Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID121637559
StrainM_bovis_BCG_str_Pasteur_1173P2
Protein IDYP_977782.1
Description PE-PGRS family protein [Mycobacterium bovis BCG str. Pasteur 1173P2]
Sequence MSFLLVEPDLVTAAAANLAGIRSALSEAAAAASTPTTALASAGADEVSAA
VSRLFGAYGQQFQALNARAATFHAEFVSLLNGGAAAYTGAEAASVSSMQA
LLDAVNAPTQTLLGRPLIGNGADGVAGTGSNAGGNGGPGGILYGNGGNGG
AGGPDGGAGGNGGAAGLIGNGGAGGAGGVGGAGGAGGAGGTGGLLYGNGG
AGGNGGSAAAAGGAGGNALLFGNGGNGGSGASGGAAGHAGTIFGNGGNAG
AGSGLAGADGGLFGNGGDGGSSTSKAGGAGGNALFGNGGDGGSSTVAAGG
AGGNTLVGNGGAGGAGGTSGLTGSGVAGGAGGSVGLWGSGGAGGDGGAAT
SLLGVGMNAGAGGAGGNAGLLYGNGGAGGAGGNGGDTTVPLFDSGVGGAG
GAGGNASLFGNGGTGGVGGKGGTSSDLASATSGAGGAGGAGGVGGLLYGN
GGNGGAGGIGGAAINILANAGAGGAGGAAGSSFIGNGGNGGAGGAGGAAA
LFSSGVGGAGGSGGTALLLGSGGAGGNGGTGGANSGSLFASPGGTGGAGG
HGGAGGLIWGNGGAGGNGGNGGTTADGALEGGTGGIGGTGGSAIAFGNGG
QGGAGGTGGDHSGGNGIGGKGGASGNGGNAGQVFGDGGTGGTGGAGGAGS
GTKAGGTGSDGGHGGNATLIGNGGDGGAGGAGGAGSPAGAPGNGGTGGTG
GVLFGQSGSSGPPGAAALAFPSLSSSVPILGPYEDLIANTVANLASIGNT
WLADPAPFLQQYLANQFGYGQLTLTALTDATRDFAIGLAGIPPSLQSALQ
ALAAGDVSGAVTDVLGAVVKVFVSGVDASDLSNILLLGPVGDLFPILSIP
GAMSQNFTNVVMTVTDTTIAFSIDTTNLTGVMTFGLPLAMTLNAVGSPIT
TAIAFAESTTAFVSAVQAGNLQAAAAALVGAPANVANGFLNGEARLPLAL
PTSATGGIPVTVEVPVGGILAPLQPFQATAVIPVIGPVTVTLEGTPAGGI
VPALVNYAPTQLAQAIAP
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)174
MHC class II prediction (Propred)74
MHC class 1 prediction (Propred1)512
CTL epitope prediction (CTLpred)79
Prediction of interferon-gamma inducing peptides (IFNepitope)569
Prediction of IL4 inducing peptides (IL4pred)452