Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID120406282
StrainM_vanbaalenii_PYR-1
Protein IDYP_956111.1
Description response regulator receiver/ANTAR domain-containing protein [Mycobacte
Sequence MHAPLHPDLLSRRSIDVAVGILMALRRCSEDQAFAEIAAAAHRMGLPLGE
VTRALIAVADAHSGHTSHRDEALRIWGELFSEHPRR
gene ID120406282
StrainM_vanbaalenii_PYR-1
Protein IDYP_956111.1
Description response regulator receiver/ANTAR domain-containing protein [Mycobacte
Sequence MHAPLHPDLLSRRSIDVAVGILMALRRCSEDQAFAEIAAAAHRMGLPLGE
VTRALIAVADAHSGHTSHRDEALRIWGELFSEHPRR
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo