Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID120406222
StrainM_vanbaalenii_PYR-1
Protein IDYP_956051.1
Description L-2-4-diaminobutyric acid acetyltransferase [Mycobacterium vanbaalenii
Sequence MSRGAGIASRTWTAAAKSTVVRSNSWARFLRRPSDRDAIAMHRLVADTRV
LDVNSTYTYLLMATDFADTTIVADRDGELCGLITAYHPPVRPEVLFVWQV
AVAESARGTGLAGVMLDTLVDRVRRDRHGHPVTVEATVSPDNTASRAFFG
AFAKRHGVLLVEQPHFTSAQLDSDGNHEDEPLLRIGPIATPMVD
gene ID120406222
StrainM_vanbaalenii_PYR-1
Protein IDYP_956051.1
Description L-2-4-diaminobutyric acid acetyltransferase [Mycobacterium vanbaalenii
Sequence MSRGAGIASRTWTAAAKSTVVRSNSWARFLRRPSDRDAIAMHRLVADTRV
LDVNSTYTYLLMATDFADTTIVADRDGELCGLITAYHPPVRPEVLFVWQV
AVAESARGTGLAGVMLDTLVDRVRRDRHGHPVTVEATVSPDNTASRAFFG
AFAKRHGVLLVEQPHFTSAQLDSDGNHEDEPLLRIGPIATPMVD
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo