Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID120406143
StrainM_vanbaalenii_PYR-1
Protein IDYP_955972.1
Description hypothetical protein Mvan_5195 [Mycobacterium vanbaalenii PYR-1]
Sequence MRDWPAKLIAAIGVLLATGFVALSAVGGALYWNRVELNGEEQARAELPSL
AAQQIPLVFGFDYQTVERTFAEVYPLLTPEYRKEFQDRVTNEIIPQARDR
QLISQAHSVGAGILDAHRTSASVMVYMNRTVTDKAKESVYDGSRLRVDYK
KVDGKWLIAYITPI
gene ID120406143
StrainM_vanbaalenii_PYR-1
Protein IDYP_955972.1
Description hypothetical protein Mvan_5195 [Mycobacterium vanbaalenii PYR-1]
Sequence MRDWPAKLIAAIGVLLATGFVALSAVGGALYWNRVELNGEEQARAELPSL
AAQQIPLVFGFDYQTVERTFAEVYPLLTPEYRKEFQDRVTNEIIPQARDR
QLISQAHSVGAGILDAHRTSASVMVYMNRTVTDKAKESVYDGSRLRVDYK
KVDGKWLIAYITPI
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo