Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID120406313
StrainM_vanbaalenii_PYR-1
Protein IDYP_956142.1
Description NAD-dependent glycerol-3-phosphate dehydrogenase-like protein [Mycobac
Sequence MVQPPAGGDVPHDGFRPARLTIGVISAGRVGTAMGVALERAEHVVVGCSA
VSAASRDRARRWLPDTPILPVDEVARRAELLLLAVPDAELSALVSGLAAT
GAVRPNTIVVHTSGANGIGVLAPLADRGCITLAIHPAMTFVGTDEDVDRL
RGTCFGVTAGDDIGYAIAASLVLEIGGEPFRVREDARTLYHAALAHSSNH
VVTVVLDAVDALRAALWGQELLGQELVGDVPGGLPERIIGPLARAALDNA
LRRGQAALTGPVARGDAAAVAGHLQALREVNPDLAQAYRTNSWRTAQRAH
APQEVLEVLSEAGQS
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo