Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID120406748
StrainM_vanbaalenii_PYR-1
Protein IDYP_956577.1
Description cobalamin B12-binding domain-containing protein [Mycobacterium vanbaal
Sequence MSVDASRARERLWAAVLEADEFAAATTVFGAVDGGMPPEDVLLDVIASVQ
RRVGSEWAANRITVAQEHAATAINDRVIAALAHHPACSRADGAGRVTVAC
VDGEWHALPARLLAEVLRLRGWHVDFLGAQVPTPHLIAHLHQHGPEAVAL
SCMIPTRLPTAHAAITACQAAGTAVLAGGAAFGADGRFARQLGADAWAPD
ARAAAELLGRGLRPARTSPTHQPIDDLPHLADQEYTMVKSAGAQLIQTTL
WELEQRFPAMRGYTEMQRQHTIEDLAHIVDFLTTALYVDDDDLFTGFITW
TADILAARDVPAASLIPALESLAGQLPEFPRTQRLLKAAHAAFPPTPTTP
SLPV
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo