Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID121637715
StrainM_bovis_BCG_str_Pasteur_1173P2
Protein IDYP_977938.1
Description hypothetical protein BCG_1847c [Mycobacterium bovis BCG str. Pasteur 1
Sequence MITNLRRRTAMAAAGLGAALGLGILLVPTVDAHLANGSMSEVMMSEIAGL
PIPPIIHYGAIAYAPSGASGKAWHQRTPARAEQVALEKCGDKTCKVVSRF
TRCGAVAYNGSKYQGGTGLTRRAAEDDAVNRLEGGRIVNWACN
B cell epitope (IEDB)0
T cell epitope (IEDB)1
MHC binder (IEDB)1
Vaccine TargetYes
B cell prediction (LBtope)19
MHC class II prediction (Propred)18
MHC class 1 prediction (Propred1)96
CTL epitope prediction (CTLpred)21
Prediction of interferon-gamma inducing peptides (IFNepitope)75
Prediction of IL4 inducing peptides (IL4pred)87