Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID120406346
StrainM_vanbaalenii_PYR-1
Protein IDYP_956175.1
Description cold-shock DNA-binding domain-containing protein [Mycobacterium vanbaa
Sequence MPQGTVKWFNAEKGFGFIAPEDGSADVFVHYTEIQGSGFRTLEENQKVEF
EVGQSPKGPQATGVRAI
gene ID120406346
StrainM_vanbaalenii_PYR-1
Protein IDYP_956175.1
Description cold-shock DNA-binding domain-containing protein [Mycobacterium vanbaa
Sequence MPQGTVKWFNAEKGFGFIAPEDGSADVFVHYTEIQGSGFRTLEENQKVEF
EVGQSPKGPQATGVRAI
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo