Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID148660175
StrainMtb_H37Ra
Protein IDYP_001281698.1
Description serine/threonine protein kinase [Mycobacterium tuberculosis H37Ra]
Sequence MAKASETERSGPGTQPADAQTATSATVRPLSTQAVFRPDFGDEDNFPHPT
LGPDTEPQDRMATTSRVRPPVRRLGGGLVEIPRAPDIDPLEALMTNPVVP
ESKRFCWNCGRPVGRSDSETKGASEGWCPYCGSPYSFLPQLNPGDIVAGQ
YEVKGCIAHGGLGWIYLALDRNVNGRPVVLKGLVHSGDAEAQAMAMAERQ
FLAEVVHPSIVQIFNFVEHTDRHGDPVGYIVMEYVGGQSLKRSKGQKLPV
AEAIAYLLEILPALSYLHSIGLVYNDLKPENIMLTEEQLKLIDLGAVSRI
NSFGYLYGTPGFQAPEIVRTGPTVATDIYTVGRTLAALTLDLPTRNGRYV
DGLPEDDPVLKTYDSYGRLLRRAIDPDPRQRFTTAEEMSAQLTGVLREVV
AQDTGVPRPGLSTIFSPSRSTFGVDLLVAHTDVYLDGQVHAEKLTANEIV
TALSVPLVDPTDVAASVLQATVLSQPVQTLDSLRAARHGALDADGVDFSE
SVELPLMEVRALLDLGDVAKATRKLDDLAERVGWRWRLVWYRAVAELLTG
DYDSATKHFTEVLDTFPGELAPKLALAATAELAGNTDEHKFYQTVWSTND
GVISAAFGLARARSAEGDRVGAVRTLDEVPPTSRHFTTARLTSAVTLLSG
RSTSEVTEEQIRDAARRVEALPPTEPRVLQIRALVLGGALDWLKDNKAST
NHILGFPFTSHGLRLGVEASLRSLARVAPTQRHRYTLVDMANKVRPTSTF
B cell epitope (IEDB)0
T cell epitope (IEDB)0
MHC binder (IEDB)0
Vaccine TargetYes
B cell prediction (LBtope)56
MHC class II prediction (Propred)105
MHC class 1 prediction (Propred1)508
CTL epitope prediction (CTLpred)127
Prediction of interferon-gamma inducing peptides (IFNepitope)299
Prediction of IL4 inducing peptides (IL4pred)424