Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID120406001
StrainM_vanbaalenii_PYR-1
Protein IDYP_955830.1
Description molybdenum cofactor biosynthesis protein MoaC [Mycobacterium vanbaalen
Sequence MPDRLSHLDETGAAHMVDVTAKDATKRIAVASGTVHTRPDVVELITANGL
PKGDALATARVAGIMAAKRTSDLVPLCHPLAITGVDIDFTIGGDDDLGAV
AITATVRTTDRTGVEMEALTAVSVAALTVYDMIKAVDRAARIDDIRVVRK
EGGKTGTWVR
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo