLAYLALTKPRVIELLLVTAIPAMLLAQRGTVNPLLIVNTLIGGMLAAGG
ANTLNCVADADIDKVMKRTARRPLARAAVPTRNALVLGLVLTVGSFFWLW
WTTNLLSGLLALATIAFYVFVYTLLLKRRTSQNVVWGGAAGCMPVMIGWS
AVTNTIGWPALVMFAIIFFWTPPHTWALAMRYKDDYKAAGVPMLPAVATE
RQVTKQILIYTWLTVLSTLALALATGWLYAAVAVVAGVWFLAMAHQLYAG
VRVGEPVKPLRLFLQSNNYLAVVFCALAIDSAIGLPHLF
379762723YP_005349120.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MHAIEVSETGGPEVLRYVDTPQPSPGPGEVLIEAEAIGVNYIDTYFRSGQ
YPRQLPFILGQETSGTVVDTGEGVEGFTAGDRVVTATASGGYAEYATAPA
SFTASVPDGVPADVAASALLKGLTAHYLLKSVYPVQAGDTVLVHAGAGGV
GLILTQWAHLLGARVITTVSTPEKARMSAKAGADEVLSYPDDADEFGERI
RALTDGAGVAAVYDGVGATTFDASLASLAVRGTLALFGAASGPVPPFDPQ
RLNAAGSVFLTRPSLAHFVRTGQEFSWRAEELFAAIARGDITVEVGGRYP
LADAARAHEDLQGRKTTGSIVLVP
379762722YP_005349119.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MPGHEARSSGRLPSPHRAGGARRRPRRRGAGARAAPAWPARAVAVLGRPG
GRPGRPGDPAGRPGRAGPARRIPGLDPPGAPPAQPARRHRLEFH
379762721YP_005349118.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MLGRTLLRLVDLLPNPSLGVQRLIAAAVILTQGGIAITGAIVRVTASGLG
CPTWPQCFPGSFVPVAHAEVPRIHQAVEFGNRMVTFAVVITAALAVLAVT
RARRRREVLVYAWLMPVSTVVQAVIGGITVRTGLLWWTVAIHLLTSMTMV
WLAVLLYVKIGEPDDGAVRVLIPAPLRALTALSGVNLAAVLITGTLVTAA
GPHAGDRSATRTVPRLKVEVATLVHVHSSLLVAYLALVVGLGFGLLAVRA
TRAVLRRLGVLLVLLCAQAAVGTAQYYTGVPAALVALHVAGAAAATAATA
ALWASMRERAEPEPLAA
379762720YP_005349117.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSESPFPAGTFAPDPRPSAVPKMLAAQFGLELKLLLRNGEQLLLTMFIPI
TLLVGLTLLPLGSFGQHRAATFTPVIMALAVISTAFTGQAIAVAFDRRYG
ALKRLGATPLPVWGIIAGKSLAVVTVVFLQAILLGAIGFALGWRPALLAL
ALGAGVIALGTVVFAALGLLLGGTLRAEIVLAVANLMWFVFAGLGALTVE
TDIIPTGVKWAARLTPSGALTEALSQAMTMSVDWFGVIVLAAWGTLAALS
ALRWFRFT
379762719YP_005349116.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MRLRGVNKHYGSTTAVSDLDLEVHAAEVLALLGPNGAGKTTTVEMCEGFV
RPDAGTIEVLGLDPIADNARLRARIGVMLQGGGGYPAARAGEMLDLVAAY
AADPLDPAWLLDILGLTDAARTTYRRLSGGQQQRLALACALVGRPELVFL
DEPTAGMDAHARLLVWELIDALRRDGVTVVLTTHQLKEAEELADRIVIID
RGATVASGTPTELMRSGAKDQLRFSAPPRLDLSLLTAALPEDYKATEVTP
GEYLVEGPVDPQVLATVTAWCARIDVLATDMRVEQRSLEDVFLDLTGRKL
RP
379762718YP_005349115.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSARHHTLSSSIASLHGDEQAVGTPLNDTELTSLRRIRLFGASGTMLMAI
GALGAGARPVVQDPTFGVRLLNLPSRIQTVSLTMTTTGAVMMALAWLMLG
RFALGNRRMSRGDLDRTLLLWVLPLLIAPPMYSKDVYSYLAQSQISLEGL
DPYRVGPASGLGLSHIFTLSVPTLWRETPAPYGPLFLWMGRGISAITGEN
IVAAVLCHRLVELLGVALIVWATPRLARRCGVAEVSALWLGAANPLLIMH
LVAGVHNEALMLGLMLAGAEFALRGVDTPRLLPRSLKPGPDWEPLGMLVA
GAVLITLSSQVKLPSLLALGFVTMALAYRRGGNLRALLLTGGGMAALSLA
VMAVVGWASGLGFGWIYTLGTANVVRSWMSPPTLLALGTGQVGILLGLGD
HTTAVLGLTRAIGVLIITVMVAWLLLAVFRGRLHPIGGLGVALGICVLLF
PVVQPWYLLWAIIPLACWATRTGFRVAAIVISLVVGIFGPTANGDRFALF
QIVDATLASTVIVVLLIALTYTRLPWRPLPVQARETDRRPAADPSSPAQP
APTPRPTPTHDAYADST
379762717YP_005349114.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MKIRTSPDGVAAPDVGAASSDRHTRRAIVRLLLESGTITAGEIGDRLGLA
AAGVRRHLDALIEAGDAEATAPAAWQQAGRGRPAKRYRLTAGGRAKLDHA
YDDLAAAAMRQLREIGGEEAVQAFARQRIDAILTEVTAADSAADDDVEAA
AERIATALTKAGYVASTTQVGGPIHGVQICQHHCPVSHVAEEFPELCEAE
QQAMAEVLGTHVQRLATIVNGDCACTTHVPLTQSKASSTAPSPRHMTDTT
SIKGASR
379762716YP_005349113.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTLTPEASKTATAPLTQEEAIASLGRYGYGWADSDVAGASAQRGLSEAVV
RDISEKKSEPEWMLQARLKALRIFERKPMPTWGSNLEGIDFENIKYFVRS
TEKQAATWDDLPEDIRNTYDRLGIPEAEKQRLVGGVAAQYESEVVYHQIR
EDLEAQGVIFVDTDTGLREHPEIFQEYFGTVIPAGDNKFSALNTAVWSGG
SFIYVPPGVHVDIPLQAYFRINTENMGQFERTLIIADEGSYVHYVEGCTA
PIYKSDSLHSAVVEIIVKPNARVRYTTIQNWSNNVYNLVTKRARAEAGAT
MEWVDGNIGSKVTMKYPAVWMTGEYAKGEVLSVAFAGEDQHQDTGAKMLH
LAPNTSSNIVSKSVARGGGRASYRGLVQVNKGAHGSRSSVKCDALLVDTI
SRSDTYPYVDIREDDVTMGHEATVSKVSEDQLFYLMSRGLTEDEAMAMVV
RGFVEPIAKELPMEYALELNRLIELQMEGAVG
379762715YP_005349112.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTNLTEAVEGSSLTALNKGELFSSFDVDAFEVPHGRDEIWRFTPLRRLRG
LHDGSAHATGKAQITVTEQPGVRTEVVRRGDERLGQGGVPADRVAAQAFS
SFNSATVVTVARDTEVAKPIEIVVDGPGEGAVAYGHLQIRVEELARAIVV
VDLRGSGTYADNVEIIVSDSAALGVIWIADWADDMVNVSAHHARLGKDSV
LGHVNVTLGGDLVRTSTTVRFTAAGGDAQLLGTYFADDGQHIESRLLVDH
AHPNCRSDVLYKGALQADPESDRPDAHAVWVGDVLIRAEATGTDTFETNR
NLILTDGARADSVPNLEIETGEIVGAGHASATGRFDDEQVFYLRARGIPE
DQARRLIVRGFFAEIIQKIAVPAVRERLTEAIEHELELTEGNKN
379762714YP_005349111.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTTLEIKDLHVSVARTNEADAIGILKGVDLTVSSGETHALMGPNGSGKST
LSYAIAGHPKYEVTSGSITLDGQDVLAMSVDERARAGLFLAMQYPIEVTG
VSMSNFLRSAATAVRGEAPKLRHWVKEVKAAMDDLGIDPAFSERSVNEGF
SGGEKKRHEILQLSLLKPKIAILDETDSGLDVDALRVVSEGVNRYAEAEH
GGVLLITHYTRILRYIQPQFVHVFVGGRIVEAGGPELADQLEEHGYERFV
QAASAKA
379762713YP_005349110.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTRRDAAASALDLAAIRADFPILKRVMRGGNQLAYLDSGATAQRPLQVLD
AEREFLLTSNGGVHRGAHQLMEEATDAYEQGRADIAAFVGADAQELIFTK
NATEALNLVSYVLGDNRFERAVGPGDVIVTTELEHHANLVPWQELARRTG
ATLRWYGISDEGRIDLDSLELDERVKVVAFSHHSNVTGALAPVGELVSRA
KAVGALTVLDSCQSVPHRPVDFHALDVDFAAFSGHKMLGPNGIGVLYGRG
ELLSAMPPFLTGGSMIENVAMDASTYAAPPQRFEAGTPMTSQVVGLAAAA
RYLDGIGMDAVEAHERGLVAAALEGLSGIEGVRIIGPTALENRGSPVSFV
VEGVHAHDVGQVLDDDGVAVRVGHHCALPLHRRFGLAATARASFAVYNTA
EEVERLVAGVRRALDFFVGDRKRGEAGRSGSSPWVGRQ
379762712YP_005349109.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTLRLEQMYQDVILDHYKHPQHRGLREPFGAEVFHVNPVCGDEVTLRVAL
SDDGETVADVSYDGQGCSISQAATSVLTQQVIGQSVGDALKTITAFTEMV
SSRGTIDGDEDVLGDGVAFAGVAKYPARVKCALLGWMACKDALAQAYSRQ
EPALEEVTDERDHHTT
379762711YP_005349108.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSETTTPHDELLADVEEAMHDVVDPELGINVMDLGLVYGLEVEHGEMGPV
ALIDMTLTSAACPLQDVIEDQSRSALVGAGLVDELKINWVWNPPWGPDKI
TDDGREQLRALGFTV
379762710YP_005349107.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MDRIFHALIGDSAGVTGAAIKSSTLFLTAAVLFRFTERRTLAEFAPFDWI
AAVAAGAIVGRAATASDASWLSATTALICLLVTHAVLARLRFIPGVRRFI
DPPLKVLIRDGKIDRRNLRQCGLTAADLEAVLRLHGHPNADCINLAIFEA
KGAISVLRKDDDCRAARDSSRYRSSRP
379762709YP_005349106.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MPAPARIHDVVIVGSGPAGYTAGIYAARAQLDTVLIEGTSRGGALMTTTV
VENYPGFREGTGGPLLVGDMCAQAKRFGAQLHPDDVDDFRLDGDVKTVAA
AGKVWRSRAVILAMGSAPRALGIPGEKRLRGRGVSTTAKGAGLMLRDKDV
AVVGGGDAAMEEALFLTGIARSITIVHHRDTFRASPLTTARVRAHDKVTV
LTNTSVLAVRGRRWVTGLRLRQHVGGAERDLPVSAVIVAVGHGPRSELLV
GIVDLDPHGYVLTREGTSHTSVDGVFAAGDLVDRRYRQAITAAASGCACS
LDAERWLAKSALRQGR
379762708YP_005349105.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MGELRAHRAFPARVGPKGNLIYRLITTTDHKLIGIMYIVACFAFFFVGGL
MALFIRTELAAPGLQFLSNEQYNQLFTMHGTVMLLFYATPIVFGFANLVL
PLQIGAPDVAFPRLNALSFWLFMFGALIALAGFITPGGAADFGWTAYTPL
SNEVHSPGAGGDLWILGLIVGGLGTILGGVNMITTVVCLRAPGMTMFRLP
VFTWNILVTSIMVIVAFPLLTAALFGAAADRHLGARIFDASNGGVLLWQH
LFWFFGHPEVYIIALPFFGIITEVVPVFSRKPLFGYSTMVYATISIGALS
IAVWAHHLYATGAVLLPFFSFTTFLIAVPTGIKFVNWIGTMWRGQLTFET
PMLFAMGFLVTFLLGGLSGVLLASPPIDFHVTDTYFVVAHFHYVLFGTIV
FATYAGVYFWFPKMTGRLLDERFGKLHFWLTLIGFHTTFLVQHWLGSMGM
PRRYSDYLPTDGFQPLNIVSTIGAFILGFSMLPFVWNVFKSWRYGEPVTV
DDPWGHGNSLEWATSSPPPRHNFIELPRIRSERPAFELHYPHMVDRLRAE
SHVRYGSADAR
379762707YP_005349104.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MQDLIRKQPGVVSTRVGYTGGQNAHPTYRNHPGHAEAIEITYDPDRTDYR
TLLEFFFQIHDPTTKNRQGNDVGTSYRSAIFYLDDEQKRIALDTIADVDE
SGLWPGAVVTEVAPAGEFWEAEPEHQDYLERYPSGYTCHYVRPGWKLPHR
SGFRDAKSPSAHANRDG
379762706YP_005349103.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSHEYTKNPAAVDALSPEQYHVTQESGTERPFSGEYWANKEPGIYVDIVS
GEPLFASVDKFESGTGWPSFTQPIDADNVVEKSDRSHFMERTEVRSAHGD
SHLGHVFSDGPRDKGGLRYCINSASLRFIHRDNLEAEGYGRYLSLFSDAA
AERRGGAPVSEQRS
379762705YP_005349102.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MHFDGKKVIVVGGSAGMGRQVALDVVDHGGSAVIIGRSKDRVDDTVAELT
NRRRHAWGIAAELTDRAAVADVQRALSEQHDDATLLVNAAGFFIPRPFLE
YDQQFYDSYMELNYALFFLTQTVVAGMIANGEGGSIVNIGSMWAHQAIGL
TPSSAYSMQKAGLHALTHNLAIELAEHKIRVNAVAPAVVKTPLYEGFIPK
DEIDATLDTFAPLHPLGRVGTPVDVANAVTYLLSEQASWVTGAILNVDGG
IMAGRN
379762704YP_005349101.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MANSPFLSWVYEIMSIDAFGRLNGTVELVTAALLALKPWSPKAAVVGGIV
ASLFFVTTLSFMITTPGVGEASAGGFPILSADGEFLMKDIALIGLALWLL
VDAIDATREQPVVAKSQ
379762703YP_005349100.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MVEHHHVDWDADTRRIETPRLVLRPWELDDALAAYAIYGAPEVARWLCPA
LPPIPDAMVMRHVLAAWIAESDPTGLPLGRWAITDNTAGDVIGGVALLPL
PPGGTDLEIGWQLSPNAWGYGYGAEAGHAVAHQAFENPGISEVFAVVRPE
NRRGVATARRVGMEWVGETDKYYNLTLQVYRLTKADLDLPEPACAH
379762702YP_005349099.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MQSLDVLAGRVRTADIVDAMGRRHRHRCHLLDLVSPTPGRRLFGPAVTIS
YFPACRVALPPERYNFKRLFYDAIESGADGRVLVLASNGCSDASLGGGTK
LSRVHNHRLAGILADGKLRDFAELAHYDLAVYCRGETTRSGGDIVTPYEA
NRPVVIAGVAVRPGDYVFADASGAAVIPAGDVRAVVRAAKKVALEDAETI
VAIRAETPNTLGTNEN
379762701YP_005349098.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MMTEPTHVDGNAAAGAFAEVLGFEVTTATLTCGKCCRNTAFAESHVYHRG
PGIVVRCPGCDDVLARLVQTSTDTWLDFRGAQSWRIATPDR
379762700YP_005349097.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MDVEVKPALRWRVARVVNSHPETDSARTIRLTVPGWGGHLAGQHIDLKLT
AEDGYSAQRSYSLSRPADGEHIELTVQRISDGEVSPFLLGLAAGDEIELR
GPIGGWFVWRPDEGGQVLLVGGGSGIVPLMAMLRQRLVVGSAHFRLIYSV
RSPTDVYYAQELARLERECDWLEVTRVYTRSAAPHTTRPSGRVRAADFAP
TRWAPRNELRIYVCGPTGFVESVTAMLIEQGHQPSAIRTERFGPSN
379762699YP_005349096.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTVVNKGFRGRRAESVVELPPGQHLTADFPVLQAGPTPRIDLDRWRFTIR
DEHGTERVWTWAQLRQLPSERPTVDIHCVTTWSKLNTMWEGVAVDTLFEG
IDTAAEFALVGCYGGYTTNLPLRDLLGGRAWIVYAYDGAPLSPVHGGPAR
LLVPHLYFWKSAKWVRSIELRDSDIPGFWEGLGYHNYGDPWREQRYAGD
379762698YP_005349095.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTQDPTLTALSAAGVSVWLDDLSRDRLVSGNLQRLIDTRSVVGVTTNPSI
FQRAISHGHAYDRQITELAEGGADAESAIRTVITDDVRQACDVLRPQWEA
SGGVDGRVSIEVDPRAAHDADKTVSQAVELWKIVDRPNLFIKIPATSAGM
SAITATVAEGISVNVTLIFSVERHRAVMNAYLAGLEAAQRAGKDLTQIHS
VASLFVSRIDTEIDQRLETIGTEAAMELRGRAGIATARLAYAAYQEVFQA
GHRYAALGYDGAHVQRPLWASTGVKNPAYPDTMYITELVAPHTVSTIPEK
TLEALADHGVISGDSITGTAADARAVLDNISAAGVELKDVVRTLEDDGVA
KFVASWRQLLGSYPAPPNLLPKGHQ
379762697YP_005349094.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTTRDRRMLAGAYWPVVAFAAALLTARTARSRRHRQEAADT
379762696YP_005349093.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MILGGGPAGYEAALVAAARGPEVARVSIVDADGIGGAAVLCDCVPSKTFI
ASTGLRTELRRAPLSLDIGIADAEISLPEIHQRVKTLAAAQSADITADLL
SMGVELIAGRGELIDATPGLARHCVKVTKPDGTAMVRDADVVLVATGASP
RILPSAQPDDERIVTWRQLYDLTALPEHLIVVGSGVTGAEFANAYAELGA
AVTVVASRDRVLPYEDADAAWVLEESFAERGVKLVKNARAQSVVRTEGGV
VVTMTDGRTVEGSHALMTIGSTPNTDGLGLERVGIELGRGNHLTVDRVSR
TSVPGIYAAGDCTGLLPLASVAAMQGRIAMYHALGEAVSPIRLRTVAATV
FTRPEIAAVGVPQTAIDDGSVPARTIMLPLETNARAKMSELRHGFVKLFC
QQATGVVIGGVVVSPIASELILPIAVAVQNRITVDGLAQTLAIYPSLSGS
ITEAARRLIAHDDLD
379762695YP_005349092.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]METALMGISEFDDVGAHLLEPEESVDSEQTGIDLDEGYSPPESPRELRAW
GLTAREARTHESLARRLARELPDVTDQWDGDGIGDSADSDGEPIDDQVGG
MRAGRLVAFDVDPTDPATDYLAYDVGIDGGAASAEEAAIHIIGDEDTNAG
GGWRF
379762694YP_005349091.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MAQPRPTVEPSSISDEDMAWLLVDAVNSCLTGYERTVVFVELGCGEGYLV
IKRILTSLLATRTALPVAIHSKLTGWLNGYAGSPEEPQLRRMLAIIRPRQ
PEAV
379762693YP_005349090.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSGSAGRSDNGVGQAGARAVLLATKLHVPAMGAQLVHRAALLDALSAGRT
RKLTLLSAPAGWGKTTLLAQWAMGGDGRFAWLSLDSSDNDPVWFWMYVVA
ALQKVSPGLGIRAVELLAMGADPVQVVLPTLLNDLDTIPSPVVLILDDYH
LVVGRAMHEQLAFFISRMPANLHLVLATRADPMLPLARLRASGELAEVRT
DDLRFGPTEADHLLNDVLGLGLAPTDIQLLHRRTEGWAAGLYLAALSLAG
RADTATFIKTFAGDNRHIVDYLMAEVLDGQPPNLRSFLLRTSVLGRLSGA
LCDAVLQTSGSAAVLQKIERENLFVVPLDTSRHWYRYHQLFGELLRTELR
RTEPDLVADLHRRAATWFEAEGLIDEALRHLLAAGDTARSADLIAADWVD
EFNGGGLSTISGYLDLLPEETVLEDPRLSVARAWIALSVGQLDDAAEWIE
AVEARSADDTADGRAISAQAAVLRAVHSFKTADVAAALEGARRATTLDFG
EAPLGRPSAYCIYGAALYFSGDVPEAQAAFRRAVQLAEKVGDRRARSSSL
GYLALISAERGELADAEHQIREASGSPRDLADAEHLVDVMVSLATAELLA
KSGDALAAVAAADMAVMSARQSGAILEVAKAQLVRAEISERLGDHQTAKA
SLEEAGTLVRGCADAGIAPTLLASAERNAGVAVSPRNERSVVAEELTPKE
VEVLRLLATRLSRREIGERLYVSLNTVKTHQRAIYRKLGVEHRGAAVSRA
RELGLF
379762692YP_005349089.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MDRRDPTRARRRRANAQRVEKTMMSTLLGMLMMMPVVFGVGGYVLVSRRP
379762691YP_005349088.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MIGALVTALARGRGGVLVIEGPPGIGKSRLLTEVLALADHSGVRTLFGEA
FEYQQTVPFFSLFMATLNADPPVGDAEALRRLGGSADLRYWVVHDLADAI
HAAAAQTPLVIVLEDIHWADNGTLLALRSLATARPDAAVLWILTARTGAG
GPAVQETLSVLHRAHATFLRLGAIAPDAVADMVCDAVRAKADVSLLNLAA
KAHGNPFLVSELVRGLGEEDRLSVTGGHAVATGHELPRRLGASMQQRLDL
LSEGASEVVRVAAVLPDRFSAGLLAAMLERSPTSLLSALEEAVRADLFIE
DGEQLRFRHDLLREATRQSLPQSLRRAMERQSASVMLGMGAAPAEVATQL
ARSAEPGDREAIDALRHAAQSVGRGDASAAADLSKRALGLLPADDAEHGS
LVAETVGWLNRAGRHGEAEELAVAALSGAASPEVEAEIRLRLPVHTKHTD
QRRVEENRRALELSGLSEITRARHLAWLAYNLVFDEGGQRREAADEAAAA
AAATGDLEATIMAGVTHALLDAGEGYTARALRRFEELCPLAHTNETALAH
AYAGMYNANLLAVVGRLDDATAQVAQGIGQAGREGNAMALALWAVFSGLV
HLAAGRLSAARDATECLPPPQRTGATEHDVLRTVILAEVAAHTDDRNLLQ
QMVNDARDAHSTGSAGIRRGSAYVLARAAWQRDDIHDAMRWLGDVILLAT
PFFPHALARLILGARVASAAGDAGLRARVLQATEVLERDRPAVPLFAAVA
GYARGILEHDAQALVAAAELLHASPRPLLYASAAEDAGGELARAQRNAEA
LEQLNAAFDTYIECGATADARRVGRALRGLGVERRIVTHPRAKTGLDSLT
DSELTVVHLIADGATNRAVAQQLHLSPHTVKTHLHNAFAKLGITSRAQLT
QLMRRPD
379762690YP_005349087.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSAANASGQLRTPPIRGRASELRAIDALIAALAQGRGGVLVIEGPPGIGK
SRLLTEVLARAEKAAVRALFGEAFEYQQTVPFFPLFMATLRADPPVGDAE
ALRRLGTSADLSYWVVRDLQAAIHATASRTPLAILLEDIHWADNATLLAL
RSLAATRPDAPVLWILTARTGAGGPAVRETLTALEREDATFLRLTAMTPS
AVADIVQDAVRANADASLLNLADKAHGNPFLLTELLRGLDEEGRLDVSDG
RAVATGDSLPRRLSHTMQQRLDQLSPAASQVVRVAAVLPDRFSARLLAAM
LERRPAALVSAVEEAVRADLLIEDGDQMRFRHDLLREATRQSLPRSLRRA
MERQSASVMLDMGAAPQEVATQLARSAEVGDQAAIAALREAAQSLAYSDP
GAASDLSKRALELQPAQDSGRASLVTETIVLLNRATRYEEAERLADTTLS
AALAPEEEAKILLQLRTPITDTTTRHIEDNRRALQLPHLSDVTRARHQAW
LAYNMAMYGQQGQDSAAANEAAAAAASTGDLESSILSGVALACLDCADGY
AGRALYRVEQLQALTPAGDMTAHNLAACHLANLLAVVGRLNDAAALVDKC
TEKSKQERDGMALHIWALTAGVVQAAAGRLSAARAAIEWLPTPERTGSTF
VTAMRMFTLAEVAARTDDRTLLLETMSEARDAYSSGTPAVRRGAAAALGL
AAWQRDDVHEAVRWLGGDIPLLVTPVLPIVFDQLTLTARVASAAGDAGLR
ARLLAVVDVLERERPGVRFFSTVAEHIRGILERDADALVAVASALHSSSR
PLLYAGAAEDAGGELSRAQRNAEALDELNAAFDTYIACEAIADARRVGRA
LRGLGVERRIVSPRAKSGWGSLTDSELTVVNLIAQGATNRDVATELHLSP
HTVKTHVHNAFAKLGVSSRAQLAQLMRGAD
379762689YP_005349086.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MGSQARRTAELEQAKETFLPVESLDVIRSVDEDIVRPGVLDSWRRSRALQ
VHPDRVELPFVREPNRGSRLVRAAAPVLERVTFDLAAQDVSVVLTSADGV
VVDRTAAAVPILDALDTVSLAPGYSLAEEVAGTNGIGTALETGQPTFIGG
SEHYVAMFTGFACAGSPIRDPVTGRVIGAVNLSCLADRSDPLLLALATSA
SRHIEERLRLVAHESETALLEAYLQQARRCSAGVLAIGGDVVLMNPYLRR
TLDGDEQTALLEHASDLLTSTLSGTALVVLPRGHIAKITAADRSTTRAGR
LNVVFRVDLSGETGSQSRRTGRLAPTYIPGLVGRNSAWLHCCQQVRQCCR
DREWVMIEGEKGSGRAKLAQAVGQHVKPDRTIRVMRSESFGSAASFVAEL
ATLAADDDFAVVIADVDDIDEDILEAIVPMLAARAGRGWIAATTSSAAPA
APIKQLLPLFTHTVTVPALRHRIDDLEELVPLLLREITRGADVTLAPEAM
RQLSRLPWPGNVSQLRRVLTDTVARQRSGIIGVDKLPPECRSVTRRKLTR
MEALERDAIVRSLQDSGGNKQEAARALGMSRATIYRKINDYGIA
379762688YP_005349085.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MEPRQFQRPPTEYGSGATRTPWLLHRLRGAAASARHWARRNGEAGTGAIP
AIEDQLHALQPICSAQGLATGTTCGAPAVAVAEIHAIDGCDQMGLSPDGD
LVETLCQHCLATVRWAMATYVGDKREMASRCGTRPVCATCGRSTGYLRSV
FAVRPIGSEGVS
379762687YP_005349084.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MLPADGSHRAVLYLHGGAFLTCGAHSHGRLVSMLSGFADSPVLVPNYRKI
PKHAIGEAIEDCYDGYRWLRRQGYQPDQIVLAGDSAGGYLALALAQRLLE
CGEQPAAMAAMSPLLQLATQPKTTHPNVGSDAMFPPRAFDAFHALITRAA
GRTAAYGHSDALYEPLDHIRPGLPPMLIHVSGCEVLLHDAQLAAQRLAAA
GVPVEVQVWPGQIHVFQLAAPMIPEAIRSLRQIGRYIREATG
379762686YP_005349083.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MDFGALPPEINSGRMYSGPGCGSMLAASAAWDGLAADLYSAAGSYGSVIS
DLTSAAWLGPGSVAMAAAAAPYVSWLTTTAGLCEQAAAGARVAAAAYEAA
FAMTVPPPVVAANRAQLMLLIATNIFGQNTPAIAATEAEYGEMWAQDAGA
MYGYAGASAAASALPPFTSPLPTTDPAGVAEQGAAAAHAGTTTAGTATQA
ILSAGSQLLSAVPNALQGLALPLPAAAGLPSFLELLSLLSPVNLSVSSAA
TAITSTGTAGSYAGLGYAAHYDPDGASKMDAVLERLGALSGGPGASAAAS
LGSAERAGSGAAPVLSAGVGRASSIGALSVPSGWAAATPTIRAVAVTWPN
SLPGPIPPTVLATNPENMLNEMALASMAMRGIRGAPPQSRSTITITVTPR
PPDDGGARITM
379762685YP_005349082.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MRLEAGATETVFTGEIRDQSQLYGLLDRVRDLGLELVSVQPQPAADPTTT
THIRKDL
379762684YP_005349081.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MRAITVSDRDAGVAGLSLTDLPYPQAADNDVVVRVHAAGFTPGELDWPHT
WIDRSGHDRTPSVPGHELSGVVVELGYGTTLLTVGQRVFGLADWARNGSL
AEYAAVEARNLAPLPMDIDHTVAAALPISGLAAWQGLFDHGRLAAGQTVL
IHGAAGGVGSIAVQLAREVGARVIGTGRTADRDRAEELGVHAFLDLETEK
LEDAGEVDVVFDVIGGEVLARSAALVRAGGTLVTIAEPPKTQPHDGRAVF
FLVEADRAQLADLAARVRDGRLKPVVGAVLPLADAATAFAPGKRIPGKTI
LRVVED
379762683YP_005349080.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MALKPLAALTVAVMLAPAAHAEPAPENPEQKPVVRPVFNQPTNVPGKSLE
AVSVSYPPGAKSEAHHHAKSAFIVAYVISGAIRSQVEGEPARVYHVGETW
SEAPGAHHTISENASATEPAELLAVFLLDTGDGPLTTDDNASHAHA
379762682YP_005349079.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTVIVWAATATEASLAILLLAGWWPKLVGAATCLVLTVFGTAMAVSLGIE
SPLSYSVFSAASAAAAYAILGATSPAPAAGASCSPETSNRRNPARCNG
379762681YP_005349078.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSLMKASKDFDVIVIGGGVAGVAAVRKLASVGLSVALIDDRLVGGECHYW
GCNPSKTLLRPIEVFNLARSVPGVREAISDRKIDVAAVFAKRDAIIEHLS
DDDRRASLRQAGVAVFHGFGRLSGERTVRVAYAPGDTTEVVLTAHHAVVV
ATGTRPNVPEVPGLAQARPWTNRDLTTMAQVPPRALVVGGGPVGVEFATI
LTGLGSAVTLLVRGNTLLPNCEPEARELVAQSLRSQGVTIHFETELSSAA
RPVAGGPVAATFHRQTVEVDEIVLAAGRRTNTDNIGLETLGLPRGETVAV
NDHLQAVGVTGDWLYALGDTTGRARLSHISTYHGRVVADIIAARAAGREL
SENELTAHDAGNLAQVIHTDPQVAWAGRTESQARAEGFAVRTRTARYPGA
VSFLALYRDGFQGWAKLVINDETDTLLGATFVGPQFSELIQAATLAIVAK
VPVSFLRHAVAPHPTVNQVWDPLLAEESELARLLKNETQKAQKSA
379762680YP_005349077.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTMLVAGIRTLGGNVETFDVDDPRPLAADEVLIDVRGAGVGNWDNIIRYG
GWDVGTGPPLALGVEAAGVIKAVGNSPGGFGVGDEVLCHPVPLRDHGAWA
PLLIAPVGSLARKPPEIPWETAAIFPVPALTAEQVVGEALALRGGETLLV
HGAGGITGGLIVQLAALRGVDVLATAGPRSAVRVREHGAREVIDYRDPLW
PQHARALARGSVDAVANAAPGGAGAAMTALADGGRLATITPDPPAPTRGI
GVTSVYVRSDGAQLGRLAALLASRRLSMPTPRSCGLDQAAAALAHVVAGH
EASGVAITTDSSQSQPKSTHRQGVSR
379762679YP_005349076.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTTITPIRTGVADHIGHYADAVAVSGGGTQIFVSGTPGVREDGTLPEDFT
DEARQCWANVEKALGKAGATLTDIVYMRQWVTGRDNASAYLAVSKEIIRH
RPAAMFSIIDGLVWPNIRVEVEVIAILPA
379762678YP_005349075.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSDYARVELSTDELLTTTRSVRKRLDLTKPVPIGLIRECLEIAVQAPTSA
NVQNWSFIVVTDAEQRRAIAEVYRRTWDSIATSPYAVADRFKDDPARNRE
QRKVSDSAAYLAEHLGEVPVLMIPCVEVIDGDGTLTGENANRYWSSVMPA
AWSYMLAARSRGLGTTWTGVTIMADDEMRAILGLPDNVYHATTIPTAYYT
GTTFRRAKRIPLDDVLHFDRW
379762677YP_005349074.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MTLRDAAPTRRAMVVAVTVSMVAFFDSTVINLALPATEHDLGGGLALQQW
VIDGYLLAMAAAILPGGSVSDLFGRVPVMRFGLLTFGAGSVLAAAATSPA
MLIAARLVQGLGAAFLVPGSLALINTVFDKAQRSAAIGVWTGWTGTAFAA
GPLLGGMCVDFLGWRWIFVLSAIPMAVGYALTFWLCPVSGRVEGARVDTA
GVVLSAVGLGATVYALIESQRDGWTDPAVLAPLVVGVAALAGFVRWQHRS
KCPMLPLSLFTFRNFAAANLVTAFVYGALTLGSLAVALYTQEIGRYSATA
AGLATLPIPALSFVFARHVGRIAARVGPRAFLIGGPAVAGLGLLLIRPKP
SGFHAISDLIPGMTVLGIGLVATITPLTSVMLASVPTDHSGLASAINNAV
SRLAALMSIGSMGLITVGAASAAGFARVLEVSAALFALGALCAALLITNP
PGGCRPVPCDIAALCRDRPGVQPAVASSPSAAMEET
379762676YP_005349073.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MMTMLTGFWVTQIVRAAATFNVADHLAAGTDTAEAIAAEESIDPAATRRL
IRACASLGLVTSDDGVRLTGTPLLSTLLRDDPNSLRGMVLAQAAPGHWLT
WGRFPDAVRSGTGQMKAAHGTPGTIFDYLAAHPDEASHFTEAMSNLSAAA
AIEIAKVVDTLGVRYALDVGGANGEVLRAMMRANPHLRGGVFDLPHIVPD
AATAARKDGLHERLTAVGGDFFETVPPSDLYVLKYILHDWDDQNCTRILR
NCRAALQENGRLVVIDYLVGEFGLPGLPAMMDMNMLVMNGGKERDIAEFD
ALFASAGFRRTTVGQAGQFAVIETVGI
379762675YP_005349072.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MALVIGGVAVIRLNGVFPGPGLPKPDPRDATPPYAAKTAIYEILGPPGTT
GVVNWMDAESLPQKANFTTLPWSKTIVAEMPGIFAYVVAQGDSPFIGCRI
TVDGKLVDQQQATNRNAQVSCLDKSA
379762674YP_005349071.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MSSDSSDADDTAEIPVVQRTEVERKPRIARTIRVLALPIIVVWLLIAIGV
NVFVPQLEKVAEEVSVPLSPSDAPSVTGMKHIGEKFKEYDSDNLVLVTLV
GDKPLGEDAHRFYDDLVKKLQQDHEHVEHALNFWGQRFTSSGVESYDHKA
AYVQVNLRGDQGGAVGDKSVAAVRKIVADSKPPAGVKAYVAGQGALTADT
IVVGDASLAKMTIITIIIIAIMLMFVYRSIGTVLLTMVILFVGLATGRGV
VALLGETGIMGLSTFAVNLLTALAIAAGTDYAIFMVGRYQEGRERGLDRE
AAYYDTFAGVTKVVLGSGLTIVGALACLKFTRLPYFSSLAFPCAVGLLVV
VAAGVTLTPALIAFASGFGLFDPKREFNYTRWRRLATAIVRWPAPILATS
VILAIVGAIGLMGFTPRYNDLYYLPPSASSVQAYTAADQHFTQARLNPDL
LMIESDHDLRNPRDMLVLDKIAGAIFRVPGIERVQSITRPLGPPIQDGSI
PFQLSVQSAPIRSNLNYLKDRVADIKKITGFLDTQIALLERQYAVTQKLA
NAADDSSKTTGETAAITDEIRDHIADFDDFWRPIRSYFYWEKHCYDIPIC
WSLRSLFDALDGFDLLAEKFHALTSDLTNTAKATRELLAIIPENIAVSKS
IRDTTLTIYSSFDSLIDQFDRLTDTNAVMGKSFNDAQVESLFYLPPEIFQ
NSDFQLGLSLMVSPDGKAARFIITHSVDPATSKGIASVDQERQAAKEALK
LTSLENADIYLGGTAATFYDIANGAKYDLMIAGVASIVLIFIIMVIVTRA
LVAAGVIVGTIVMSLGAAFGFSTLIWQHLGDFQLHWVATEFALIVLLAVG
SDYNLMLVSRIEEEIGAGLKTGLIRGMGVTGPVVTAAGVVFAVTMGTMIT
SDLRAIGQFGTTIGIGLLFDTFVVRSLITPSIMTVMGRWFWWPKRVRVRP
ASQMLRSVGPRPLVRALLYHPQRGVPSDAQT
379762673YP_005349070.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MVKTKTCVHCGHTFDPDARRRDLSDPEWLPAASVYCSHECSDRYHCEIVH
CCSTHVKEKAQREAAMAAHRET
379762672YP_005349069.1 unnamed protein product [Mycobacterium intracellulare MOTT-64]MHFDGKKVIVVGGSAGMGRQVATDVVDHGGSAVIVGRSKARVDDTVADLT
GRRGHAWGIAAELTDRAAIADVRRALAEQHSDATLLVNAAGFFIPRPFLD
YDAQFYDSYMELNYALFFLTQAVVAGMVARGEGGAIVNIGSMWAHQAIGR
TPSAGHSMQKAGLHALTH