Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID120405523
StrainM_vanbaalenii_PYR-1
Protein IDYP_955352.1
Description type 12 methyltransferase [Mycobacterium vanbaalenii PYR-1]
Sequence MNDSVDNPFFARLWTLMSSREPESLRRLRRENLAGLTGRVLEVGAGTGTN
FEFYPATVTEVVAVEPEHRLATLAQDAAARAAVPITVTTDTVEEFTDAEP
FDAVVCSLVLCSVDKPEDVVAELLSMLKPGGQLRYLEHIAAEGGRARLQR
FADATVWPRLLGNCHTHRHTEETIVGAGFRVRDARREWTFPRWVPLPVAE
FAIGVAVKP
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo