Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID120405141
StrainM_vanbaalenii_PYR-1
Protein IDYP_954970.1
Description MarR family transcriptional regulator [Mycobacterium vanbaalenii PYR-1
Sequence MDARDVTGIELTDNILWLLKQAFYFSLTTVNEAISEHGVSTAQIGVLRQL
ANEPGLSGAELARRLLISPQGVQLALTALERQGLVERKQNPAHGRILQAF
LTDKGRKVAAAVLHDAIAAHDRVFGVLSKAEQQTLRELLGRVVEQGTGHE
LYTDHVDP
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo