Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID120405485
StrainM_vanbaalenii_PYR-1
Protein IDYP_955314.1
Description FO synthase [Mycobacterium vanbaalenii PYR-1]
Sequence MALNTQRGADLPSPVVPPRSGAPNPAALRRVLRRARDGVALNVDEAAIAL
TARGDDLVDLCASAARVRDAGLEAAGRRGDTGRLPVSYSRKVFIPVTHLC
RDTCHYCTFVTVPGRLRAEGKGMFMEPDEILDVARGGAEMGCKEALFTLG
DRPEARWPEARRWLDERGYDSTLDYVRAMAIRVLEETGLLPHLNPGVMSW
SELSRLKPVAPSMGMMLETTSRRLFETKGLAHYGSPDKDPAVRLRTLDDA
GRLSIPFTTGLLVGIGETLTERAETVHAIRRSHKEFGHVQEVIVQNFRAK
DHTAMASVPDAGLDDFLATIAVTRLVMGPKVRIQAPPNLVSRQECLALIA
AGVDDWGGVSPLTPDHVNPERPWPALDELAEVTLEAGYDLVQRLTAQPQY
VQAGAAWIDPRVHGHVAALADPDTGYARDVNPVGRPWQEPDEATESLGRV
DLHTAIDTEGRLTTTRSDLGDAFGDWESIRAKVEELAARAPERIDTDVLA
ALRSAERDPAGCSDDEYLALATADGPALDAVTALADSLRRDTVGDDVTFV
VNRNINFTNICYTGCRFCAFAQRKGDADAYSLSTAEVADRAWEAHVAGAT
EVCMQGGIDPELPVTGYADLVRAVKARVPSMHVHAFSPMEIANGVTRSGT
SIREWLTALREAGLDTIPGTAAEILDDEVRWVLTKGKLPTSMWIEVVTTA
HEVGLRSSSTMMYGHVDTPRHWVGHLNVLRGIQDRTGGFTEFVPLPFVHQ
SSPLYLAGGSRPGPTHRDNRAVHALARIMLHGRISHIQTSWVKLGTERTQ
VMLRGGANDLGGTLMEETISRMAGSENGSAKTVAELVAIAEGIGRPARQR
TTDYTPLAA
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo