Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID120405947
StrainM_vanbaalenii_PYR-1
Protein IDYP_955776.1
Description epocide hydrolase domain-containing protein [Mycobacterium vanbaalenii
Sequence MAHIQPFRIAIPDADLADLTARLQRTRWPEAECVDDWSQGIPLSYTRELA
AYWADEYDWRAREASLNRFEQFTTEIDGLPIHFIHARSTRPDAFPLIITH
GWPGSVVEFHKVIEPLTDAGFHVVCPSLPGYGFSGKPRSTGWGVERIAAA
WDELMVRLGYRRYGAQGGDWGGAVTTQIGRNIGHCVAIHTNMPIGRAPKD
LSDPTPDEQAALERLGYYQRWDSGYSKQQSTRPQTLGYGLVDSPVGQLAW
IVEKFWSWTDCDGHPENALTRDELLDNVMLYWATGTGASSARLYWESFGS
FAGGGAVTLPTGVAAFPLEILRSPRHWCEPHYNITRWTTMPRGGHFAAFE
QPGPFVEEVGSFFADFR
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo