Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID120405460
StrainM_vanbaalenii_PYR-1
Protein IDYP_955289.1
Description putative glucosyl-3-phosphoglycerate synthase [Mycobacterium vanbaalen
Sequence MTVLSDRVDELATYGVAEHRWLTDRSWCRPNWTVAELEAAKKGRTVSVVL
PALNEEETVAGVVETITPLLGGLVDELIVLDSGSTDDTEIRAVAAGARVI
SREVALPEVPPQPGKGEVLWRSLAATTGDIVAFVDSDLLDPDPMFVPKLL
GPLLTAEDVHLVKGFYRRPLKVSGKEDANGGGRVTELVARPLLASLRPEL
MCLYQPLGGEYAGTRELLTSVPFAPGYGVEIGLLVDTYDRLGLDAIAQVN
LGVRTHRNRPLTELASMSRQVIATLLSRCGIPDSGVGLTQFFADGLDYTP
RTSSVSLTDRPPMITLRPR
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo