Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID121636207
StrainM_bovis_BCG_str_Pasteur_1173P2
Protein IDYP_976430.1
Description hypothetical protein BCG_0332 [Mycobacterium bovis BCG str. Pasteur 11
Sequence MNPIPSWPGRGRVTLVLLAVVPVALAYPWQSTRDYVLLGVAAAVVIGLFG
FWRGLYFTTIARRGLAILRRRRRIAEPATCTRTTVLVWVGPPASDTNVLP
LTLIARYLDRYGIRADTIRITSRVTASGDCRTWVGLTVVADDNLAALQAR
SARIPLQETAQVAARRLADHLREIGWEAGTAAPDEIPALVAADSRETWRG
MRHTDSDYVAAYRVSADAELPDTLPAIRSRPAQETWIALEIAYAAGSSTR
YTVAAACALRTDWRPGGTAPVAGLLPQHGNHVPALTALDPRSTRRLDGHT
DAPADLLTRLHWPTPTAGAHRAPLTNAVSRT
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)17
MHC class II prediction (Propred)57
MHC class 1 prediction (Propred1)237
CTL epitope prediction (CTLpred)68
Prediction of interferon-gamma inducing peptides (IFNepitope)165
Prediction of IL4 inducing peptides (IL4pred)212