Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID120405989
StrainM_vanbaalenii_PYR-1
Protein IDYP_955818.1
Description major facilitator superfamily transporter [Mycobacterium vanbaalenii P
Sequence MTGSRRDHRDPDGQQGGRYYPPRPPAGEHPGMANYPSDPAMSPGNRRSGR
PGPSSQSANRWLPPLDDSSRPHGHSYPPPPGRGADEKVTVTRAAAQRSRE
MGSKMYGLVHRAATADGADKSGLTALTWPVVANFAVDAAMAVALANTLFF
AAASGESKSRVALYLLITIAPFAVIAPLIGPALDRLQHGRRVALAASFSL
RTVLAVVLIANFDSATGSFPSWVLYPCALGMMVLSKSFSVLRSAVTPRVL
PPTIDLVRVNSRLTTFGLLGGTMIGGGIAAAAEWGFQLFQMPGALYVVVA
VTIGGAVLAMRIPKWVEVTAGEVPTTLSYHGQTEGLRREPHGAVSAKTRQ
PLGRNIITALWGNCTVKVMVGFLFLYPAFVAKAHDASGWEQLRILGMIGA
AAAVGNFAGNFTAARLKLGHPARLVVRCATAVTVMALATALSGNLLVAAA
ATLVTSGASAIAKASLDASLQDDLPEESRASAFGRSESLLQLAWVAGGAT
GVLIYTELYAGFTTITAILILGLAQTVLSYRGESLVPGFGGNRPVLAEQE
GVWTDAAVTRE
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo