Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID121637836
StrainM_bovis_BCG_str_Pasteur_1173P2
Protein IDYP_978059.1
Description transcriptional regulatory protein [Mycobacterium bovis BCG str. Paste
Sequence MVIVGFPGDPVDTVILPGGAGVDAARSEPALIDWVKAVSGTARRVVTVCT
GAFLAAEAGLLGRTPSDDALGLCRTFRPRISGRSGRCRPDLHAQFAEGVD
RGWSHRRHRPRAGTGRRRPRHRDCPDGCPLARPVSAPTRWADPVRGSGVD
ATRQTDLDPPGAGGHRGRAGGAHRIGELAQRAAMSPRHFTRVFSDEVGEA
PGRYVERIRTEAARRQLEETHDTVVAIAARCGFGTAETMRRSFIRRVGIS
PDQYRKAFA
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)14
MHC class II prediction (Propred)24
MHC class 1 prediction (Propred1)166
CTL epitope prediction (CTLpred)40
Prediction of interferon-gamma inducing peptides (IFNepitope)138
Prediction of IL4 inducing peptides (IL4pred)171