Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID121639584
StrainM_bovis_BCG_str_Pasteur_1173P2
Protein IDYP_979808.1
Description membrane-associated serine protease [Mycobacterium bovis BCG str. Past
Sequence MTPSQWLDIAVLAVAFIAAISGWRAGALGSMLSFGGVLLGATAGVLLAPH
IVSQISAPRAKLFAALFLILALVVVGEVAGVVLGRAVRGAIRNRPIRLID
SVIGVGVQLVVVLTAAWLLAMPLTQSKEQPELAAAVKGSRVLARVNEAAP
TWLKTVPKRLSALLTTSGLPAVLEPFSRTPVIPVASPDPALVNNPVVAAT
EPSVVKIRSLAPRCQKVLEGTGFVISPDRVMTNAHVVAGSNNVTVYAGDK
PFEATVVSYDPSVDVAILAVPHLPPPPLVFAAEPAKTGADVVVLGYPGGG
NFTATPARIREAIRLSGPDIYGDPEPVTRDVYTIRADVEQGDSGGPLIDL
NGQVLGVVLGAAVDDAETGFVLTAGEVAGQLAKIGATQPVGTGACVS
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)27
MHC class II prediction (Propred)68
MHC class 1 prediction (Propred1)269
CTL epitope prediction (CTLpred)75
Prediction of interferon-gamma inducing peptides (IFNepitope)153
Prediction of IL4 inducing peptides (IL4pred)241