Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID121636406
StrainM_bovis_BCG_str_Pasteur_1173P2
Protein IDYP_976629.1
Description two component sensor histidine kinase senX3 [Mycobacterium bovis BCG s
Sequence MTVFSALLLAGVLSALALAVGGAVGMRLTSRVVEQRQRVATEWSGITVSQ
MLQCIVTLMPLGAAVVDTHRDVVYLNERAKELGLVRDRQLDDQAWRAARQ
ALGGEDVESDLSPRKRSATGRSGLSVHGHARLLSEEDRRFAVVFVHDQSD
YARMEAARRDFVANVSHELKTPVGAMALLAEALLASADDSETVRRFAEKV
LIEANRLGDMVAELIELSRLQGAERLPNMTDVDVDTIVSEAISRHKVAAD
NADIEVRTDAPSNLRVLGDQTLLVTALANLVSNAIAYSPRGSLVSISRRR
RGANIEIAVTDRGIGIAPEDQERVFERFFRGDKARSRATGGSGLGLAIVK
HVAANHDGTIRVWSKPGTGSTFTLALPALIEAYHDDERPEQAREPELRSN
RSQREEELSR
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)17
MHC class II prediction (Propred)59
MHC class 1 prediction (Propred1)276
CTL epitope prediction (CTLpred)80
Prediction of interferon-gamma inducing peptides (IFNepitope)175
Prediction of IL4 inducing peptides (IL4pred)260