Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID120406067
StrainM_vanbaalenii_PYR-1
Protein IDYP_955896.1
Description phosphoribosylformylglycinamidine synthase II [Mycobacterium vanbaalen
Sequence MTQEVDTVERAAATPDHPQPYRELGLKDDEYERIREILGRRPTDAELAMY
SVMWSEHCSYKSSKVHLRYFGETTTEKMRETMLAGIGENAGVVDIGDGWA
ATFKVESHNHPSYIEPYQGAATGVGGIVRDIMAMGARPVAVMDQLRFGAA
DAPDTRRVLDGVVRGIGGYGNSLGLPNIGGETVFDASYAGNPLVNALCVG
VLRKEDLKLAFASGAGNKIILFGARTGLDGIGGVSVLASETFGGDESGAG
RKKLPSVQVGDPFTEKVLIECCLELYAADLVVGIQDLGGAGLSCATSELA
SAGDGGMRVELERVPLRAANMTPAEILSSESQERMCAVVTPDNVDAFMAV
CRKWDVLATDIGEVTDSGRLEITWHGETVVDVPPRTVAHEGPVYERPVQR
PDSQDALVANTTASLERPSTGDELRATLLQLLGSPALCSRAFITEQYDRY
VRGNTVLAEHADGGVLRVDEQTGRGIAISTDASGRYTALDPYAGAQLALA
EAYRNVAVTGATPVAVTNCLNFGSPEDPGVMWQFSQAVRGLADGAAALGI
PVTGGNVSFYNQTGTTAILPTPVVGVLGVIDDVKRRIPTGFGTEPGETLI
LLGDTRDEFDGSIWAQVTADHLGGVPPTVDLDRERLLAEVLTAASRDGLV
SAAHDLSEGGLIQAVVEASLAGETGCRIVLPEGWNPFVTLFSESAGRVLV
AVPRTEESRFTAMCEARGLPANRIGVVDQGPDGGEPAVEVQGLFTVTLEE
LRRTSEGVLPGLFG
gene ID120406067
StrainM_vanbaalenii_PYR-1
Protein IDYP_955896.1
Description phosphoribosylformylglycinamidine synthase II [Mycobacterium vanbaalen
Sequence MTQEVDTVERAAATPDHPQPYRELGLKDDEYERIREILGRRPTDAELAMY
SVMWSEHCSYKSSKVHLRYFGETTTEKMRETMLAGIGENAGVVDIGDGWA
ATFKVESHNHPSYIEPYQGAATGVGGIVRDIMAMGARPVAVMDQLRFGAA
DAPDTRRVLDGVVRGIGGYGNSLGLPNIGGETVFDASYAGNPLVNALCVG
VLRKEDLKLAFASGAGNKIILFGARTGLDGIGGVSVLASETFGGDESGAG
RKKLPSVQVGDPFTEKVLIECCLELYAADLVVGIQDLGGAGLSCATSELA
SAGDGGMRVELERVPLRAANMTPAEILSSESQERMCAVVTPDNVDAFMAV
CRKWDVLATDIGEVTDSGRLEITWHGETVVDVPPRTVAHEGPVYERPVQR
PDSQDALVANTTASLERPSTGDELRATLLQLLGSPALCSRAFITEQYDRY
VRGNTVLAEHADGGVLRVDEQTGRGIAISTDASGRYTALDPYAGAQLALA
EAYRNVAVTGATPVAVTNCLNFGSPEDPGVMWQFSQAVRGLADGAAALGI
PVTGGNVSFYNQTGTTAILPTPVVGVLGVIDDVKRRIPTGFGTEPGETLI
LLGDTRDEFDGSIWAQVTADHLGGVPPTVDLDRERLLAEVLTAASRDGLV
SAAHDLSEGGLIQAVVEASLAGETGCRIVLPEGWNPFVTLFSESAGRVLV
AVPRTEESRFTAMCEARGLPANRIGVVDQGPDGGEPAVEVQGLFTVTLEE
LRRTSEGVLPGLFG
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo