Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID121636611
StrainM_bovis_BCG_str_Pasteur_1173P2
Protein IDYP_976834.1
Description hypothetical protein BCG_0739c [Mycobacterium bovis BCG str. Pasteur 1
Sequence MTGTEHLVHTLRSQGRVCTSSGSPMYRELLELVAADVESGGVFASILADQ
KGAPEGQAVPLRLLGGLHRMVLDGRAPVLRRWYPSTGGTWQAEAAWPDIV
RTATDQPESLRAALDRPPQTNEVGRSAALIGGLLIACLQFDLPIRLFEIG
SSAGLNLRPDRYRYRYLGGEWGLADSPVRIDNAWLGELPPTATVRIVERH
GYDIAPIDVTSPDGELNALSYIWPDQTDRLERLRGAIAVARNIPADLHRQ
AAHAAVAGMTLTDDALTVLWHSITWQYLPADERAAIRAGIDALAAQADAH
CPFVHLTLEPAHQRPGAQIKYLVRMRSWPGGHARVLGECHPHGPPVTWQ
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)19
MHC class II prediction (Propred)47
MHC class 1 prediction (Propred1)232
CTL epitope prediction (CTLpred)61
Prediction of interferon-gamma inducing peptides (IFNepitope)145
Prediction of IL4 inducing peptides (IL4pred)246