Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID120405136
StrainM_vanbaalenii_PYR-1
Protein IDYP_954965.1
Description taurine catabolism dioxygenase TauD/TfdA [Mycobacterium vanbaalenii PY
Sequence MTLLTINKLTSSVGAEVTGLDPGRLAGDDALGTAVLDALEDNGVLVFPGL
HLEPEVQVEFCRRLGEIDFSSDGHHRVAGIYPVTLDKSKNSSAAYLRATF
DWHIDGCTPTGDDYPQMATVLSAKQVAESGGETEFASSYAAYDALTDAEK
QRFASLRVVHSLEASQRRVNPDPSPEELARWRARPTHEHPLVWTHRTGRK
SLVLGASADYIVGMDPEEGRALLSELLDRATTADKVYSHHWAVGDTVIWD
NRGVLHRAARYDENSPREMLRTTVLGDEPIQ
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo