Antigen Card


The is the antigen card for every antigen and all its information available in our database.

gene ID148661624
StrainMtb_H37Ra
Protein IDYP_001283147.1
Description PE-PGRS family protein [Mycobacterium tuberculosis H37Ra]
Sequence MSFVVTIPEALAAVATDLAGIGSTIGTANAAAAVPTTTVLAAAADEVSAA
MAALFSGHAQAYQALSAQAALFHEQFVRALTAGAGSYAAAEAASAAPLEG
VLDVINAPALALLGRPLIGNGANGAPGTGANGGDGGILIGNGGAGGSGAA
GMPGGNGGAAGLFGNGGAGGAGGNVASGTAGFGGAGGAGGLLYGAGGAGG
AGGRAGGGVGGIGGAGGAGGNGGLLFGAGGAGGVGGLAADAGDGGAGGDG
GLFFGVGGAGGAGGTGTNVTGGAGGAGGNGGLLFGAGGVGGVGGDGVAFL
GTAPGGPGGAGGAGGLFGVGGAGGAGGIGLVGNGGAGGSGGSALLWGDGG
AGGAGGVGSTTGGAGGAGGNAGLLVGAGGAGGAGALGGGATGVGGAGGNG
GTAGLLFGAGGAGGFGFGGAGGAGGLGGKAGLIGDGGDGGAGGNGTGAKG
GDGGAGGGAILVGNGGNGGNAGSGTPNGSAGTGGAGGLLGKNGMNGLP
B cell epitope (IEDB)0
T cell epitope (IEDB)34
MHC binder (IEDB)6
Vaccine TargetYes
B cell prediction (LBtope)168
MHC class II prediction (Propred)26
MHC class 1 prediction (Propred1)210
CTL epitope prediction (CTLpred)16
Prediction of interferon-gamma inducing peptides (IFNepitope)359
Prediction of IL4 inducing peptides (IL4pred)242