Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID120405583
StrainM_vanbaalenii_PYR-1
Protein IDYP_955412.1
Description 4-hydroxy-3-methylbut-2-enyl diphosphate reductase [Mycobacterium vanb
Sequence MPPTVNMGIPGASRTALGSVAGDVTGKRVLLAEPRGYCAGVDRAVETVER
ALEKHGAPIYVRHEIVHNRYVVDTLAKAGAIFVEQTDEVPEGAIVVFSAH
GVAPTVHEEAAARHLRTIDATCPLVTKVHNEAKRFARDDYDILLVGHEGH
EEVVGTAGEAPDHVQVVDNPDAVDKVTVRDPNKVIWLSQTTLSVDETMET
VRRLREKFPTLQDPPSDDICYATQNRQVAVKAMAPECELVIVVGSKNSSN
SVRLVEVALGAGASAAHLVDYADDIDPAWFDGVTTVGVTSGASVPEILVR
GVLDRLAEHGYDVVQPVTTANETLVFALPREIRPARQ
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)1
Vaccine TargetNo