Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID120405420
StrainM_vanbaalenii_PYR-1
Protein IDYP_955249.1
Description FAD-binding 9- siderophore-interacting domain-containing protein [Myco
Sequence MTDTKMSRGFAGAVLKLLRAGDYELTVTGRTEVSPHYLRLSFQAGGLLRD
RALHPTMWIRMWFTDGEKLHQRGYTLVNPDPVGDTVDVEFALHDGVASRW
AQQARPGDTIEVTVLGSNFALPEPRPAGYVIVGDTASLPAVNSLLDAIGD
APARIFLEAAHDDDKQLLVRRTADVTWVDRKNAGEALVSAVASAAFDAAD
HFGWVACDNRTTRAVAKLLREDYKIPRKSVKAQAYWVA
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo