Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID120405455
StrainM_vanbaalenii_PYR-1
Protein IDYP_955284.1
Description glucose-1-phosphate adenylyltransferase [Mycobacterium vanbaalenii PYR
Sequence MREAPHVLGIVLAGGEGKRLYPLTADRAKPAVPFGGGYRLIDFVLSNLVN
ARFLRICVLTQYKSHSLDRHISQNWRLSGLAGEYITPVPAQQRLGPRWYT
GSADAIYQSMNLIYDEDPDYIVIFGADHVYRMDPEQMVQQHIESGAGATV
AGIRVPRAEASAFGCIDSDDSGRIRGFIEKPADPPGTPDDPEQTFVSMGN
YIFTTKVLIDAIRADAEDDDSDHDMGGDIIPRLVADGMAAVYDFNDNEVP
GATERDHGYWRDVGTLDAFYDAHMDLVSVHPVFNLYNKRWPIRGGAENLA
PAKFVNGGSAQESVVGAGSIISAASVRNSVLSSNVVIDDGAIVEGSVIMP
GARIGRGAVVRHAILDKNVVVGPGEMVGVDLDKDRERFSISAGGVVAVGK
GVWI
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo