Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID120405329
StrainM_vanbaalenii_PYR-1
Protein IDYP_955158.1
Description lytic transglycosylase catalytic subunit [Mycobacterium vanbaalenii PY
Sequence MSCNRVGGLAALIACVLVGCSSPTTPPTGDPAAATTGAGVLTSARPTPAP
APAAPATAQPALESDPARIVDDLTADEQTLRAPGAPEAALVAAARRQQKA
YRVLARHPEWDAVVRPRVPRPLLDVYDRNIDARRQLGAMSRGKVALPAWR
VERPPAADQLLGFYRKAEAASGVSWNYLAAINFVETAFGRITGVSTAGAQ
GPMQFMPSTFAAYGAGTDIHSPHDSIMAAGRFLAAHGFARDRDQAIYRYN
NSRQYVRAINQYATLIAADPAAFSGYYRWDVYYNSTAGDVILPVGYASTT
QIPVEEYLKTHPQ
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo