Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID120406036
StrainM_vanbaalenii_PYR-1
Protein IDYP_955865.1
Description phosphate uptake regulator PhoU [Mycobacterium vanbaalenii PYR-1]
Sequence MRTAYHEQLEALSNRLGDMCGLAGVAMERATQALLQADLALAEQVITDHE
QIAALSARAEEEAFVLLALQAPVAGDLRAIVSSIQIVADVDRMGALALHV
AKIARRRHPQHALPEEVNGYFAEMGRVAVELGHSAQEVLITQDPEKAARI
REEDDAMDDLHRHLFTVLMDREWKHGVAAAVDVTLLGRYYERFSDHAVEV
ARRVIFQVTGNTPTEQEVSEHY
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo