Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID120405607
StrainM_vanbaalenii_PYR-1
Protein IDYP_955436.1
Description transposase IS116/IS110/IS902 family protein [Mycobacterium vanbaaleni
Sequence MLVESEDSEQIIARVAALDIGKAELVCCVRVPGRGTRRLQEVSTHSTMAR
SLTELANHLVESGVQRVVMEATSDYWKPVFYLLEAHGLDPWLVNARDVKH
LPGRPKTDVLDAVWLAKLAERQMLRPSFVPPPPIRQLRDLTRYRIDLVAT
RTAERNRVEKLLEDACIKLSVVASDIFGVSGRAMMAALIAGERDPKVLAQ
LARSRMRTKIGRLEEAFNGHFNAHHGFLLTRMLARLDGIDADIAVLDEQI
EVYLAPFAAAAARLDEIPGIGAVAAAIILAEIGTDMSVFPTAGHLCSWAK
FSPGIQSSAGKTKGTASTGHGNRYLAQILGEAAIAASRTDTFLGQRYRRI
ARRRGNKRALVAVGRSILVIIWHLLTDPDATFIDLGPDHYTKHLNPETKR
RNHIRQLEALGYTVTLTPAA
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo