Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID120405327
StrainM_vanbaalenii_PYR-1
Protein IDYP_955156.1
Description hypothetical protein Mvan_4374 [Mycobacterium vanbaalenii PYR-1]
Sequence MSTQGLSREELLAESALALPDKEVVSILDLNADVDVAIDAASPIDLAAAA
NLNVAAPIDAAAGANVLTYGSGSQATVDQGTSIEQMLDADAYATSTQVSG
IDQGGMDTDGDDTTGGTVTDGTVTDGTDVTDGTDGTGTTVDTSPGALLDG
NLLNVNVNVDLDSDLAAPISGAVAANANVAAPINAGVSANIGSIDSDAIS
VAEQDAIIKQTVIGEAVAEADQESTISQGDGDAGTTTDSGTSGDSGSTDG
GSTAG
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo