Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID120406093
StrainM_vanbaalenii_PYR-1
Protein IDYP_955922.1
Description adenylosuccinate lyase [Mycobacterium vanbaalenii PYR-1]
Sequence MPHYLPVQGPISCVFVSNPVPVPDVLAHRYASEEMVAIWSPEAKIVAERR
LWLAVLKAQAELGVGVPDGVVADYERVLEEVDLASIAARERVLRHDVKAR
IEEFNALAGHEHVHKGMTSRDLTENVEQLQIRRSLELVHARGIAVVARLA
ERAALYRDLVMAGRSHNVAAQATTLGKRFASAAEELLVALQRVRELIDRY
PLRGIKGPMGTAQDMLDLFDGDTDRLADLERRVAGFLGFTDIFTSVGQVY
PRSLDHDVVSALVQLGAGPSSMAHTIRLMAGHELVTEGFAPGQVGSSAMP
HKMNTRSCERVNGLQVVLRGYASMTAELAGAQWNEGDVFCSVVRRVALPD
AFFALDGQTETFLTVLDEFGAYPAVIQRELDRYLPFLATTRILIAAVRAG
VGRETAHEVIKEHAVAVALAMREKGAEPDLLDRLAADPRLPLDRQALDAA
LADKQVFTGAAGDQVDRVVAAVDDLIARYPEAAEYTSGAIL
gene ID120406093
StrainM_vanbaalenii_PYR-1
Protein IDYP_955922.1
Description adenylosuccinate lyase [Mycobacterium vanbaalenii PYR-1]
Sequence MPHYLPVQGPISCVFVSNPVPVPDVLAHRYASEEMVAIWSPEAKIVAERR
LWLAVLKAQAELGVGVPDGVVADYERVLEEVDLASIAARERVLRHDVKAR
IEEFNALAGHEHVHKGMTSRDLTENVEQLQIRRSLELVHARGIAVVARLA
ERAALYRDLVMAGRSHNVAAQATTLGKRFASAAEELLVALQRVRELIDRY
PLRGIKGPMGTAQDMLDLFDGDTDRLADLERRVAGFLGFTDIFTSVGQVY
PRSLDHDVVSALVQLGAGPSSMAHTIRLMAGHELVTEGFAPGQVGSSAMP
HKMNTRSCERVNGLQVVLRGYASMTAELAGAQWNEGDVFCSVVRRVALPD
AFFALDGQTETFLTVLDEFGAYPAVIQRELDRYLPFLATTRILIAAVRAG
VGRETAHEVIKEHAVAVALAMREKGAEPDLLDRLAADPRLPLDRQALDAA
LADKQVFTGAAGDQVDRVVAAVDDLIARYPEAAEYTSGAIL
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo