Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID120405260
StrainM_vanbaalenii_PYR-1
Protein IDYP_955089.1
Description glyoxalase/bleomycin resistance protein/dioxygenase [Mycobacterium van
Sequence MTAEQTDARPVLATALVTAIDHVGIAVPDLDAAIKWYHDHLGMIVLHEEV
NEEQGVREAMLTVRGAAVGSAQIQLMSPLDETSTIAKFIDKRGPGLQQLA
YRTSDIDALSERLREQGVRLLYDTPRRGTADSRINFVHPKDAGGVLIELV
EPAKDSGEGSH
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo