Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID120406328
StrainM_vanbaalenii_PYR-1
Protein IDYP_956157.1
Description D-alanyl-D-alanine carboxypeptidase/D-alanyl-D-alanine-endopeptidase [
Sequence MRPTRWRRSTYLVVGVSVLLLVVVVVVAAAALVATRQPAEQPAVEAAPAP
ATAAPGVVPVSDSADKPTPQGLTRALQAVLANPDLGRFTGRITDARSGDQ
LWAQGAGVPMQPASTNKMLTAAAALLTLDRDARLTTRVLSASPGVVVLVG
GGDPTLSAAPRNVDTWYRDAARIVDLADQIRRSGVDVKSVQVDVSAYSGP
SMAPGWDPLDIDGGDIAPMEAIMLDGGRTQPVTVESRRSRTPALDAGRAL
AVALRVDPAKVTVLPSAARGTEIASVQSPPLMQRLRDMMNFSDNVMAEAI
GREVAAEVGRPQSFDGAARAVLSTLEDAGIDTAGARLLDSSGLSVDNRLT
AETLDEVVQAAAGDSEPALRPLVDLLPIAGGSGTLSNRYLDTDDGRAAAG
YLRAKTGSLTGTNSLAGIVTDESGRVLTFALLSNDAGPTGRTALDAFAAT
LRSCGCR
gene ID120406328
StrainM_vanbaalenii_PYR-1
Protein IDYP_956157.1
Description D-alanyl-D-alanine carboxypeptidase/D-alanyl-D-alanine-endopeptidase [
Sequence MRPTRWRRSTYLVVGVSVLLLVVVVVVAAAALVATRQPAEQPAVEAAPAP
ATAAPGVVPVSDSADKPTPQGLTRALQAVLANPDLGRFTGRITDARSGDQ
LWAQGAGVPMQPASTNKMLTAAAALLTLDRDARLTTRVLSASPGVVVLVG
GGDPTLSAAPRNVDTWYRDAARIVDLADQIRRSGVDVKSVQVDVSAYSGP
SMAPGWDPLDIDGGDIAPMEAIMLDGGRTQPVTVESRRSRTPALDAGRAL
AVALRVDPAKVTVLPSAARGTEIASVQSPPLMQRLRDMMNFSDNVMAEAI
GREVAAEVGRPQSFDGAARAVLSTLEDAGIDTAGARLLDSSGLSVDNRLT
AETLDEVVQAAAGDSEPALRPLVDLLPIAGGSGTLSNRYLDTDDGRAAAG
YLRAKTGSLTGTNSLAGIVTDESGRVLTFALLSNDAGPTGRTALDAFAAT
LRSCGCR
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo