Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID120406998
StrainM_vanbaalenii_PYR-1
Protein IDYP_956827.1
Description peptidoglycan binding domain-containing protein [Mycobacterium vanbaal
Sequence MSSLRRGDRGGAVAEIRAALSALGMIDSPDEDLTTGKHVAADMFDDDLDH
AVRAFQQHRGLLVDGIVGEATYRALKEASYRLGARTLNHQFGAPMYGDDV
ATLQSRLQDLGFYTGLVDGHFGLQTHNALSSYQREYGLYPDGICGPETLR
SLYFLGSRVTGGSPHAIREEELVRRSGPRLSGKRIIIDPGRGGSDHGLIM
NGPAGPISEADILWDLASRLEGRMTAIGIETFLSRSAHTSASDAERAATA
NTVGADMMISLRCAAHPSPAANGVASFHFGNSHGSVSTIGRNLADFIQRE
VVARTGLRDCRVHGRTWDLLRLTRMPTVQVDVGYITNPGDRATLVSATAR
DALAEGILAAVKRLYLLGKNDRPTGTFTFAELLAHELAVEQARRV
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetNo