Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID121637568
StrainM_bovis_BCG_str_Pasteur_1173P2
Protein IDYP_977791.1
Description chalcone synthase pks10 [Mycobacterium bovis BCG str. Pasteur 1173P2]
Sequence MSVIAGVFGALPPYRYSQRELTDSFVSIPDFEGYEDIVRQLHASAKVNSR
HLVLPLEKYPKLTDFGEANKIFIEKAVDLGVQALAGALDESGLRPEDLDV
LITATVTGLAVPSLDARIAGRLGLRADVRRVPLFGLGCVAGAAGVARLHD
YLRGAPDGVAALVSVELCSLTYPGYKPTLPGLVGSALFADGAAAVVAAGV
KRAQDIGADGPDILDSRSHLYPDSLRTMGYDVGSAGFELVLSRDLAAVVE
QYLGNDVTTFLASHGLSTTDVGAWVTHPGGPKIINAITETLDLSPQALEL
TWRSLGEIGNLSSASVLHVLRDTIAKPPPSGSPGLMIAMGPGFCSELVLL
RWH
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)27
MHC class II prediction (Propred)48
MHC class 1 prediction (Propred1)241
CTL epitope prediction (CTLpred)45
Prediction of interferon-gamma inducing peptides (IFNepitope)106
Prediction of IL4 inducing peptides (IL4pred)200