Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID120405339
StrainM_vanbaalenii_PYR-1
Protein IDYP_955168.1
Description two component LuxR family transcriptional regulator [Mycobacterium van
Sequence MIAEDSALLRAGIERILTDAGHQVVAGVPDATNLLRLVNDERPDLAILDV
RMPPTFTDEGIRAAALLRSQNPESPVLVLSHYVEERYAADLIASDTRGFG
YLLKDRVADVPAFLDAVEVVGSGGTVLDPEVVSQILVRSRRRNALDALTP
REHEVLQLMAEGKTNSAIAAALHMSVGSAEKHIASIFTKLDLAPDENRRV
LAVLRYLDS
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo