Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID120405167
StrainM_vanbaalenii_PYR-1
Protein IDYP_954996.1
Description Rieske (2Fe-2S) domain-containing protein [Mycobacterium vanbaalenii P
Sequence MAHFPKPAAGSWTENWPELGTAPVDYTDSIDPEQWKLEQQAIFRKLWLHV
GRVERLPKAGSYFTREMPSVGAGTSIIVNKDKDGQVRAFYNLCRHRGNKL
VWNDYPGEEVSGSCRQFTCKYHAWRYALDGELTFIQQEDEFFDVDKADYP
LKPVRCEVWEGFIFVNFDDDAEPLVDYLGDFAKGLEGYPFHEMTEVYSYR
AEINSNWKLFIDAFVEFYHAPILHMKQATAEEAAKLAKVGFEALHYDIKD
QHSMISSWGGMSPPKDLNMVKPIERILHSGLFGPWDRPDIKGILPDELPP
AVNPARQPTWGQDSFEFFPNFTLLLWAPGWYLTYNYWPTAVDKHIFECNL
YFVPPKNTRQRLSQELAAVTFKEYALQDANTLEATQTQIGTRAVTEFPLC
DQEILLRHLHHTAHKYVDKYKLEQAAKAATNGSASKTEKEGANV
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo