Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID120405519
StrainM_vanbaalenii_PYR-1
Protein IDYP_955348.1
Description pyridoxamine 5'-phosphate oxidase-like protein [Mycobacterium vanbaale
Sequence MTRDVFDDKLLALIGGNSLGVLATLKRDGRPQLSNVSYHFDARTLTISVS
IAEPRAKTRNLRRDPRAAIHVSSDDGWAYAVAEGDAVLSAPAADPGDDTV
TGLIELYRNISGEHPDWDDYRRAMVDERRVLMRLPISHVYGMPPGKR
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo